3S2HJ

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s2hJ00
2OPTA 5E3OA 1HCRA 2K9QA 1E3OC 3GTGJ 2FX0A 4RDUA 1I6HJ 4UUSA 2CUEA 1QVTA 1YRNA 1FTZA 1IDYA 5J1YA 4Y7NJ 2L7MP 2P81A 3S1MJ 2GM4A 3L1PA 2N8GA 3BTJA 3OSFA 3HOYJ 3A02A 2JA5J 4B4CA 5K7FA 1LE8B 1AHDP 4A3IJ 1BW5A 4V2FA 4UUSB 2ZB9A 3QPSA 1YRNB 3HOUJ 4IHVA 2PMZN 3B6AA 3TW7A 3BG9A 4A3JJ 1ZGWA 2EZHA 1O4XA 2ME0A 1JUSA 1K61A 1JKQC 2DA7A 1AKHB 1Z77A 3ZQIA 3Q0WA 1MBKA 4C3JJ 2AHQA 5BNGA 2L9RA 1FJLA 3BG3A 2GBYA 4JX4A 2YS9A 1IGNA 2DA5A 2DA3A 2E19A 5C44J 3Q3SA 1LFUP 1MBJA 1OJLA 1U8BA 3ZQHA 1IJWC 1IDZA 5JLXA 3BR6A 2HOTA 4IHYA 2JK3A 4DYQA 2DN0A 4QSHA 3JR9A 1ENHA 3GTOJ 4XRMA 2G0EA 1VF9A 2VUMJ 1Z0XA 2L7ZA 4MIMA 1F36A 1SFOJ 1RESA 4BY1J 1MSFC 4FE4A 2LR8A 1HLVA 2ME6A 4D7MA 2R93J 5M3FJ 2LLKA 5M5YJ 2IAIA 2XGCA 1NTCA 1ETWA 3BQZA 4DYRA 3HDDA 2QF7A 3OSGA 3JRIA 2JN6A 4A3KJ 5F27A 4M3FA 2NVYJ 3GTPJ 1JT6A 2IBDA 3F0CA 1Y1WJ 4DZJA 3DEWA 4HNVA 2H1KA 2NVTJ 1WH5A 1RKWA 2X6OA 1IRZA 2M8GX 2QCOA 4XICA 4X6AJ 3WHBA 1T56A 2CJJA 4J19A 3CQZJ 2EH3A 1TWCJ 1GV2A 1U78A 5C4XJ 2KT0A 1ETXA 5JLWA 3JRCA 2NOGA 3FISA 4QTRA 4BBSJ 1MBGA 1DU0A 4M3BA 2R7ZJ 3JRHA 2ECBA 3PM1A 5FLMJ 1UG2A 3HOZJ 3HB9A 4FE7A 5EGOA 5J1RA 2R0QC 3OOUA 5IOYA 2NS7A 3S14J 4CYCA 1ZTRA 1IUFA 4NDLA 3S17J 1SANA 4BXXJ 2CRGA 3G1LA 2Y9YA 2XPWA 1GVDA 2EQRA 2ECCA 4DW6A 5IYCJ 3SJMA 5EGOB 5EEAA 5FKMA 4A3FJ 1JGGA 4ABZA 4BBRJ 5M5XJ 1LE8A 3Q0UA 4DYCA 2TCTA 5F0FA 2NVQJ 2ID6A 4CYCB 1TC3C 4C3IJ 1S7EA 2HXIA 5EG0A 3S2HJ 2W48A 2B63J 3JRGA 3SDGA 2O8KA 3HOXJ 1ZR2A 3BTIA 2XRLA 3CDLA 1JUMA 2M9HA 1MBHA 1X58A 2HQ5A 1ZK8A 1AKHA 1P7IA 1ZQ3P 5FKNA 4A93J 3HBLA 2AO9A 1MH4A 3BR3A 1MSEC 2GLOA 3RZDJ 2L7FP 3BR5A 3K7AJ 5EG0B 3PO3J 5FJ8J 1ORKA 1ZR4A 2E2JJ 3BR1A 1ZKGA 1IV6A 2EBIA 3FKIJ 1BJZA 5M5WJ 5F08A 5M3MJ 1B72A 3E7LA 2LP0A 4XRSA 1TWGJ 4BY7J 4B1RA 1MBEA 1OCTC 3ZQFA 1MBFA 2DMNA 1XG1A 1U9OA 2X48A 1DU6A 2L0KA 4B3AA 5IOZA 3LSGA 4M3DA 3HOVJ 2E2HJ 1B72B 3LSPA 1BW6A 2JMWA 1EF4A 4FISA 1UMQA 1ITYA 3SFIA 2LTPA 2CU7A 4D7NA 1POGA 5IP9J 5IP7J 3GBGA 2H8RA 2LD5A 1P7JA 2O7OA 4MLOA 3GTMJ 4C2MJ 3I4NJ 3C2BA 5J1UA 3VPRA 3JRDA 1OCPA 2VI6A 1HOMA 3BTLA 4I76A 1A5JA 4JX5A 3BTCA 4IEJA 1GUUA 2IEKA 4BKXA 1BL0A 1NK3P 2O9LA 3GTKJ 3M4OJ 3S1NJ 2MSYA 3FK6A 3BG5A 1RKTA 5EDNA 3UKGA 1K83J 2K9SA 1VNDA 1MNMC 2MGQA 1JUPA 2Y2ZA 2JWTA 2I10A 1GDTA 5GPCA 3W6VA 4DZPA 5GPAA 1G2HA 4D5FA 2ELKA 2TRTA 2Y30A 1WI3A 4JX6A 2VPRA 4FTHA 1JKRC 1HDDC 5GP9A 4A69C 2WV1A 2DA2A 3HGGA 1W0TA 1TWHJ 3PO2J 1APLC 1QVUA 2R5YA 2MW8A 3S1RJ 1HF0A 3NARA 2FQ4A 1JJ6C 1ETKA 3A03A 5F0HA 2Y31A 4RBOA 5FLVA 4A3CJ 5HODA 1TWFJ 3NAUA 5C3EJ 4L5EA 2XB0X 4MFDA 3ZOBA 2LVSA 3BQYA 3BR2A 2HOSA 1JKOC 3LSJA 2R5YB 1RR7A 2DTZA 4GFBA 2DMUA 1ETOA 5K7HA 1CQTA 3RQIA 4EEFG 2OF7A 1JTXA 1WCMJ 1RETA 2LY9A 3MN2A 3CMYA 2JA7J 5IYDJ 2DMPA 4A3DJ 3QQAA 3S2DJ 2K40A 2YU9J 1XS9A 3O8GA 2XPUA 3Q0VA 2EZIA 1RPWA 1IG7A 2JA8J 2KDZA 2DA6A 4W1UA 4JYKA 5F1JA 5DS9A 1F43A 3MVPA 4A3MJ 5C4JJ 1NK2P 1PUFA 1I50J 5FKLA 2DJNA 1X2MA 2JA6J 3MKLA 3FK7A 2RAEA 3G1MA 5K7ZA 3A01B 3H3VK 3LOCA 3LNQA 4D5CA 4S0HB 4G12A 5EZHA 2HXOA 1B8IA 4AC0A 2VKEA 1AU7A 1PUFB 3IH2A 1FEXA 4W97A 1W0UA 1UHSA 4IHXA 2YUSA 3QPLA 1XC5A 5E3LA 3WHCA 4A3GJ 2HYJA 5IYBJ 1HDPA 2CQQA 3HGYA 2HDDA 2DA1A 1LFBA 1B8IB 3CCYA 2NVXJ 3LSRA 1JT0A 1Y1VJ 4A3LJ 2FD5A 3HEFA 3M3YJ 2XB5A 1TWAJ 2D5VA 4QIWN 3O8HA 3ZQGA 3S1QJ 1OFCX 2DMTA 3JRAA 3ZQCA 1VFCA 4C3HJ 3OIOA 5F0CA 2WB1N 4MFEA 2HOAA 2HI3A 1JTYA 4JP0A 1I3QJ 4I6ZA 4Y52J 1X2NA 2WAQN 2XGEA 2K9NA 3BR0A 3GTJJ 1WH7A 5EYRA 2M2EA 2EZLA 1A6IA 2VKVA 3GTQJ 3FIWA 3TEDA 3TW6A 5J3LA 2MG4A 3HKZN 1FIPA 5IPAA 3TP3A 2COBA 4V2GA 1R9TJ 4M3EA 3HOWJ 5FKKA 2DMQA 9ANTA 5EZGA 3JREA 3BT9A 1WPKA 3RKQA 1H88C 2XGDA 3G1OA 1FTTA 3JRBA 1JKPC 5EF6A 1D5YA 2CQXA 3TP0A 1ETQA 3D1NI 4XIDA 3K2AA 3IV5A 4AUXA 4AYBN 2Y0SN 3DCFA 4A3EJ 2E2IJ 1H89C 5E3MA 3S16J 4XRSG 1QRYA 2CUFA 1JJ8C 3I4MJ 1Q1VA 5F04A 2XSDC 2LKXA 3S15J 1BA5A 2E1OA 5DTDA 5IP6A 1FIAA 1U9NA 2LK2A 3IH3A 3IH4A 4M6VA 4M3GA 3RZOJ 3B6CA 4FCYA 4X1EA 1GV5A 3JRFA 2LFBA 5E3NA 2X9DA 4UUTA 1QPIA 2R92J 3A01A 2R5ZA 3ZQLA 1H8AC 2FJ1A 1WGXA 4MO7A 2EZKA 4IHWA 2XPVA 4LOCA 4XK4A 2Y9ZA 1VI0A 2DA4A 3GTLJ 2M0CA 1ETVA 1ETYA 1IC8A 2ID3A 1MH3A 1T33A 1GT0C 3H0GJ 2JJ7A 3HM5A 2M34A 5FKOA 4A3BJ 2NS8A 2R5ZB
chains in the Genus database with same CATH superfamily
3FX3A 4PGHA 4GGGA 4OINF 1QPMA 2K9QA 1E3OC 3GTGJ 2FX0A 3K9TA 4Y33A 1KU2A 1HXDA 3KX2A 4KDPA 3S3NA 1QZYA 2V1XA 1B1BA 2CUEA 1QVTA 2PFBA 2HPIA 1IDYA 2LY1A 1L3LA 4NQWA 5HNHA 1B59A 3CCVI 1D0ZA 3S1MJ 3IHUA 1LEBA 1F5TA 2GM4A 1D1BA 3L1PA 3OSFA 2Z2SB 1SAXA 3PUFA 5K7FA 2LKSA 1BW5A 4MNUA 2W4SA 1IV8A 3HIFA 5CVRA 4IHVA 2PMZN 4NQWB 3B6AA 2KJBA 2H27A 5BQTA 2GOXB 1T8IA 1JUSA 3CMMA 2DA7A 1VQLI 1MJ9A 5TJJA 2BXZA 4C3JJ 4C2UA 1ZRCA 3O2PE 2L9RA 1KQ8A 3BG3A 1O3QA 4M6YA 4BACA 4E6KG 1T0FC 3IRQA 3Q3SA 4KT6A 4B3XA 3LAJA 4YFKF 2G7HA 2P4WA 4RB1A 2F2EA 1ZG3A 2YR2A 4AVPA 3OYIA 2XAFA 2JK3A 3ZN1A 2CV1A 1P4WA 1U0JA 3QP6A 3V7RA 5E18F 2V26A 1BC7C 2QUFA 3FF5A 2L7ZA 4HEA2 4MIMA 3KP2A 2KPMA 1F36A 2E60A 2WA0A 3OYHA 2ZNYA 4FE4A 3IL2A 1MSFC 1E3PA 1IN5A 1B9NA 2DYRH 4UVAA 4EATA 2FEZA 5M3FJ 3G3ZA 4HQMA 2ZJQF 2IAIA 1XB4A 1V5GA 4DYRA 3HOTA 2ZKZA 2E71A 3EYYA 1FP2A 3J80Z 1XMAA 3LFUA 4HLXA 2EWNA 2NVYJ 3F0CA 3GFJA 3AL0B 4Z6YA 3ECHA 4FASD 1I1GA 2IS4A 3MZHA 4XKBA 3I4PA 2NVTJ 1RKWA 1YJWI 4C2TA 2QCOA 5H6RA 1IRZA 1BJAA 3WTUC 1STZA 4IRIA 6PAXA 3ZMZA 1NHAA 1J0RA 1T08B 4ZYHA 2VC1A 2OTJI 2PQ8A 5FD6A 1X1BA 3HOSA 1QU3A 2IS2A 4QTRA 2CQNA 4E7IA 1A04A 2IT0A 1I1SA 4PJ0C 3JRHA 2ECBA 1VQKI 1I5ZA 1P9QC 2VIXA 1UJ8A 3Q9VA 3G73A 1KU9A 4HX8A 2VBXA 5GTIC 3IKVA 4PJLA 3ELKA 3QOPA 3J7AY 4NDLA 1IUFA 3KEOA 2GIVA 4XKWA 2IA2A 2KRFA 1WHUA 3OYBA 3S17J 1SANA 2WAQA 4L0YB 1H0MA 3BJOA 2RNJA 2ECCA 4EM1A 1BC8C 3GF2A 4KIGA 4ABZA 3VYUB 5M5XJ 2Z99A 3C1DA 4B44A 4DYCA 4XQFA 5F0FA 2ID6A 1R4NB 4C3IJ 1A31A 1XGSA 2HXIA 5EG0A 3ZGKA 1OPCA 2ELHA 4DBRA 1Y56A 2ZXIA 3HOXJ 5HVQC 3BTIA 2XRLA 3CDLA 3E6CC 1XDUA 1JUMA 2XAHA 4XMYA 1DQUA 3OIQA 4OMZA 1X58A 4XN3A 2D1HA 1ZQ3P 4A93J 1N78A 3CDHA 2DQRA 3HBLA 2OCEA 3DBHB 2VBYA 1MH4A 1FC3A 3BR3A 4OOIA 1YW7A 4IRGA 3RZDJ 5EG0B 5E8GA 3K7AJ 3PO3J 1Z6TA 3C18A 1R71A 3ZPLA 3RYRA 4RM2A 2EBIA 1S7AA 4NC8A 2QSHX 2QQ8A 1T39A 2VBZA 2DLLA 2V9VA 4LLGF 2DYSH 2OBPA 2LP0A 1MMAA 4D1QA 4GYGA 3QYFA 4LD5A 1SFKA 2CO5A 3JAMZ 1ODDA 2UUZA 4OWRB 2O0YA 3WGGA 4OIRF 1MBFA 4UHTA 1IXCA 2DMNA 2ISZA 3DTEA 1YE9A 2X48A 2JA2A 4ZH4F 1BR4A 3VODA 1FSHA 1SVOA 4B3AA 5IOZA 3WE3A 4M3DA 4A6DA 1VQNI 4L5JA 3I55I 2HDCA 2GA1A 5K5QA 3SFIA 3ABTA 3M8JA 5IP9J 2H8RA 1U8RA 4OIPF 5B1BH 1P7JA 2O7OA 4MLOA 4C2MJ 2LG4A 3ZMVA 1TNSA 4EM0B 1D0XA 5J1UA 4N0BA 3IAM2 1WZ2A 3VPRA 3OR1C 2ICWG 4JX5A 3GTKJ 2O9LA 2Y69H 4E7ZA 1N75A 4PJJA 2WBMA 3IKTA 3VYRB 2WTEA 5L3CA 2STTA 2V7FA 2W24A 2STWA 4MEYF 2MGQA 2Y2ZA 4YIFA 1T38A 2I10A 4E4HA 2OCCH 4M73A 4U7DA 4D5FA 1KU7A 4F92B 2I8DA 1WI3A 4JX6A 3K4KA 3OV8A 3K70C 3EUHA 2F5FA 1HDDC 2WV1A 3S2WA 2L54A 3SZPA 1YJNI 2NVUB 3SZTA 2CH0A 2CWEA 4YFXF 3K2ZA 5GAGJ 2IGMA 2MFZA 2CUJA 1QVUA 3KP6A 3IC7A 2MW8A 4RGXA 1ZHFA 5HNFA 3P9KA 4DIQA 2WAFA 3FDYA 4BHPA 4Y3OA 2Y31A 5HODA 4U0WA 3NAUA 2MABA 2V6CA 3PFYA 4F93B 3SXYA 3M9AA 4ENJA 2EINH 1IN8A 1T98A 5CVUA 1ZG5A 2DMUA 1ETOA 1R5HA 3GLXA 2DFHA 3E6BA 4EQQA 2IS6A 1UB9A 3LWFA 3OYKA 3I54A 2G9WA 2DQLA 1P92A 3KETA 3CF2A 2JA7J 2W82A 3SHFA 4A3DJ 5IYDJ 2OU2A 2KIQA 4ESFA 5HLTA 3LL7A 1XS9A 3KLNA 3A0BC 3BZKA 5DV5A 2CV2A 2MBFA 3FXUA 3ZMSA 3U21A 5LHIA 2DA6A 4JYKA 5DS9A 4V19K 3MVPA 3K4MA 3DP7A 4Q47A 2Q1ZB 1J5YA 1TQPA 5FKLA 2DJNA 4NNJA 4XLHA 2HTJA 3I56I 3MKLA 3MEXA 3G1MA 5K7ZA 4M71A 2HTSA 3WE2A 1PUEE 3H3VK 2FRHA 2LC2A 1ZG1A 3ROUA 3M8EA 4BJTA 2OD5A 3LNQA 4O3MA 2UXNA 2RQPA 1W5SA 4PUSA 2RKHA 1B8IA 1FOWA 2VKEA 2F5DA 2V1UA 2M8EA 2DBBA 3CESA 3KZYA 4KJZA 1FEXA 1W0UA 3WHCA 2HYJA 4L9NA 4Q48A 2CQQA 3HGYA 2DA1A 1B8IB 2OA4A 1ZRFA 2HQRA 1AA7A 3FXKA 5E1WA 2NVXJ 1FOYA 3IUOA 5LRSA 3LSRA 1X1DA 2WY7Q 5KNLA 2HKOA 1K4SA 4GRIA 4ITVA 1B6AA 4LB6B 4RLFA 3ONQA 4KNYA 1ZGJA 4KT5C 2D5VA 4QIWN 3VDXA 3VSLA 3O8HA 3OS0A 3FMSA 1OFCX 5GAHJ 1USTA 3HSEA 3JRAA 1BI1A 3MD2A 2EPFA 3WU1B 1I27A 2HOAA 3ABLH 1WQ2A 1JTYA 1SD4A 5JFRA 3E1SA 3WTZA 3FHZA 4WX9A 4QLCU 2X4HA 2Z9OA 1X2NA 2VE9A 3CDIA 2ETHA 2V79A 3J80K 1FX7A 1MNDA 3GTJJ 4Y13A 1WH7A 2BV6A 2BY1A 3MKZA 3KEYA 2VKVA 1QA6A 2X1CA 3A4CA 4D9JA 3FIWA 3LSKA 2PI0A 1W1WE 3TW6A 5J3LA 4XNFA 4QWQA 1QZEA 2M0MA 4FHTA 1TL8A 4Z2YA 1FMWA 1U3EM 5IPAA 1S3JA 4YIIA 1O57A 1SD7A 4V2GA 2BE5F 5JR3A 2JT1A 4A5NA 2JTVA 1OR7C 1TNTA 3P7NA 5IT3A 3E5QA 3JREA 1WPKA 3ZXSA 5E20A 3F8FA 3BZ6A 3G1OA 3G6EI 1MNEA 2COMA 3KPHA 1W5CC 1JKPC 1XGNA 2EJRA 2K3FA 2M45A 2Z16A 4Q5SF 2JSCA 2NAZA 4EJTA 5F6FA 4B48A 2QA4I 4BXFA 3CO7C 3K1NA 4G7ZF 4AYBN 2Y0SN 