3S2HJ

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s2hJ00
3S2DJ 3S1MJ 3FK7A 3A01A 1XS9A 3LSRA 1F43A 3SDGA 1ZGWA 1VNDA 2JWTA 2MW8A 4QIWN 2XPWA 2DA7A 4ABZA 2EH3A 1CQTA 2I10A 1VF9A 3S1QJ 3SJMA 2E2HJ 3RQIA 2R93J 4LOCA 1RESA 2X48A 3FKIJ 2XPUA 5BNGA 2R92J 1X2NA 1JTXA 3W6VA 2X6OA 4Y7NJ 3GTGJ 1MBHA 5FKKA 2JN6A 3S2HJ 5K7ZA 2M9HA 2WV1A 3B6AA 4A3DJ 5JLXA 2DA6A 4B3AA 3S16J 3BR6A 1ZK8A 4A69C 2Y9YA 1BJZA 2JK3A 1EF4A 1JT6A 1U8BA 3JRHA 5HODA 2HI3A 4G12A 5J1RA 3CCYA 3IH4A 4A3MJ 1ETWA 1TWCJ 1UMQA 3LSGA 1K83J 2VPRA 3CQZJ 1HOMA 2EZIA 1JKRC 2MG4A 2OPTA 3RZDJ 1LE8B 2FD5A 4UUSA 3TP0A 9ANTA 2JJ7A 4UUSB 5EG0A 5IYCJ 1LFUP 2Y30A 5EZGA 2CJJA 2JA6J 3JRIA 3BT9A 5J1UA 2E1OA 4A3JJ 2XSDC 2M0CA 2EZKA 3GTMJ 2IBDA 4D5FA 3K2AA 3A01B 1ETYA 3HKZN 4IHYA 4FCYA 1BW5A 1JKOC 1X2MA 1RETA 3OOUA 4A3IJ 1Q1VA 4QTRA 2WB1N 3RZOJ 1ETQA 2JA7J 5M3FJ 1HDDC 4AC0A 2N8GA 2LKXA 2G0EA 5K7HA 3RKQA 2KT0A 4AYBN 1Y1WJ 2JA8J 3FK6A 2EZLA 5IYBJ 3HOXJ 1ZKGA 1UG2A 4M3GA 5F0CA 1AHDP 2Y2ZA 5GPCA 3BTJA 2PMZN 2K9NA 5EYRA 2W48A 5FJ8J 2IAIA 3LSJA 3Q0WA 5C4XJ 1TWGJ 4M3EA 4DZJA 2E2JJ 1TC3C 4XRSG 2EZHA 1GV5A 2XGCA 5M3MJ 1TWFJ 4BBRJ 1MSFC 4IHXA 4A3GJ 2ME0A 3GTKJ 1ZR2A 1Y1VJ 1ETKA 2NVTJ 2VKEA 4M3DA 4MFEA 1MBFA 4A3FJ 3JREA 1B8IA 2HDDA 3C2BA 2R5ZA 4I6ZA 2LLKA 3OIOA 1X58A 2CUFA 1QPIA 3OSGA 5IOZA 1B72B 2ID6A 2LD5A 1OJLA 2L7MP 4A3LJ 1NTCA 3HM5A 3HGGA 3Q3SA 5FKLA 1MBEA 1HLVA 3G1LA 1OFCX 3QQAA 5IP7J 4BY1J 5E3NA 2HXIA 3B6CA 2XGEA 2TRTA 3CMYA 1U9OA 4M3FA 4B4CA 3H3VK 2FX0A 2XPVA 1GVDA 1VI0A 2FQ4A 2HXOA 3BQYA 3H0GJ 4X1EA 4DW6A 2HOSA 2O8KA 1WPKA 2NOGA 3PO3J 2CRGA 1R9TJ 5E3LA 4DYQA 2YUSA 1MBKA 4GFBA 4BKXA 1WH7A 1Z0XA 5J1YA 3BTCA 3IH3A 3HOZJ 5M5XJ 1FTTA 2L7ZA 5FLVA 5F27A 3HOWJ 2CQXA 3G1OA 3K7AJ 3BG3A 1MH3A 3GBGA 3ZQLA 1IGNA 4J19A 2VKVA 4QSHA 1U9NA 5IYDJ 1POGA 4XRMA 3LOCA 2R5ZB 2GLOA 3BG5A 5IP6A 1B8IB 3HDDA 1WCMJ 3I4NJ 2L0KA 5FKMA 5K7FA 1B72A 4M6VA 1JKQC 1WI3A 2ID3A 3HOUJ 3DCFA 3BQZA 1PUFA 3PO2J 3SFIA 4V2GA 4AUXA 1NK2P 2LFBA 2K9QA 5EF6A 1G2HA 4DYCA 2RAEA 3BR2A 2DA3A 1I50J 3ZQCA 4FE7A 5GPAA 2H1KA 4D7MA 1YRNA 3I4MJ 2DMUA 2ME6A 1P7IA 4A3KJ 1IDZA 4RDUA 1HF0A 4CYCB 4JX5A 1GUUA 2COBA 2WAQN 1AKHB 1AKHA 1I3QJ 3GTLJ 2XB5A 1ETXA 1BL0A 3JRFA 5EGOA 5DS9A 2R5YA 3D1NI 1FIPA 3S1RJ 2DA2A 2DMPA 1E3OC 1RR7A 2QF7A 2M34A 3VPRA 2MGQA 3CDLA 1QVUA 3JR9A 2CUEA 1JUPA 3ZQIA 4IHVA 2XGDA 2H8RA 3L1PA 1MSEC 5F08A 5M5YJ 2R0QC 2NVYJ 1ENHA 1HCRA 2VI6A 2ECCA 2TCTA 5FKOA 1MBGA 5F0HA 4FE4A 2QCOA 1DU6A 2XRLA 4D7NA 3Q0VA 1ZTRA 4M3BA 4HNVA 4A3BJ 2NVQJ 2LTPA 3BR1A 4MFDA 4XICA 5IPAA 4NDLA 4DZPA 1I6HJ 3GTPJ 5GP9A 1VFCA 2EQRA 4DYRA 5FLMJ 2B63J 1IV6A 1H8AC 2DMTA 4C2MJ 1XC5A 3FISA 2Y9ZA 3A02A 1OCPA 3TP3A 3PM1A 1IC8A 1T33A 1APLC 1OCTC 5J3LA 2ECBA 2MSYA 4W1UA 3FIWA 1Z77A 3MVPA 2O7OA 4V2FA 1JGGA 5C3EJ 4X6AJ 4JX6A 3ZQGA 1JJ6C 1D5YA 2M2EA 3HOYJ 2DJNA 1LE8A 2ELKA 1ORKA 5JLWA 3S17J 2IEKA 4B1RA 4MIMA 2Y31A 4IEJA 3ZOBA 4JYKA 2AO9A 3IV5A 2AHQA 1SFOJ 3S15J 1TWHJ 2Y0SN 3OSFA 1T56A 4BBSJ 2DA1A 1QVTA 2DN0A 1IDYA 2YU9J 2K40A 1IUFA 1JTYA 1ZR4A 2GBYA 4A93J 4BY7J 1RKWA 5EZHA 1H88C 1A5JA 1HDPA 4JP0A 3TW6A 3JRCA 2NS7A 2M8GX 4W97A 1AU7A 4JX4A 3ZQFA 2E19A 3GTJJ 3G1MA 1IG7A 4XIDA 2YS9A 1F36A 2EBIA 1PUFB 4MLOA 2HOAA 1QRYA 3NAUA 3M3YJ 1ITYA 2NVXJ 2DMQA 1TWAJ 1LFBA 3HB9A 4FTHA 5IOYA 2LK2A 3JRBA 1XG1A 3LSPA 5EGOB 4L5EA 2FJ1A 1JKPC 3BR0A 5IP9J 3GTOJ 5M5WJ 4UUTA 4C3IJ 4RBOA 2HYJA 1DU0A 1JUMA 5E3MA 5EEAA 1WGXA 3HGYA 3TEDA 2HOTA 4D5CA 1ETOA 1FJLA 5F0FA 3S1NJ 2OF7A 2L7FP 3M4OJ 1WH5A 2NS8A 3QPLA 1H89C 3O8GA 5F1JA 3JRDA 1S7EA 5C4JJ 1JUSA 2LR8A 2K9SA 1UHSA 5EG0B 1SANA 4A3CJ 1JT0A 2ZB9A 1MBJA 1JJ8C 2JA5J 1ETVA 1BA5A 3LNQA 2L9RA 1O4XA 2CU7A 1IJWC 5DTDA 1BW6A 4I76A 5C44J 3Q0UA 2DA4A 3NARA 4S0HB 2R5YB 2DA5A 3GTQJ 2P81A 3JRGA 2O9LA 2DTZA 4CYCA 2E2IJ 1W0UA 2JMWA 2D5VA 3E7LA 1ZQ3P 3BR3A 4XK4A 1YRNB 3QPSA 2GM4A 1MH4A 1FTZA 1FEXA 2R7ZJ 2HQ5A 3O8HA 3MKLA 5F04A 3HEFA 3WHCA 3UKGA 5EDNA 1GV2A 1GDTA 2CQQA 3IH2A 1RPWA 2VUMJ 2LVSA 3TW7A 2LP0A 2KDZA 3HOVJ 4IHWA 1P7JA 3DEWA 2DMNA 5FKNA 4BXXJ 3S14J 3BG9A 3ZQHA 4FISA 3BTLA 1IRZA 4C3JJ 4MO7A 3BR5A 1A6IA 2X9DA 2LY9A 3A03A 4C3HJ 3JRAA 1K61A 1U78A 5E3OA 3MN2A 1FIAA 3HBLA 1NK3P 3WHBA 3BTIA 1W0TA 1MNMC 1RKTA 2XB0X 3F0CA 4XRSA 1GT0C 4A3EJ 4EEFG 4Y52J
chains in the Genus database with same CATH superfamily
3L7WA 3S1MJ 3FK7A 1BI1A 4ZYAA 4WWCA 1XS9A 4WXCA 3SDGA 4OIRF 1WJ5A 3WG9A 2JWTA 2MW8A 4EATA 4DBRA 5HDNA 5LEJA 1BBYA 2EH3A 2VONA 4BDZA 1CQTA 3VSLA 4CCKA 1VQKI 2ETHA 2E2HJ 1I1SA 1XPXA 3FKIJ 4L18B 1X2NA 5ICGA 2VQHA 2ZJ2A 2X6OA 2DJIA 3BPXA 1S7AA 1MZBA 3TKYA 4JOMA 5FKKA 3Q9SA 3DBHB 2M9HA 3B6AA 2WV1A 3OYGA 1G4DA 4QPOA 1HBXG 3FXMA 1F9NA 4K2EA 5LEKA 3MKWB 4CCJA 2OCCH 4A69C 2Y9YA 2F4OB 3V4GA 2E7WA 4LD5A 2IW5A 1FBUA 2VQGA 1JT6A 2DO7A 1SVLA 1YQAA 4UB6C 1U8BA 1WZ2A 3ASOH 4OWRB 5J1RA 3IUOA 3FHNA 1UMQA 4BDYA 1Z9CA 1TL8A 3CLQA 4KITB 4I0AA 3I64A 3F8NA 4FQGA 3D0SA 1JKRC 1PUEE 3GWZA 5L3EA 1BC7C 2IS1A 4XLAA 9ANTA 3M1EA 1J9IA 2M87A 1LFUP 1V3FA 2CJJA 4L5JA 3CCUI 3CCMI 3BT9A 3WTUC 4ENMA 2JTVA 3NEUA 4IJAA 4A3JJ 2OC6A 2XSDC 2EJRA 4D5FA 3K2AA 1ETYA 1B4AA 4HG2A 2NS0A 4NC6A 1Y0NA 1GLNA 2XAUA 4FCYA 5JI6A 2BXYA 3PNVA 4OOIA 5FLXK 1PDNC 1A36A 2WB1N 3CP8A 3OMYA 3K9TA 2L7KA 4AC0A 3CCRI 2N8GA 4F55A 4FX4A 5D4RA 2XDVA 4WK8F 4FX0A 4Q5SF 1HXDA 2A6HF 5IT3A 2W25A 2EZLA 3FK6A 2DT5A 3HOXJ 2HEOA 4GCVA 3F23A 3KP3A 1SD4A 2PMZN 5DUIA 2CV0A 3HPGA 2H09A 2K9NA 4XN3A 2ZO4A 5E18F 2CQNA 1YI2I 5L3FA 3GEZA 3MWMA 2MABA 4XRSG 2RVCA 4KFCA 4QWQA 2XGCA 4BBRJ 1MSFC 4HSRA 1YO5C 3AFHA 4LLLA 1ZGAA 1FT9A 2E34A 5H20A 1ETKA 3PSFA 1W7PD 4A3FJ 3JREA 3ZRGA 3GLXA 1SFUA 2E60A 5GTIC 5IOZA 1B72B 2DK8A 2ID6A 2LD5A 1OJLA 2L7MP 4A3LJ 1MMNA 1NTCA 3FMQA 5D8LB 1U3EM 4CHUA 4IQ4A 5KVRA 4XQFA 2DT7B 3CTAA 4BY1J 1Y8RB 2ZJPF 1RNLA 2P7VB 3CUOA 1U9OA 2L02A 1HQCA 2VBZA 3HTSB 4I7HA 3G71I 5LLQA 2L9VA 1Z05A 2FX0A 2K4BA 4A0ZA 2ACJA 4HLYA 4F93B 4BE2A 1ODDA 3H0GJ 3BQYA 1J59A 2MYSA 2O8KA 4PGHA 3JTHA 2FU4A 4HA8A 4B8XA 2CRGA 3E6DA 4ASNA 2VJJA 1WI9A 3RIRA 4DYQA 1YW7A 4OU0A 4RGRA 1TQMA 2GA1A 3JAMK 3IH3A 5J4YA 5M5XJ 1FTTA 1HA8A 3HOWJ 4RGUA 4H0EA 2E1CA 2LY2A 3ZQLA 2O0YA 2HR3A 1IGNA 2ZMEA 3HTUA 5E79C 1L3LA 1POGA 1JHHA 4RLQA 3DEEA 1HW5A 4GRIA 2R5ZB 3BG5A 4OMZA 4OIPF 1R4MB 5CVIA 5FKMA 3TL4X 1B1BA 4B44A 3CCSI 1IN5A 4A6DA 4L9NA 5B1AH 4ENJA 1JKQC 2W4SA 2ID3A 4BXUA 4GO1A 1G6NA 4U0WA 4AWXB 4HRIA 3HOUJ 4XORA 2XF6A 1DUXC 1NK2P 2LFBA 3NWTA 4WCGA 3DTKA 1V55H 3AAFA 4L9JA 4ITVA 3ZQCA 2WA0A 3QOEA 2BBYA 4Y15A 1TP4A 2BVLA 3I4MJ 2NYXA 4NQWA 5TRDA 1D0ZA 4F92B 1HF0A 4BYYA 2HOEA 3GFMA 3K70D 1J2XA 2H27A 4XM3A 2P7CB 3S3MA 1S6LA 1FYMA 1GUUA 2COBA 3JSPA 1RRJA 2F5VA 2VOPA 4EGZA 1QQIA 3QWLA 1FBQA 1XCBA 2XRNA 3CP2A 3TDZC 2XKOA 3LA7A 2QLZA 1ZN2A 1GHCA 5EGOA 4LITA 3QPTA 2NNYA 2Z9OA 3D1NI 2XSJC 3S1RJ 2DA2A 1IN7A 2P8TA 1MJBA 3MMYB 2QF7A 3H3UA 2CG4A 2VJ5A 3A2KA 3HHHA 1JGSA 2MGQA 3CDLA 4IHVA 1IUYA 3H9QA 2MD0A 3ABMH 2ZC2A 3E5QA 2D1HA 3ESWB 2XAGA 5F08A 1ZG3A 3CJTB 1BR2A 3VSKA 2B7EA 2R0QC 2KZVA 3H35A 3CDIA 3OYNA 1YTYA 2IA2A 3FWEA 1Z21A 2FSWA 2CFXA 3CESA 4YG2F 5F0HA 5FFXA 2WADA 4FE4A 4A0YA 4M3BA 3R4KA 3ROUA 2VL8A 2NVQJ 2COMA 1AOYA 3BR1A 2CSOA 5A2QZ 4NDLA 3OYLA 2VBYA 4DZPA 1WJEA 2DODA 5HNHA 4G8XA 1W36D 3GTPJ 3MKYB 1XDUA 2JUGA 3VB2A 3W3CA 2A5WA 3CC2I 1EJ9A 3WTZA 3PM1A 3HRSA 1APLC 3GF2A 5TJJA 5JVGF 1OCTC 4EM2A 3CO6C 5LFAA 1X4OA 4W1UA 2ISZA 1Z77A 1K4SA 4NBQA 5A2QK 1XGOA 3PIOF 1FSEA 2O7OA 3BZKA 1R23A 2ESHA 4X6AJ 3ZQGA 4UNOA 1QZEA 1U2WA 2CYYA 3C2GA 4MNUA 2ELKA 4RB1A 1XGMA 4MTEA 1T39A 3QYEA 5BOXA 1O3QA 2IEKA 2VN2A 4MIMA 3ERED 3DBLB 2UXNA 2RNGA 3P5JA 3R0AA 2R7SA 4PCQA 2Y0SN 3OSFA 3DKXA 4BBSJ 2IGMA 4PFOA 2K85A 4IVNA 4U87A 2XAHA 1RUNA 2QQ9A 5CVUA 5JHUA 4G6DA 1JTYA 1GVJA 3I4PA 3WODF 3AL0B 5D5VB 1QZYA 1RKWA 1A5JA 4A0XA 2UV1A 3HL2A 4I99C 4NNJA 4LJZF 