4CCKA 3LA2A 2ZMEA 3H5RA 2UZKA 2E5ZA 2ZFUA 3TMOA 3K70D 4M9XA 4XRSG 2BXYA 2CUFA 2HYFA 1JJ8C 1IO2A 4ZC3A 4P9FA 4AD9A 5LEKA 2GZWA 1VQ4I 2XAGA 1OISA 4XKCA 2M1BA 2ZMEB 2FE3A 4BQAA 1FIAA 2FBHA 2LK2A 3B02A 3FM3A 3IH3A 3L2QA 4M6VA 3FM5A 2ZXHA 4CCOA 2DI3A 4X1EA 4KFCA 1GVJA 2DDAA 2R92J 2R5ZA 3F72A 2ZSIB 3CCRI 1RR8C 4BNCA 5FRNA 1ZLJA 2KHMA 1WGXA 2HR3A 5DCMA 3WU2C 2XPVA 2HYGD 3OL4A 2W1OA 3CUQA 3VYSB 1K79A 1ETVA 3GTLJ 3U1KA 2K85A 4RAGA 2VL8A 4CA0A 2CV0A 2B0LA 1ETYA 1O3TA 2VOPA 2DDBA 3H0GJ 3I64A 3GFIA 1GT0C 5FKOA 1K7AA 2C6YA 2XKOA 3JTHA 3FXRA 4RLQA 2Q8KA 3F8NA 2R5ZB 4ANJA 4S04A 4WCGA 3QAHA 1IN7A 4AIDA 3IWFA 1HCRA 2G7UA 5DCMB 4DNCA 1FNNA 1ON1A 3F22A 3CUQB 1I6HJ 4L9TA 3EUAA 2EIJH 1BM9A 5J4VA 3WTTC 1HSTA 4HSRA 3E5XA 4ENMA 4Y7NJ 3RTRA 2P81A 1G8XA 2EV5A 2HVQA 2W00A 3A0HC 3BTJA 3HOYJ 1ZAOA 3RJPA 1WKMA 3QPSA 1GHCA 1GXPA 2P0WA 2A6HF 1G3TA 2K7LA 1ZGWA 4HX7A 2EZHA 1O4XA 2HZDA 2ME0A 2Y0SA 4AYBA 4YRVA 1K61A 3DEUA 2MD5A 4LFUA 1HA8A 1G59A 3ZQIA 1J59A 4BE1A 1MBKA 1YS7A 1YIJI 5E1ZB 2GBYA 2YS9A 3E6DA 2ZBKA 1IGNA 3WTXC 3S8PA 2QQ9A 5C44J 1EH8A 3K4JA 4LITA 3H9QA 2WV0A 5JLXA 2CMPA 3BR6A 5E17F 4L5IA 1BBYA 1R00A 3KYDB 3OYJA 4ESJA 3UNGC 2R7UA 3SFZA 4IHYA 4DYQA 2DN0A 3JR9A 1XSDA 3BDDA 3GTOJ 1RUOA 4XRMA 1AWCA 3QYBA 4XLEA 1Z0XA 3HRMA 1IUYA 1S8NA 3I9V2 4IQ4A 5AIPA 3GZNB 4XONA 4DQ2A 4Q4ZF 3RQ4A 1HLVA 2PMHA 1FYMA 1O3SA 2LDUA 4DOZA 2K86A 3TOAA 2R93J 2HS5A 2LLKA 2XGCA 1HKTA 1U6GA 4ZDPA 2ADUA 1Z05A 3CC7I 1W36C 4BQNA 1DUXC 2JN6A 4A3KJ 5F27A 3CCQI 1YW9A 3OYFA 2GIZA 5F1RA 3HHHA 3OL3A 4LK1F 3CC4I 2MC4A 1DPRA 3TGNA 2J5OA 4C30A 4HNVA 2H1KA 2OUMA 3CCEI 1UZCA 2RN7A 3O3KA 4XICA 1R1VA 1P4XA 3WHBA 3I5UA 4HOBA 3CLOA 2DFIA 1USSA 1Z21A 2XF6A 5L3DA 1HW1A 2EH3A 1TWCJ 2NS0A 3JRCA 4ZTFA 3FISA 2DJIA 2F5EA 3IRRA 2RV8A 2ESNA 2K9MA 3B73A 4XLNF 3FZVA 4ESBA 1DU0A 1HC8A 1R5ID 1S72I 1VQPI 3MQ0A 3LSTA 1JGSA 4FE7A 5EGOA 3HTSB 2R0QC 5ICGA 2WB1A 3OOUA 4A5MA 3D5RC 4OIOF 2A61A 1ZTRA 2W85A 1FZPB 1R1TA 5CJ9A 5BS6A 1I6XA 4GCVA 1FMVA 3WG9A 4BXXJ 2W57A 4AIHA 1VQ9I 3VYTB 1XCBA 4IPAA 3W3CA 4XSZF 2CW7A 2L9SA 4DW6A 5IT9Z 5EGOB 4A3FJ 3PSIA 3HKZA 2KRHA 2NVQJ 2E36A 1S7EA 1MJAA 3DXJF 4G8XA 1U5TC 3JRGA 3I71A 2O8KA 3FMRA 2HWVA 3LSHA 1ZR2A 4PJMA 1J9IA 1MBHA 1J75A 2XAUA 1ZK8A 3GMEA 1O7LA 2X6XA 2VN2A 5FKNA 3QPHA 3ZMTA 2JRMA 3CJQB 1MSEC 2WC2A 1LDKB 2HNHA 2L7FP 1ZR4A 5KAFC 2E2JJ 3BR1A 3LA3A 2EK5A 2CSOA 3X2QH 2E7WA 4MQVA 2B9SA 2CS3A 3ABUA 5K5OA 2VQCA 5M3MJ 4A6EA 1B72A 3K4CA 4ENKA 2BW3A 1A36A 3GCMA 1TWGJ 2P8TA 4B1RA 3T0YA 4AWXB 2LRDA 3ZQFA 3WU0A 3C3WA 4XLPF 3J7ZI 1XG1A 2K27A 3BWGA 1XGMA 2DODA 2VASA 3LSGA 1T6SA 2FUG2 3PQKA 2P7VB 3LSPA 1B72B 2BW3B 5DYMA 3WODF 1S7OA 1EF4A 4HV6A 2VKHA 4E7SA 2JUCA 3CCMI 2OZUA 5JI6A 1ITYA 2LTPA 2GA2A 4F55A 3ASOH 2VJIA 2F4IA 3RYPA 2XC7A 2P5LC 3EUHC 3QOEA 5CLSA 2HKXA 1X1CA 3C2BA 2OQGA 4ZDLA 1X1PA 5FGMA 1OCPA 1BOAA 4GXOA 3BTLA 4XOTA 1HOMA 3VEPA 1A5JA 1GUUA 5ILUA 1RIOH 1V5FA 2XGXA 4RAZA 1R49A 3BG5A 2VOOA 4ZYEA 1P4AA 4HX4A 2K9LA 1REPC 2K9SA 3JW4A 1X3UA 2BY3A 2JWTA 3OIPA 4UVCA 5GPCA 1GDTA 4DZPA 3W6VA 1YJ9I 4KMFA 5GPAA 3H0DA 2TRTA 5CYVA 2VPRA 3W6JB 1BOBA 5LHHA 2DA2A 4IZZA 3HGGA 1J09A 3KP5A 2MH2A 3TOBA 2NOJB 1RRJA 3PO2J 1APLC 4ZDOA 3F6VA 1M1EB 2O03A 5CQEA 5ERIA 1W36D 4F7ZA 2FQ4A 2PMZA 2NNYA 1JJ6C 2HQAA 2LOOA 2VJJA 2QKMB 4RBOA 2ELJA 2DK5A 4A3CJ 1T2KA 4MFDA 3KYLA 2IPQX 3ZOBA 4RAYA 3BQYA 3BR2A 2CG4A 2R7WA 4O5VA 5LLQA 4XKVA 4PZJA 5H6QA 3F8BA 1RR7A 4GFBA 2NXNB 2VXDA 3RKXA 5K7HA 3V4GA 4RGRA 4HDUA 3K6GA 5ICCA 2OF7A 5HDGA 1WJBA 2KLOA 1RUNA 4CDGA 1IRGA 4FX4A 2L01A 4S05A 2ACJA 2LY9A 3V7CA 5B3SH 2DMPA 1BN5A 3F6OA 2O61A 4I01A 2DO7A 3O8GA 3Q0VA 2EZIA 4UY8I 1RPWA 1IG7A 1G4DA 2BZTA 2JA8J 4AM3A 4W1UA 1I3AA 4ZYGA 3H36A 5F1JA 1F43A 4I09A 2QKLB 4A3MJ 1NK2P 1LVAA 4LIVA 1I50J 1NH3A 1ZN2A 3DBLB 2XSJC 2R7QA 5L3EA 3WTYC 1OYIA 2Y48A 3L7WA 2DT6A 4G12A 4S0HB 4ZZLA 2YPRA 1MMSA 1D1CA 2HXOA 3SDBA 3R4KA 1QGPA 3BG7A 5FROA 1R7JA 5AIQA 2VT2A 1NG7A 2LNBA 1JI8A 2Z33A 2HQNA 1IXRC 2JUGA 1EV7A 1UHSA 4PGGA 3M8FA 4CSWA 1WWXA 4HDVA 3BPXA 2KJCA 3TQNA 1HDPA 4IO9F 3EETA 1LEAA 1D5VA 3BCAA 5FO5A 5D8KB 1LFBA 3FBIB 4FETA 4CZCA 3CCYA 1VQ5I 1OCRH 2KIMA 3K4NA 3KYCB 1IRXA 3CP2A 1Y1VJ 1C0WA 3IWZA 5KCMA 2E1MB 3M3YJ 4HYEA 2QSFX 2O3FA 3BZCA 1H9TA 4RMNA 1PP8F 2IA0A 2P5KA 4LGWA 3ZQGA 1GXQA 2V9PA 1QZZA 2BOLA 3L2VA 2O5RA 4C3HJ 2IGNA 2ZXJA 3VB2A 3LSMA 2L4AA 2VQGA 3M07A 3DKWA 3BJ6A 3MZ8A 4P55A 1I3QJ 5HS9A 4Y52J 5D5WB 2F4MB 1A35A 2A5WA 3BR0A 2K9NA 1ULYA 5EYRA 2H1LA 1A6IA 1YX5A 3AG2H 2BY0A 3TEDA 2MG4A 1ZH5A 1R22A 4EJVA 3CO6C 1TT5B 4HRIA 5B66C 3OYCA 3REOA 3HPHA 1YO5C 3DV8A 1R9TJ 2QEXI 4G6TB 2HEOA 3W2AA 4HZFA 1T0FA 3A1YA 1U2WA 1H88C 2QQAA 1FBUA 4DJAA 4IKFA 2A3SA 4IRHA 3K4LA 4AUXA 3KZIC 5J8FA 3DU6A 4I0BA 1H89C 2X6YA 3BG6A 3CCJI 1J2XA 5H20A 3K4BA 2VBWA 2UWMA 4CCJA 1N77A 1BA5A 2E1OA 1X4PA 1R23A 2V1NA 2LBFB 4KIFA 1N25A 4EMSA 5IT9K 3RCOA 2V6EA 5CKTA 1FYLA 4G6QA 2P7CB 2GXBA 2KKOA 3IH4A 1IN4A 3RZOJ 3B6CA 4FCYA 3CP8A 2JVHA 1R36A 4KN7X 2LY2A 4XORA 4CO8A 3L2CA 3EYIA 2VJ4A 2DU9A 2XASA 2M4GA 4BH9A 1QPIA 2BVLA 2LSOA 4AVZA 1H8AC 4E7KA 2X85A 2FJ1A 3M1EA 4QPQA 3GUDA 4MO7A 2EZKA 4LOCA 5LGUA 1VI0A 2AQEA 4OIQF 1SMYF 2D1VA 2XKPA 2ID3A 1MH3A 3TBIA 2XROA 2JJ7A 5D6FA 1RZ4A 3HM5A 3W6KB 4A3BJ 2NS8A 3BPVA 4BU2A 1LNWA 4F3QA 2DFEA 2OPTA 3DF8A 5E3OA 1YG2A 2QWWA 1LFPA 4G94A 4U88A 3TO9A 2WADA 1FPQA 4Y4RA 1Y0UA 4UUSA 1WJCA 2F6CA 4A0XA 3LFKA 4EJOA 1Y39A 5J1YA 1TT0A 3J7YJ 1SVMA 2L7MP 3EQLF 3Q9SA 3F8MA 3S32A 4XRFA 5A2QZ 3GVAA 5HLHA 1MZBA 1Y6IA 3A02A 4NB5A 2FF4A 4B4CA 1LE8B 4ON0A 4UUSB 3VSKA 2XAJA 2IA1A 2ZC2A 5EEHA 3HOUJ 4TV7A 5LFAA 3TW7A 4CHUA 3RKWA 4A3JJ 3DKYA 5E79C 5D5XB 2EA2A 2B7EA 2ZJ2A 4HSTA 1JKQC 1UHWA 1AKHB 4IVNA 3ABMH 4D0PA 3Q0WA 4LLLA 3GZ6A 2Z1DA 3WGHA 1DGWY 2AHQA 1J7KA 4E7HA 1FJLA 2QENA 2DA5A 1LJ9A 1MBJA 1VQ8I 3M1CA 1OJLA 1IJWC 2NNNA 4BXUA 1YIOA 3T5XA 2I5UA 2KMUA 5ILVA 2E1NA 3BOQA 1V55H 3F9KA 4QSHA 5DD8A 4RA2A 4RAFA 1BR1A 1IXSB 3RPUA 4EVIA 4LB5A 1HBXG 3DPLC 5LD2C 2DFFA 1QQIA 4UXNA 3J7AO 1RESA 2E7XA 4BY1J 2IW5A 3HC7A 2ME6A 3OY9A 2OAZA 3L2UA 2EILH 2FSWA 4D7MA 1ONVA 2P5VA 3KE2A 1F9NA 5HDKA 3BQZA 2IRFG 3HDDA 2Z3YA 3ZQ7A 2QF7A 5LHGA 5TRDA 5K1YA 2VJ5A 3N4MA 3QWLA 4M3FA 3GTPJ 5J40A 1JT6A 3ZQQA 1Y1WJ 4DBQA 3RIRA 4UNOA 1KU3A 2A68F 1S5LC 4A0YA 1DP3A 2DPUA 1O7FA 1LDJA 3RKYA 2MLGA 2M8GX 3TKYA 3DLLF 2NYXA 2A6TA 2CJJA 1MMNA 2MLKA 1KYWA 3GLLA 5D5VB 3N97A 4EV0A 5DM7F 3HTUA 1U78A 5C4XJ 1GV2A 2R7DA 2JRTA 1IN6A 5JLWA 3OYGA 2DCEA 2IGOA 1XD7A 4BBSJ 1MBGA 3HG9A 4M3BA 3WTVC 2R7ZJ 4EJUA 4X0GA 2MC3A 3HYIA 3PM1A 4RM3A 4ASNA 5FLMJ 2IGKA 4IHSA 1YHQI 2W7NA 1EH7A 3HB9A 3DPUA 1YITI 5CPRB 3V7SA 5IOYA 3S14J 3CUOA 4CYCA 3CMEI 2YSRA 2XF5A 1D8JA 4M6XA 2CRGA 1W7PD 1MKMA 3FMQA 3CJNA 2KP6A 3TDZC 1FOXA 3JCUC 5EEAA 5FKMA 2D45A 2HZTA 4JQFA 2RGVA 4G7OF 2VC0A 3S93A 1QHGA 3Q0UA 2OC6A 2TCTA 3H5NA 1K78A 4CYCB 1BI0A 3FXMA 1TC3C 5DDGA 1MJBA 3S2HJ 1EH6A 2W48A 1LDDA 2ZSHB 1CF7A 2HGCA 1VQMI 1ACIA 1ERDA 3Q5FA 2R4GA 4HF1A 3HSRA 4PSWA 3W2WA 1R58A 2YU3A 1JHHA 1R5GA 2HQ5A 4I99C 4BHCA 1P7IA 2KFDA 3DTIA 1K78B 1B4AA 3FWEA 3ZN0A 3AAFA 2GLOA 1ZREA 1FWZA 2XV4S 3K10A 4WXDA 1CF7B 1YI2I 1DPUA 1SAUA 3ERED 1ZKGA 4CZZA 1IV6A 1BJZA 5M5WJ 2F4OB 4KICA 3E7LA 2CUZA 4XRSA 1MBEA 3CTAA 1OCTC 2F5CA 2LMDA 4HV5A 5EJCA 3GO5A 4YFNF 3FXOA 4B47A 1U9OA 4OAZA 4M9ZA 3AL0C 2FMYA 1D8KA 2L0KA 2QQBA 1UELB 5DEQA 3HOVJ 1V54H 4HBLA 4BAYA 1TTYA 1BW6A 4BJ6C 4FISA 2F5VA 2VPLA 4P5OA 1Z9CA 4D7NA 1SFUA 3HXLA 1SFEA 3GBGA 4UUVA 3WTSC 4O6JA 3GYHX 2LD5A 4JBAA 3AG3H 1Z7UA 4M72A 3OYLA 2PG4A 2E34A 2HFHA 3HL2A 4WK8F 3QYEA 3C7JA 2IVMA 2UV1A 1V5EA 4LG0A 5ICEA 2VI6A 4XOPA 3MFKA 4J01A 2L5QA 2OJED 1HW2A 3BTCA 2IEKA 3R0AA 4IEJA 4PDKA 4PFPA 4BKXA 1BL0A 1NK3P 3PIPF 3FK6A 1XTAA 2OQRA 3DWLE 2FOKA 3I53A 4II3A 5EDNA 3UKGA 1K83J 2RREA 1VNDA 1ZLKA 3CZ6A 1JUPA 3PL8A 3QODA 5BOXA 4HA8A 3OS2A 4N4NB 4LG0B 1BR2A 2XDVA 1K6OA 1FOKA 2ELKA 4FTHA 5DUKA 1JKRC 3SZGA 3BCBA 3ASNH 1YOVB 3SEQA 2Q0OA 1O3RA 4WF2A 5CVVA 1TWHJ 2EIMH 2HVSA 4IOCF 2CW8A 1JHFA 2R5YA 4IOAF 5KVRA 5J4YA 1YFHA 2L9NA 1XCVA 3NARA 4BQQA 2TDXA 2JQ7A 3F23A 2DOEA 5F0HA 4N9IA 1TP4A 1TWFJ 2K4BA 4L5EA 1DGRM 2XB0X 2CQ7A 2JVGA 2X0LA 2LH9A 2LVSA 4G7HF 1XMKA 2HOSA 3HHGA 1JKOC 3LSJA 2R5YB 5DCFA 1OR7A 1HSJA 5J8CA 2CYYA 2DTZA 4XM3A 4BYYA 4EJWA 3RQIA 1KQ0A 3KP4A 3LQRA 4GYIA 3PNTA 1KA8A 5CQGA 4BL0B 4F52A 4BHBA 1WCMJ 3H5AA 3MN2A 4M74A 3CMYA 1BIAA 3F8CA 3EUKL 1X4OA 4BE0A 3S2DJ 2YU9J 3I59A 1T95A 4NC7A 5DUIA 1Y0NA 3FBNB 5A2QK 3K69A 4LLNA 2KDZA 1XGOA 1SVLA 1YW8A 3PSFA 3VWBA 4BDYA 2VT3A 3CLQA 3F3XA 2P6SA 1PUFA 4MGRA 3S3MA 3TDUC 3DQVC 1XN7A 2V9KA 3FK7A 5FD5A 3I59B 2VXZA 4XL9A 3A01B 2FNAA 4HW0A 3PJRA 4K2EA 4LIUA 3IAS2 2R7OA 5J6XA 2PLYA 1QNTA 3GXOA 2XIGA 4OU0A 4NHJA 5GTHC 4MQ9F 1PUFB 1AU7A 4CCLA 3IH2A 4BDZA 2OV7A 4LG3A 1V4RA 3KFWX 4OAYA 4IHXA 1TQMA 4L9VA 2K5CA 5ICFA 4EGYA 2YUSA 4RGUA 5E3LA 4A3GJ 3V8JA 2IS1A 2HDDA 1WRJA 5FFXA 4KMUX 2VKDA 4BUPA 1JT0A 2A5YB 1LQ1A 4A3LJ 1OYYA 1XSVA 2FD5A 2XB5A 3H9JA 2R3SA 1TWAJ 2KZGA 5LBQA 1D1AA 2DW4A 3V8LA 4I2OA 2KRCA 4B09A 3S1QJ 5FB2A 3D0SA 3V42A 2R7FA 3ZR8X 4MFEA 1EJ9A 1R4MB 2HDWA 2HI3A 4JP0A 1UAAA 2AQFA 5TISC 1KYZA 3H9GA 3G71I 2WAQN 1UG0A 3TL4X 3QP5A 1K6YA 3H3ZA 4XLCA 1UHMA 2M2EA 3BROA 2EZLA 5E8IA 2JPBA 4ZYAA 1I39A 1YYVA 3W2VA 1SD6A 3WTWC 2W84A 3RDIA 2EV6A 3OYEA 1FIPA 1TLHB 4ENNA 4GDFA 1XDSA 4ETSA 1WJAA 4M3EA 3HOWJ 1MMGA 3E3VA 2M7AA 3KP7A 2DMQA 2H8WA 1OCZH 3O6BB 3GFMA 3K0LA 5LGTA 1D0YA 4ZYDA 3COAC 3MWMA 5CVJA 2ZO4A 4R1HA 1FTTA 3SYTA 3JRBA 3BJAA 2GQQA 2JZYA 5EF6A 1F1ZA 3TP0A 1ETQA 4F91B 3D1NI 1LB2A 2EB7A 3ML6A 1WSUA 4XIDA 1IAWA 2LYCA 1MIJA 3K2AA 3IV5A 4IHTA 3ECOA 2E2IJ 5E3MA 3DFGA 4MTEA 3MKWB 2ZXWH 4YG2F 3J81Z 1QRYA 1RNLA 1P6RA 4CYDA 1Q1VA 5F04A 2HOEA 4YEJA 2LKXA 3S15J 1FP1D 4EGZA 3AG1H 3EDPA 2VE8A 1CGPA 2E5NA 5GAEJ 1R6RA 5IP6A 4YIRX 1FYKA 1TBXA 2X1EA 1YLFA 2D2WA 1EKEA 3OWTA 3CF5F 3KLOA 3JRFA 2FBIA 2A69F 5E3NA 1KGSA 2KISA 2X9DA 1E17A 3ZQLA 2UXXA 1BI3A 5D6EA 4J00A 2M5WA 3NWSA 4P1WA 4XK4A 3OMYA 2AS5F 2M0CA 1Q1HA 1XX5A 2M3AA 2GXGA 3SEZA 1FT9A 1GLNA 2K02A 4LJZF 2M34A 1HQCA 2DAOA 1G3YA 1TW3A 5HLIA 4II2A 1KONA 2EIKH 2P6TA 1Z67A 3ERMA 2JSPA 3BLYA 1Z7LA 2NRAC 2J5PA 5H2FC 4RDUA 1LUJB 4RS8A 1Z3YA 1YRNA 1FTZA 4XLAA 2PJPA 3RSNA 2DXIA 3FKJA 3GWZA 3CJRB 2ISYA 3JTGA 4GO1A 4HG2A 3MKYB 2N8GA 3C2HA 3OS1A 2DPDA 2JA5J 3R6SA 5B5EC 4XLFA 2CFXA 4A3IJ 1AHDP 2E1CA 2DTRA 4V2FA 1FLIA 2ZB9A 3R0JA 1YRNB 3S3OA 2VONA 3GEZA 3L2RA 3BG9A 3NEUA 4HF0A 1XPXA 4AIKA 4BQOA 2PEXA 1E2XA 4EM2A 3OYAA 1Z77A 1LVKA 1ZGAA 3U1DA 4MEXF 1U5TA 2IXSA 3D5SC 3HJEA 2QYOA 4I7HA 5BNGA 4BJ5C 4JX4A 2KIFA 3ULQB 2L02A 1G3WA 2X1DA 2DA3A 2E19A 4YELA 4PCQA 1QO0D 1DP7P 4KIBA 1LFUP 5FLXK 4AIJA 3MAJA 1U8BA 3ZQHA 1IZ1A 1IDZA 3T8RA 1U5TB 2XVCA 5L3FA 2HOTA 4WXHA 4ZJZA 5K5RA 2LREA 2WAEA 4ZZDA 2PJRA 2BVMA 4XN0A 1KQ9A 3HPGA 3K1PA 5DM6F 3K1MA 3UR3C 1ENHA 2YX7A 2G0EA 5D4RA 2ZMEC 2CFOA 1VF9A 2VUMJ 1Z1DA 1ZARA 1G3SA 1W5TA 1SFXA 3KZZA 2WWYA 1SFOJ 2GAUA 2LR8A 3HSFA 1RC9A 2MH9A 2PJRB 3NWTA 3TO7A 3FXJA 3BP8A 5M5YJ 4A2UA 1NTCA 4KA4A 1ETWA 3H3UA 4HPQA 1ZRDA 4B8XA 1ZELA 1OMIA 2K4JA 3P9IA 3JRIA 3LSIA 3OSGA 2LBFA 2IBDA 1ZYRF 4DZJA 2VQHA 1LPQA 4NBQA 2RDPA 3SQNA 2FNPA 3DEWA 3KIOA 3RI4A 1WH5A 2X6OA 1YX3A 2GXAA 3CUQC 3PQJA 5FFZA 1G6NA 4X6AJ 1T56A 2BYVE 4J19A 5BPDA 2OTLI 2R7TA 3L9FA 2DOAA 3IP4B 3CQZJ 4P9UA 4B43A 2KT0A 1ETXA 4I98B 2NOGA 5HOOA 2EFWA 1SMTA 2R7XA 1PYVA 5KK1A 1IW7F 4CICA 1UG2A 1LKXA 1P2FA 5JVTA 3HOZJ 1DDNA 5J1RA 4HF2A 2XHKA 2PN6A 2NS7A 1RI7A 3DEEA 1SEUA 5BPIA 4PJNA 4KUMA 2R7VA 1MW7A 5ED4A 4JK1X 4L0ZB 1NG6A 3G1LA 2LF8A 2Y9YA 1VQ7I 3OYMA 4IXAA 3LQQA 2XPWA 1GVDA 2EQRA 5DD4A 5KAIC 3DLAA 4HNUA 2DT7B 4IF4A 1BI2A 2M7BA 3P9CA 5IYCJ 3SJMA 1E0EA 1JGGA 4U7BA 4XR6A 1A6QA 4BBRJ 5J47A 1LE8A 3PUBA 5JHFA 4CGZA 3CMAI 2AXTC 4JOMA 2O6GE 2CGPA 2B63J 3SDGA 2IJLA 4I0AA 4LK0F 3GZ5A 3PNYA 2M9HA 4U87A 3FHNA 2RNGA 2H94A 3U9GA 2QSGX 1AKHA 3KCCA 2AXLA 1MGTA 3G2BA 3ESWB 3M7GA 5HDNA 2AO9A 2XF7A 3BR5A 1XMXA 5FJ8J 1ORKA 3OYNA 4DGWB 3ISPA 2H09A 1OCCH 3I0TA 3FKIJ 2LKPA 4BS9A 5F08A 3DU5A 3L2WA 3ZMDA 3DBRB 2Q2EA 2EFQA 2KZVA 2MD0A 3E6MA 2V4JC 4BY7J 2HPMA 3GFLA 2VB6A 4CUGA 1X3WB 1WFXA 3E97A 4Y17A 4MHGA 1DU6A 1VTNC 1B9MA 1Z91A 5BMZA 3QU6A 2GOMA 1W4MA 2E2HJ 2Q2EB 4H4KC 2JMWA 1UMQA 5E1XA 3H1CA 2CU7A 1JXSA 1POGA 3RPUD 5IP7J 2OZ6A 4KYWA 1PJRA 4CH7A 3GTMJ 3EPZA 2QM3A 3I4NJ 1OLTA 4MTDA 3MZYA 1S6LA 1PP7U 4IJAA 3JSPA 1PVEA 1QHHD 1Y8RB 3JRDA 1VZ0A 2QVOA 4I76A 1AOYA 2W25A 1WJ5A 4U0VA 4HAMA 3M4OJ 4HNTA 3S1NJ 4N9HA 2QBYA 2MSYA 1RKTA 2Y75A 2XRNA 4UB8C 1MNMC 2X51A 2M4KA 2QGUA 2ZCWA 3U2RA 1FY7A 1XSXA 3J81K 4PK4A 3H35A 3CC2I 1G2HA 2Y30A 3DTKA 3T8TA 5GP9A 5FRMA 4A69C 2EFOA 4Y15A 3E5UA 2QBYB 1W0TA 1X3ZB 2L9VA 1KZHA 1OQYA 3DKXA 5L3GA 1H9GA 2FA5A 3VOEA 3V8KA 3S1RJ 1HF0A 2BEOA 3KP3A 1ETKA 1L0OC 2XUBA 3A03A 4E7LA 4G9YA 5FLVA 3AKZA 3FXLA 5F64A 5C3EJ 3G4SI 1TW2A 2CW0F 2MA3A 1VQ6I 1WJEA 3TO6A 4E7JA 1R1UA 2O8XA 1BIBA 1D3YA 5KHDA 4R8HA 2M87A 4UB6C 2Z5UA 4OMYA 1CQTA 4EEFG 4CXFA 1IRFA 1JTXA 3MMYB 4UV9A 1ON2A 1F4KA 3PFIA 3H92A 4ZTJA 2DT5A 3N05A 2KQRA 1RETA 3HRTA 2L4MA 3QQAA 4PFOA 3NRVA 2BY2A 2K40A 2WY8Q 5D4SA 1K4TA 2HVRA 2IP2A 2KDOA 2XPUA 2L2OA 4IQJA 2X6WA 2EA4A 2L7KA 2FMLA 3E0JB 5D5UB 2EV0A 2FQ3A 1OKRA 2YX4A 5C4JJ 5LEJA 3CJTB 3MCZA 2FOWA 5AONA 4RB3C 1SD5A 2PMUA 4IX7A 1X2MA 2JA6J 2LF7A 2RAEA 3LMMA 1FSEA 1W7PA 1UCRA 2E35A 3LOCA 4R79A 1UFMA 3ZP5A 3OOPA 4D5CA 1EA3A 2QZ8A 1X19A 5EZHA 3HRUA 2BGCA 2BHZA 4I02A 1YTYA 3DPTA 3JAMK 4UVBA 5ILSA 4AC0A 4L9JA 4CCNA 3QRFF 1HKQA 4W97A 3HRSA 4A12A 4UV8A 1S9HA 1W7PB 5TGTA 3QPLA 1XC5A 4E70A 2A05A 5JHUA 5LRRA 5IYBJ 2BHYA 3A2KA 4XSXF 1MDMA 3BC8A 4G6DA 2FU4A 1YQAA 5CVIA 2Y0MA 2M30A 3KEQA 3R60A 4M9SA 2A07F 4FT8A 3T1BA 3C2GA 1X1AA 3OR2C 3HEFA 2DOFA 3PIOF 2ZNZA 3L00A 3AG4H 2K3PA 4FX0A 3FXQA 2F48A 2DMTA 3ZQCA 3CD6I 2R7RA 1MDMB 1VFCA 3OIOA 4NUBA 2WB1N 1Z3XA 5F0CA 2VLAA 2ZFWA 4RB2C 5L3BA 4I6ZA 3F21A 2H6BA 1V3FA 3AFHA 4C9YA 5HLGA 5HS7A 2XGEA 2H6CA 3ZRGA 4HQEA 1WJFA 2GWRA 1OYWA 3VFZA 1TQIA 2KIUA 5FLXZ 3GTQJ 4P96A 2RVCA 3D5LA 3HKZN 2A6EF 3LAPA 5B1AH 2ESHA 4WWCA 4BEHA 3HUGA 3TP3A 2COBA 3JSOA 1E3HA 2HU9A 5FKKA 3RPQA 1S29A 9ANTA 3ABKH 5EZGA 2R7SA 1SC7A 3BT9A 3RKQA 2XGDA 3HZJA 3I3LA 1MMDA 3LA7A 2L3DA 3NQOA 3I58A 3ZCOA 5GADJ 3CCSI 1QBJA 2RC4A 1WVRA 2JPCA 1MD0A 1D5YA 4RB0A 2CQXA 4KISA 4BEHB 3HUGB 5HS8A 2CQKA 3QPTA 1OCOH 4QPOA 3WG7H 3QU3A 3ZMUA 1VQOI 3GW2A 3DCFA 5IY5H 4A3EJ 3S16J 4LMYA 3PNVA 4CCMA 4RGSA 3CCLI 4HLYA 2PX9A 3I4MJ 1IF1A 2XSDC 1YS6A 4NC6A 4IL6C 2QLZA 2V1DA 5D8LB 1Z6RA 4BGDA 4BE2A 3CCUI 3WGIA 2EFNA 5DTDA 1PDNC 3GX4X 4KITB 2BBYA 1U9NA 1WI9A 2DK8A 4M3GA 2KL4A 4N4OB 3L09A 1GV5A 4H0EA 2LFBA 2VQLA 2ZJRF 5LGNA 2FBKA 1Y8QB 4UUTA 1TZLA 2RQQA 3A01A 2VODA 4U0YA 4WXCA 1HW5A 2MYSA 1FBQA 4IHWA 4L18B 2Y9ZA 3BY6A 3R61A 4A0ZA 4FQGA 4PSXA 2DA4A 2EFPA 2E1MC 2PBIA 5EEGA 4KN4X 1JE8A 1FBSA 4AU7A 1IC8A 1HKSA 5JVGF 1T33A 4XBFA 2XAQA 2FXAA 3P5JA 3OYDA 1WJDA 2ZJPF
chains in the Genus database with same CATH topology
2OPTA 5E3OA 1HCRA 2K9QA 1E3OC 3GTGJ 2FX0A 4RDUA 1I6HJ 4UUSA 2CUEA 1QVTA 1YRNA 1FTZA 1IDYA 5J1YA 4Y7NJ 2L7MP 2P81A 3S1MJ 2GM4A 3L1PA 2N8GA 3BTJA 3OSFA 3HOYJ 3A02A 2JA5J 4B4CA 5K7FA 1LE8B 1AHDP 4A3IJ 1BW5A 4V2FA 4UUSB 2ZB9A 3QPSA 1YRNB 3HOUJ 4IHVA 2PMZN 3B6AA 3TW7A 3BG9A 4A3JJ 1ZGWA 2EZHA 1O4XA 2ME0A 1JUSA 1K61A 1JKQC 2DA7A 1AKHB 1Z77A 3ZQIA 3Q0WA 1MBKA 4C3JJ 2AHQA 5BNGA 2L9RA 1FJLA 3BG3A 2GBYA 4JX4A 2YS9A 1IGNA 2DA5A 2DA3A 2E19A 5C44J 3Q3SA 1LFUP 1MBJA 1OJLA 1U8BA 3ZQHA 1IJWC 1IDZA 5JLXA 3BR6A 2HOTA 4IHYA 2JK3A 4DYQA 2DN0A 4QSHA 3JR9A 1ENHA 3GTOJ 4XRMA 2G0EA 1VF9A 2VUMJ 1Z0XA 2L7ZA 4MIMA 1F36A 1SFOJ 1RESA 4BY1J 1MSFC 4FE4A 2LR8A 1HLVA 2ME6A 4D7MA 2R93J 5M3FJ 2LLKA 5M5YJ 2IAIA 2XGCA 1NTCA 1ETWA 3BQZA 4DYRA 3HDDA 2QF7A 3OSGA 3JRIA 2JN6A 4A3KJ 5F27A 4M3FA 2NVYJ 3GTPJ 1JT6A 2IBDA 3F0CA 1Y1WJ 4DZJA 3DEWA 4HNVA 2H1KA 2NVTJ 1WH5A 1RKWA 2X6OA 1IRZA 2M8GX 2QCOA 4XICA 4X6AJ 3WHBA 1T56A 2CJJA 4J19A 3CQZJ 2EH3A 1TWCJ 1GV2A 1U78A 5C4XJ 2KT0A 1ETXA 5JLWA 3JRCA 2NOGA 3FISA 4QTRA 4BBSJ 1MBGA 1DU0A 4M3BA 2R7ZJ 3JRHA 2ECBA 3PM1A 5FLMJ 1UG2A 3HOZJ 3HB9A 4FE7A 5EGOA 5J1RA 2R0QC 3OOUA 5IOYA 2NS7A 3S14J 4CYCA 1ZTRA 1IUFA 4NDLA 3S17J 1SANA 4BXXJ 2CRGA 3G1LA 2Y9YA 2XPWA 1GVDA 2EQRA 2ECCA 4DW6A 5IYCJ 3SJMA 5EGOB 5EEAA 5FKMA 4A3FJ 1JGGA 4ABZA 4BBRJ 5M5XJ 1LE8A 3Q0UA 4DYCA 2TCTA 5F0FA 2NVQJ 2ID6A 4CYCB 1TC3C 4C3IJ 1S7EA 2HXIA 5EG0A 3S2HJ 2W48A 2B63J 3JRGA 3SDGA 2O8KA 3HOXJ 1ZR2A 3BTIA 2XRLA 3CDLA 1JUMA 2M9HA 1MBHA 1X58A 2HQ5A 1ZK8A 1AKHA 1P7IA 1ZQ3P 5FKNA 4A93J 3HBLA 2AO9A 1MH4A 3BR3A 1MSEC 2GLOA 3RZDJ 2L7FP 3BR5A 3K7AJ 5EG0B 3PO3J 5FJ8J 1ORKA 1ZR4A 2E2JJ 3BR1A 1ZKGA 1IV6A 2EBIA 3FKIJ 1BJZA 5M5WJ 5F08A 5M3MJ 1B72A 3E7LA 2LP0A 4XRSA 1TWGJ 4BY7J 4B1RA 1MBEA 1OCTC 3ZQFA 1MBFA 2DMNA 1XG1A 1U9OA 2X48A 1DU6A 2L0KA 4B3AA 5IOZA 3LSGA 4M3DA 3HOVJ 2E2HJ 1B72B 3LSPA 1BW6A 2JMWA 1EF4A 4FISA 1UMQA 1ITYA 3SFIA 2LTPA 2CU7A 4D7NA 1POGA 5IP9J 5IP7J 3GBGA 2H8RA 2LD5A 1P7JA 2O7OA 4MLOA 3GTMJ 4C2MJ 3I4NJ 3C2BA 5J1UA 3VPRA 3JRDA 1OCPA 2VI6A 1HOMA 3BTLA 4I76A 1A5JA 4JX5A 3BTCA 4IEJA 1GUUA 2IEKA 4BKXA 1BL0A 1NK3P 2O9LA 3GTKJ 3M4OJ 3S1NJ 2MSYA 3FK6A 3BG5A 1RKTA 5EDNA 3UKGA 1K83J 2K9SA 1VNDA 1MNMC 2MGQA 1JUPA 2Y2ZA 2JWTA 2I10A 1GDTA 5GPCA 3W6VA 4DZPA 5GPAA 1G2HA 4D5FA 2ELKA 2TRTA 2Y30A 1WI3A 4JX6A 2VPRA 4FTHA 1JKRC 1HDDC 5GP9A 4A69C 2WV1A 2DA2A 3HGGA 1W0TA 1TWHJ 3PO2J 1APLC 1QVUA 