2E1NA 4XSZF 3IL2A 1N78A 2A07F 4JX4A 5LHGA 3ZQFA 3LSHA 4E6KG 5D6EA 2XAJA 1KU7A 3OR2C 3VWBA 4XIDA 2VT2A 2YS9A 1YIOA 2VLAA 2BEOA 2KZGA 2PBIA 3HUGA 1YITI 3K4CA 1M1EB 4A5MA 1F5TA 4WX9A 1WWXA 2PG4A 1QRYA 3M3YJ 1W36C 1TWAJ 1BI2A 2WAQA 1RC9A 5IOYA 4XLHA 2LK2A 5IY5H 3V8JA 5B1BH 1KYZA 1X3WB 5F6FA 1XSVA 1BM9A 2L4AA 3CMMA 2X4HA 2FA5A 1YFHA 4D0PA 4HNUA 3K4BA 3TO9A 3IP4B 1ZHFA 1MIJA 1JUMA 2ZSIB 4XSXF 5E3MA 1JI8A 2CMPA 1OYWA 1CF7A 4CXFA 1FOKA 3I59A 1KQ8A 1T98A 2LBFA 3RTRA 4HSTA 4N9HA 1FJLA 3S32A 4IL6C 2CS3A 1QHHD 1DPRA 3LL7A 3QPLA 3WGGA 2V1DA 3AG1H 3JRDA 1LEAA 1JUSA 3CJRB 3J81K 2QENA 3H9GA 2CV1A 1OYIA 5GADJ 2IA1A 1JT0A 5BMZA 1MBJA 2A68F 2XUBA 2L5QA 2D45A 2VJ4A 4LIVA 2BY2A 1F1ZA 4IKFA 2L9RA 2DOAA 1O4XA 4NUBA 5DTDA 1Z6TA 4RLFA 2EILH 2DDBA 1Z67A 2KIFA 3JCUC 1LPQA 3NARA 1OQYA 2HDWA 2JRTA 3GTQJ 3TMOA 2XGXA 3ZR8X 2E2IJ 3KYDB 1OMIA 2JMWA 2ZCWA 4KIGA 2A61A 1OR7C 3E7LA 4XK4A 1YRNB 2FOWA 2GM4A 5FRNA 2V1UA 5H6QA 1FLIA 1FEXA 2R7ZJ 3EUHC 2ICWG 3K69A 4PJJA 3VODA 2MH2A 3B02A 2NRAC 3WHCA 2GOXB 2ZXWH 4KUMA 1GDTA 2VBXA 2DU9A 4RAYA 1RPWA 4BEHA 1B6AA 5J8FA 5EEGA 2LVSA 3TW7A 3P7NA 2KDZA 2R7WA 4IHWA 1P7JA 4B48A 3M07A 4BXXJ 2LDUA 1X1BA 3WU2C 5HNFA 4ENKA 3ABKH 1WJDA 2MBFA 4I2OA 1OKRA 3KP7A 3J7YJ 4DJAA 2VOOA 2QVOA 2X9DA 4C3HJ 1SC7A 4GYIA 2DXIA 2JSPA 4ZDPA 2EV6A 3VYRB 2M8EA 2DDAA 2H1LA 2DPDA 1FOXA 3HBLA 3COAC 2UWMA 1FYKA 1IXSB 2F5EA 1MNMC 2XB0X 4XRSA 3BP8A 4ZTFA 4YELA 1Y6IA 2EFOA 3KEOA 2CO5A 1JHFA 5L3GA 2Q1ZB 2Q0OA 2FNAA 3G4SI 3RCOA 2I8DA 1T95A 1FNNA 2PFBA 4QIWN 2GAUA 1ON1A 3L00A 1E2XA 2ELJA 2I10A 4UB8C 2UZKA 3OR1C 4HQMA 2M1BA 2OTJI 2P6SA 3KE2A 3KZZA 1FMVA 2CUZA 1IRFA 1U5TA 3W6VA 1ZH5A 3OS0A 4C2TA 3HPHA 1FZPB 3E3VA 2GIVA 3OS1A 1C0WA 2JRMA 1FSHA 2XHKA 4A3DJ 2DA6A 4B3AA 3GMEA 3HHGA 4IZZA 4OINF 3F8BA 4FASD 4HQEA 3DPTA 2X85A 1BJZA 3S93A 4B47A 2J5OA 4HAMA 2RQPA 4BHCA 1WVRA 3JRHA 4Z6YA 4G12A 2OTLI 4B43A 2LF7A 3CCYA 3IH4A 1TWCJ 5KAIC 5BPIA 1K83J 2DT6A 4N4OB 2HQAA 1LDJA 3HYIA 2R7TA 1HOMA 3HOSA 2MG4A 4DIQA 2E71A 4ZC3A 5EG0A 2MH9A 3HZJA 2ISYA 2DAOA 2PX9A 2JA6J 5J1UA 1YJWI 4H4KC 2E1OA 1WHUA 2M0CA 1U8RA 4IOCF 2EZKA 3GTMJ 2IBDA 2R7DA 2KPMA 4KMFA 3HKZN 1X1AA 5B3SH 1VQMI 3CUQB 4LB6B 1BW5A 5H2FC 1XSDA 1IXRC 3OYKA 4C30A 2XAFA 3CLOA 3GVAA 3KLOA 4A5NA 4RB0A 2OZUA 3OOUA 3GX4X 1DP3A 1Q1VA 3RZOJ 1IN8A 2DFFA 3DWLE 2HPMA 5M3FJ 3OYJA 4GDFA 2JA7J 3RYPA 1HDDC 4N4NB 3S3NA 3N97A 1MD0A 2G0EA 2M4GA 5JFRA 1W7PB 1FOWA 3DTIA 2GXGA 2KT0A 3RKQA 5DD4A 2KJBA 1N75A 2ELHA 1UG2A 4BAYA 3TDUC 2HKOA 1AHDP 4L0ZB 5GPCA 3BTJA 3G2BA 4IOAF 1K6YA 2RDPA 4PJMA 5EYRA 4ZYEA 1Z7LA 5LHIA 1BOAA 1PJRA 2IAIA 5FJ8J 3LSJA 1V4RA 2R4GA 2IS4A 1TWGJ 4M3EA 4DZJA 2E2JJ 5LGNA 2EZHA 1GV5A 4J00A 1TWFJ 1BR4A 3I55I 2ME0A 1XGNA 2VKEA 3GW2A 2HFHA 3CDHA 4M3DA 3KEQA 4EJVA 2LSOA 3DFGA 3ZPLA 2R5ZA 3AG2H 4I6ZA 3KLNA 1MDMA 1CF7B 2DOEA 3K4NA 3DPUA 1K78A 2DLLA 1QPIA 5ERIA 1V5GA 3FXJA 2VT3A 3T1BA 2ZSHB 1Z91A 3OYAA 3GZ5A 1MDMB 3FHZA 2CV2A 1J0RA 1N77A 3H1CA 4CDGA 3QQAA 2F5FA 1E3PA 2VPLA 1SVOA 4YEJA 3F21A 4PSWA 3H5RA 3C2HA 4BGDA 1ZARA 3H5NA 1A31A 4F52A 3J80K 3L09A 3NQOA 4KA4A 1MMSA 3KYCB 3QU6A 4DW6A 1VQ4I 2FBKA 4MGRA 2OQGA 1XCVA 3MCZA 3NRVA 1R9TJ 1KONA 2A05A 2YUSA 5E3LA 4X0GA 4WXDA 3DTEA 2FXAA 2KHMA 1WH7A 1Z0XA 5J1YA 3I9V2 2CW8A 3BTCA 3QYFA 3HOZJ 2W7NA 5BQTA 5CLSA 1T8IA 3IKVA 3ZGKA 4U7BA 3GZ6A 1PYVA 4Y3OA 4P9UA 4J19A 2VKVA 3EYYA 2VJIA 4XRMA 4AIDA 3LOCA 4A6EA 5IP6A 3FXUA 1B9NA 2GIZA 3D5LA 1UELB 2L0KA 2CFOA 2QSHX 1XN7A 1XMXA 4C2UA 3W2VA 2QUFA 4BH9A 4BUPA 3U9GA 3VOEA 4AUXA 1AWCA 1FOYA 4G7OF 1TT5B 2LH9A 5EF6A 3BCBA 2RAEA 3BR2A 3G73A 3L2WA 1X19A 4XL9A 3VEPA 2K27A 4FE7A 3DBRB 5ED4A 4D7MA 1GXQA 5J8CA 1P4AA 2ME6A 4HDVA 2STTA 2YPRA 4P9FA 2GWRA 2K9LA 4HYEA 2V6CA 3C18A 4HF0A 4EMSA 1YS6A 1YX5A 4AYBA 2F48A 2Z5UA 2XKPA 1EKEA 2Z33A 1QBJA 2FEZA 5EEHA 1AKHA 3GTLJ 1DGRM 3CMEI 4XLFA 4LB5A 3ZQ7A 1ETXA 4IRGA 1BL0A 3QAHA 2YX7A 3SXYA 4P55A 1FIPA 2WY7Q 2DTRA 1KQ9A 1TQPA 1E3OC 1HKTA 5KAFC 2PN6A 1R1UA 2V1XA 2GZWA 2L9NA 2O03A 1QVUA 2CUEA 4HX7A 4HNTA 5HLHA 3FM5A 5EJCA 2FMLA 1Y8QB 2H8RA 4ZDOA 4LK0F 3L1PA 2XF7A 1VQOI 4IHTA 1Y39A 3CF5F 2FBHA 2NVYJ 3IKTA 3K2ZA 2VXDA 2TCTA 2HKXA 5FKOA 2MD5A 4HBLA 3Q5FA 2LG4A 1MBGA 1TNTA 1UG0A 2BW3A 1MNDA 3TQNA 2DI3A 1ZG1A 2BHYA 3K1NA 3LFUA 1E3HA 1IXCA 4MFDA 1IO2A 5IPAA 1FP2A 5HDGA 1LDDA 1I6HJ 3KX2A 1VFCA 3V7CA 2DFHA 2B63J 3ABLH 1UFMA 3OYEA 4C2MJ 1XC5A 1Y0UA 2RC4A 1HSJA 2ESNA 4KN7X 1TLHB 1OCPA 3A02A 4EV0A 1MJ9A 2IPQX 3F72A 3EUAA 1SEUA 2JVGA 3MVPA 1OLTA 1JXSA 4V2FA 2M5WA 5H6RA 3DLLF 1D5YA 4UUVA 1TBXA 1O3RA 3DXJF 3CCLI 3WTVC 2PI0A 3HIFA 3P9IA 2EFNA 3S17J 5GTHC 2ZBKA 3ZOBA 4IXAA 3IV5A 1UCRA 3OYDA 2FUG2 1T56A 3T0YA 2IXSA 3PNTA 1IN6A 1IUFA 4HF1A 5HLGA 1ZR4A 1S3JA 1J75A 4M9SA 4A93J 4HPQA 5EZHA 3PFIA 4KNYA 1H9TA 2QWWA 1J09A 4JP0A 3TW6A 4BEHB 2E35A 3JRCA 3K4LA 2M8GX 4W97A 1N25A 5JR3A 3HSEA 5AIPA 4OAZA 1YE9A 2FMYA 1IG7A 3I71A 3QOPA 5HLIA 1HW2A 3A4CA 5DCFA 1QO0D 2HNHA 2OU2A 4M9XA 4YFKF 2RV8A 3E97A 2DMQA 5F64A 2HTSA 2VQCA 4FTHA 1YLFA 3BR0A 5IP9J 1S5LC 5CYVA 4C3IJ 1I39A 4RBOA 1FYLA 1FY7A 2DYRH 4G9YA 2HYJA 1R1TA 4MHGA 2Y69H 3AKZA 2L3DA 2CQ7A 5HVQC 5ILSA 2IT0A 1SAXA 1X3ZB 5E17F 2OV7A 2MC3A 3L2QA 2HOTA 5DYMA 2FRHA 1LJ9A 3MEXA 4HDUA 5J6XA 5F1JA 5DEQA 1E0EA 2LR8A 2Q2EA 3L2VA 4ZZDA 4A2UA 2BXZA 1MJAA 3ZP5A 3L2CA 1SD6A 1KU9A 2JA5J 1ETVA 2BE5F 1BA5A 3P9KA 2AXTC 1IJWC 3ZN0A 4ETSA 3KP2A 3SFZA 3HC7A 5C44J 4PK4A 4HF2A 2R5YB 2OCEA 4UVBA 4DQ2A 2OJED 3U1KA 3OYCA 2R7QA 2MLGA 5TISC 4DBQA 4WXHA 2NVUB 2IS2A 3RPUD 3VYTB 4P96A 4XR6A 2MA3A 2O5RA 3HXLA 3SQNA 2V26A 4IRIA 3BR3A 5E8GA 3QPSA 1P92A 2PEXA 1MH4A 1FTZA 4UVAA 1XSXA 3FXKA 2GA2A 2HQ5A 2JSCA 3MKLA 3HRTA 3I0TA 3WG7H 2JUCA 5DD8A 1TW2A 3ZMSA 1NH3A 3KZIC 3CC4I 4CA0A 3ABTA 3M8EA 2BVMA 5HS9A 3CJNA 3SYTA 3ZN1A 4KIBA 1VQNI 3FF5A 2LP0A 3HOTA 3CO7C 4ESBA 5K5RA 1UZCA 3QPHA 3BG9A 3LSIA 4PUSA 5DCMB 3ZQHA 4G7ZF 3FXOA 3OIQA 1A6IA 2LY9A 3F22A 4E7JA 1W7PA 3JRAA 2H6CA 3C1DA 3F6OA 4Y33A 5E3OA 2WY8Q 1QHGA 3DKYA 2ZJQF 1NK3P 5E1XA 3WHBA 2PMUA 2ZXHA 3F0CA 4RS8A 1OCZH 4A3EJ 3OL3A 1KQ0A 1ZREA 1V54H 3S2DJ 5ICFA 3JTGA 4M6YA 4ENNA 2F6CA 2M0MA 3LSRA 2K3FA 2V9VA 3A0HC 2EB7A 3WTWC 1ZGWA 3AL0C 5L3CA 1VNDA 1CGPA 4HOBA 1ON2A 5AONA 2ZXJA 4XMYA 1VF9A 3HRMA 3S1QJ 3SJMA 2BY0A 3MQ0A 3RQIA 2XPUA 2R92J 4XNFA 3EQLF 2L54A 4IO9F 1JTXA 4EVIA 4BHBA 2HZDA 3TO7A 4KYWA 3E6CC 1GXPA 1FWZA 4IRHA 2ZNZA 3S2HJ 2IP2A 3Q9VA 4LMYA 2HYGD 1SD7A 2K9MA 1WQ2A 1Z6RA 5DUKA 3BWGA 3PNYA 4JK1X 1R58A 2GQQA 2LREA 1ZK8A 1IRGA 1WRJA 2P4WA 3KCCA 5FD6A 1OPCA 1EH7A 2ZMEC 4A3MJ 1ETWA 5HDKA 1UJ8A 3E5UA 3LSGA 3QODA 2VPRA 3RZDJ 4UUSA 5L3BA 1ZAOA 4UUSB 4LLGF 3E5XA 3H9JA 5EZGA 2IS6A 1BR1A 3JRIA 3R0JA 4Q48A 4CCLA 2QYOA 2R7FA 3ZMVA 1W1WE 4U88A 3A01B 2R7XA 2HQNA 4U0YA 4IHYA 1WJFA 4J01A 2JVHA 2H6BA 2ADUA 2EFPA 1JKOC 4M6XA 4UV9A 2KP6A 1R36A 4M74A 3C7JA 1ETQA 2G9WA 2KJCA 4PJNA 2EK5A 4XOTA 2KFDA 2LKXA 3OIPA 2ZFWA 4M73A 3TGNA 2EV5A 4ZYGA 3PSIA 2I5UA 4AYBN 3DF8A 2HWVA 1S7OA 1ULYA 2K5CA 5F0CA 5FO5A 2KRHA 3I56I 4CYDA 1D0YA 3ELKA 3LAJA 4YIIA 3OYBA 2W84A 3Q0WA 4R8HA 5DDGA 3L2RA 3KP4A 1TC3C 1UAAA 4DOZA 3EETA 4GXOA 3MKZA 1U6GA 2HPIA 5ILVA 1W5SA 5HOOA 1Y1VJ 1MBFA 1T6SA 1XMKA 2HDDA 2H94A 2BV6A 3P9CA 3OIOA 2RNJA 4LK1F 1X58A 2PMHA 1T2KA 1MMAA 2ZMEB 5GAHJ 2DFIA 5CKTA 3ZMZA 1OCRH 3IC7A 5BPDA 1HKQA 4MQ9F 2DW4A 1U0JA 5FKLA 4U0VA 1HLVA 3ASNH 3G1LA 1OFCX 4KT5C 1U5TB 2XIGA 2AQFA 3A0BC 5E3NA 1QNTA 2V6EA 2HXIA 3F8MA 1I6XA 2WAEA 2TRTA 3DPLC 2QQAA 1R49A 4AIJA 3BJAA 2JPCA 1O3TA 3HSRA 4M3FA 4B4CA 3H3VK 2G7UA 3KPHA 5KCMA 1D1CA 2YU3A 2FQ4A 3EUHA 4PGGA 5KNLA 2V9KA 3PO3J 4N0BA 2FF4A 4RB3C 2HS5A 2BOLA 1MBKA 1OR7A 4GFBA 2QEXI 2NNNA 3K0LA 1X1DA 4HW0A 1MMDA 2R7UA 3RPUA 2L7ZA 5FLVA 4BQQA 2L01A 1Z7UA 4LLNA 1S29A 3T8RA 3K7AJ 2QZ8A 4BU2A 3I59B 1I1GA 1PVEA 2IGNA 4BJTA 3PUBA 3CD6I 2VXZA 4D1QA 4CCNA 1B8IB 3K70C 3V7RA 1T38A 1WCMJ 4BE0A 1MKMA 4Z2YA 2HVSA 5K7FA 4MQVA 2RKHA 4M6VA 3KP5A 5D5WB 1XTAA 3J7ZI 2ZFUA 2D1VA 3DCFA 3O6BB 3PJRA 1PUFA 3WE2A 1Z3YA 4KT6A 1IW7F 4UV8A 2P5LC 3PO2J 1LKXA 3OYIA 3HJEA 2K9QA 4IQJA 1G2HA 1G3YA 4DYCA 4G94A 4KIFA 4BQAA 4PJ0C 4EQQA 4Y13A 2O8XA 3RJPA 3WTTC 2WB1A 1BI0A 4IF4A 1LVAA 3RI4A 1YRNA 4KICA 3U2RA 2F5CA 4A3KJ 3QP6A 1IDZA 4RDUA 5B5EC 4RAZA 2B9SA 2KDOA 2EIJH 1EV7A 2F5DA 5J47A 1PP7U 1EA3A 5LD2C 4CCMA 1WJAA 2WAQN 3M7GA 3LQRA 1SFKA 3CCQI 1X4PA 1VQ8I 1TNSA 4Q47A 1ZGJA 1ZRDA 2XB5A 4BNCA 1P9QC 1KGSA 1USSA 5K5OA 3ZMDA 5DS9A 3IHUA 4E7SA 3WU0A 3WGIA 5LRSA 3N4MA 4OIQF 3JW4A 4G7HF 3SZTA 4XBFA 2M34A 3VPRA 5J4VA 1J5YA 5ICEA 5FFZA 2BHZA 1VQ6I 3JR9A 2CW0F 4EM1A 1YG2A 3CJQB 3FZVA 3ZQIA 1HSTA 1T08B 4R79A 2DOFA 3ULQB 3KYLA 1R5GA 1MSEC 4XONA 5M5YJ 2OAZA 3NWSA 4CH7A 3L2UA 3E0JB 1ENHA 1HCRA 2TDXA 2VI6A 2LOOA 4PJLA 5K1YA 3QRFF 4XKVA 2FOKA 4XOPA 1P4WA 3H0DA 1KA8A 4HEA2 2XRLA 4D7NA 1ZTRA 3FBNB 3LMMA 4E70A 2YSRA 4XICA 1YIJI 1VQ7I 5FROA 2QKLB 1FC3A 2RGVA 3SEZA 1BN5A 5FLXZ 2L9SA 1EH6A 4DYRA 2EWNA 1R6RA 4LG3A 3FISA 2DBBA 1K6OA 4BE1A 3TP3A 2OBPA 1T0FA 4ESJA 4NC8A 2VE9A 1IV8A 2L2OA 4XKBA 1DGWY 4LGWA 2EIKH 1SMTA 3KFWX 2YX4A 3KP6A 1A6QA 5C3EJ 5HS7A 4PZJA 3T8TA 1S8NA 1JJ6C 3HOYJ 2KQRA 1TT0A 4RA2A 4AD9A 1LE8A 3KIOA 4WF2A 4ZYHA 5JLWA 5TGTA 1YW8A 1MGTA 4B1RA 3RQ4A 1R5ID 2Y31A 4IEJA 1KZHA 4JYKA 3M9AA 2DYSH 2AHQA 1ZYRF 3S15J 4YRVA 2DA1A 1QVTA 3H92A 1LNWA 2ZXIA 2DN0A 2MLKA 5E20A 4F7ZA 1IDYA 3WTXC 2YU9J 2JZYA 1W5CC 2H8WA 2LF8A 2Z1DA 4AVPA 2GBYA 3SHFA 1ZLJA 4I98B 3LA3A 1BC8C 2IJLA 4BY7J 3BJ6A 1HDPA 3U21A 4QLCU 3TBIA 4MTDA 1YW9A 2NS7A 1FMWA 1AU7A 3F8FA 4RAGA 4RM2A 2V1NA 1WFXA 3DV8A 2G7HA 2M7BA 4LFUA 4HV5A 2O61A 2EBIA 1F4KA 3MD2A 4RB2C 2V4JC 4CGZA 2E5NA 2RREA 3BG6A 4MLOA 3VFZA 3NAUA 4I02A 2NVXJ 2LC2A 4OMYA 2IVMA 3RKWA 5KHDA 3ECOA 5FB2A 3ML6A 3OYFA 2M30A 3JRBA 1XG1A 5EGOB 2D2WA 3ECHA 2OA4A 2AS5F 4BXFA 2M45A 2XF5A 4Q4ZF 3CCJI 3V42A 4V19K 4FHTA 2X6YA 3BC8A 4UXNA 3OWTA 2E36A 1XGSA 3W2WA 1NG6A 5EEAA 3LAPA 1DQUA 1WGXA 4HZFA 3TEDA 3EUKL 4D5CA 3IWFA 4ZTJA 3R6SA 1RUOA 5F0FA 2OF7A 3DKWA 3S3OA 2L7FP 1P4XA 1OCCH 3HUGB 1WH5A 3R61A 3L9FA 2E5ZA 4A12A 2IA0A 1KU2A 3O8GA 2CGPA 5C4JJ 5E8IA 1Q1HA 2P5VA 1UHSA 2VC1A 5EG0B 4GGGA 2PLYA 1SANA 3PQKA 2A69F 4A3CJ 3QU3A 2KLOA 3S8PA 2RN7A 1YJ9I 2ZB9A 1JJ8C 1VQ9I 2E7XA 3EPZA 3BJOA 1KU3A 3FXQA 3LNQA 2BY3A 5CVRA 3S2WA 2CU7A 3LSKA 3VYUB 3W6JB 1BW6A 4I76A 1R4NB 2HGCA 3K1PA 2Y0MA 2PQ8A 4M71A 3BDDA 2PJRB 1VTNC 5DM7F 4S0HB 4L5IA 2X6XA 1XDSA 2DA5A 5E1ZB 2P81A 1TQIA 2HTJA 2OZ6A 3VDXA 5B66C 3TOBA 2LKPA 2BY1A 4II2A 2D5VA 1ZQ3P 2QQ8A 2PJRA 2VODA 1K78B 4E7HA 3CMAI 2NAZA 2WTEA 2A5YB 2NOJB 2E1MC 5D4SA 3EDPA 1SFXA 4M9ZA 3AG4H 3KETA 1R5HA 3HEFA 2K02A 3UKGA 1B9MA 5EDNA 1GV2A 1P6RA 5CJ9A 4Y17A 2HYFA 2OQRA 2VUMJ 3OOPA 3HOVJ 3A1YA 3DLAA 5BS6A 2VBWA 2DMNA 5FKNA 2W24A 1FBSA 2PMZA 3S14J 2DK5A 4FISA 3K4MA 4C3JJ 5AIQA 3GXOA 4R1HA 4MO7A 3MFKA 1RZ4A 4I0BA 1RR8C 3A03A 2P5KA 2KISA 1K61A 4IX7A 1K79A 2DQRA 4DGWB 3CCVI 2KMUA 4HV6A 4AVZA 3MN2A 5JVTA 3RKYA 4II3A 3BTIA 3SZGA 1RKTA 3GUDA 4UHTA 4EEFG 4G6QA 4CO8A 1GT0C 2ZJRF 1D1BA 3UR3C 1STZA 1XD7A 2EA2A 3A01A 2OUMA 1F43A 4I09A 1E17A 3OL4A 4ANJA 3V8KA 3IRQA 2HQRA 1VQLI 4E7LA 2XPWA 3W6KB 2DA7A 2CWEA 4HX8A 3J81Z 4YIRX 4YIFA 4ABZA 2CW7A 3E6MA 3O3KA 4U7DA 3DU5A 3LFKA 2DFEA 2R93J 4LOCA 1RESA 2X48A 4CUGA 4E7KA 5BNGA 3BOQA 4CZZA 2K4JA 3BROA 4G6TB 1IAWA 1VQ5I 2VE8A 4Y7NJ 3GTGJ 1MBHA 4FT8A 1BOBA 2UUZA 3ERMA 5CVJA 2JN6A 1YOVB 3B73A 5K7ZA 2WWYA 2RQQA 1T0FC 1UB9A 5JLXA 2LMDA 2EPFA 1B59A 3S16J 1A35A 3BR6A 1O7LA 2JK3A 1EF4A 3BZ6A 4JQFA 5LHHA 2A3SA 3BY6A 5HODA 2HI3A 4I01A 1WJBA 4O6JA 2Z16A 2LRDA 1EH8A 2X51A 3CQZJ 5D8KB 2EZIA 1LE8B 2OPTA 1LEBA 1V5FA 2FD5A 1DP7P 1TZLA 3TP0A 2JJ7A 5IYCJ 1U5TC 2Y30A 2MFZA 1BIAA 3M8JA 3CF2A 1TTYA 3E6BA 3JSOA 5LBQA 5CVVA 3J80Z 4XN0A 3K4KA 3PUFA 2LBFB 3HRUA 2Q2EB 4M72A 1SVMA 1D5VA 3ZCOA 5D5XB 3JAMZ 1RI7A 1ZLKA 1X2MA 3DEUA 2XROA 2JA2A 1RETA 4A3IJ 4QTRA 2IGOA 4XLNF 2EFQA 1IZ1A 1V5EA 3CUQC 4ZDLA 2GXAA 3TO6A 3K6GA 5ICCA 2V79A 3F3XA 1AA7A 2Q8KA 5K7HA 4E7ZA 3SEQA 5DCMA 1LUJB 1Y1WJ 1Z3XA 2JA8J 5IYBJ 2X1DA 1ZKGA 3OS2A 1QU3A 4M3GA 1FX7A 2Y2ZA 3SDBA 5D5UB 4TV7A 2W48A 3F6VA 3ZQQA 5CQGA 5GAEJ 2VC0A 5C4XJ 3D5RC 2GOMA 3IAS2 3MZ8A 5M3MJ 5HLTA 3EYIA 4IHXA 2A6TA 1X1PA 2Y48A 3QYBA 2W00A 4A3GJ 3AG3H 3GTKJ 1ZR2A 2NVTJ 1YYVA 4MFEA 4CCOA 1B8IA 3PL8A 3C2BA 2QSGX 2LLKA 3WU1B 2XVCA 3I5UA 2DPUA 1P2FA 1W4MA 2Z99A 3IWZA 2CUFA 2V7FA 1HW1A 2A6EF 4RMNA 4B09A 3V8LA 3OSGA 1D0XA 1WKMA 3I53A 1IN4A 2WC2A 5IT9Z 5DV5A 3K10A 3HM5A 4KN4X 3HGGA 3Q3SA 1MBEA 3MAJA 1FP1D 5IP7J 4XKCA 1MMGA 2DQLA 3T5XA 2PJPA 1YS7A 2VKHA 3B6CA 1A04A 2XGEA 3CMYA 4L0YB 3DP7A 3KZYA 3H3ZA 3GFIA 2V9PA 4RGSA 4P1WA 1QA6A 3HSFA 4N9IA 4IHSA 2F4MB 2XPVA 1GVDA 1VI0A 1BI3A 2HXOA 4X1EA 1VZ0A 1PP8F 2HOSA 4O3MA 2Z3YA 1Z1DA 1WPKA 2NOGA 4XLCA 3FXRA 2KIQA 3N05A 1O57A 4XRFA 4MEXF 3F9KA 5ILUA 1K4TA 3BG7A 4BKXA 3ZMTA 1ERDA 5FRMA 4EJOA 5F27A 2CQXA 3G1OA 3BG3A 2B0LA 1MH3A 2VIXA 3GBGA 4L9TA 5K5QA 4BQNA 1H0MA 2KL4A 2C6YA 4QSHA 3GO5A 2VASA 1U9NA 5IYDJ 3U1DA 3WTSC 1S72I 2GLOA 2QQBA 2WAFA 1G8XA 2P6TA 4NC7A 3HDDA 3W2AA 2Y75A 3I4NJ 2FE3A 4DNCA 1B72A 3D5SC 1OISA 4KISA 3FDYA 1Y56A 4JBAA 2HVQA 3RKXA 1WI3A 2VKDA 3BQZA 3G6EI 3OY9A 1G3WA 2R3SA 1XX5A 3SFIA 4ZJZA 4V2GA 5LGUA 1ZRCA 3GCMA 1QZZA 4UY8I 2DA3A 2KRFA 1I50J 3GZNB 4LG0A 3M8FA 5GPAA 2DCEA 2FBIA 1RIOH 2H1KA 4BL0B 3ZMUA 2MC4A 2DMUA 2ZNYA 2R7VA 1P7IA 1UHWA 1ONVA 1W5TA 2K7LA 2M4KA 4XLPF 1SD5A 5CQEA 4CYCB 1TW3A 4JX5A 5FD5A 5GAGJ 4KDPA 2ZKZA 3FBIB 3LSMA 2LY1A 4EJWA 1AKHB 1I3QJ 2QSFX 2HZTA 3JRFA 3UNGC 2R5YA 3G3ZA 3PQJA 2DMPA 1RR7A 4AM3A 6PAXA 1R22A 2M7AA 2P0WA 4RAFA 2QA4I 2X1EA 3BCAA 3V7SA 1JUPA 4GYGA 4L9VA 2XGDA 3DU6A 1ACIA 3TOAA 3LSTA 4ZH4F 3K1MA 2K3PA 3FM3A 3GFJA 2EV0A 1ZRFA 1D8JA 2ECCA 1G3SA 2FNPA 2KIUA 1I27A 3RYRA 1SMYF 5L3DA 2QCOA 1L0OC 2IRFG 3HG9A 3Q0VA 4HNVA 4A3BJ 1DU6A 2QBYB 1HC8A 2W85A 2QKMB 4EM0B 2LTPA 1DDNA 3ISPA 4LIUA 2BW3B 2KKOA 3FXLA 4KJZA 4CSWA 5GP9A 2QBYA 2EQRA 2GXBA 1D8KA 1LQ1A 3J7AO 5FLMJ 3OYMA 1JE8A 1IV6A 1H8AC 2DMTA 2Y9ZA 1R7JA 2CUJA 1IC8A 4AU7A 2QM3A 1T33A 5J3LA 2ECBA 4RGXA 4MEYF 2MSYA 3FIWA 4ZYDA 1J7KA 1OCOH 2W57A 3FMRA 3CC7I 5HS8A 1JGGA 4JX6A 1QGPA 2O6GE 2M2EA 3H5AA 5E1WA 1R00A 2DJNA 2HU9A 1G3TA 4F91B 1YHQI 3H36A 1ORKA 4EGYA 2LNBA 3GYHX 2NXNB 3MZYA 1X1CA 2AO9A 2BGCA 2IGKA 3C3WA 2KIMA 1SFOJ 1TWHJ 4CICA 1X3UA 2XV4S 1LFPA 3BLYA 1O7FA 4PFPA 1WSUA 2CH0A 2HVRA 2K40A 5LGTA 2WV0A 2EA4A 4NHJA 4P5OA 2JQ7A 2FQ3A 4PSXA 1OYYA 2WBMA 3FMSA 1ZELA 2HDCA 1H88C 5CPRB 2AXLA 3BPVA 3IRRA 1I3AA 1LB2A 2F4IA 4NQWB 4RM3A 1UHMA 3I3LA 4YFXF 3WTYC 2E19A 1REPC 2X0LA 4QPQA 3GTJJ 3PFYA 4S04A 3O2PE 3G1MA 4E7IA 4LG0B 1MNEA 4XLEA 1F36A 1QPMA 1PUFB 1KYWA 2LYCA 2X1CA 2CQKA 1WJCA 4UVCA 2HOAA 1ITYA 2X6WA 1DPUA 1SFEA 3CCEI 3RDIA 4PDKA 1LFBA 3HB9A 2XASA 1YX3A 4Y4RA 3LSPA 4L5EA 2FJ1A 4AIKA 1JKPC 3OV8A 3GTOJ 5M5WJ 1NG7A 2E1MB 4UUTA 1S9HA 5LRRA 3RPQA 3LQQA 4C9YA 1DU0A 4BACA 2VQLA 2QGUA 3J7AY 3QP5A 4OIOF 3HGYA 4IPAA 1YJNI 1ETOA 3IAM2 2YR2A 3S1NJ 1IRXA 3GLLA 4ZZLA 2R7RA 3M4OJ 2NS8A 2J5PA 1H89C 2F2EA 1H9GA 1R1VA 1S7EA 1IF1A 3F8CA 2K9SA 2EFWA 3K4JA 3ZXSA 4F3QA 2LKSA 3ONQA 3ABUA 4O5VA 2K86A 2M3AA 3DQVC 2BYVE 3LWFA 2UXXA 4NB5A 3FX3A 5D6FA 2XC7A 1USTA 1G59A 3OYHA 3VYSB 3BZCA 2R7OA 4D9JA 4CZCA 3Q0UA 2AQEA 2DA4A 1XMAA 2JT1A 1BIBA 4BS9A 1HKSA 1LDKB 3JRGA 2O9LA 2DTZA 2VB6A 3WGHA 4YFNF 4CYCA 1O3SA 1W0UA 1LVKA 3HKZA 1I5ZA 2XAQA 4HLXA 2O3FA 5JHFA 3E1SA 2STWA 1VQPI 2EINH 5KK1A 3RSNA 2Z2SB 4ON0A 4OAYA 4AIHA 3CUQA 3O8HA 1FPQA 2W1OA 5F04A 3MZHA 1MW7A 4HX4A 2JPBA 4S05A 4ESFA 5J40A 3KEYA 3PIPF 4FETA 2CQQA 3IH2A 3CZ6A 3X2QH 5FGMA 4BQOA 4B3XA 4E4HA 3R60A 2BZTA 1D3YA 1ZG5A 2KRCA 3DEWA 3WE3A 5IT9K 4BJ6C 4KMUX 3I54A 1R71A 3FKJA 1BJAA 2W82A 3I58A 1SAUA 2L4MA 3BTLA 4XKWA 1IRZA 3SZPA 4EJUA 1XB4A 2Y0SA 3M1CA 1D1AA 3REOA 3BR5A 3LA2A 1K7AA 2OD5A 5DM6F 1U78A 4EJTA 1FIAA 4BJ5C 4BHPA 2EIMH 5F1RA 1W0TA 3GFLA 1NHAA 4Y52J