2R5YA 2MW8A 3S1RJ 1HF0A 3NARA 2FQ4A 1JJ6C 1ETKA 3A03A 5F0HA 2Y31A 4RBOA 5FLVA 4A3CJ 5HODA 1TWFJ 3NAUA 5C3EJ 4L5EA 2XB0X 4MFDA 3ZOBA 2LVSA 3BQYA 3BR2A 2HOSA 1JKOC 3LSJA 2R5YB 1RR7A 2DTZA 4GFBA 2DMUA 1ETOA 5K7HA 1CQTA 3RQIA 4EEFG 2OF7A 1JTXA 1WCMJ 1RETA 2LY9A 3MN2A 3CMYA 2JA7J 5IYDJ 2DMPA 4A3DJ 3QQAA 3S2DJ 2K40A 2YU9J 1XS9A 3O8GA 2XPUA 3Q0VA 2EZIA 1RPWA 1IG7A 2JA8J 2KDZA 2DA6A 4W1UA 4JYKA 5F1JA 5DS9A 1F43A 3MVPA 4A3MJ 5C4JJ 1NK2P 1PUFA 1I50J 5FKLA 2DJNA 1X2MA 2JA6J 3MKLA 3FK7A 2RAEA 3G1MA 5K7ZA 3A01B 3H3VK 3LOCA 3LNQA 4D5CA 4S0HB 4G12A 5EZHA 2HXOA 1B8IA 4AC0A 2VKEA 1AU7A 1PUFB 3IH2A 1FEXA 4W97A 1W0UA 1UHSA 4IHXA 2YUSA 3QPLA 1XC5A 5E3LA 3WHCA 4A3GJ 2HYJA 5IYBJ 1HDPA 2CQQA 3HGYA 2HDDA 2DA1A 1LFBA 1B8IB 3CCYA 2NVXJ 3LSRA 1JT0A 1Y1VJ 4A3LJ 2FD5A 3HEFA 3M3YJ 2XB5A 1TWAJ 2D5VA 4QIWN 3O8HA 3ZQGA 3S1QJ 1OFCX 2DMTA 3JRAA 3ZQCA 1VFCA 4C3HJ 3OIOA 5F0CA 2WB1N 4MFEA 2HOAA 2HI3A 1JTYA 4JP0A 1I3QJ 4I6ZA 4Y52J 1X2NA 2WAQN 2XGEA 2K9NA 3BR0A 3GTJJ 1WH7A 5EYRA 2M2EA 2EZLA 1A6IA 2VKVA 3GTQJ 3FIWA 3TEDA 3TW6A 5J3LA 2MG4A 3HKZN 1FIPA 5IPAA 3TP3A 2COBA 4V2GA 1R9TJ 4M3EA 3HOWJ 5FKKA 2DMQA 9ANTA 5EZGA 3JREA 3BT9A 1WPKA 3RKQA 1H88C 2XGDA 3G1OA 1FTTA 3JRBA 1JKPC 5EF6A 1D5YA 2CQXA 3TP0A 1ETQA 3D1NI 4XIDA 3K2AA 3IV5A 4AUXA 4AYBN 2Y0SN 3DCFA 4A3EJ 2E2IJ 1H89C 5E3MA 3S16J 4XRSG 1QRYA 2CUFA 1JJ8C 3I4MJ 1Q1VA 5F04A 2XSDC 2LKXA 3S15J 1BA5A 2E1OA 5DTDA 5IP6A 1FIAA 1U9NA 2LK2A 3IH3A 3IH4A 4M6VA 4M3GA 3RZOJ 3B6CA 4FCYA 4X1EA 1GV5A 3JRFA 2LFBA 5E3NA 2X9DA 4UUTA 1QPIA 2R92J 3A01A 2R5ZA 3ZQLA 1H8AC 2FJ1A 1WGXA 4MO7A 2EZKA 4IHWA 2XPVA 4LOCA 4XK4A 2Y9ZA 1VI0A 2DA4A 3GTLJ 2M0CA 1ETVA 1ETYA 1IC8A 2ID3A 1MH3A 1T33A 1GT0C 3H0GJ 2JJ7A 3HM5A 2M34A 5FKOA 4A3BJ 2NS8A 2R5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPT A;  5E3O A;  1HCR A;  2K9Q A;  1E3O C;  3GTG J;  2FX0 A;  4RDU A;  1I6H J;  4UUS A;  2CUE A;  1QVT A;  1YRN A;  1FTZ A;  1IDY A;  5J1Y A;  4Y7N J;  2L7M P;  2P81 A;  3S1M J;  2GM4 A;  3L1P A;  2N8G A;  3BTJ A;  3OSF A;  3HOY J;  3A02 A;  2JA5 J;  4B4C A;  5K7F A;  1LE8 B;  1AHD P;  4A3I J;  1BW5 A;  4V2F A;  4UUS B;  2ZB9 A;  3QPS A;  1YRN B;  3HOU J;  4IHV A;  2PMZ N;  3B6A A;  3TW7 A;  3BG9 A;  4A3J J;  1ZGW A;  2EZH A;  1O4X A;  2ME0 A;  1JUS A;  1K61 A;  1JKQ C;  2DA7 A;  1AKH B;  1Z77 A;  3ZQI A;  3Q0W A;  1MBK A;  4C3J J;  2AHQ A;  5BNG A;  2L9R A;  1FJL A;  3BG3 A;  2GBY A;  4JX4 A;  2YS9 A;  1IGN A;  2DA5 A;  2DA3 A;  2E19 A;  5C44 J;  3Q3S A;  1LFU P;  1MBJ A;  1OJL A;  1U8B A;  3ZQH A;  1IJW C;  1IDZ A;  5JLX A;  3BR6 A;  2HOT A;  4IHY A;  2JK3 A;  4DYQ A;  2DN0 A;  4QSH A;  3JR9 A;  1ENH A;  3GTO J;  4XRM A;  2G0E A;  1VF9 A;  2VUM J;  1Z0X A;  2L7Z A;  4MIM A;  1F36 A;  1SFO J;  1RES A;  4BY1 J;  1MSF C;  4FE4 A;  2LR8 A;  1HLV A;  2ME6 A;  4D7M A;  2R93 J;  5M3F J;  2LLK A;  5M5Y J;  2IAI A;  2XGC A;  1NTC A;  1ETW A;  3BQZ A;  4DYR A;  3HDD A;  2QF7 A;  3OSG A;  3JRI A;  2JN6 A;  4A3K J;  5F27 A;  4M3F A;  2NVY J;  3GTP J;  1JT6 A;  2IBD A;  3F0C A;  1Y1W J;  4DZJ A;  3DEW A;  4HNV A;  2H1K A;  2NVT J;  1WH5 A;  1RKW A;  2X6O A;  1IRZ A;  2M8G X;  2QCO A;  4XIC A;  4X6A J;  3WHB A;  1T56 A;  2CJJ A;  4J19 A;  3CQZ J;  2EH3 A;  1TWC J;  1GV2 A;  1U78 A;  5C4X J;  2KT0 A;  1ETX A;  5JLW A;  3JRC A;  2NOG A;  3FIS A;  4QTR A;  4BBS J;  1MBG A;  1DU0 A;  4M3B A;  2R7Z J;  3JRH A;  2ECB A;  3PM1 A;  5FLM J;  1UG2 A;  3HOZ J;  3HB9 A;  4FE7 A;  5EGO A;  5J1R A;  2R0Q C;  3OOU A;  5IOY A;  2NS7 A;  3S14 J;  4CYC A;  1ZTR A;  1IUF A;  4NDL A;  3S17 J;  1SAN A;  4BXX J;  2CRG A;  3G1L A;  2Y9Y A;  2XPW A;  1GVD A;  2EQR A;  2ECC A;  4DW6 A;  5IYC J;  3SJM A;  5EGO B;  5EEA A;  5FKM A;  4A3F J;  1JGG A;  4ABZ A;  4BBR J;  5M5X J;  1LE8 A;  3Q0U A;  4DYC A;  2TCT A;  5F0F A;  2NVQ J;  2ID6 A;  4CYC B;  1TC3 C;  4C3I J;  1S7E A;  2HXI A;  5EG0 A;  3S2H J;  2W48 A;  2B63 J;  3JRG A;  3SDG A;  2O8K A;  3HOX J;  1ZR2 A;  3BTI A;  2XRL A;  3CDL A;  1JUM A;  2M9H A;  1MBH A;  1X58 A;  2HQ5 A;  1ZK8 A;  1AKH A;  1P7I A;  1ZQ3 P;  5FKN A;  4A93 J;  3HBL A;  2AO9 A;  1MH4 A;  3BR3 A;  1MSE C;  2GLO A;  3RZD J;  2L7F P;  3BR5 A;  3K7A J;  5EG0 B;  3PO3 J;  5FJ8 J;  1ORK A;  1ZR4 A;  2E2J J;  3BR1 A;  1ZKG A;  1IV6 A;  2EBI A;  3FKI J;  1BJZ A;  5M5W J;  5F08 A;  5M3M J;  1B72 A;  3E7L A;  2LP0 A;  4XRS A;  1TWG J;  4BY7 J;  4B1R A;  1MBE A;  1OCT C;  3ZQF A;  1MBF A;  2DMN A;  1XG1 A;  1U9O A;  2X48 A;  1DU6 A;  2L0K A;  4B3A A;  5IOZ A;  3LSG A;  4M3D A;  3HOV J;  2E2H J;  1B72 B;  3LSP A;  1BW6 A;  2JMW A;  1EF4 A;  4FIS A;  1UMQ A;  1ITY A;  3SFI A;  2LTP A;  2CU7 A;  4D7N A;  1POG A;  5IP9 J;  5IP7 J;  3GBG A;  2H8R A;  2LD5 A;  1P7J A;  2O7O A;  4MLO A;  3GTM J;  4C2M J;  3I4N J;  3C2B A;  5J1U A;  3VPR A;  3JRD A;  1OCP A;  2VI6 A;  1HOM A;  3BTL A;  4I76 A;  1A5J A;  4JX5 A;  3BTC A;  4IEJ A;  1GUU A;  2IEK A;  4BKX A;  1BL0 A;  1NK3 P;  2O9L A;  3GTK J;  3M4O J;  3S1N J;  2MSY A;  3FK6 A;  3BG5 A;  1RKT A;  5EDN A;  3UKG A;  1K83 J;  2K9S A;  1VND A;  1MNM C;  2MGQ A;  1JUP A;  2Y2Z A;  2JWT A;  2I10 A;  1GDT A;  5GPC A;  3W6V A;  4DZP A;  5GPA A;  1G2H A;  4D5F A;  2ELK A;  2TRT A;  2Y30 A;  1WI3 A;  4JX6 A;  2VPR A;  4FTH A;  1JKR C;  1HDD C;  5GP9 A;  4A69 C;  2WV1 A;  2DA2 A;  3HGG A;  1W0T A;  1TWH J;  3PO2 J;  1APL C;  1QVU A;  2R5Y A;  2MW8 A;  3S1R J;  1HF0 A;  3NAR A;  2FQ4 A;  1JJ6 C;  1ETK A;  3A03 A;  5F0H A;  2Y31 A;  4RBO A;  5FLV A;  4A3C J;  5HOD A;  1TWF J;  3NAU A;  5C3E J;  4L5E A;  2XB0 X;  4MFD A;  3ZOB A;  2LVS A;  3BQY A;  3BR2 A;  2HOS A;  1JKO C;  3LSJ A;  2R5Y B;  1RR7 A;  2DTZ A;  4GFB A;  2DMU A;  1ETO A;  5K7H A;  1CQT A;  3RQI A;  4EEF G;  2OF7 A;  1JTX A;  1WCM J;  1RET A;  2LY9 A;  3MN2 A;  3CMY A;  2JA7 J;  5IYD J;  2DMP A;  4A3D J;  3QQA A;  3S2D J;  2K40 A;  2YU9 J;  1XS9 A;  3O8G A;  2XPU A;  3Q0V A;  2EZI A;  1RPW A;  1IG7 A;  2JA8 J;  2KDZ A;  2DA6 A;  4W1U A;  4JYK A;  5F1J A;  5DS9 A;  1F43 A;  3MVP A;  4A3M J;  5C4J J;  1NK2 P;  1PUF A;  1I50 J;  5FKL A;  2DJN A;  1X2M A;  2JA6 J;  3MKL A;  3FK7 A;  2RAE A;  3G1M A;  5K7Z A;  3A01 B;  3H3V K;  3LOC A;  3LNQ A;  4D5C A;  4S0H B;  4G12 A;  5EZH A;  2HXO A;  1B8I A;  4AC0 A;  2VKE A;  1AU7 A;  1PUF B;  3IH2 A;  1FEX A;  4W97 A;  1W0U A;  1UHS A;  4IHX A;  2YUS A;  3QPL A;  1XC5 A;  5E3L A;  3WHC A;  4A3G J;  2HYJ A;  5IYB J;  1HDP A;  2CQQ A;  3HGY A;  2HDD A;  2DA1 A;  1LFB A;  1B8I B;  3CCY A;  2NVX J;  3LSR A;  1JT0 A;  1Y1V J;  4A3L J;  2FD5 A;  3HEF A;  3M3Y J;  2XB5 A;  1TWA J;  2D5V A;  4QIW N;  3O8H A;  3ZQG A;  3S1Q J;  1OFC X;  2DMT A;  3JRA A;  3ZQC A;  1VFC A;  4C3H J;  3OIO A;  5F0C A;  2WB1 N;  4MFE A;  2HOA A;  2HI3 A;  1JTY A;  4JP0 A;  1I3Q J;  4I6Z A;  4Y52 J;  1X2N A;  2WAQ N;  2XGE A;  2K9N A;  3BR0 A;  3GTJ J;  1WH7 A;  5EYR A;  2M2E A;  2EZL A;  1A6I A;  2VKV A;  3GTQ J;  3FIW A;  3TED A;  3TW6 A;  5J3L A;  2MG4 A;  3HKZ N;  1FIP A;  5IPA A;  3TP3 A;  2COB A;  4V2G A;  1R9T J;  4M3E A;  3HOW J;  5FKK A;  2DMQ A;  9ANT A;  5EZG A;  3JRE A;  3BT9 A;  1WPK A;  3RKQ A;  1H88 C;  2XGD A;  3G1O A;  1FTT A;  3JRB A;  1JKP C;  5EF6 A;  1D5Y A;  2CQX A;  3TP0 A;  1ETQ A;  3D1N I;  4XID A;  3K2A A;  3IV5 A;  4AUX A;  4AYB N;  2Y0S N;  3DCF A;  4A3E J;  2E2I J;  1H89 C;  5E3M A;  3S16 J;  4XRS G;  1QRY A;  2CUF A;  1JJ8 C;  3I4M J;  1Q1V A;  5F04 A;  2XSD C;  2LKX A;  3S15 J;  1BA5 A;  2E1O A;  5DTD A;  5IP6 A;  1FIA A;  1U9N A;  2LK2 A;  3IH3 A;  3IH4 A;  4M6V A;  4M3G A;  3RZO J;  3B6C A;  4FCY A;  4X1E A;  1GV5 A;  3JRF A;  2LFB A;  5E3N A;  2X9D A;  4UUT A;  1QPI A;  2R92 J;  3A01 A;  2R5Z A;  3ZQL A;  1H8A C;  2FJ1 A;  1WGX A;  4MO7 A;  2EZK A;  4IHW A;  2XPV A;  4LOC A;  4XK4 A;  2Y9Z A;  1VI0 A;  2DA4 A;  3GTL J;  2M0C A;  1ETV A;  1ETY A;  1IC8 A;  2ID3 A;  1MH3 A;  1T33 A;  1GT0 C;  3H0G J;  2JJ7 A;  3HM5 A;  2M34 A;  5FKO A;  4A3B J;  2NS8 A;  2R5Z B; 
#chains in the Genus database with same CATH topology
 3FX3 A;  4PGH A;  4GGG A;  4OIN F;  1QPM A;  2K9Q A;  1E3O C;  3GTG J;  2FX0 A;  3K9T A;  4Y33 A;  1KU2 A;  1HXD A;  3KX2 A;  4KDP A;  3S3N A;  1QZY A;  2V1X A;  1B1B A;  2CUE A;  1QVT A;  2PFB A;  2HPI A;  1IDY A;  2LY1 A;  1L3L A;  4NQW A;  5HNH A;  1B59 A;  3CCV I;  1D0Z A;  3S1M J;  3IHU A;  1LEB A;  1F5T A;  2GM4 A;  1D1B A;  3L1P A;  3OSF A;  2Z2S B;  1SAX A;  3PUF A;  5K7F A;  2LKS A;  1BW5 A;  4MNU A;  2W4S A;  1IV8 A;  3HIF A;  5CVR A;  4IHV A;  2PMZ N;  4NQW B;  3B6A A;  2KJB A;  2H27 A;  5BQT A;  2GOX B;  1T8I A;  1JUS A;  3CMM A;  2DA7 A;  1VQL I;  1MJ9 A;  5TJJ A;  2BXZ A;  4C3J J;  4C2U A;  1ZRC A;  3O2P E;  2L9R A;  1KQ8 A;  3BG3 A;  1O3Q A;  4M6Y A;  4BAC A;  4E6K G;  1T0F C;  3IRQ A;  3Q3S A;  4KT6 A;  4B3X A;  3LAJ A;  4YFK F;  2G7H A;  2P4W A;  4RB1 A;  2F2E A;  1ZG3 A;  2YR2 A;  4AVP A;  3OYI A;  2XAF A;  2JK3 A;  3ZN1 A;  2CV1 A;  1P4W A;  1U0J A;  3QP6 A;  3V7R A;  5E18 F;  2V26 A;  1BC7 C;  2QUF A;  3FF5 A;  2L7Z A;  4HEA 2;  4MIM A;  3KP2 A;  2KPM A;  1F36 A;  2E60 A;  2WA0 A;  3OYH A;  2ZNY A;  4FE4 A;  3IL2 A;  1MSF C;  1E3P A;  1IN5 A;  1B9N A;  2DYR H;  4UVA A;  4EAT A;  2FEZ A;  5M3F J;  3G3Z A;  4HQM A;  2ZJQ F;  2IAI A;  1XB4 A;  1V5G A;  4DYR A;  3HOT A;  2ZKZ A;  2E71 A;  3EYY A;  1FP2 A;  3J80 Z;  1XMA A;  3LFU A;  4HLX A;  2EWN A;  2NVY J;  3F0C A;  3GFJ A;  3AL0 B;  4Z6Y A;  3ECH A;  4FAS D;  1I1G A;  2IS4 A;  3MZH A;  4XKB A;  3I4P A;  2NVT J;  1RKW A;  1YJW I;  4C2T A;  2QCO A;  5H6R A;  1IRZ A;  1BJA A;  3WTU C;  1STZ A;  4IRI A;  6PAX A;  3ZMZ A;  1NHA A;  1J0R A;  1T08 B;  4ZYH A;  2VC1 A;  2OTJ I;  2PQ8 A;  5FD6 A;  1X1B A;  3HOS A;  1QU3 A;  2IS2 A;  4QTR A;  2CQN A;  4E7I A;  1A04 A;  2IT0 A;  1I1S A;  4PJ0 C;  3JRH A;  2ECB A;  1VQK I;  1I5Z A;  1P9Q C;  2VIX A;  1UJ8 A;  3Q9V A;  3G73 A;  1KU9 A;  4HX8 A;  2VBX A;  5GTI C;  3IKV A;  4PJL A;  3ELK A;  3QOP A;  3J7A Y;  4NDL A;  1IUF A;  3KEO A;  2GIV A;  4XKW A;  2IA2 A;  2KRF A;  1WHU A;  3OYB A;  3S17 J;  1SAN A;  2WAQ A;  4L0Y B;  1H0M A;  3BJO A;  2RNJ A;  2ECC A;  4EM1 A;  1BC8 C;  3GF2 A;  4KIG A;  4ABZ A;  3VYU B;  5M5X J;  2Z99 A;  3C1D A;  4B44 A;  4DYC A;  4XQF A;  5F0F A;  2ID6 A;  1R4N B;  4C3I J;  1A31 A;  1XGS A;  2HXI A;  5EG0 A;  3ZGK A;  1OPC A;  2ELH A;  4DBR A;  1Y56 A;  2ZXI A;  3HOX J;  5HVQ C;  3BTI A;  2XRL A;  3CDL A;  3E6C C;  1XDU A;  1JUM A;  2XAH A;  4XMY A;  1DQU A;  3OIQ A;  4OMZ A;  1X58 A;  4XN3 A;  2D1H A;  1ZQ3 P;  4A93 J;  1N78 A;  3CDH A;  2DQR A;  3HBL A;  2OCE A;  3DBH B;  2VBY A;  1MH4 A;  1FC3 A;  3BR3 A;  4OOI A;  1YW7 A;  4IRG A;  3RZD J;  5EG0 B;  5E8G A;  3K7A J;  3PO3 J;  1Z6T A;  3C18 A;  1R71 A;  3ZPL A;  3RYR A;  4RM2 A;  2EBI A;  1S7A A;  4NC8 A;  2QSH X;  2QQ8 A;  1T39 A;  2VBZ A;  2DLL A;  2V9V A;  4LLG F;  2DYS H;  2OBP A;  2LP0 A;  1MMA A;  4D1Q A;  4GYG A;  3QYF A;  4LD5 A;  1SFK A;  2CO5 A;  3JAM Z;  1ODD A;  2UUZ A;  4OWR B;  2O0Y A;  3WGG A;  4OIR F;  1MBF A;  4UHT A;  1IXC A;  2DMN A;  2ISZ A;  3DTE A;  1YE9 A;  2X48 A;  2JA2 A;  4ZH4 F;  1BR4 A;  3VOD A;  1FSH A;  1SVO A;  4B3A A;  5IOZ A;  3WE3 A;  4M3D A;  4A6D A;  1VQN I;  4L5J A;  3I55 I;  2HDC A;  2GA1 A;  5K5Q A;  3SFI A;  3ABT A;  3M8J A;  5IP9 J;  2H8R A;  1U8R A;  4OIP F;  5B1B H;  1P7J A;  2O7O A;  4MLO A;  4C2M J;  2LG4 A;  3ZMV A;  1TNS A;  4EM0 B;  1D0X A;  5J1U A;  4N0B A;  3IAM 2;  1WZ2 A;  3VPR A;  3OR1 C;  2ICW G;  4JX5 A;  3GTK J;  2O9L A;  2Y69 H;  4E7Z A;  1N75 A;  4PJJ A;  2WBM A;  3IKT A;  3VYR B;  2WTE A;  5L3C A;  2STT A;  2V7F A;  2W24 A;  2STW A;  4MEY F;  2MGQ A;  2Y2Z A;  4YIF A;  1T38 A;  2I10 A;  4E4H A;  2OCC H;  4M73 A;  4U7D A;  4D5F A;  1KU7 A;  4F92 B;  2I8D A;  1WI3 A;  4JX6 A;  3K4K A;  3OV8 A;  3K70 C;  3EUH A;  2F5F A;  1HDD C;  2WV1 A;  3S2W A;  2L54 A;  3SZP A;  1YJN I;  2NVU B;  3SZT A;  2CH0 A;  2CWE A;  4YFX F;  3K2Z A;  5GAG J;  2IGM A;  2MFZ A;  2CUJ A;  1QVU A;  3KP6 A;  3IC7 A;  2MW8 A;  4RGX A;  1ZHF A;  5HNF A;  3P9K A;  4DIQ A;  2WAF A;  3FDY A;  4BHP A;  4Y3O A;  2Y31 A;  5HOD A;  4U0W A;  3NAU A;  2MAB A;  2V6C A;  3PFY A;  4F93 B;  3SXY A;  3M9A A;  4ENJ A;  2EIN H;  1IN8 A;  1T98 A;  5CVU A;  1ZG5 A;  2DMU A;  1ETO A;  1R5H A;  3GLX A;  2DFH A;  3E6B A;  4EQQ A;  2IS6 A;  1UB9 A;  3LWF A;  3OYK A;  3I54 A;  2G9W A;  2DQL A;  1P92 A;  3KET A;  3CF2 A;  2JA7 J;  2W82 A;  3SHF A;  4A3D J;  5IYD J;  2OU2 A;  2KIQ A;  4ESF A;  5HLT A;  3LL7 A;  1XS9 A;  3KLN A;  3A0B C;  3BZK A;  5DV5 A;  2CV2 A;  2MBF A;  3FXU A;  3ZMS A;  3U21 A;  5LHI A;  2DA6 A;  4JYK A;  5DS9 A;  4V19 K;  3MVP A;  3K4M A;  3DP7 A;  4Q47 A;  2Q1Z B;  1J5Y A;  1TQP A;  5FKL A;  2DJN A;  4NNJ A;  4XLH A;  2HTJ A;  3I56 I;  3MKL A;  3MEX A;  3G1M A;  5K7Z A;  4M71 A;  2HTS A;  3WE2 A;  1PUE E;  3H3V K;  2FRH A;  2LC2 A;  1ZG1 A;  3ROU A;  3M8E A;  4BJT A;  2OD5 A;  3LNQ A;  4O3M A;  2UXN A;  2RQP A;  1W5S A;  4PUS A;  2RKH A;  1B8I A;  1FOW A;  2VKE A;  2F5D A;  2V1U A;  2M8E A;  2DBB A;  3CES A;  3KZY A;  4KJZ A;  1FEX A;  1W0U A;  3WHC A;  2HYJ A;  4L9N A;  4Q48 A;  2CQQ A;  3HGY A;  2DA1 A;  1B8I B;  2OA4 A;  1ZRF A;  2HQR A;  1AA7 A;  3FXK A;  5E1W A;  2NVX J;  1FOY A;  3IUO A;  5LRS A;  3LSR A;  1X1D A;  2WY7 Q;  5KNL A;  2HKO A;  1K4S A;  4GRI A;  4ITV A;  1B6A A;  4LB6 B;  4RLF A;  3ONQ A;  4KNY A;  1ZGJ A;  4KT5 C;  2D5V A;  4QIW N;  3VDX A;  3VSL A;  3O8H A;  3OS0 A;  3FMS A;  1OFC X;  5GAH J;  1UST A;  3HSE A;  3JRA A;  1BI1 A;  3MD2 A;  2EPF A;  3WU1 B;  1I27 A;  2HOA A;  3ABL H;  1WQ2 A;  1JTY A;  1SD4 A;  5JFR A;  3E1S A;  3WTZ A;  3FHZ A;  4WX9 A;  4QLC U;  2X4H A;  2Z9O A;  1X2N A;  2VE9 A;  3CDI A;  2ETH A;  2V79 A;  3J80 K;  1FX7 A;  1MND A;  3GTJ J;  4Y13 A;  1WH7 A;  2BV6 A;  2BY1 A;  3MKZ A;  3KEY A;  2VKV A;  1QA6 A;  2X1C A;  3A4C A;  4D9J A;  3FIW A;  3LSK A;  2PI0 A;  1W1W E;  3TW6 A;  5J3L A;  4XNF A;  4QWQ A;  1QZE A;  2M0M A;  4FHT A;  1TL8 A;  4Z2Y A;  1FMW A;  1U3E M;  5IPA A;  1S3J A;  4YII A;  1O57 A;  1SD7 A;  4V2G A;  2BE5 F;  5JR3 A;  2JT1 A;  4A5N A;  2JTV A;  1OR7 C;  1TNT A;  3P7N A;  5IT3 A;  3E5Q A;  3JRE A;  1WPK A;  3ZXS A;  5E20 A;  3F8F A;  3BZ6 A;  3G1O A;  3G6E I;  1MNE A;  2COM A;  3KPH A;  1W5C C;  1JKP C;  1XGN A;  2EJR A;  2K3F A;  2M45 A;  2Z16 A;  4Q5S F;  2JSC A;  2NAZ A;  4EJT A;  5F6F A;  4B48 A;  2QA4 I;  4BXF A;  3CO7 C;  3K1N A;  4G7Z F;  4AYB N;  2Y0S N;  4CCK A;  3LA2 A;  2ZME A;  3H5R A;  2UZK A;  2E5Z A;  2ZFU A;  3TMO A;  3K70 D;  4M9X A;  4XRS G;  2BXY A;  2CUF A;  2HYF A;  1JJ8 C;  1IO2 A;  4ZC3 A;  4P9F A;  4AD9 A;  5LEK A;  2GZW A;  1VQ4 I;  2XAG A;  1OIS A;  4XKC A;  2M1B A;  2ZME B;  2FE3 A;  4BQA A;  1FIA A;  2FBH A;  2LK2 A;  3B02 A;  3FM3 A;  3IH3 A;  3L2Q A;  4M6V A;  3FM5 A;  2ZXH A;  4CCO A;  2DI3 A;  4X1E A;  4KFC A;  1GVJ A;  2DDA A;  2R92 J;  2R5Z A;  3F72 A;  2ZSI B;  3CCR I;  1RR8 C;  4BNC A;  5FRN A;  1ZLJ A;  2KHM A;  1WGX A;  2HR3 A;  5DCM A;  3WU2 C;  2XPV A;  2HYG D;  3OL4 A;  2W1O A;  3CUQ A;  3VYS B;  1K79 A;  1ETV A;  3GTL J;  3U1K A;  2K85 A;  4RAG A;  2VL8 A;  4CA0 A;  2CV0 A;  2B0L A;  1ETY A;  1O3T A;  2VOP A;  2DDB A;  3H0G J;  3I64 A;  3GFI A;  1GT0 C;  5FKO A;  1K7A A;  2C6Y A;  2XKO A;  3JTH A;  3FXR A;  4RLQ A;  2Q8K A;  3F8N A;  2R5Z B;  4ANJ A;  4S04 A;  4WCG A;  3QAH A;  1IN7 A;  4AID A;  3IWF A;  1HCR A;  2G7U A;  5DCM B;  4DNC A;  1FNN A;  1ON1 A;  3F22 A;  3CUQ B;  1I6H J;  4L9T A;  3EUA A;  2EIJ H;  1BM9 A;  5J4V A;  3WTT C;  1HST A;  4HSR A;  3E5X A;  4ENM A;  4Y7N J;  3RTR A;  2P81 A;  1G8X A;  2EV5 A;  2HVQ A;  2W00 A;  3A0H C;  3BTJ A;  3HOY J;  1ZAO A;  3RJP A;  1WKM A;  3QPS A;  1GHC A;  1GXP A;  2P0W A;  2A6H F;  1G3T A;  2K7L A;  1ZGW A;  4HX7 A;  2EZH A;  1O4X A;  2HZD A;  2ME0 A;  2Y0S A;  4AYB A;  4YRV A;  1K61 A;  3DEU A;  2MD5 A;  4LFU A;  1HA8 A;  1G59 A;  3ZQI A;  1J59 A;  4BE1 A;  1MBK A;  1YS7 A;  1YIJ I;  5E1Z B;  2GBY A;  2YS9 A;  3E6D A;  2ZBK A;  1IGN A;  3WTX C;  3S8P A;  2QQ9 A;  5C44 J;  1EH8 A;  3K4J A;  4LIT A;  3H9Q A;  2WV0 A;  5JLX A;  2CMP A;  3BR6 A;  5E17 F;  4L5I A;  1BBY A;  1R00 A;  3KYD B;  3OYJ A;  4ESJ A;  3UNG C;  2R7U A;  3SFZ A;  4IHY A;  4DYQ A;  2DN0 A;  3JR9 A;  1XSD A;  3BDD A;  3GTO J;  1RUO A;  4XRM A;  1AWC A;  3QYB A;  4XLE A;  1Z0X A;  3HRM A;  1IUY A;  1S8N A;  3I9V 2;  4IQ4 A;  5AIP A;  3GZN B;  4XON A;  4DQ2 A;  4Q4Z F;  3RQ4 A;  1HLV A;  2PMH A;  1FYM A;  1O3S A;  2LDU A;  4DOZ A;  2K86 A;  3TOA A;  2R93 J;  2HS5 A;  2LLK A;  2XGC A;  1HKT A;  1U6G A;  4ZDP A;  2ADU A;  1Z05 A;  3CC7 I;  1W36 C;  4BQN A;  1DUX C;  2JN6 A;  4A3K J;  5F27 A;  3CCQ I;  1YW9 A;  3OYF A;  2GIZ A;  5F1R A;  3HHH A;  3OL3 A;  4LK1 F;  3CC4 I;  2MC4 A;  1DPR A;  3TGN A;  2J5O A;  4C30 A;  4HNV A;  2H1K A;  2OUM A;  3CCE I;  1UZC A;  2RN7 A;  3O3K A;  4XIC A;  1R1V A;  1P4X A;  3WHB A;  3I5U A;  4HOB A;  3CLO A;  2DFI A;  1USS A;  1Z21 A;  2XF6 A;  5L3D A;  1HW1 A;  2EH3 A;  1TWC J;  2NS0 A;  3JRC A;  4ZTF A;  3FIS A;  2DJI A;  2F5E A;  