chains in the Genus database with same CATH topology
3S2DJ 3S1MJ 3FK7A 3A01A 1XS9A 3LSRA 1F43A 3SDGA 1ZGWA 1VNDA 2JWTA 2MW8A 4QIWN 2XPWA 2DA7A 4ABZA 2EH3A 1CQTA 2I10A 1VF9A 3S1QJ 3SJMA 2E2HJ 3RQIA 2R93J 4LOCA 1RESA 2X48A 3FKIJ 2XPUA 5BNGA 2R92J 1X2NA 1JTXA 3W6VA 2X6OA 4Y7NJ 3GTGJ 1MBHA 5FKKA 2JN6A 3S2HJ 5K7ZA 2M9HA 2WV1A 3B6AA 4A3DJ 5JLXA 2DA6A 4B3AA 3S16J 3BR6A 1ZK8A 4A69C 2Y9YA 1BJZA 2JK3A 1EF4A 1JT6A 1U8BA 3JRHA 5HODA 2HI3A 4G12A 5J1RA 3CCYA 3IH4A 4A3MJ 1ETWA 1TWCJ 1UMQA 3LSGA 1K83J 2VPRA 3CQZJ 1HOMA 2EZIA 1JKRC 2MG4A 2OPTA 3RZDJ 1LE8B 2FD5A 4UUSA 3TP0A 9ANTA 2JJ7A 4UUSB 5EG0A 5IYCJ 1LFUP 2Y30A 5EZGA 2CJJA 2JA6J 3JRIA 3BT9A 5J1UA 2E1OA 4A3JJ 2XSDC 2M0CA 2EZKA 3GTMJ 2IBDA 4D5FA 3K2AA 3A01B 1ETYA 3HKZN 4IHYA 4FCYA 1BW5A 1JKOC 1X2MA 1RETA 3OOUA 4A3IJ 1Q1VA 4QTRA 2WB1N 3RZOJ 1ETQA 2JA7J 5M3FJ 1HDDC 4AC0A 2N8GA 2LKXA 2G0EA 5K7HA 3RKQA 2KT0A 4AYBN 1Y1WJ 2JA8J 3FK6A 2EZLA 5IYBJ 3HOXJ 1ZKGA 1UG2A 4M3GA 5F0CA 1AHDP 2Y2ZA 5GPCA 3BTJA 2PMZN 2K9NA 5EYRA 2W48A 5FJ8J 2IAIA 3LSJA 3Q0WA 5C4XJ 1TWGJ 4M3EA 4DZJA 2E2JJ 1TC3C 4XRSG 2EZHA 1GV5A 2XGCA 5M3MJ 1TWFJ 4BBRJ 1MSFC 4IHXA 4A3GJ 2ME0A 3GTKJ 1ZR2A 1Y1VJ 1ETKA 2NVTJ 2VKEA 4M3DA 4MFEA 1MBFA 4A3FJ 3JREA 1B8IA 2HDDA 3C2BA 2R5ZA 4I6ZA 2LLKA 3OIOA 1X58A 2CUFA 1QPIA 3OSGA 5IOZA 1B72B 2ID6A 2LD5A 1OJLA 2L7MP 4A3LJ 1NTCA 3HM5A 3HGGA 3Q3SA 5FKLA 1MBEA 1HLVA 3G1LA 1OFCX 3QQAA 5IP7J 4BY1J 5E3NA 2HXIA 3B6CA 2XGEA 2TRTA 3CMYA 1U9OA 4M3FA 4B4CA 3H3VK 2FX0A 2XPVA 1GVDA 1VI0A 2FQ4A 2HXOA 3BQYA 3H0GJ 4X1EA 4DW6A 2HOSA 2O8KA 1WPKA 2NOGA 3PO3J 2CRGA 1R9TJ 5E3LA 4DYQA 2YUSA 1MBKA 4GFBA 4BKXA 1WH7A 1Z0XA 5J1YA 3BTCA 3IH3A 3HOZJ 5M5XJ 1FTTA 2L7ZA 5FLVA 5F27A 3HOWJ 2CQXA 3G1OA 3K7AJ 3BG3A 1MH3A 3GBGA 3ZQLA 1IGNA 4J19A 2VKVA 4QSHA 1U9NA 5IYDJ 1POGA 4XRMA 3LOCA 2R5ZB 2GLOA 3BG5A 5IP6A 1B8IB 3HDDA 1WCMJ 3I4NJ 2L0KA 5FKMA 5K7FA 1B72A 4M6VA 1JKQC 1WI3A 2ID3A 3HOUJ 3DCFA 3BQZA 1PUFA 3PO2J 3SFIA 4V2GA 4AUXA 1NK2P 2LFBA 2K9QA 5EF6A 1G2HA 4DYCA 2RAEA 3BR2A 2DA3A 1I50J 3ZQCA 4FE7A 5GPAA 2H1KA 4D7MA 1YRNA 3I4MJ 2DMUA 2ME6A 1P7IA 4A3KJ 1IDZA 4RDUA 1HF0A 4CYCB 4JX5A 1GUUA 2COBA 2WAQN 1AKHB 1AKHA 1I3QJ 3GTLJ 2XB5A 1ETXA 1BL0A 3JRFA 5EGOA 5DS9A 2R5YA 3D1NI 1FIPA 3S1RJ 2DA2A 2DMPA 1E3OC 1RR7A 2QF7A 2M34A 3VPRA 2MGQA 3CDLA 1QVUA 3JR9A 2CUEA 1JUPA 3ZQIA 4IHVA 2XGDA 2H8RA 3L1PA 1MSEC 5F08A 5M5YJ 2R0QC 2NVYJ 1ENHA 1HCRA 2VI6A 2ECCA 2TCTA 5FKOA 1MBGA 5F0HA 4FE4A 2QCOA 1DU6A 2XRLA 4D7NA 3Q0VA 1ZTRA 4M3BA 4HNVA 4A3BJ 2NVQJ 2LTPA 3BR1A 4MFDA 4XICA 5IPAA 4NDLA 4DZPA 1I6HJ 3GTPJ 5GP9A 1VFCA 2EQRA 4DYRA 5FLMJ 2B63J 1IV6A 1H8AC 2DMTA 4C2MJ 1XC5A 3FISA 2Y9ZA 3A02A 1OCPA 3TP3A 3PM1A 1IC8A 1T33A 1APLC 1OCTC 5J3LA 2ECBA 2MSYA 4W1UA 3FIWA 1Z77A 3MVPA 2O7OA 4V2FA 1JGGA 5C3EJ 4X6AJ 4JX6A 3ZQGA 1JJ6C 1D5YA 2M2EA 3HOYJ 2DJNA 1LE8A 2ELKA 1ORKA 5JLWA 3S17J 2IEKA 4B1RA 4MIMA 2Y31A 4IEJA 3ZOBA 4JYKA 2AO9A 3IV5A 2AHQA 1SFOJ 3S15J 1TWHJ 2Y0SN 3OSFA 1T56A 4BBSJ 2DA1A 1QVTA 2DN0A 1IDYA 2YU9J 2K40A 1IUFA 1JTYA 1ZR4A 2GBYA 4A93J 4BY7J 1RKWA 5EZHA 1H88C 1A5JA 1HDPA 4JP0A 3TW6A 3JRCA 2NS7A 2M8GX 4W97A 1AU7A 4JX4A 3ZQFA 2E19A 3GTJJ 3G1MA 1IG7A 4XIDA 2YS9A 1F36A 2EBIA 1PUFB 4MLOA 2HOAA 1QRYA 3NAUA 3M3YJ 1ITYA 2NVXJ 2DMQA 1TWAJ 1LFBA 3HB9A 4FTHA 5IOYA 2LK2A 3JRBA 1XG1A 3LSPA 5EGOB 4L5EA 2FJ1A 1JKPC 3BR0A 5IP9J 3GTOJ 5M5WJ 4UUTA 4C3IJ 4RBOA 2HYJA 1DU0A 1JUMA 5E3MA 5EEAA 1WGXA 3HGYA 3TEDA 2HOTA 4D5CA 1ETOA 1FJLA 5F0FA 3S1NJ 2OF7A 2L7FP 3M4OJ 1WH5A 2NS8A 3QPLA 1H89C 3O8GA 5F1JA 3JRDA 1S7EA 5C4JJ 1JUSA 2LR8A 2K9SA 1UHSA 5EG0B 1SANA 4A3CJ 1JT0A 2ZB9A 1MBJA 1JJ8C 2JA5J 1ETVA 1BA5A 3LNQA 2L9RA 1O4XA 2CU7A 1IJWC 5DTDA 1BW6A 4I76A 5C44J 3Q0UA 2DA4A 3NARA 4S0HB 2R5YB 2DA5A 3GTQJ 2P81A 3JRGA 2O9LA 2DTZA 4CYCA 2E2IJ 1W0UA 2JMWA 2D5VA 3E7LA 1ZQ3P 3BR3A 4XK4A 1YRNB 3QPSA 2GM4A 1MH4A 1FTZA 1FEXA 2R7ZJ 2HQ5A 3O8HA 3MKLA 5F04A 3HEFA 3WHCA 3UKGA 5EDNA 1GV2A 1GDTA 2CQQA 3IH2A 1RPWA 2VUMJ 2LVSA 3TW7A 2LP0A 2KDZA 3HOVJ 4IHWA 1P7JA 3DEWA 2DMNA 5FKNA 4BXXJ 3S14J 3BG9A 3ZQHA 4FISA 3BTLA 1IRZA 4C3JJ 4MO7A 3BR5A 1A6IA 2X9DA 2LY9A 3A03A 4C3HJ 3JRAA 1K61A 1U78A 5E3OA 3MN2A 1FIAA 3HBLA 1NK3P 3WHBA 3BTIA 1W0TA 1MNMC 1RKTA 2XB0X 3F0CA 4XRSA 1GT0C 4A3EJ 4EEFG 4Y52J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D J;  3S1M J;  3FK7 A;  3A01 A;  1XS9 A;  3LSR A;  1F43 A;  3SDG A;  1ZGW A;  1VND A;  2JWT A;  2MW8 A;  4QIW N;  2XPW A;  2DA7 A;  4ABZ A;  2EH3 A;  1CQT A;  2I10 A;  1VF9 A;  3S1Q J;  3SJM A;  2E2H J;  3RQI A;  2R93 J;  4LOC A;  1RES A;  2X48 A;  3FKI J;  2XPU A;  5BNG A;  2R92 J;  1X2N A;  1JTX A;  3W6V A;  2X6O A;  4Y7N J;  3GTG J;  1MBH A;  5FKK A;  2JN6 A;  3S2H J;  5K7Z A;  2M9H A;  2WV1 A;  3B6A A;  4A3D J;  5JLX A;  2DA6 A;  4B3A A;  3S16 J;  3BR6 A;  1ZK8 A;  4A69 C;  2Y9Y A;  1BJZ A;  2JK3 A;  1EF4 A;  1JT6 A;  1U8B A;  3JRH A;  5HOD A;  2HI3 A;  4G12 A;  5J1R A;  3CCY A;  3IH4 A;  4A3M J;  1ETW A;  1TWC J;  1UMQ A;  3LSG A;  1K83 J;  2VPR A;  3CQZ J;  1HOM A;  2EZI A;  1JKR C;  2MG4 A;  2OPT A;  3RZD J;  1LE8 B;  2FD5 A;  4UUS A;  3TP0 A;  9ANT A;  2JJ7 A;  4UUS B;  5EG0 A;  5IYC J;  1LFU P;  2Y30 A;  5EZG A;  2CJJ A;  2JA6 J;  3JRI A;  3BT9 A;  5J1U A;  2E1O A;  4A3J J;  2XSD C;  2M0C A;  2EZK A;  3GTM J;  2IBD A;  4D5F A;  3K2A A;  3A01 B;  1ETY A;  3HKZ N;  4IHY A;  4FCY A;  1BW5 A;  1JKO C;  1X2M A;  1RET A;  3OOU A;  4A3I J;  1Q1V A;  4QTR A;  2WB1 N;  3RZO J;  1ETQ A;  2JA7 J;  5M3F J;  1HDD C;  4AC0 A;  2N8G A;  2LKX A;  2G0E A;  5K7H A;  3RKQ A;  2KT0 A;  4AYB N;  1Y1W J;  2JA8 J;  3FK6 A;  2EZL A;  5IYB J;  3HOX J;  1ZKG A;  1UG2 A;  4M3G A;  5F0C A;  1AHD P;  2Y2Z A;  5GPC A;  3BTJ A;  2PMZ N;  2K9N A;  5EYR A;  2W48 A;  5FJ8 J;  2IAI A;  3LSJ A;  3Q0W A;  5C4X J;  1TWG J;  4M3E A;  4DZJ A;  2E2J J;  1TC3 C;  4XRS G;  2EZH A;  1GV5 A;  2XGC A;  5M3M J;  1TWF J;  4BBR J;  1MSF C;  4IHX A;  4A3G J;  2ME0 A;  3GTK J;  1ZR2 A;  1Y1V J;  1ETK A;  2NVT J;  2VKE A;  4M3D A;  4MFE A;  1MBF A;  4A3F J;  3JRE A;  1B8I A;  2HDD A;  3C2B A;  2R5Z A;  4I6Z A;  2LLK A;  3OIO A;  1X58 A;  2CUF A;  1QPI A;  3OSG A;  5IOZ A;  1B72 B;  2ID6 A;  2LD5 A;  1OJL A;  2L7M P;  4A3L J;  1NTC A;  3HM5 A;  3HGG A;  3Q3S A;  5FKL A;  1MBE A;  1HLV A;  3G1L A;  1OFC X;  3QQA A;  5IP7 J;  4BY1 J;  5E3N A;  2HXI A;  3B6C A;  2XGE A;  2TRT A;  3CMY A;  1U9O A;  4M3F A;  4B4C A;  3H3V K;  2FX0 A;  2XPV A;  1GVD A;  1VI0 A;  2FQ4 A;  2HXO A;  3BQY A;  3H0G J;  4X1E A;  4DW6 A;  2HOS A;  2O8K A;  1WPK A;  2NOG A;  3PO3 J;  2CRG A;  1R9T J;  5E3L A;  4DYQ A;  2YUS A;  1MBK A;  4GFB A;  4BKX A;  1WH7 A;  1Z0X A;  5J1Y A;  3BTC A;  3IH3 A;  3HOZ J;  5M5X J;  1FTT A;  2L7Z A;  5FLV A;  5F27 A;  3HOW J;  2CQX A;  3G1O A;  3K7A J;  3BG3 A;  1MH3 A;  3GBG A;  3ZQL A;  1IGN A;  4J19 A;  2VKV A;  4QSH A;  1U9N A;  5IYD J;  1POG A;  4XRM A;  3LOC A;  2R5Z B;  2GLO A;  3BG5 A;  5IP6 A;  1B8I B;  3HDD A;  1WCM J;  3I4N J;  2L0K A;  5FKM A;  5K7F A;  1B72 A;  4M6V A;  1JKQ C;  1WI3 A;  2ID3 A;  3HOU J;  3DCF A;  3BQZ A;  1PUF A;  3PO2 J;  3SFI A;  4V2G A;  4AUX A;  1NK2 P;  2LFB A;  2K9Q A;  5EF6 A;  1G2H A;  4DYC A;  2RAE A;  3BR2 A;  2DA3 A;  1I50 J;  3ZQC A;  4FE7 A;  5GPA A;  2H1K A;  4D7M A;  1YRN A;  3I4M J;  2DMU A;  2ME6 A;  1P7I A;  4A3K J;  1IDZ A;  4RDU A;  1HF0 A;  4CYC B;  4JX5 A;  1GUU A;  2COB A;  2WAQ N;  1AKH B;  1AKH A;  1I3Q J;  3GTL J;  2XB5 A;  1ETX A;  1BL0 A;  3JRF A;  5EGO A;  5DS9 A;  2R5Y A;  3D1N I;  1FIP A;  3S1R J;  2DA2 A;  