3IRR A;  2RV8 A;  2ESN A;  2K9M A;  3B73 A;  4XLN F;  3FZV A;  4ESB A;  1DU0 A;  1HC8 A;  1R5I D;  1S72 I;  1VQP I;  3MQ0 A;  3LST A;  1JGS A;  4FE7 A;  5EGO A;  3HTS B;  2R0Q C;  5ICG A;  2WB1 A;  3OOU A;  4A5M A;  3D5R C;  4OIO F;  2A61 A;  1ZTR A;  2W85 A;  1FZP B;  1R1T A;  5CJ9 A;  5BS6 A;  1I6X A;  4GCV A;  1FMV A;  3WG9 A;  4BXX J;  2W57 A;  4AIH A;  1VQ9 I;  3VYT B;  1XCB A;  4IPA A;  3W3C A;  4XSZ F;  2CW7 A;  2L9S A;  4DW6 A;  5IT9 Z;  5EGO B;  4A3F J;  3PSI A;  3HKZ A;  2KRH A;  2NVQ J;  2E36 A;  1S7E A;  1MJA A;  3DXJ F;  4G8X A;  1U5T C;  3JRG A;  3I71 A;  2O8K A;  3FMR A;  2HWV A;  3LSH A;  1ZR2 A;  4PJM A;  1J9I A;  1MBH A;  1J75 A;  2XAU A;  1ZK8 A;  3GME A;  1O7L A;  2X6X A;  2VN2 A;  5FKN A;  3QPH A;  3ZMT A;  2JRM A;  3CJQ B;  1MSE C;  2WC2 A;  1LDK B;  2HNH A;  2L7F P;  1ZR4 A;  5KAF C;  2E2J J;  3BR1 A;  3LA3 A;  2EK5 A;  2CSO A;  3X2Q H;  2E7W A;  4MQV A;  2B9S A;  2CS3 A;  3ABU A;  5K5O A;  2VQC A;  5M3M J;  4A6E A;  1B72 A;  3K4C A;  4ENK A;  2BW3 A;  1A36 A;  3GCM A;  1TWG J;  2P8T A;  4B1R A;  3T0Y A;  4AWX B;  2LRD A;  3ZQF A;  3WU0 A;  3C3W A;  4XLP F;  3J7Z I;  1XG1 A;  2K27 A;  3BWG A;  1XGM A;  2DOD A;  2VAS A;  3LSG A;  1T6S A;  2FUG 2;  3PQK A;  2P7V B;  3LSP A;  1B72 B;  2BW3 B;  5DYM A;  3WOD F;  1S7O A;  1EF4 A;  4HV6 A;  2VKH A;  4E7S A;  2JUC A;  3CCM I;  2OZU A;  5JI6 A;  1ITY A;  2LTP A;  2GA2 A;  4F55 A;  3ASO H;  2VJI A;  2F4I A;  3RYP A;  2XC7 A;  2P5L C;  3EUH C;  3QOE A;  5CLS A;  2HKX A;  1X1C A;  3C2B A;  2OQG A;  4ZDL A;  1X1P A;  5FGM A;  1OCP A;  1BOA A;  4GXO A;  3BTL A;  4XOT A;  1HOM A;  3VEP A;  1A5J A;  1GUU A;  5ILU A;  1RIO H;  1V5F A;  2XGX A;  4RAZ A;  1R49 A;  3BG5 A;  2VOO A;  4ZYE A;  1P4A A;  4HX4 A;  2K9L A;  1REP C;  2K9S A;  3JW4 A;  1X3U A;  2BY3 A;  2JWT A;  3OIP A;  4UVC A;  5GPC A;  1GDT A;  4DZP A;  3W6V A;  1YJ9 I;  4KMF A;  5GPA A;  3H0D A;  2TRT A;  5CYV A;  2VPR A;  3W6J B;  1BOB A;  5LHH A;  2DA2 A;  4IZZ A;  3HGG A;  1J09 A;  3KP5 A;  2MH2 A;  3TOB A;  2NOJ B;  1RRJ A;  3PO2 J;  1APL C;  4ZDO A;  3F6V A;  1M1E B;  2O03 A;  5CQE A;  5ERI A;  1W36 D;  4F7Z A;  2FQ4 A;  2PMZ A;  2NNY A;  1JJ6 C;  2HQA A;  2LOO A;  2VJJ A;  2QKM B;  4RBO A;  2ELJ A;  2DK5 A;  4A3C J;  1T2K A;  4MFD A;  3KYL A;  2IPQ X;  3ZOB A;  4RAY A;  3BQY A;  3BR2 A;  2CG4 A;  2R7W A;  4O5V A;  5LLQ A;  4XKV A;  4PZJ A;  5H6Q A;  3F8B A;  1RR7 A;  4GFB A;  2NXN B;  2VXD A;  3RKX A;  5K7H A;  3V4G A;  4RGR A;  4HDU A;  3K6G A;  5ICC A;  2OF7 A;  5HDG A;  1WJB A;  2KLO A;  1RUN A;  4CDG A;  1IRG A;  4FX4 A;  2L01 A;  4S05 A;  2ACJ A;  2LY9 A;  3V7C A;  5B3S H;  2DMP A;  1BN5 A;  3F6O A;  2O61 A;  4I01 A;  2DO7 A;  3O8G A;  3Q0V A;  2EZI A;  4UY8 I;  1RPW A;  1IG7 A;  1G4D A;  2BZT A;  2JA8 J;  4AM3 A;  4W1U A;  1I3A A;  4ZYG A;  3H36 A;  5F1J A;  1F43 A;  4I09 A;  2QKL B;  4A3M J;  1NK2 P;  1LVA A;  4LIV A;  1I50 J;  1NH3 A;  1ZN2 A;  3DBL B;  2XSJ C;  2R7Q A;  5L3E A;  3WTY C;  1OYI A;  2Y48 A;  3L7W A;  2DT6 A;  4G12 A;  4S0H B;  4ZZL A;  2YPR A;  1MMS A;  1D1C A;  2HXO A;  3SDB A;  3R4K A;  1QGP A;  3BG7 A;  5FRO A;  1R7J A;  5AIQ A;  2VT2 A;  1NG7 A;  2LNB A;  1JI8 A;  2Z33 A;  2HQN A;  1IXR C;  2JUG A;  1EV7 A;  1UHS A;  4PGG A;  3M8F A;  4CSW A;  1WWX A;  4HDV A;  3BPX A;  2KJC A;  3TQN A;  1HDP A;  4IO9 F;  3EET A;  1LEA A;  1D5V A;  3BCA A;  5FO5 A;  5D8K B;  1LFB A;  3FBI B;  4FET A;  4CZC A;  3CCY A;  1VQ5 I;  1OCR H;  2KIM A;  3K4N A;  3KYC B;  1IRX A;  3CP2 A;  1Y1V J;  1C0W A;  3IWZ A;  5KCM A;  2E1M B;  3M3Y J;  4HYE A;  2QSF X;  2O3F A;  3BZC A;  1H9T A;  4RMN A;  1PP8 F;  2IA0 A;  2P5K A;  4LGW A;  3ZQG A;  1GXQ A;  2V9P A;  1QZZ A;  2BOL A;  3L2V A;  2O5R A;  4C3H J;  2IGN A;  2ZXJ A;  3VB2 A;  3LSM A;  2L4A A;  2VQG A;  3M07 A;  3DKW A;  3BJ6 A;  3MZ8 A;  4P55 A;  1I3Q J;  5HS9 A;  4Y52 J;  5D5W B;  2F4M B;  1A35 A;  2A5W A;  3BR0 A;  2K9N A;  1ULY A;  5EYR A;  2H1L A;  1A6I A;  1YX5 A;  3AG2 H;  2BY0 A;  3TED A;  2MG4 A;  1ZH5 A;  1R22 A;  4EJV A;  3CO6 C;  1TT5 B;  4HRI A;  5B66 C;  3OYC A;  3REO A;  3HPH A;  1YO5 C;  3DV8 A;  1R9T J;  2QEX I;  4G6T B;  2HEO A;  3W2A A;  4HZF A;  1T0F A;  3A1Y A;  1U2W A;  1H88 C;  2QQA A;  1FBU A;  4DJA A;  4IKF A;  2A3S A;  4IRH A;  3K4L A;  4AUX A;  3KZI C;  5J8F A;  3DU6 A;  4I0B A;  1H89 C;  2X6Y A;  3BG6 A;  3CCJ I;  1J2X A;  5H20 A;  3K4B A;  2VBW A;  2UWM A;  4CCJ A;  1N77 A;  1BA5 A;  2E1O A;  1X4P A;  1R23 A;  2V1N A;  2LBF B;  4KIF A;  1N25 A;  4EMS A;  5IT9 K;  3RCO A;  2V6E A;  5CKT A;  1FYL A;  4G6Q A;  2P7C B;  2GXB A;  2KKO A;  3IH4 A;  1IN4 A;  3RZO J;  3B6C A;  4FCY A;  3CP8 A;  2JVH A;  1R36 A;  4KN7 X;  2LY2 A;  4XOR A;  4CO8 A;  3L2C A;  3EYI A;  2VJ4 A;  2DU9 A;  2XAS A;  2M4G A;  4BH9 A;  1QPI A;  2BVL A;  2LSO A;  4AVZ A;  1H8A C;  4E7K A;  2X85 A;  2FJ1 A;  3M1E A;  4QPQ A;  3GUD A;  4MO7 A;  2EZK A;  4LOC A;  5LGU A;  1VI0 A;  2AQE A;  4OIQ F;  1SMY F;  2D1V A;  2XKP A;  2ID3 A;  1MH3 A;  3TBI A;  2XRO A;  2JJ7 A;  5D6F A;  1RZ4 A;  3HM5 A;  3W6K B;  4A3B J;  2NS8 A;  3BPV A;  4BU2 A;  1LNW A;  4F3Q A;  2DFE A;  2OPT A;  3DF8 A;  5E3O A;  1YG2 A;  2QWW A;  1LFP A;  4G94 A;  4U88 A;  3TO9 A;  2WAD A;  1FPQ A;  4Y4R A;  1Y0U A;  4UUS A;  1WJC A;  2F6C A;  4A0X A;  3LFK A;  4EJO A;  1Y39 A;  5J1Y A;  1TT0 A;  3J7Y J;  1SVM A;  2L7M P;  3EQL F;  3Q9S A;  3F8M A;  3S32 A;  4XRF A;  5A2Q Z;  3GVA A;  5HLH A;  1MZB A;  1Y6I A;  3A02 A;  4NB5 A;  2FF4 A;  4B4C A;  1LE8 B;  4ON0 A;  4UUS B;  3VSK A;  2XAJ A;  2IA1 A;  2ZC2 A;  5EEH A;  3HOU J;  4TV7 A;  5LFA A;  3TW7 A;  4CHU A;  3RKW A;  4A3J J;  3DKY A;  5E79 C;  5D5X B;  2EA2 A;  2B7E A;  2ZJ2 A;  4HST A;  1JKQ C;  1UHW A;  1AKH B;  4IVN A;  3ABM H;  4D0P A;  3Q0W A;  4LLL A;  3GZ6 A;  2Z1D A;  3WGH A;  1DGW Y;  2AHQ A;  1J7K A;  4E7H A;  1FJL A;  2QEN A;  2DA5 A;  1LJ9 A;  1MBJ A;  1VQ8 I;  3M1C A;  1OJL A;  1IJW C;  2NNN A;  4BXU A;  1YIO A;  3T5X A;  2I5U A;  2KMU A;  5ILV A;  2E1N A;  3BOQ A;  1V55 H;  3F9K A;  4QSH A;  5DD8 A;  4RA2 A;  4RAF A;  1BR1 A;  1IXS B;  3RPU A;  4EVI A;  4LB5 A;  1HBX G;  3DPL C;  5LD2 C;  2DFF A;  1QQI A;  4UXN A;  3J7A O;  1RES A;  2E7X A;  4BY1 J;  2IW5 A;  3HC7 A;  2ME6 A;  3OY9 A;  2OAZ A;  3L2U A;  2EIL H;  2FSW A;  4D7M A;  1ONV A;  2P5V A;  3KE2 A;  1F9N A;  5HDK A;  3BQZ A;  2IRF G;  3HDD A;  2Z3Y A;  3ZQ7 A;  2QF7 A;  5LHG A;  5TRD A;  5K1Y A;  2VJ5 A;  3N4M A;  3QWL A;  4M3F A;  3GTP J;  5J40 A;  1JT6 A;  3ZQQ A;  1Y1W J;  4DBQ A;  3RIR A;  4UNO A;  1KU3 A;  2A68 F;  1S5L C;  4A0Y A;  1DP3 A;  2DPU A;  1O7F A;  1LDJ A;  3RKY A;  2MLG A;  2M8G X;  3TKY A;  3DLL F;  2NYX A;  2A6T A;  2CJJ A;  1MMN A;  2MLK A;  1KYW A;  3GLL A;  5D5V B;  3N97 A;  4EV0 A;  5DM7 F;  3HTU A;  1U78 A;  5C4X J;  1GV2 A;  2R7D A;  2JRT A;  1IN6 A;  5JLW A;  3OYG A;  2DCE A;  2IGO A;  1XD7 A;  4BBS J;  1MBG A;  3HG9 A;  4M3B A;  3WTV C;  2R7Z J;  4EJU A;  4X0G A;  2MC3 A;  3HYI A;  3PM1 A;  4RM3 A;  4ASN A;  5FLM J;  2IGK A;  4IHS A;  1YHQ I;  2W7N A;  1EH7 A;  3HB9 A;  3DPU A;  1YIT I;  5CPR B;  3V7S A;  5IOY A;  3S14 J;  3CUO A;  4CYC A;  3CME I;  2YSR A;  2XF5 A;  1D8J A;  4M6X A;  2CRG A;  1W7P D;  1MKM A;  3FMQ A;  3CJN A;  2KP6 A;  3TDZ C;  1FOX A;  3JCU C;  5EEA A;  5FKM A;  2D45 A;  2HZT A;  4JQF A;  2RGV A;  4G7O F;  2VC0 A;  3S93 A;  1QHG A;  3Q0U A;  2OC6 A;  2TCT A;  3H5N A;  1K78 A;  4CYC B;  1BI0 A;  3FXM A;  1TC3 C;  5DDG A;  1MJB A;  3S2H J;  1EH6 A;  2W48 A;  1LDD A;  2ZSH B;  1CF7 A;  2HGC A;  1VQM I;  1ACI A;  1ERD A;  3Q5F A;  2R4G A;  4HF1 A;  3HSR A;  4PSW A;  3W2W A;  1R58 A;  2YU3 A;  1JHH A;  1R5G A;  2HQ5 A;  4I99 C;  4BHC A;  1P7I A;  2KFD A;  3DTI A;  1K78 B;  1B4A A;  3FWE A;  3ZN0 A;  3AAF A;  2GLO A;  1ZRE A;  1FWZ A;  2XV4 S;  3K10 A;  4WXD A;  1CF7 B;  1YI2 I;  1DPU A;  1SAU A;  3ERE D;  1ZKG A;  4CZZ A;  1IV6 A;  1BJZ A;  5M5W J;  2F4O B;  4KIC A;  3E7L A;  2CUZ A;  4XRS A;  1MBE A;  3CTA A;  1OCT C;  2F5C A;  2LMD A;  4HV5 A;  5EJC A;  3GO5 A;  4YFN F;  3FXO A;  4B47 A;  1U9O A;  4OAZ A;  4M9Z A;  3AL0 C;  2FMY A;  1D8K A;  2L0K A;  2QQB A;  1UEL B;  5DEQ A;  3HOV J;  1V54 H;  4HBL A;  4BAY A;  1TTY A;  1BW6 A;  4BJ6 C;  4FIS A;  2F5V A;  2VPL A;  4P5O A;  1Z9C A;  4D7N A;  1SFU A;  3HXL A;  1SFE A;  3GBG A;  4UUV A;  3WTS C;  4O6J A;  3GYH X;  2LD5 A;  4JBA A;  3AG3 H;  1Z7U A;  4M72 A;  3OYL A;  2PG4 A;  2E34 A;  2HFH A;  3HL2 A;  4WK8 F;  3QYE A;  3C7J A;  2IVM A;  