2DMP A;  1E3O C;  1RR7 A;  2QF7 A;  2M34 A;  3VPR A;  2MGQ A;  3CDL A;  1QVU A;  3JR9 A;  2CUE A;  1JUP A;  3ZQI A;  4IHV A;  2XGD A;  2H8R A;  3L1P A;  1MSE C;  5F08 A;  5M5Y J;  2R0Q C;  2NVY J;  1ENH A;  1HCR A;  2VI6 A;  2ECC A;  2TCT A;  5FKO A;  1MBG A;  5F0H A;  4FE4 A;  2QCO A;  1DU6 A;  2XRL A;  4D7N A;  3Q0V A;  1ZTR A;  4M3B A;  4HNV A;  4A3B J;  2NVQ J;  2LTP A;  3BR1 A;  4MFD A;  4XIC A;  5IPA A;  4NDL A;  4DZP A;  1I6H J;  3GTP J;  5GP9 A;  1VFC A;  2EQR A;  4DYR A;  5FLM J;  2B63 J;  1IV6 A;  1H8A C;  2DMT A;  4C2M J;  1XC5 A;  3FIS A;  2Y9Z A;  3A02 A;  1OCP A;  3TP3 A;  3PM1 A;  1IC8 A;  1T33 A;  1APL C;  1OCT C;  5J3L A;  2ECB A;  2MSY A;  4W1U A;  3FIW A;  1Z77 A;  3MVP A;  2O7O A;  4V2F A;  1JGG A;  5C3E J;  4X6A J;  4JX6 A;  3ZQG A;  1JJ6 C;  1D5Y A;  2M2E A;  3HOY J;  2DJN A;  1LE8 A;  2ELK A;  1ORK A;  5JLW A;  3S17 J;  2IEK A;  4B1R A;  4MIM A;  2Y31 A;  4IEJ A;  3ZOB A;  4JYK A;  2AO9 A;  3IV5 A;  2AHQ A;  1SFO J;  3S15 J;  1TWH J;  2Y0S N;  3OSF A;  1T56 A;  4BBS J;  2DA1 A;  1QVT A;  2DN0 A;  1IDY A;  2YU9 J;  2K40 A;  1IUF A;  1JTY A;  1ZR4 A;  2GBY A;  4A93 J;  4BY7 J;  1RKW A;  5EZH A;  1H88 C;  1A5J A;  1HDP A;  4JP0 A;  3TW6 A;  3JRC A;  2NS7 A;  2M8G X;  4W97 A;  1AU7 A;  4JX4 A;  3ZQF A;  2E19 A;  3GTJ J;  3G1M A;  1IG7 A;  4XID A;  2YS9 A;  1F36 A;  2EBI A;  1PUF B;  4MLO A;  2HOA A;  1QRY A;  3NAU A;  3M3Y J;  1ITY A;  2NVX J;  2DMQ A;  1TWA J;  1LFB A;  3HB9 A;  4FTH A;  5IOY A;  2LK2 A;  3JRB A;  1XG1 A;  3LSP A;  5EGO B;  4L5E A;  2FJ1 A;  1JKP C;  3BR0 A;  5IP9 J;  3GTO J;  5M5W J;  4UUT A;  4C3I J;  4RBO A;  2HYJ A;  1DU0 A;  1JUM A;  5E3M A;  5EEA A;  1WGX A;  3HGY A;  3TED A;  2HOT A;  4D5C A;  1ETO A;  1FJL A;  5F0F A;  3S1N J;  2OF7 A;  2L7F P;  3M4O J;  1WH5 A;  2NS8 A;  3QPL A;  1H89 C;  3O8G A;  5F1J A;  3JRD A;  1S7E A;  5C4J J;  1JUS A;  2LR8 A;  2K9S A;  1UHS A;  5EG0 B;  1SAN A;  4A3C J;  1JT0 A;  2ZB9 A;  1MBJ A;  1JJ8 C;  2JA5 J;  1ETV A;  1BA5 A;  3LNQ A;  2L9R A;  1O4X A;  2CU7 A;  1IJW C;  5DTD A;  1BW6 A;  4I76 A;  5C44 J;  3Q0U A;  2DA4 A;  3NAR A;  4S0H B;  2R5Y B;  2DA5 A;  3GTQ J;  2P81 A;  3JRG A;  2O9L A;  2DTZ A;  4CYC A;  2E2I J;  1W0U A;  2JMW A;  2D5V A;  3E7L A;  1ZQ3 P;  3BR3 A;  4XK4 A;  1YRN B;  3QPS A;  2GM4 A;  1MH4 A;  1FTZ A;  1FEX A;  2R7Z J;  2HQ5 A;  3O8H A;  3MKL A;  5F04 A;  3HEF A;  3WHC A;  3UKG A;  5EDN A;  1GV2 A;  1GDT A;  2CQQ A;  3IH2 A;  1RPW A;  2VUM J;  2LVS A;  3TW7 A;  2LP0 A;  2KDZ A;  3HOV J;  4IHW A;  1P7J A;  3DEW A;  2DMN A;  5FKN A;  4BXX J;  3S14 J;  3BG9 A;  3ZQH A;  4FIS A;  3BTL A;  1IRZ A;  4C3J J;  4MO7 A;  3BR5 A;  1A6I A;  2X9D A;  2LY9 A;  3A03 A;  4C3H J;  3JRA A;  1K61 A;  1U78 A;  5E3O A;  3MN2 A;  1FIA A;  3HBL A;  1NK3 P;  3WHB A;  3BTI A;  1W0T A;  1MNM C;  1RKT A;  2XB0 X;  3F0C A;  4XRS A;  1GT0 C;  4A3E J;  4EEF G;  4Y52 J; 
#chains in the Genus database with same CATH topology
 3L7W A;  3S1M J;  3FK7 A;  1BI1 A;  4ZYA A;  4WWC A;  1XS9 A;  4WXC A;  3SDG A;  4OIR F;  1WJ5 A;  3WG9 A;  2JWT A;  2MW8 A;  4EAT A;  4DBR A;  5HDN A;  5LEJ A;  1BBY A;  2EH3 A;  2VON A;  4BDZ A;  1CQT A;  3VSL A;  4CCK A;  1VQK I;  2ETH A;  2E2H J;  1I1S A;  1XPX A;  3FKI J;  4L18 B;  1X2N A;  5ICG A;  2VQH A;  2ZJ2 A;  2X6O A;  2DJI A;  3BPX A;  1S7A A;  1MZB A;  3TKY A;  4JOM A;  5FKK A;  3Q9S A;  3DBH B;  2M9H A;  3B6A A;  2WV1 A;  3OYG A;  1G4D A;  4QPO A;  1HBX G;  3FXM A;  1F9N A;  4K2E A;  5LEK A;  3MKW B;  4CCJ A;  2OCC H;  4A69 C;  2Y9Y A;  2F4O B;  3V4G A;  2E7W A;  4LD5 A;  2IW5 A;  1FBU A;  2VQG A;  1JT6 A;  2DO7 A;  1SVL A;  1YQA A;  4UB6 C;  1U8B A;  1WZ2 A;  3ASO H;  4OWR B;  5J1R A;  3IUO A;  3FHN A;  1UMQ A;  4BDY A;  1Z9C A;  1TL8 A;  3CLQ A;  4KIT B;  4I0A A;  3I64 A;  3F8N A;  4FQG A;  3D0S A;  1JKR C;  1PUE E;  3GWZ A;  5L3E A;  1BC7 C;  2IS1 A;  4XLA A;  9ANT A;  3M1E A;  1J9I A;  2M87 A;  1LFU P;  1V3F A;  2CJJ A;  4L5J A;  3CCU I;  3CCM I;  3BT9 A;  3WTU C;  4ENM A;  2JTV A;  3NEU A;  4IJA A;  4A3J J;  2OC6 A;  2XSD C;  2EJR A;  4D5F A;  3K2A A;  1ETY A;  1B4A A;  4HG2 A;  2NS0 A;  4NC6 A;  1Y0N A;  1GLN A;  2XAU A;  4FCY A;  5JI6 A;  2BXY A;  3PNV A;  4OOI A;  5FLX K;  1PDN C;  1A36 A;  2WB1 N;  3CP8 A;  3OMY A;  3K9T A;  2L7K A;  4AC0 A;  3CCR I;  2N8G A;  4F55 A;  4FX4 A;  5D4R A;  2XDV A;  4WK8 F;  4FX0 A;  4Q5S F;  1HXD A;  2A6H F;  5IT3 A;  2W25 A;  2EZL A;  3FK6 A;  2DT5 A;  3HOX J;  2HEO A;  4GCV A;  3F23 A;  3KP3 A;  1SD4 A;  2PMZ N;  5DUI A;  2CV0 A;  3HPG A;  2H09 A;  2K9N A;  4XN3 A;  2ZO4 A;  5E18 F;  2CQN A;  1YI2 I;  5L3F A;  3GEZ A;  3MWM A;  2MAB A;  4XRS G;  2RVC A;  4KFC A;  4QWQ A;  2XGC A;  4BBR J;  1MSF C;  4HSR A;  1YO5 C;  3AFH A;  4LLL A;  1ZGA A;  1FT9 A;  2E34 A;  5H20 A;  1ETK A;  3PSF A;  1W7P D;  4A3F J;  3JRE A;  3ZRG A;  3GLX A;  1SFU A;  2E60 A;  5GTI C;  5IOZ A;  1B72 B;  2DK8 A;  2ID6 A;  2LD5 A;  1OJL A;  2L7M P;  4A3L J;  1MMN A;  1NTC A;  3FMQ A;  5D8L B;  1U3E M;  4CHU A;  4IQ4 A;  5KVR A;  4XQF A;  2DT7 B;  3CTA A;  4BY1 J;  1Y8R B;  2ZJP F;  1RNL A;  2P7V B;  3CUO A;  1U9O A;  2L02 A;  1HQC A;  2VBZ A;  3HTS B;  4I7H A;  3G71 I;  5LLQ A;  2L9V A;  1Z05 A;  2FX0 A;  2K4B A;  4A0Z A;  2ACJ A;  4HLY A;  4F93 B;  4BE2 A;  1ODD A;  3H0G J;  3BQY A;  1J59 A;  2MYS A;  2O8K A;  4PGH A;  3JTH A;  2FU4 A;  4HA8 A;  4B8X A;  2CRG A;  3E6D A;  4ASN A;  2VJJ A;  1WI9 A;  3RIR A;  4DYQ A;  1YW7 A;  4OU0 A;  4RGR A;  1TQM A;  2GA1 A;  3JAM K;  3IH3 A;  5J4Y A;  5M5X J;  1FTT A;  1HA8 A;  3HOW J;  4RGU A;  4H0E A;  2E1C A;  2LY2 A;  3ZQL A;  2O0Y A;  2HR3 A;  1IGN A;  2ZME A;  3HTU A;  5E79 C;  1L3L A;  1POG A;  1JHH A;  4RLQ A;  3DEE A;  1HW5 A;  4GRI A;  2R5Z B;  3BG5 A;  4OMZ A;  4OIP F;  1R4M B;  5CVI A;  5FKM A;  3TL4 X;  1B1B A;  4B44 A;  3CCS I;  1IN5 A;  4A6D A;  4L9N A;  5B1A H;  4ENJ A;  1JKQ C;  2W4S A;  2ID3 A;  4BXU A;  4GO1 A;  1G6N A;  4U0W A;  4AWX B;  4HRI A;  3HOU J;  4XOR A;  2XF6 A;  1DUX C;  1NK2 P;  2LFB A;  3NWT A;  4WCG A;  3DTK A;  1V55 H;  3AAF A;  4L9J A;  4ITV A;  3ZQC A;  2WA0 A;  3QOE A;  2BBY A;  4Y15 A;  1TP4 A;  2BVL A;  3I4M J;  2NYX A;  4NQW A;  5TRD A;  1D0Z A;  4F92 B;  1HF0 A;  4BYY A;  2HOE A;  3GFM A;  3K70 D;  1J2X A;  2H27 A;  4XM3 A;  2P7C B;  3S3M A;  1S6L A;  1FYM A;  1GUU A;  2COB A;  3JSP A;  1RRJ A;  2F5V A;  2VOP A;  4EGZ A;  1QQI A;  3QWL A;  1FBQ A;  1XCB A;  2XRN A;  3CP2 A;  3TDZ C;  2XKO A;  3LA7 A;  2QLZ A;  1ZN2 A;  1GHC A;  5EGO A;  4LIT A;  3QPT A;  2NNY A;  2Z9O A;  3D1N I;  2XSJ C;  3S1R J;  2DA2 A;  1IN7 A;  2P8T A;  1MJB A;  3MMY B;  2QF7 A;  3H3U A;  2CG4 A;  2VJ5 A;  3A2K A;  3HHH A;  1JGS A;  2MGQ A;  3CDL A;  4IHV A;  1IUY A;  3H9Q A;  2MD0 A;  3ABM H;  2ZC2 A;  3E5Q A;  2D1H A;  3ESW B;  2XAG A;  5F08 A;  1ZG3 A;  3CJT B;  1BR2 A;  3VSK A;  2B7E A;  2R0Q C;  2KZV A;  3H35 A;  3CDI A;  3OYN A;  1YTY A;  2IA2 A;  3FWE A;  1Z21 A;  2FSW A;  2CFX A;  3CES A;  4YG2 F;  5F0H A;  5FFX A;  2WAD A;  4FE4 A;  4A0Y A;  4M3B A;  3R4K A;  3ROU A;  2VL8 A;  2NVQ J;  2COM A;  1AOY A;  3BR1 A;  2CSO A;  5A2Q Z;  4NDL A;  3OYL A;  2VBY A;  4DZP A;  1WJE A;  2DOD A;  5HNH A;  4G8X A;  1W36 D;  3GTP J;  3MKY B;  1XDU A;  2JUG A;  3VB2 A;  3W3C A;  2A5W A;  3CC2 I;  1EJ9 A;  3WTZ A;  3PM1 A;  3HRS A;  1APL C;  3GF2 A;  5TJJ A;  5JVG F;  1OCT C;  4EM2 A;  3CO6 C;  5LFA A;  1X4O A;  4W1U A;  2ISZ A;  1Z77 A;  1K4S A;  4NBQ A;  5A2Q K;  1XGO A;  3PIO F;  1FSE A;  2O7O A;  3BZK A;  1R23 A;  2ESH A;  4X6A J;  3ZQG A;  4UNO A;  1QZE A;  1U2W A;  2CYY A;  3C2G A;  4MNU A;  2ELK A;  4RB1 A;  1XGM A;  4MTE A;  1T39 A;  3QYE A;  5BOX A;  1O3Q A;  2IEK A;  2VN2 A;  4MIM A;  3ERE D;  3DBL B;  2UXN A;  2RNG A;  3P5J A;  3R0A A;  2R7S A;  4PCQ A;  2Y0S N;  3OSF A;  3DKX A;  4BBS J;  2IGM A;  4PFO A;  2K85 A;  4IVN A;  4U87 A;  2XAH A;  1RUN A;  2QQ9 A;  5CVU A;  5JHU A;  4G6D A;  1JTY A;  1GVJ A;  3I4P A;  3WOD F;  3AL0 B;  5D5V B;  1QZY A;  1RKW A;  1A5J A;  4A0X A;  2UV1 A;  3HL2 A;  4I99 C;  4NNJ A;  4LJZ F;  2E1N A;  4XSZ F;  3IL2 A;  1N78 A;  2A07 F;  4JX4 A;  5LHG A;  3ZQF A;  3LSH A;  4E6K G;  5D6E A;  2XAJ A;  1KU7 A;  3OR2 C;  3VWB A;  4XID A;  2VT2 A;  2YS9 A;  1YIO A;  2VLA A;  2BEO A;  2KZG A;  2PBI A;  3HUG A;  1YIT I;  3K4C A;  1M1E B;  4A5M A;  1F5T A;  4WX9 A;  1WWX A;  2PG4 A;  1QRY A;  3M3Y J;  1W36 C;  1TWA J;  1BI2 A;  2WAQ A;  1RC9 A;  5IOY A;  4XLH A;  2LK2 A;  5IY5 H;  3V8J A;  5B1B H;  1KYZ A;  1X3W B;  5F6F A;  1XSV A;  1BM9 A;  2L4A A;  3CMM A;  2X4H A;  2FA5 A;  1YFH A;  4D0P A;  4HNU A;  3K4B A;  3TO9 A;  3IP4 B;  1ZHF A;  1MIJ A;  1JUM A;  2ZSI B;  4XSX F;  5E3M A;  1JI8 A;  2CMP A;  1OYW A;  1CF7 A;  4CXF A;  1FOK A;  3I59 A;  1KQ8 A;  1T98 A;  2LBF A;  3RTR A;  4HST A;  4N9H A;  1FJL A;  3S32 A;  4IL6 C;  2CS3 A;  1QHH D;  1DPR A;  3LL7 A;  3QPL A;  3WGG A;  2V1D A;  3AG1 H;  3JRD A;  1LEA A;  1JUS A;  3CJR B;  3J81 K;  2QEN A;  3H9G A;  2CV1 A;  1OYI A;  5GAD J;  2IA1 A;  1JT0 A;  5BMZ A;  1MBJ A;  2A68 F;  2XUB A;  2L5Q A;  2D45 A;  2VJ4 A;  4LIV A;  2BY2 A;  1F1Z A;  4IKF A;  2L9R A;  2DOA A;  1O4X A;  4NUB A;  5DTD A;  1Z6T A;  4RLF A;  2EIL H;  2DDB A;  1Z67 A;  2KIF A;  3JCU C;  1LPQ A;  3NAR A;  1OQY A;  2HDW A;  2JRT A;  3GTQ J;  3TMO A;  2XGX A;  3ZR8 X;  2E2I J;  3KYD B;  1OMI A;  2JMW A;  2ZCW A;  4KIG A;  2A61 A;  1OR7 C;  3E7L A;  4XK4 A;  1YRN B;  2FOW A;  2GM4 A;  5FRN A;  2V1U A;  5H6Q A;  1FLI A;  1FEX A;  2R7Z J;  3EUH C;  2ICW G;  3K69 A;  4PJJ A;  3VOD A;  2MH2 A;  3B02 A;  2NRA C;  3WHC A;  2GOX B;  2ZXW H;  4KUM A;  1GDT A;  2VBX A;  2DU9 A;  4RAY A;  1RPW A;  4BEH A;  1B6A A;  5J8F A;  5EEG A;  2LVS A;  3TW7 A;  3P7N A;  2KDZ A;  2R7W A;  4IHW A;  1P7J A;  4B48 A;  3M07 A;  4BXX J;  2LDU A;  1X1B A;  3WU2 C;  5HNF A;  4ENK A;  3ABK H;  1WJD A;  2MBF A;  4I2O A;  1OKR A;  3KP7 A;  3J7Y J;  4DJA A;  2VOO A;  2QVO A;  2X9D A;  4C3H J;  1SC7 A;  4GYI A;  2DXI A;  2JSP A;  4ZDP A;  2EV6 A;  3VYR B;  2M8E A;  2DDA A;  2H1L A;  2DPD A;  1FOX A;  3HBL A;  3COA C;  2UWM A;  1FYK A;  1IXS B;  2F5E A;  1MNM C;  2XB0 X;  4XRS A;  3BP8 A;  4ZTF A;  4YEL A;  1Y6I A;  2EFO A;  3KEO A;  2CO5 A;  1JHF A;  5L3G A;  2Q1Z B;  2Q0O A;  2FNA A;  3G4S I;  3RCO A;  2I8D A;  1T95 A;  1FNN A;  2PFB A;  4QIW N;  2GAU A;  1ON1 A;  3L00 A;  1E2X A;  2ELJ A;  2I10 A;  4UB8 C;  2UZK A;  3OR1 C;  4HQM A;  2M1B A;  2OTJ I;  2P6S A;  3KE2 A;  3KZZ A;  1FMV A;  2CUZ A;  1IRF A;  1U5T A;  3W6V A;  1ZH5 A;  3OS0 A;  4C2T A;  3HPH A;  1FZP B;  3E3V A;  2GIV A;  3OS1 A;  1C0W A;  2JRM A;  1FSH A;  2XHK A;  4A3D J;  2DA6 A;  4B3A A;  3GME A;  3HHG A;  4IZZ A;  4OIN F;  3F8B A;  4FAS D;  4HQE A;  3DPT A;  2X85 A;  1BJZ A;  3S93 A;  4B47 A;  2J5O A;  4HAM A;  2RQP A;  4BHC A;  1WVR A;  3JRH A;  4Z6Y A;  4G12 A;  2OTL I;  4B43 A;  2LF7 A;  3CCY A;  3IH4 A;  1TWC J;  5KAI C;  5BPI A;  1K83 J;  2DT6 A;  4N4O B;  2HQA A;  1LDJ A;  3HYI A;  2R7T A;  1HOM A;  3HOS A;  2MG4 A;  4DIQ A;  2E71 A;  4ZC3 A;  5EG0 A;  2MH9 A;  3HZJ A;  2ISY A;  2DAO A;  2PX9 A;  2JA6 J;  5J1U A;  1YJW I;  4H4K C;  2E1O A;  1WHU A;  2M0C A;  1U8R A;  4IOC F;  2EZK A;  3GTM J;  2IBD A;  2R7D A;  2KPM A;  4KMF A;  3HKZ N;  1X1A A;  5B3S H;  1VQM I;  3CUQ B;  4LB6 B;  1BW5 A;  5H2F C;  1XSD A;  1IXR C;  3OYK A;  4C30 A;  2XAF A;  3CLO A;  3GVA A;  3KLO A;  4A5N A;  4RB0 A;  2OZU A;  3OOU A;  3GX4 X;  1DP3 A;  1Q1V A;  3RZO J;  1IN8 A;  2DFF A;  3DWL E;  2HPM A;  5M3F J;  3OYJ A;  4GDF A;  2JA7 J;  3RYP A;  1HDD C;  4N4N B;  3S3N A;  3N97 A;  1MD0 A;  2G0E A;  2M4G A;  5JFR A;  1W7P B;  1FOW A;  3DTI A;  2GXG A;  2KT0 A;  3RKQ A;  5DD4 A;  2KJB A;  1N75 A;  2ELH A;  1UG2 A;  4BAY A;  3TDU C;  2HKO A;  1AHD P;  4L0Z B;  5GPC A;  3BTJ A;  3G2B A;  4IOA F;  1K6Y A;  2RDP A;  4PJM A;  5EYR A;  4ZYE A;  1Z7L A;  5LHI A;  1BOA A;  1PJR A;  2IAI A;  5FJ8 J;  3LSJ A;  1V4R A;  2R4G A;  2IS4 A;  1TWG J;  4M3E A;  4DZJ A;  2E2J J;  5LGN A;  2EZH A;  1GV5 A;  4J00 A;  1TWF J;  1BR4 A;  3I55 I;  2ME0 A;  1XGN A;  2VKE A;  3GW2 A;  2HFH A;  3CDH A;  4M3D A;  3KEQ A;  4EJV A;  2LSO A;  3DFG A;  3ZPL A;  2R5Z A;  3AG2 H;  4I6Z A;  3KLN A;  1MDM A;  1CF7 B;  2DOE A;  3K4N A;  3DPU A;  1K78 A;  2DLL A;  1QPI A;  5ERI A;  1V5G A;  3FXJ A;  2VT3 A;  3T1B A;  2ZSH B;  1Z91 A;  3OYA A;  3GZ5 A;  1MDM B;  3FHZ A;  2CV2 A;  1J0R A;  1N77 A;  3H1C A;  4CDG A;  3QQA A;  2F5F A;  1E3P A;  2VPL A;  1SVO A;  4YEJ A;  3F21 A;  4PSW A;  3H5R A;  3C2H A;  4BGD A;  1ZAR A;  3H5N A;  1A31 A;  4F52 A;  3J80 K;  3L09 A;  3NQO A;  4KA4 A;  1MMS A;  3KYC B;  3QU6 A;  4DW6 A;  1VQ4 I;  2FBK A;  4MGR A;  2OQG A;  1XCV A;  3MCZ A;  3NRV A;  1R9T J;  1KON A;  2A05 A;  2YUS A;  5E3L A;  4X0G A;  4WXD A;  3DTE A;  2FXA A;  2KHM A;  1WH7 A;  1Z0X A;  5J1Y A;  3I9V 2;  2CW8 A;  3BTC A;  3QYF A;  3HOZ J;  2W7N A;  5BQT A;  5CLS A;  1T8I A;  3IKV A;  3ZGK A;  4U7B A;  3GZ6 A;  1PYV A;  4Y3O A;  4P9U A;  4J19 A;  2VKV A;  3EYY A;  2VJI A;  4XRM A;  4AID A;  3LOC A;  4A6E A;  5IP6 A;  3FXU A;  1B9N A;  2GIZ A;  3D5L A;  1UEL B;  2L0K A;  2CFO A;  2QSH X;  1XN7 A;  1XMX A;  4C2U A;  3W2V A;  2QUF A;  4BH9 A;  4BUP A;  3U9G A;  3VOE A;  4AUX A;  1AWC A;  1FOY A;  4G7O F;  1TT5 B;  2LH9 A;  5EF6 A;  3BCB A;  2RAE A;  3BR2 A;  3G73 A;  3L2W A;  1X19 A;  4XL9 A;  3VEP A;  2K27 A;  4FE7 A;  3DBR B;  5ED4 A;  4D7M A;  1GXQ A;  5J8C A;  1P4A A;  2ME6 A;  4HDV A;  2STT A;  2YPR A;  4P9F A;  2GWR A;  2K9L A;  4HYE A;  2V6C A;  3C18 A;  4HF0 A;  4EMS A;  1YS6 A;  1YX5 A;  4AYB A;  2F48 A;  2Z5U A;  2XKP A;  1EKE A;  2Z33 A;  1QBJ A;  2FEZ A;  5EEH A;  1AKH A;  3GTL J;  1DGR M;  3CME I;  4XLF A;  4LB5 A;  3ZQ7 A;  1ETX A;  4IRG A;  1BL0 A;  3QAH A;  2YX7 A;  3SXY A;  4P55 A;  1FIP A;  2WY7 Q;  2DTR A;  1KQ9 A;  1TQP A;  1E3O C;  1HKT A;  5KAF C;  2PN6 A;  1R1U A;  2V1X A;  2GZW A;  2L9N A;  2O03 A;  1QVU A;  2CUE A;  4HX7 A;  4HNT A;  5HLH A;  3FM5 A;  5EJC A;  2FML A;  1Y8Q B;  2H8R A;  4ZDO A;  4LK0 F;  3L1P A;  2XF7 A;  1VQO I;  4IHT A;  1Y39 A;  3CF5 F;  2FBH A;  2NVY J;  3IKT A;  3K2Z A;  2VXD A;  2TCT A;  2HKX A;  5FKO A;  2MD5 A;  4HBL A;  3Q5F A;  2LG4 A;  1MBG A;  1TNT A;  1UG0 A;  2BW3 A;  1MND A;  3TQN A;  2DI3 A;  1ZG1 A;  2BHY A;  3K1N A;  3LFU A;  1E3H A;  1IXC A;  4MFD A;  1IO2 A;  5IPA A;  1FP2 A;  5HDG A;  1LDD A;  1I6H J;  3KX2 A;  1VFC A;  3V7C A;  2DFH A;  2B63 J;  3ABL H;  1UFM A;  3OYE A;  4C2M J;  1XC5 A;  1Y0U A;  2RC4 A;  1HSJ A;  2ESN A;  4KN7 X;  1TLH B;  1OCP A;  3A02 A;  4EV0 A;  1MJ9 A;  2IPQ X;  3F72 A;  3EUA A;  1SEU A;  2JVG A;  3MVP A;  1OLT A;  1JXS A;  4V2F A;  2M5W A;  5H6R A;  3DLL F;  1D5Y A;  4UUV A;  1TBX A;  1O3R A;  3DXJ F;  3CCL I;  3WTV C;  2PI0 A;  3HIF A;  3P9I A;  2EFN A;  3S17 J;  5GTH C;  2ZBK A;  3ZOB A;  4IXA A;  3IV5 A;  1UCR A;  3OYD A;  2FUG 2;  1T56 A;  3T0Y A;  2IXS A;  3PNT A;  1IN6 A;  1IUF A;  4HF1 A;  5HLG A;  1ZR4 A;  1S3J A;  1J75 A;  4M9S A;  4A93 J;  4HPQ A;  5EZH A;  3PFI A;  4KNY A;  1H9T A;  2QWW A;  1J09 A;  4JP0 A;  3TW6 A;  4BEH B;  2E35 A;  3JRC A;  3K4L A;  2M8G X;  4W97 A;  1N25 A;  5JR3 A;  3HSE A;  5AIP A;  4OAZ A;  1YE9 A;  2FMY A;  1IG7 A;  3I71 A;  