2UV1 A;  1V5E A;  4LG0 A;  5ICE A;  2VI6 A;  4XOP A;  3MFK A;  4J01 A;  2L5Q A;  2OJE D;  1HW2 A;  3BTC A;  2IEK A;  3R0A A;  4IEJ A;  4PDK A;  4PFP A;  4BKX A;  1BL0 A;  1NK3 P;  3PIP F;  3FK6 A;  1XTA A;  2OQR A;  3DWL E;  2FOK A;  3I53 A;  4II3 A;  5EDN A;  3UKG A;  1K83 J;  2RRE A;  1VND A;  1ZLK A;  3CZ6 A;  1JUP A;  3PL8 A;  3QOD A;  5BOX A;  4HA8 A;  3OS2 A;  4N4N B;  4LG0 B;  1BR2 A;  2XDV A;  1K6O A;  1FOK A;  2ELK A;  4FTH A;  5DUK A;  1JKR C;  3SZG A;  3BCB A;  3ASN H;  1YOV B;  3SEQ A;  2Q0O A;  1O3R A;  4WF2 A;  5CVV A;  1TWH J;  2EIM H;  2HVS A;  4IOC F;  2CW8 A;  1JHF A;  2R5Y A;  4IOA F;  5KVR A;  5J4Y A;  1YFH A;  2L9N A;  1XCV A;  3NAR A;  4BQQ A;  2TDX A;  2JQ7 A;  3F23 A;  2DOE A;  5F0H A;  4N9I A;  1TP4 A;  1TWF J;  2K4B A;  4L5E A;  1DGR M;  2XB0 X;  2CQ7 A;  2JVG A;  2X0L A;  2LH9 A;  2LVS A;  4G7H F;  1XMK A;  2HOS A;  3HHG A;  1JKO C;  3LSJ A;  2R5Y B;  5DCF A;  1OR7 A;  1HSJ A;  5J8C A;  2CYY A;  2DTZ A;  4XM3 A;  4BYY A;  4EJW A;  3RQI A;  1KQ0 A;  3KP4 A;  3LQR A;  4GYI A;  3PNT A;  1KA8 A;  5CQG A;  4BL0 B;  4F52 A;  4BHB A;  1WCM J;  3H5A A;  3MN2 A;  4M74 A;  3CMY A;  1BIA A;  3F8C A;  3EUK L;  1X4O A;  4BE0 A;  3S2D J;  2YU9 J;  3I59 A;  1T95 A;  4NC7 A;  5DUI A;  1Y0N A;  3FBN B;  5A2Q K;  3K69 A;  4LLN A;  2KDZ A;  1XGO A;  1SVL A;  1YW8 A;  3PSF A;  3VWB A;  4BDY A;  2VT3 A;  3CLQ A;  3F3X A;  2P6S A;  1PUF A;  4MGR A;  3S3M A;  3TDU C;  3DQV C;  1XN7 A;  2V9K A;  3FK7 A;  5FD5 A;  3I59 B;  2VXZ A;  4XL9 A;  3A01 B;  2FNA A;  4HW0 A;  3PJR A;  4K2E A;  4LIU A;  3IAS 2;  2R7O A;  5J6X A;  2PLY A;  1QNT A;  3GXO A;  2XIG A;  4OU0 A;  4NHJ A;  5GTH C;  4MQ9 F;  1PUF B;  1AU7 A;  4CCL A;  3IH2 A;  4BDZ A;  2OV7 A;  4LG3 A;  1V4R A;  3KFW X;  4OAY A;  4IHX A;  1TQM A;  4L9V A;  2K5C A;  5ICF A;  4EGY A;  2YUS A;  4RGU A;  5E3L A;  4A3G J;  3V8J A;  2IS1 A;  2HDD A;  1WRJ A;  5FFX A;  4KMU X;  2VKD A;  4BUP A;  1JT0 A;  2A5Y B;  1LQ1 A;  4A3L J;  1OYY A;  1XSV A;  2FD5 A;  2XB5 A;  3H9J A;  2R3S A;  1TWA J;  2KZG A;  5LBQ A;  1D1A A;  2DW4 A;  3V8L A;  4I2O A;  2KRC A;  4B09 A;  3S1Q J;  5FB2 A;  3D0S A;  3V42 A;  2R7F A;  3ZR8 X;  4MFE A;  1EJ9 A;  1R4M B;  2HDW A;  2HI3 A;  4JP0 A;  1UAA A;  2AQF A;  5TIS C;  1KYZ A;  3H9G A;  3G71 I;  2WAQ N;  1UG0 A;  3TL4 X;  3QP5 A;  1K6Y A;  3H3Z A;  4XLC A;  1UHM A;  2M2E A;  3BRO A;  2EZL A;  5E8I A;  2JPB A;  4ZYA A;  1I39 A;  1YYV A;  3W2V A;  1SD6 A;  3WTW C;  2W84 A;  3RDI A;  2EV6 A;  3OYE A;  1FIP A;  1TLH B;  4ENN A;  4GDF A;  1XDS A;  4ETS A;  1WJA A;  4M3E A;  3HOW J;  1MMG A;  3E3V A;  2M7A A;  3KP7 A;  2DMQ A;  2H8W A;  1OCZ H;  3O6B B;  3GFM A;  3K0L A;  5LGT A;  1D0Y A;  4ZYD A;  3COA C;  3MWM A;  5CVJ A;  2ZO4 A;  4R1H A;  1FTT A;  3SYT A;  3JRB A;  3BJA A;  2GQQ A;  2JZY A;  5EF6 A;  1F1Z A;  3TP0 A;  1ETQ A;  4F91 B;  3D1N I;  1LB2 A;  2EB7 A;  3ML6 A;  1WSU A;  4XID A;  1IAW A;  2LYC A;  1MIJ A;  3K2A A;  3IV5 A;  4IHT A;  3ECO A;  2E2I J;  5E3M A;  3DFG A;  4MTE A;  3MKW B;  2ZXW H;  4YG2 F;  3J81 Z;  1QRY A;  1RNL A;  1P6R A;  4CYD A;  1Q1V A;  5F04 A;  2HOE A;  4YEJ A;  2LKX A;  3S15 J;  1FP1 D;  4EGZ A;  3AG1 H;  3EDP A;  2VE8 A;  1CGP A;  2E5N A;  5GAE J;  1R6R A;  5IP6 A;  4YIR X;  1FYK A;  1TBX A;  2X1E A;  1YLF A;  2D2W A;  1EKE A;  3OWT A;  3CF5 F;  3KLO A;  3JRF A;  2FBI A;  2A69 F;  5E3N A;  1KGS A;  2KIS A;  2X9D A;  1E17 A;  3ZQL A;  2UXX A;  1BI3 A;  5D6E A;  4J00 A;  2M5W A;  3NWS A;  4P1W A;  4XK4 A;  3OMY A;  2AS5 F;  2M0C A;  1Q1H A;  1XX5 A;  2M3A A;  2GXG A;  3SEZ A;  1FT9 A;  1GLN A;  2K02 A;  4LJZ F;  2M34 A;  1HQC A;  2DAO A;  1G3Y A;  1TW3 A;  5HLI A;  4II2 A;  1KON A;  2EIK H;  2P6T A;  1Z67 A;  3ERM A;  2JSP A;  3BLY A;  1Z7L A;  2NRA C;  2J5P A;  5H2F C;  4RDU A;  1LUJ B;  4RS8 A;  1Z3Y A;  1YRN A;  1FTZ A;  4XLA A;  2PJP A;  3RSN A;  2DXI A;  3FKJ A;  3GWZ A;  3CJR B;  2ISY A;  3JTG A;  4GO1 A;  4HG2 A;  3MKY B;  2N8G A;  3C2H A;  3OS1 A;  2DPD A;  2JA5 J;  3R6S A;  5B5E C;  4XLF A;  2CFX A;  4A3I J;  1AHD P;  2E1C A;  2DTR A;  4V2F A;  1FLI A;  2ZB9 A;  3R0J A;  1YRN B;  3S3O A;  2VON A;  3GEZ A;  3L2R A;  3BG9 A;  3NEU A;  4HF0 A;  1XPX A;  4AIK A;  4BQO A;  2PEX A;  1E2X A;  4EM2 A;  3OYA A;  1Z77 A;  1LVK A;  1ZGA A;  3U1D A;  4MEX F;  1U5T A;  2IXS A;  3D5S C;  3HJE A;  2QYO A;  4I7H A;  5BNG A;  4BJ5 C;  4JX4 A;  2KIF A;  3ULQ B;  2L02 A;  1G3W A;  2X1D A;  2DA3 A;  2E19 A;  4YEL A;  4PCQ A;  1QO0 D;  1DP7 P;  4KIB A;  1LFU P;  5FLX K;  4AIJ A;  3MAJ A;  1U8B A;  3ZQH A;  1IZ1 A;  1IDZ A;  3T8R A;  1U5T B;  2XVC A;  5L3F A;  2HOT A;  4WXH A;  4ZJZ A;  5K5R A;  2LRE A;  2WAE A;  4ZZD A;  2PJR A;  2BVM A;  4XN0 A;  1KQ9 A;  3HPG A;  3K1P A;  5DM6 F;  3K1M A;  3UR3 C;  1ENH A;  2YX7 A;  2G0E A;  5D4R A;  2ZME C;  2CFO A;  1VF9 A;  2VUM J;  1Z1D A;  1ZAR A;  1G3S A;  1W5T A;  1SFX A;  3KZZ A;  2WWY A;  1SFO J;  2GAU A;  2LR8 A;  3HSF A;  1RC9 A;  2MH9 A;  2PJR B;  3NWT A;  3TO7 A;  3FXJ A;  3BP8 A;  5M5Y J;  4A2U A;  1NTC A;  4KA4 A;  1ETW A;  3H3U A;  4HPQ A;  1ZRD A;  4B8X A;  1ZEL A;  1OMI A;  2K4J A;  3P9I A;  3JRI A;  3LSI A;  3OSG A;  2LBF A;  2IBD A;  1ZYR F;  4DZJ A;  2VQH A;  1LPQ A;  4NBQ A;  2RDP A;  3SQN A;  2FNP A;  3DEW A;  3KIO A;  3RI4 A;  1WH5 A;  2X6O A;  1YX3 A;  2GXA A;  3CUQ C;  3PQJ A;  5FFZ A;  1G6N A;  4X6A J;  1T56 A;  2BYV E;  4J19 A;  5BPD A;  2OTL I;  2R7T A;  3L9F A;  2DOA A;  3IP4 B;  3CQZ J;  4P9U A;  4B43 A;  2KT0 A;  1ETX A;  4I98 B;  2NOG A;  5HOO A;  2EFW A;  1SMT A;  2R7X A;  1PYV A;  5KK1 A;  1IW7 F;  4CIC A;  1UG2 A;  1LKX A;  1P2F A;  5JVT A;  3HOZ J;  1DDN A;  5J1R A;  4HF2 A;  2XHK A;  2PN6 A;  2NS7 A;  1RI7 A;  3DEE A;  1SEU A;  5BPI A;  4PJN A;  4KUM A;  2R7V A;  1MW7 A;  5ED4 A;  4JK1 X;  4L0Z B;  1NG6 A;  3G1L A;  2LF8 A;  2Y9Y A;  1VQ7 I;  3OYM A;  4IXA A;  3LQQ A;  2XPW A;  1GVD A;  2EQR A;  5DD4 A;  5KAI C;  3DLA A;  4HNU A;  2DT7 B;  4IF4 A;  1BI2 A;  2M7B A;  3P9C A;  5IYC J;  3SJM A;  1E0E A;  1JGG A;  4U7B A;  4XR6 A;  1A6Q A;  4BBR J;  5J47 A;  1LE8 A;  3PUB A;  5JHF A;  4CGZ A;  3CMA I;  2AXT C;  4JOM A;  2O6G E;  2CGP A;  2B63 J;  3SDG A;  2IJL A;  4I0A A;  4LK0 F;  3GZ5 A;  3PNY A;  2M9H A;  4U87 A;  3FHN A;  2RNG A;  2H94 A;  3U9G A;  2QSG X;  1AKH A;  3KCC A;  2AXL A;  1MGT A;  3G2B A;  3ESW B;  3M7G A;  5HDN A;  2AO9 A;  2XF7 A;  3BR5 A;  1XMX A;  5FJ8 J;  1ORK A;  3OYN A;  4DGW B;  3ISP A;  2H09 A;  1OCC H;  3I0T A;  3FKI J;  2LKP A;  4BS9 A;  5F08 A;  3DU5 A;  3L2W A;  3ZMD A;  3DBR B;  2Q2E A;  2EFQ A;  2KZV A;  2MD0 A;  3E6M A;  2V4J C;  4BY7 J;  2HPM A;  3GFL A;  2VB6 A;  4CUG A;  1X3W B;  1WFX A;  3E97 A;  4Y17 A;  4MHG A;  1DU6 A;  1VTN C;  1B9M A;  1Z91 A;  5BMZ A;  3QU6 A;  2GOM A;  1W4M A;  2E2H J;  2Q2E B;  4H4K C;  2JMW A;  1UMQ A;  5E1X A;  3H1C A;  2CU7 A;  1JXS A;  1POG A;  3RPU D;  5IP7 J;  2OZ6 A;  4KYW A;  1PJR A;  4CH7 A;  3GTM J;  3EPZ A;  2QM3 A;  3I4N J;  1OLT A;  4MTD A;  3MZY A;  1S6L A;  1PP7 U;  4IJA A;  3JSP A;  1PVE A;  1QHH D;  1Y8R B;  3JRD A;  1VZ0 A;  2QVO A;  4I76 A;  1AOY A;  2W25 A;  1WJ5 A;  4U0V A;  4HAM A;  3M4O J;  4HNT A;  3S1N J;  4N9H A;  2QBY A;  2MSY A;  1RKT A;  2Y75 A;  2XRN A;  4UB8 C;  1MNM C;  2X51 A;  2M4K A;  2QGU A;  2ZCW A;  3U2R A;  1FY7 A;  1XSX A;  3J81 K;  4PK4 A;  3H35 A;  3CC2 I;  1G2H A;  2Y30 A;  3DTK A;  3T8T A;  5GP9 A;  5FRM A;  4A69 C;  2EFO A;  4Y15 A;  3E5U A;  2QBY B;  1W0T A;  1X3Z B;  2L9V A;  1KZH A;  1OQY A;  3DKX A;  5L3G A;  1H9G A;  2FA5 A;  3VOE A;  3V8K A;  3S1R J;  1HF0 A;  2BEO A;  3KP3 A;  1ETK A;  1L0O C;  2XUB A;  3A03 A;  4E7L A;  4G9Y A;  5FLV A;  3AKZ A;  3FXL A;  5F64 A;  5C3E J;  3G4S I;  1TW2 A;  2CW0 F;  2MA3 A;  1VQ6 I;  1WJE A;  3TO6 A;  4E7J A;  1R1U A;  2O8X A;  1BIB A;  1D3Y A;  5KHD A;  4R8H A;  2M87 A;  4UB6 C;  2Z5U A;  4OMY A;  1CQT A;  4EEF G;  4CXF A;  1IRF A;  1JTX A;  3MMY B;  4UV9 A;  1ON2 A;  1F4K A;  3PFI A;  3H92 A;  4ZTJ A;  2DT5 A;  3N05 A;  2KQR A;  1RET A;  3HRT A;  2L4M A;  3QQA A;  4PFO A;  3NRV A;  2BY2 A;  2K40 A;  2WY8 Q;  5D4S A;  1K4T A;  2HVR A;  2IP2 A;  2KDO A;  2XPU A;  2L2O A;  4IQJ A;  2X6W A;  2EA4 A;  2L7K A;  2FML A;  3E0J B;  5D5U B;  2EV0 A;  2FQ3 A;  1OKR A;  2YX4 A;  5C4J J;  5LEJ A;  3CJT B;  3MCZ A;  2FOW A;  5AON A;  4RB3 C;  1SD5 A;  2PMU A;  4IX7 A;  1X2M A;  2JA6 J;  2LF7 A;  2RAE A;  3LMM A;  1FSE A;  1W7P A;  1UCR A;  2E35 A;  3LOC A;  4R79 A;  1UFM A;  3ZP5 A;  3OOP A;  4D5C