3QOP A;  5HLI A;  1HW2 A;  3A4C A;  5DCF A;  1QO0 D;  2HNH A;  2OU2 A;  4M9X A;  4YFK F;  2RV8 A;  3E97 A;  2DMQ A;  5F64 A;  2HTS A;  2VQC A;  4FTH A;  1YLF A;  3BR0 A;  5IP9 J;  1S5L C;  5CYV A;  4C3I J;  1I39 A;  4RBO A;  1FYL A;  1FY7 A;  2DYR H;  4G9Y A;  2HYJ A;  1R1T A;  4MHG A;  2Y69 H;  3AKZ A;  2L3D A;  2CQ7 A;  5HVQ C;  5ILS A;  2IT0 A;  1SAX A;  1X3Z B;  5E17 F;  2OV7 A;  2MC3 A;  3L2Q A;  2HOT A;  5DYM A;  2FRH A;  1LJ9 A;  3MEX A;  4HDU A;  5J6X A;  5F1J A;  5DEQ A;  1E0E A;  2LR8 A;  2Q2E A;  3L2V A;  4ZZD A;  4A2U A;  2BXZ A;  1MJA A;  3ZP5 A;  3L2C A;  1SD6 A;  1KU9 A;  2JA5 J;  1ETV A;  2BE5 F;  1BA5 A;  3P9K A;  2AXT C;  1IJW C;  3ZN0 A;  4ETS A;  3KP2 A;  3SFZ A;  3HC7 A;  5C44 J;  4PK4 A;  4HF2 A;  2R5Y B;  2OCE A;  4UVB A;  4DQ2 A;  2OJE D;  3U1K A;  3OYC A;  2R7Q A;  2MLG A;  5TIS C;  4DBQ A;  4WXH A;  2NVU B;  2IS2 A;  3RPU D;  3VYT B;  4P96 A;  4XR6 A;  2MA3 A;  2O5R A;  3HXL A;  3SQN A;  2V26 A;  4IRI A;  3BR3 A;  5E8G A;  3QPS A;  1P92 A;  2PEX A;  1MH4 A;  1FTZ A;  4UVA A;  1XSX A;  3FXK A;  2GA2 A;  2HQ5 A;  2JSC A;  3MKL A;  3HRT A;  3I0T A;  3WG7 H;  2JUC A;  5DD8 A;  1TW2 A;  3ZMS A;  1NH3 A;  3KZI C;  3CC4 I;  4CA0 A;  3ABT A;  3M8E A;  2BVM A;  5HS9 A;  3CJN A;  3SYT A;  3ZN1 A;  4KIB A;  1VQN I;  3FF5 A;  2LP0 A;  3HOT A;  3CO7 C;  4ESB A;  5K5R A;  1UZC A;  3QPH A;  3BG9 A;  3LSI A;  4PUS A;  5DCM B;  3ZQH A;  4G7Z F;  3FXO A;  3OIQ A;  1A6I A;  2LY9 A;  3F22 A;  4E7J A;  1W7P A;  3JRA A;  2H6C A;  3C1D A;  3F6O A;  4Y33 A;  5E3O A;  2WY8 Q;  1QHG A;  3DKY A;  2ZJQ F;  1NK3 P;  5E1X A;  3WHB A;  2PMU A;  2ZXH A;  3F0C A;  4RS8 A;  1OCZ H;  4A3E J;  3OL3 A;  1KQ0 A;  1ZRE A;  1V54 H;  3S2D J;  5ICF A;  3JTG A;  4M6Y A;  4ENN A;  2F6C A;  2M0M A;  3LSR A;  2K3F A;  2V9V A;  3A0H C;  2EB7 A;  3WTW C;  1ZGW A;  3AL0 C;  5L3C A;  1VND A;  1CGP A;  4HOB A;  1ON2 A;  5AON A;  2ZXJ A;  4XMY A;  1VF9 A;  3HRM A;  3S1Q J;  3SJM A;  2BY0 A;  3MQ0 A;  3RQI A;  2XPU A;  2R92 J;  4XNF A;  3EQL F;  2L54 A;  4IO9 F;  1JTX A;  4EVI A;  4BHB A;  2HZD A;  3TO7 A;  4KYW A;  3E6C C;  1GXP A;  1FWZ A;  4IRH A;  2ZNZ A;  3S2H J;  2IP2 A;  3Q9V A;  4LMY A;  2HYG D;  1SD7 A;  2K9M A;  1WQ2 A;  1Z6R A;  5DUK A;  3BWG A;  3PNY A;  4JK1 X;  1R58 A;  2GQQ A;  2LRE A;  1ZK8 A;  1IRG A;  1WRJ A;  2P4W A;  3KCC A;  5FD6 A;  1OPC A;  1EH7 A;  2ZME C;  4A3M J;  1ETW A;  5HDK A;  1UJ8 A;  3E5U A;  3LSG A;  3QOD A;  2VPR A;  3RZD J;  4UUS A;  5L3B A;  1ZAO A;  4UUS B;  4LLG F;  3E5X A;  3H9J A;  5EZG A;  2IS6 A;  1BR1 A;  3JRI A;  3R0J A;  4Q48 A;  4CCL A;  2QYO A;  2R7F A;  3ZMV A;  1W1W E;  4U88 A;  3A01 B;  2R7X A;  2HQN A;  4U0Y A;  4IHY A;  1WJF A;  4J01 A;  2JVH A;  2H6B A;  2ADU A;  2EFP A;  1JKO C;  4M6X A;  4UV9 A;  2KP6 A;  1R36 A;  4M74 A;  3C7J A;  1ETQ A;  2G9W A;  2KJC A;  4PJN A;  2EK5 A;  4XOT A;  2KFD A;  2LKX A;  3OIP A;  2ZFW A;  4M73 A;  3TGN A;  2EV5 A;  4ZYG A;  3PSI A;  2I5U A;  4AYB N;  3DF8 A;  2HWV A;  1S7O A;  1ULY A;  2K5C A;  5F0C A;  5FO5 A;  2KRH A;  3I56 I;  4CYD A;  1D0Y A;  3ELK A;  3LAJ A;  4YII A;  3OYB A;  2W84 A;  3Q0W A;  4R8H A;  5DDG A;  3L2R A;  3KP4 A;  1TC3 C;  1UAA A;  4DOZ A;  3EET A;  4GXO A;  3MKZ A;  1U6G A;  2HPI A;  5ILV A;  1W5S A;  5HOO A;  1Y1V J;  1MBF A;  1T6S A;  1XMK A;  2HDD A;  2H94 A;  2BV6 A;  3P9C A;  3OIO A;  2RNJ A;  4LK1 F;  1X58 A;  2PMH A;  1T2K A;  1MMA A;  2ZME B;  5GAH J;  2DFI A;  5CKT A;  3ZMZ A;  1OCR H;  3IC7 A;  5BPD A;  1HKQ A;  4MQ9 F;  2DW4 A;  1U0J A;  5FKL A;  4U0V A;  1HLV A;  3ASN H;  3G1L A;  1OFC X;  4KT5 C;  1U5T B;  2XIG A;  2AQF A;  3A0B C;  5E3N A;  1QNT A;  2V6E A;  2HXI A;  3F8M A;  1I6X A;  2WAE A;  2TRT A;  3DPL C;  2QQA A;  1R49 A;  4AIJ A;  3BJA A;  2JPC A;  1O3T A;  3HSR A;  4M3F A;  4B4C A;  3H3V K;  2G7U A;  3KPH A;  5KCM A;  1D1C A;  2YU3 A;  2FQ4 A;  3EUH A;  4PGG A;  5KNL A;  2V9K A;  3PO3 J;  4N0B A;  2FF4 A;  4RB3 C;  2HS5 A;  2BOL A;  1MBK A;  1OR7 A;  4GFB A;  2QEX I;  2NNN A;  3K0L A;  1X1D A;  4HW0 A;  1MMD A;  2R7U A;  3RPU A;  2L7Z A;  5FLV A;  4BQQ A;  2L01 A;  1Z7U A;  4LLN A;  1S29 A;  3T8R A;  3K7A J;  2QZ8 A;  4BU2 A;  3I59 B;  1I1G A;  1PVE A;  2IGN A;  4BJT A;  3PUB A;  3CD6 I;  2VXZ A;  4D1Q A;  4CCN A;  1B8I B;  3K70 C;  3V7R A;  1T38 A;  1WCM J;  4BE0 A;  1MKM A;  4Z2Y A;  2HVS A;  5K7F A;  4MQV A;  2RKH A;  4M6V A;  3KP5 A;  5D5W B;  1XTA A;  3J7Z I;  2ZFU A;  2D1V A;  3DCF A;  3O6B B;  3PJR A;  1PUF A;  3WE2 A;  1Z3Y A;  4KT6 A;  1IW7 F;  4UV8 A;  2P5L C;  3PO2 J;  1LKX A;  3OYI A;  3HJE A;  2K9Q A;  4IQJ A;  1G2H A;  1G3Y A;  4DYC A;  4G94 A;  4KIF A;  4BQA A;  4PJ0 C;  4EQQ A;  4Y13 A;  2O8X A;  3RJP A;  3WTT C;  2WB1 A;  1BI0 A;  4IF4 A;  1LVA A;  3RI4 A;  1YRN A;  4KIC A;  3U2R A;  2F5C A;  4A3K J;  3QP6 A;  1IDZ A;  4RDU A;  5B5E C;  4RAZ A;  2B9S A;  2KDO A;  2EIJ H;  1EV7 A;  2F5D A;  5J47 A;  1PP7 U;  1EA3 A;  5LD2 C;  4CCM A;  1WJA A;  2WAQ N;  3M7G A;  3LQR A;  1SFK A;  3CCQ I;  1X4P A;  1VQ8 I;  1TNS A;  4Q47 A;  1ZGJ A;  1ZRD A;  2XB5 A;  4BNC A;  1P9Q C;  1KGS A;  1USS A;  5K5O A;  3ZMD A;  5DS9 A;  3IHU A;  4E7S A;  3WU0 A;  3WGI A;  5LRS A;  3N4M A;  4OIQ F;  3JW4 A;  4G7H F;  3SZT A;  4XBF A;  2M34 A;  3VPR A;  5J4V A;  1J5Y A;  5ICE A;  5FFZ A;  2BHZ A;  1VQ6 I;  3JR9 A;  2CW0 F;  4EM1 A;  1YG2 A;  3CJQ B;  3FZV A;  3ZQI A;  1HST A;  1T08 B;  4R79 A;  2DOF A;  3ULQ B;  3KYL A;  1R5G A;  1MSE C;  4XON A;  5M5Y J;  2OAZ A;  3NWS A;  4CH7 A;  3L2U A;  3E0J B;  1ENH A;  1HCR A;  2TDX A;  2VI6 A;  2LOO A;  4PJL A;  5K1Y A;  3QRF F;  4XKV A;  2FOK A;  4XOP A;  1P4W A;  3H0D A;  1KA8 A;  4HEA 2;  2XRL A;  4D7N A;  1ZTR A;  3FBN B;  3LMM A;  4E70 A;  2YSR A;  4XIC A;  1YIJ I;  1VQ7 I;  5FRO A;  2QKL B;  1FC3 A;  2RGV A;  3SEZ A;  1BN5 A;  5FLX Z;  2L9S A;  1EH6 A;  4DYR A;  2EWN A;  1R6R A;  4LG3 A;  3FIS A;  2DBB A;  1K6O A;  4BE1 A;  3TP3 A;  2OBP A;  1T0F A;  4ESJ A;  4NC8 A;  2VE9 A;  1IV8 A;  2L2O A;  4XKB A;  1DGW Y;  4LGW A;  2EIK H;  1SMT A;  3KFW X;  2YX4 A;  3KP6 A;  1A6Q A;  5C3E J;  5HS7 A;  4PZJ A;  3T8T A;  1S8N A;  1JJ6 C;  3HOY J;  2KQR A;  1TT0 A;  4RA2 A;  4AD9 A;  1LE8 A;  3KIO A;  4WF2 A;  4ZYH A;  5JLW A;  5TGT A;  1YW8 A;  1MGT A;  4B1R A;  3RQ4 A;  1R5I D;  2Y31 A;  4IEJ A;  1KZH A;  4JYK A;  3M9A A;  2DYS H;  2AHQ A;  1ZYR F;  3S15 J;  4YRV A;  2DA1 A;  1QVT A;  3H92 A;  1LNW A;  2ZXI A;  2DN0 A;  2MLK A;  5E20 A;  4F7Z A;  1IDY A;  3WTX C;  2YU9 J;  2JZY A;  1W5C C;  2H8W A;  2LF8 A;  2Z1D A;  4AVP A;  2GBY A;  3SHF A;  1ZLJ A;  4I98 B;  3LA3 A;  1BC8 C;  2IJL A;  4BY7 J;  3BJ6 A;  1HDP A;  3U21 A;  4QLC U;  3TBI A;  4MTD A;  1YW9 A;  2NS7 A;  1FMW A;  1AU7 A;  3F8F A;  4RAG A;  4RM2 A;  2V1N A;  1WFX A;  3DV8 A;  2G7H A;  2M7B A;  4LFU A;  4HV5 A;  2O61 A;  2EBI A;  1F4K A;  3MD2 A;  4RB2 C;  2V4J C;  4CGZ A;  2E5N A;  2RRE A;  3BG6 A;  4MLO A;  3VFZ A;  3NAU A;  4I02 A;  2NVX J;  2LC2 A;  4OMY A;  2IVM A;  3RKW A;  5KHD A;  3ECO A;  5FB2 A;  3ML6 A;  3OYF A;  2M30 A;  3JRB A;  1XG1 A;  5EGO B;  2D2W A;  3ECH A;  2OA4 A;  2AS5 F;  4BXF A;  2M45 A;  2XF5 A;  4Q4Z F;  3CCJ I;  3V42 A;  4V19 K;  4FHT A;  2X6Y A;  3BC8 A;  4UXN A;  3OWT A;  2E36 A;  1XGS A;  3W2W A;  1NG6 A;  5EEA A;  3LAP A;  1DQU A;  1WGX A;  4HZF A;  3TED A;  3EUK L;  4D5C A;  3IWF A;  4ZTJ A;  3R6S A;  1RUO A;  5F0F A;  2OF7 A;  3DKW A;  3S3O A;  2L7F P;  1P4X A;  1OCC H;  3HUG B;  1WH5 A;  3R61 A;  3L9F A;  2E5Z A;  4A12 A;  2IA0 A;  1KU2 A;  3O8G A;  2CGP A;  5C4J J;  5E8I A;  1Q1H A;  2P5V A;  1UHS A;  2VC1 A;  5EG0 B;  4GGG A;  2PLY A;  1SAN