A;  1EA3 A;  2QZ8 A;  1X19 A;  5EZH A;  3HRU A;  2BGC A;  2BHZ A;  4I02 A;  1YTY A;  3DPT A;  3JAM K;  4UVB A;  5ILS A;  4AC0 A;  4L9J A;  4CCN A;  3QRF F;  1HKQ A;  4W97 A;  3HRS A;  4A12 A;  4UV8 A;  1S9H A;  1W7P B;  5TGT A;  3QPL A;  1XC5 A;  4E70 A;  2A05 A;  5JHU A;  5LRR A;  5IYB J;  2BHY A;  3A2K A;  4XSX F;  1MDM A;  3BC8 A;  4G6D A;  2FU4 A;  1YQA A;  5CVI A;  2Y0M A;  2M30 A;  3KEQ A;  3R60 A;  4M9S A;  2A07 F;  4FT8 A;  3T1B A;  3C2G A;  1X1A A;  3OR2 C;  3HEF A;  2DOF A;  3PIO F;  2ZNZ A;  3L00 A;  3AG4 H;  2K3P A;  4FX0 A;  3FXQ A;  2F48 A;  2DMT A;  3ZQC A;  3CD6 I;  2R7R A;  1MDM B;  1VFC A;  3OIO A;  4NUB A;  2WB1 N;  1Z3X A;  5F0C A;  2VLA A;  2ZFW A;  4RB2 C;  5L3B A;  4I6Z A;  3F21 A;  2H6B A;  1V3F A;  3AFH A;  4C9Y A;  5HLG A;  5HS7 A;  2XGE A;  2H6C A;  3ZRG A;  4HQE A;  1WJF A;  2GWR A;  1OYW A;  3VFZ A;  1TQI A;  2KIU A;  5FLX Z;  3GTQ J;  4P96 A;  2RVC A;  3D5L A;  3HKZ N;  2A6E F;  3LAP A;  5B1A H;  2ESH A;  4WWC A;  4BEH A;  3HUG A;  3TP3 A;  2COB A;  3JSO A;  1E3H A;  2HU9 A;  5FKK A;  3RPQ A;  1S29 A;  9ANT A;  3ABK H;  5EZG A;  2R7S A;  1SC7 A;  3BT9 A;  3RKQ A;  2XGD A;  3HZJ A;  3I3L A;  1MMD A;  3LA7 A;  2L3D A;  3NQO A;  3I58 A;  3ZCO A;  5GAD J;  3CCS I;  1QBJ A;  2RC4 A;  1WVR A;  2JPC A;  1MD0 A;  1D5Y A;  4RB0 A;  2CQX A;  4KIS A;  4BEH B;  3HUG B;  5HS8 A;  2CQK A;  3QPT A;  1OCO H;  4QPO A;  3WG7 H;  3QU3 A;  3ZMU A;  1VQO I;  3GW2 A;  3DCF A;  5IY5 H;  4A3E J;  3S16 J;  4LMY A;  3PNV A;  4CCM A;  4RGS A;  3CCL I;  4HLY A;  2PX9 A;  3I4M J;  1IF1 A;  2XSD C;  1YS6 A;  4NC6 A;  4IL6 C;  2QLZ A;  2V1D A;  5D8L B;  1Z6R A;  4BGD A;  4BE2 A;  3CCU I;  3WGI A;  2EFN A;  5DTD A;  1PDN C;  3GX4 X;  4KIT B;  2BBY A;  1U9N A;  1WI9 A;  2DK8 A;  4M3G A;  2KL4 A;  4N4O B;  3L09 A;  1GV5 A;  4H0E A;  2LFB A;  2VQL A;  2ZJR F;  5LGN A;  2FBK A;  1Y8Q B;  4UUT A;  1TZL A;  2RQQ A;  3A01 A;  2VOD A;  4U0Y A;  4WXC A;  1HW5 A;  2MYS A;  1FBQ A;  4IHW A;  4L18 B;  2Y9Z A;  3BY6 A;  3R61 A;  4A0Z A;  4FQG A;  4PSX A;  2DA4 A;  2EFP A;  2E1M C;  2PBI A;  5EEG A;  4KN4 X;  1JE8 A;  1FBS A;  4AU7 A;  1IC8 A;  1HKS A;  5JVG F;  1T33 A;  4XBF A;  2XAQ A;  2FXA A;  3P5J A;  3OYD A;  1WJD A;  2ZJP F; 
#chains in the Genus database with same CATH homology
 2OPT A;  5E3O A;  1HCR A;  2K9Q A;  1E3O C;  3GTG J;  2FX0 A;  4RDU A;  1I6H J;  4UUS A;  2CUE A;  1QVT A;  1YRN A;  1FTZ A;  1IDY A;  5J1Y A;  4Y7N J;  2L7M P;  2P81 A;  3S1M J;  2GM4 A;  3L1P A;  2N8G A;  3BTJ A;  3OSF A;  3HOY J;  3A02 A;  2JA5 J;  4B4C A;  5K7F A;  1LE8 B;  1AHD P;  4A3I J;  1BW5 A;  4V2F A;  4UUS B;  2ZB9 A;  3QPS A;  1YRN B;  3HOU J;  4IHV A;  2PMZ N;  3B6A A;  3TW7 A;  3BG9 A;  4A3J J;  1ZGW A;  2EZH A;  1O4X A;  2ME0 A;  1JUS A;  1K61 A;  1JKQ C;  2DA7 A;  1AKH B;  1Z77 A;  3ZQI A;  3Q0W A;  1MBK A;  4C3J J;  2AHQ A;  5BNG A;  2L9R A;  1FJL A;  3BG3 A;  2GBY A;  4JX4 A;  2YS9 A;  1IGN A;  2DA5 A;  2DA3 A;  2E19 A;  5C44 J;  3Q3S A;  1LFU P;  1MBJ A;  1OJL A;  1U8B A;  3ZQH A;  1IJW C;  1IDZ A;  5JLX A;  3BR6 A;  2HOT A;  4IHY A;  2JK3 A;  4DYQ A;  2DN0 A;  4QSH A;  3JR9 A;  1ENH A;  3GTO J;  4XRM A;  2G0E A;  1VF9 A;  2VUM J;  1Z0X A;  2L7Z A;  4MIM A;  1F36 A;  1SFO J;  1RES A;  4BY1 J;  1MSF C;  4FE4 A;  2LR8 A;  1HLV A;  2ME6 A;  4D7M A;  2R93 J;  5M3F J;  2LLK A;  5M5Y J;  2IAI A;  2XGC A;  1NTC A;  1ETW A;  3BQZ A;  4DYR A;  3HDD A;  2QF7 A;  3OSG A;  3JRI A;  2JN6 A;  4A3K J;  5F27 A;  4M3F A;  2NVY J;  3GTP J;  1JT6 A;  2IBD A;  3F0C A;  1Y1W J;  4DZJ A;  3DEW A;  4HNV A;  2H1K A;  2NVT J;  1WH5 A;  1RKW A;  2X6O A;  1IRZ A;  2M8G X;  2QCO A;  4XIC A;  4X6A J;  3WHB A;  1T56 A;  2CJJ A;  4J19 A;  3CQZ J;  2EH3 A;  1TWC J;  1GV2 A;  1U78 A;  5C4X J;  2KT0 A;  1ETX A;  5JLW A;  3JRC A;  2NOG A;  3FIS A;  4QTR A;  4BBS J;  1MBG A;  1DU0 A;  4M3B A;  2R7Z J;  3JRH A;  2ECB A;  3PM1 A;  5FLM J;  1UG2 A;  3HOZ J;  3HB9 A;  4FE7 A;  5EGO A;  5J1R A;  2R0Q C;  3OOU A;  5IOY A;  2NS7 A;  3S14 J;  4CYC A;  1ZTR A;  1IUF A;  4NDL A;  3S17 J;  1SAN A;  4BXX J;  2CRG A;  3G1L A;  2Y9Y A;  2XPW A;  1GVD A;  2EQR A;  2ECC A;  4DW6 A;  5IYC J;  3SJM A;  5EGO B;  5EEA A;  5FKM A;  4A3F J;  1JGG A;  4ABZ A;  4BBR J;  5M5X J;  1LE8 A;  3Q0U A;  4DYC A;  2TCT A;  5F0F A;  2NVQ J;  2ID6 A;  4CYC B;  1TC3 C;  4C3I J;  1S7E A;  2HXI A;  5EG0 A;  3S2H J;  2W48 A;  2B63 J;  3JRG A;  3SDG A;  2O8K A;  3HOX J;  1ZR2 A;  3BTI A;  2XRL A;  3CDL A;  1JUM A;  2M9H A;  1MBH A;  1X58 A;  2HQ5 A;  1ZK8 A;  1AKH A;  1P7I A;  1ZQ3 P;  5FKN A;  4A93 J;  3HBL A;  2AO9 A;  1MH4 A;  3BR3 A;  1MSE C;  2GLO A;  3RZD J;  2L7F P;  3BR5 A;  3K7A J;  5EG0 B;  3PO3 J;  5FJ8 J;  1ORK A;  1ZR4 A;  2E2J J;  3BR1 A;  1ZKG A;  1IV6 A;  2EBI A;  3FKI J;  1BJZ A;  5M5W J;  5F08 A;  5M3M J;  1B72 A;  3E7L A;  2LP0 A;  4XRS A;  1TWG J;  4BY7 J;  4B1R A;  1MBE A;  1OCT C;  3ZQF A;  1MBF A;  2DMN A;  1XG1 A;  1U9O A;  2X48 A;  1DU6 A;  2L0K A;  4B3A A;  5IOZ A;  3LSG A;  4M3D A;  3HOV J;  2E2H J;  1B72 B;  3LSP A;  1BW6 A;  2JMW A;  1EF4 A;  4FIS A;  1UMQ A;  1ITY A;  3SFI A;  2LTP A;  2CU7 A;  4D7N A;  1POG A;  5IP9 J;  5IP7 J;  3GBG A;  2H8R A;  2LD5 A;  1P7J A;  2O7O A;  4MLO A;  3GTM J;  4C2M J;  3I4N J;  3C2B A;  5J1U A;  3VPR A;  3JRD A;  1OCP A;  2VI6 A;  1HOM A;  3BTL A;  4I76 A;  1A5J A;  4JX5 A;  3BTC A;  4IEJ A;  1GUU A;  2IEK A;  4BKX A;  1BL0 A;  1NK3 P;  2O9L A;  3GTK J;  3M4O J;  3S1N J;  2MSY A;  3FK6 A;  3BG5 A;  1RKT A;  5EDN A;  3UKG A;  1K83 J;  2K9S A;  1VND A;  1MNM C;  2MGQ A;  1JUP A;  2Y2Z A;  2JWT A;  2I10 A;  1GDT A;  5GPC A;  3W6V A;  4DZP A;  5GPA A;  1G2H A;  4D5F A;  2ELK A;  2TRT A;  2Y30 A;  1WI3 A;  4JX6 A;  2VPR A;  4FTH A;  1JKR C;  1HDD C;  5GP9 A;  4A69 C;  2WV1 A;  2DA2 A;  3HGG A;  1W0T A;  1TWH J;  3PO2 J;  1APL C;  1QVU A;  2R5Y A;  2MW8 A;  3S1R J;  1HF0 A;  3NAR A;  2FQ4 A;  1JJ6 C;  1ETK A;  3A03 A;  5F0H A;  2Y31 A;  4RBO A;  5FLV A;  4A3C J;  5HOD A;  1TWF J;  3NAU A;  5C3E J;  4L5E A;  2XB0 X;  4MFD A;  3ZOB A;  2LVS A;  3BQY A;  3BR2 A;  2HOS A;  1JKO C;  3LSJ A;  2R5Y B;  1RR7 A;  2DTZ A;  4GFB A;  2DMU A;  1ETO A;  5K7H A;  1CQT A;  3RQI A;  4EEF G;  2OF7 A;  1JTX A;  1WCM J;  1RET A;  2LY9 A;  3MN2 A;  3CMY A;  2JA7 J;  5IYD J;  2DMP A;  4A3D J;  3QQA A;  3S2D J;  2K40 A;  2YU9 J;  1XS9 A;  3O8G A;  2XPU A;  3Q0V A;  2EZI A;  1RPW A;  1IG7 A;  2JA8 J;  2KDZ A;  2DA6 A;  4W1U A;  4JYK A;  5F1J A;  5DS9 A;  1F43 A;  3MVP A;  4A3M J;  5C4J J;  1NK2 P;  1PUF A;  1I50 J;  5FKL A;  2DJN A;  1X2M A;  2JA6 J;  3MKL A;  3FK7 A;  2RAE A;  3G1M A;  5K7Z A;  3A01 B;  3H3V K;  3LOC A;  3LNQ A;  4D5C A;  4S0H B;  4G12 A;  5EZH A;  2HXO A;  1B8I A;  4AC0 A;  2VKE A;  1AU7 A;  1PUF B;  3IH2 A;  1FEX A;  4W97 A;  1W0U A;  1UHS A;  4IHX A;  2YUS A;  3QPL A;  1XC5 A;  5E3L A;  3WHC A;  4A3G J;  2HYJ A;  5IYB J;  1HDP A;  2CQQ A;  3HGY A;  2HDD A;  2DA1 A;  1LFB A;  1B8I B;  3CCY A;  2NVX J;  3LSR A;  1JT0 A;  1Y1V J;  4A3L J;  2FD5 A;  3HEF A;  3M3Y J;  2XB5 A;  1TWA J;  2D5V A;  4QIW N;  3O8H A;  3ZQG A;  3S1Q J;  1OFC X;  2DMT A;  3JRA A;  3ZQC A;  1VFC A;  4C3H J;  3OIO A;  5F0C A;  2WB1 N;  4MFE A;  2HOA A;  2HI3 A;  1JTY A;  4JP0 A;  1I3Q J;  4I6Z A;  4Y52 J;  1X2N A;  2WAQ N;  2XGE A;  2K9N A;  3BR0 A;  3GTJ J;  1WH7 A;  5EYR A;  2M2E A;  2EZL A;  1A6I A;  2VKV A;  3GTQ J;  3FIW A;  3TED A;  3TW6 A;  5J3L A;  2MG4 A;  3HKZ N;  1FIP A;  5IPA A;  3TP3 A;  2COB A;  4V2G A;  1R9T J;  4M3E A;  3HOW J;  5FKK A;  2DMQ A;  9ANT A;  5EZG A;  3JRE A;  3BT9 A;  1WPK A;  3RKQ A;  1H88 C;  2XGD A;  3G1O A;  1FTT A;  3JRB A;  1JKP C;  5EF6 A;  1D5Y A;  2CQX A;  3TP0 A;  1ETQ A;  3D1N I;  4XID A;  3K2A A;  3IV5 A;  4AUX A;  4AYB N;  2Y0S N;  3DCF A;  4A3E J;  2E2I J;  1H89 C;  5E3M A;  3S16 J;  4XRS G;  1QRY A;  2CUF A;  1JJ8 C;  3I4M J;  1Q1V A;  5F04 A;  2XSD C;  2LKX A;  3S15 J;  1BA5 A;  2E1O A;  5DTD A;  5IP6 A;  1FIA A;  1U9N A;  2LK2 A;  3IH3 A;  3IH4 A;  4M6V A;  4M3G A;  3RZO J;  3B6C A;  4FCY A;  4X1E A;  1GV5 A;  3JRF A;  2LFB A;  5E3N A;  2X9D A;  4UUT A;  1QPI A;  2R92 J;  3A01 A;  2R5Z A;  3ZQL A;  1H8A C;  2FJ1 A;  1WGX A;  4MO7 A;  2EZK A;  4IHW A;  2XPV A;  4LOC A;  4XK4 A;  2Y9Z A;  1VI0 A;  2DA4 A;  3GTL J;  2M0C A;  1ETV A;  1ETY A;  1IC8 A;  2ID3 A;  1MH3 A;  1T33 A;  1GT0 C;  3H0G J;  2JJ7 A;  3HM5 A;  2M34 A;  5FKO A;  4A3B J;  2NS8 A;  2R5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...