A;  3PQK A;  2A69 F;  4A3C J;  3QU3 A;  2KLO A;  3S8P A;  2RN7 A;  1YJ9 I;  2ZB9 A;  1JJ8 C;  1VQ9 I;  2E7X A;  3EPZ A;  3BJO A;  1KU3 A;  3FXQ A;  3LNQ A;  2BY3 A;  5CVR A;  3S2W A;  2CU7 A;  3LSK A;  3VYU B;  3W6J B;  1BW6 A;  4I76 A;  1R4N B;  2HGC A;  3K1P A;  2Y0M A;  2PQ8 A;  4M71 A;  3BDD A;  2PJR B;  1VTN C;  5DM7 F;  4S0H B;  4L5I A;  2X6X A;  1XDS A;  2DA5 A;  5E1Z B;  2P81 A;  1TQI A;  2HTJ A;  2OZ6 A;  3VDX A;  5B66 C;  3TOB A;  2LKP A;  2BY1 A;  4II2 A;  2D5V A;  1ZQ3 P;  2QQ8 A;  2PJR A;  2VOD A;  1K78 B;  4E7H A;  3CMA I;  2NAZ A;  2WTE A;  2A5Y B;  2NOJ B;  2E1M C;  5D4S A;  3EDP A;  1SFX A;  4M9Z A;  3AG4 H;  3KET A;  1R5H A;  3HEF A;  2K02 A;  3UKG A;  1B9M A;  5EDN A;  1GV2 A;  1P6R A;  5CJ9 A;  4Y17 A;  2HYF A;  2OQR A;  2VUM J;  3OOP A;  3HOV J;  3A1Y A;  3DLA A;  5BS6 A;  2VBW A;  2DMN A;  5FKN A;  2W24 A;  1FBS A;  2PMZ A;  3S14 J;  2DK5 A;  4FIS A;  3K4M A;  4C3J J;  5AIQ A;  3GXO A;  4R1H A;  4MO7 A;  3MFK A;  1RZ4 A;  4I0B A;  1RR8 C;  3A03 A;  2P5K A;  2KIS A;  1K61 A;  4IX7 A;  1K79 A;  2DQR A;  4DGW B;  3CCV I;  2KMU A;  4HV6 A;  4AVZ A;  3MN2 A;  5JVT A;  3RKY A;  4II3 A;  3BTI A;  3SZG A;  1RKT A;  3GUD A;  4UHT A;  4EEF G;  4G6Q A;  4CO8 A;  1GT0 C;  2ZJR F;  1D1B A;  3UR3 C;  1STZ A;  1XD7 A;  2EA2 A;  3A01 A;  2OUM A;  1F43 A;  4I09 A;  1E17 A;  3OL4 A;  4ANJ A;  3V8K A;  3IRQ A;  2HQR A;  1VQL I;  4E7L A;  2XPW A;  3W6K B;  2DA7 A;  2CWE A;  4HX8 A;  3J81 Z;  4YIR X;  4YIF A;  4ABZ A;  2CW7 A;  3E6M A;  3O3K A;  4U7D A;  3DU5 A;  3LFK A;  2DFE A;  2R93 J;  4LOC A;  1RES A;  2X48 A;  4CUG A;  4E7K A;  5BNG A;  3BOQ A;  4CZZ A;  2K4J A;  3BRO A;  4G6T B;  1IAW A;  1VQ5 I;  2VE8 A;  4Y7N J;  3GTG J;  1MBH A;  4FT8 A;  1BOB A;  2UUZ A;  3ERM A;  5CVJ A;  2JN6 A;  1YOV B;  3B73 A;  5K7Z A;  2WWY A;  2RQQ A;  1T0F C;  1UB9 A;  5JLX A;  2LMD A;  2EPF A;  1B59 A;  3S16 J;  1A35 A;  3BR6 A;  1O7L A;  2JK3 A;  1EF4 A;  3BZ6 A;  4JQF A;  5LHH A;  2A3S A;  3BY6 A;  5HOD A;  2HI3 A;  4I01 A;  1WJB A;  4O6J A;  2Z16 A;  2LRD A;  1EH8 A;  2X51 A;  3CQZ J;  5D8K B;  2EZI A;  1LE8 B;  2OPT A;  1LEB A;  1V5F A;  2FD5 A;  1DP7 P;  1TZL A;  3TP0 A;  2JJ7 A;  5IYC J;  1U5T C;  2Y30 A;  2MFZ A;  1BIA A;  3M8J A;  3CF2 A;  1TTY A;  3E6B A;  3JSO A;  5LBQ A;  5CVV A;  3J80 Z;  4XN0 A;  3K4K A;  3PUF A;  2LBF B;  3HRU A;  2Q2E B;  4M72 A;  1SVM A;  1D5V A;  3ZCO A;  5D5X B;  3JAM Z;  1RI7 A;  1ZLK A;  1X2M A;  3DEU A;  2XRO A;  2JA2 A;  1RET A;  4A3I J;  4QTR A;  2IGO A;  4XLN F;  2EFQ A;  1IZ1 A;  1V5E A;  3CUQ C;  4ZDL A;  2GXA A;  3TO6 A;  3K6G A;  5ICC A;  2V79 A;  3F3X A;  1AA7 A;  2Q8K A;  5K7H A;  4E7Z A;  3SEQ A;  5DCM A;  1LUJ B;  1Y1W J;  1Z3X A;  2JA8 J;  5IYB J;  2X1D A;  1ZKG A;  3OS2 A;  1QU3 A;  4M3G A;  1FX7 A;  2Y2Z A;  3SDB A;  5D5U B;  4TV7 A;  2W48 A;  3F6V A;  3ZQQ A;  5CQG A;  5GAE J;  2VC0 A;  5C4X J;  3D5R C;  2GOM A;  3IAS 2;  3MZ8 A;  5M3M J;  5HLT A;  3EYI A;  4IHX A;  2A6T A;  1X1P A;  2Y48 A;  3QYB A;  2W00 A;  4A3G J;  3AG3 H;  3GTK J;  1ZR2 A;  2NVT J;  1YYV A;  4MFE A;  4CCO A;  1B8I A;  3PL8 A;  3C2B A;  2QSG X;  2LLK A;  3WU1 B;  2XVC A;  3I5U A;  2DPU A;  1P2F A;  1W4M A;  2Z99 A;  3IWZ A;  2CUF A;  2V7F A;  1HW1 A;  2A6E F;  4RMN A;  4B09 A;  3V8L A;  3OSG A;  1D0X A;  1WKM A;  3I53 A;  1IN4 A;  2WC2 A;  5IT9 Z;  5DV5 A;  3K10 A;  3HM5 A;  4KN4 X;  3HGG A;  3Q3S A;  1MBE A;  3MAJ A;  1FP1 D;  5IP7 J;  4XKC A;  1MMG A;  2DQL A;  3T5X A;  2PJP A;  1YS7 A;  2VKH A;  3B6C A;  1A04 A;  2XGE A;  3CMY A;  4L0Y B;  3DP7 A;  3KZY A;  3H3Z A;  3GFI A;  2V9P A;  4RGS A;  4P1W A;  1QA6 A;  3HSF A;  4N9I A;  4IHS A;  2F4M B;  2XPV A;  1GVD A;  1VI0 A;  1BI3 A;  2HXO A;  4X1E A;  1VZ0 A;  1PP8 F;  2HOS A;  4O3M A;  2Z3Y A;  1Z1D A;  1WPK A;  2NOG A;  4XLC A;  3FXR A;  2KIQ A;  3N05 A;  1O57 A;  4XRF A;  4MEX F;  3F9K A;  5ILU A;  1K4T A;  3BG7 A;  4BKX A;  3ZMT A;  1ERD A;  5FRM A;  4EJO A;  5F27 A;  2CQX A;  3G1O A;  3BG3 A;  2B0L A;  1MH3 A;  2VIX A;  3GBG A;  4L9T A;  5K5Q A;  4BQN A;  1H0M A;  2KL4 A;  2C6Y A;  4QSH A;  3GO5 A;  2VAS A;  1U9N A;  5IYD J;  3U1D A;  3WTS C;  1S72 I;  2GLO A;  2QQB A;  2WAF A;  1G8X A;  2P6T A;  4NC7 A;  3HDD A;  3W2A A;  2Y75 A;  3I4N J;  2FE3 A;  4DNC A;  1B72 A;  3D5S C;  1OIS A;  4KIS A;  3FDY A;  1Y56 A;  4JBA A;  2HVQ A;  3RKX A;  1WI3 A;  2VKD A;  3BQZ A;  3G6E I;  3OY9 A;  1G3W A;  2R3S A;  1XX5 A;  3SFI A;  4ZJZ A;  4V2G A;  5LGU A;  1ZRC A;  3GCM A;  1QZZ A;  4UY8 I;  2DA3 A;  2KRF A;  1I50 J;  3GZN B;  4LG0 A;  3M8F A;  5GPA A;  2DCE A;  2FBI A;  1RIO H;  2H1K A;  4BL0 B;  3ZMU A;  2MC4 A;  2DMU A;  2ZNY A;  2R7V A;  1P7I A;  1UHW A;  1ONV A;  1W5T A;  2K7L A;  2M4K A;  4XLP F;  1SD5 A;  5CQE A;  4CYC B;  1TW3 A;  4JX5 A;  5FD5 A;  5GAG J;  4KDP A;  2ZKZ A;  3FBI B;  3LSM A;  2LY1 A;  4EJW A;  1AKH B;  1I3Q J;  2QSF X;  2HZT A;  3JRF A;  3UNG C;  2R5Y A;  3G3Z A;  3PQJ A;  2DMP A;  1RR7 A;  4AM3 A;  6PAX A;  1R22 A;  2M7A A;  2P0W A;  4RAF A;  2QA4 I;  2X1E A;  3BCA A;  3V7S A;  1JUP A;  4GYG A;  4L9V A;  2XGD A;  3DU6 A;  1ACI A;  3TOA A;  3LST A;  4ZH4 F;  3K1M A;  2K3P A;  3FM3 A;  3GFJ A;  2EV0 A;  1ZRF A;  1D8J A;  2ECC A;  1G3S A;  2FNP A;  2KIU A;  1I27 A;  3RYR A;  1SMY F;  5L3D A;  2QCO A;  1L0O C;  2IRF G;  3HG9 A;  3Q0V A;  4HNV A;  4A3B J;  1DU6 A;  2QBY B;  1HC8 A;  2W85 A;  2QKM B;  4EM0 B;  2LTP A;  1DDN A;  3ISP A;  4LIU A;  2BW3 B;  2KKO A;  3FXL A;  4KJZ A;  4CSW A;  5GP9 A;  2QBY A;  2EQR A;  2GXB A;  1D8K A;  1LQ1 A;  3J7A O;  5FLM J;  3OYM A;  1JE8 A;  1IV6 A;  1H8A C;  2DMT A;  2Y9Z A;  1R7J A;  2CUJ A;  1IC8 A;  4AU7 A;  2QM3 A;  1T33 A;  5J3L A;  2ECB A;  4RGX A;  4MEY F;  2MSY A;  3FIW A;  4ZYD A;  1J7K A;  1OCO H;  2W57 A;  3FMR A;  3CC7 I;  5HS8 A;  1JGG A;  4JX6 A;  1QGP A;  2O6G E;  2M2E A;  3H5A A;  5E1W A;  1R00 A;  2DJN A;  2HU9 A;  1G3T A;  4F91 B;  1YHQ I;  3H36 A;  1ORK A;  4EGY A;  2LNB A;  3GYH X;  2NXN B;  3MZY A;  1X1C A;  2AO9 A;  2BGC A;  2IGK A;  3C3W A;  2KIM A;  1SFO J;  1TWH J;  4CIC A;  1X3U A;  2XV4 S;  1LFP A;  3BLY A;  1O7F A;  4PFP A;  1WSU A;  2CH0 A;  2HVR A;  2K40 A;  5LGT A;  2WV0 A;  2EA4 A;  4NHJ A;  4P5O A;  2JQ7 A;  2FQ3 A;  4PSX A;  1OYY A;  2WBM A;  3FMS A;  1ZEL A;  2HDC A;  1H88 C;  5CPR B;  2AXL A;  3BPV A;  3IRR A;  1I3A A;  1LB2 A;  2F4I A;  4NQW B;  4RM3 A;  1UHM A;  3I3L A;  4YFX F;  3WTY C;  2E19 A;  1REP C;  2X0L A;  4QPQ A;  3GTJ J;  3PFY A;  4S04 A;  3O2P E;  3G1M A;  4E7I A;  4LG0 B;  1MNE A;  4XLE A;  1F36 A;  1QPM A;  1PUF B;  1KYW A;  2LYC A;  2X1C A;  2CQK A;  1WJC A;  4UVC A;  2HOA A;  1ITY A;  2X6W A;  1DPU A;  1SFE A;  3CCE I;  3RDI A;  4PDK A;  1LFB A;  3HB9 A;  2XAS A;  1YX3 A;  4Y4R A;  3LSP A;  4L5E A;  2FJ1 A;  4AIK A;  1JKP C;  3OV8 A;  3GTO J;  5M5W J;  1NG7 A;  2E1M B;  4UUT A;  1S9H A;  5LRR A;  3RPQ A;  3LQQ A;  4C9Y A;  1DU0 A;  4BAC A;  2VQL A;  2QGU A;  3J7A Y;  3QP5 A;  4OIO F;  3HGY A;  4IPA A;  1YJN I;  1ETO A;  3IAM 2;  2YR2 A;  3S1N J;  1IRX A;  3GLL A;  4ZZL A;  2R7R A;  3M4O J;  2NS8 A;  2J5P A;  1H89 C;  2F2E A;  1H9G A;  1R1V A;  1S7E A;  1IF1 A;  3F8C A;  2K9S A;  2EFW A;  3K4J A;  3ZXS A;  4F3Q A;  2LKS A;  3ONQ A;  3ABU A;  4O5V A;  2K86 A;  2M3A A;  3DQV C;  2BYV E;  3LWF A;  2UXX A;  4NB5 A;  3FX3 A;  5D6F A;  2XC7 A;  1UST A;  1G59 A;  3OYH A;  3VYS B;  3BZC A;  2R7O A;  4D9J A;  4CZC A;  3Q0U A;  2AQE A;  2DA4 A;  1XMA A;  2JT1 A;  1BIB A;  4BS9 A;  1HKS A;  1LDK B;  3JRG A;  2O9L A;  2DTZ A;  2VB6 A;  3WGH A;  4YFN F;  4CYC A;  1O3S A;  1W0U A;  1LVK A;  3HKZ A;  1I5Z A;  2XAQ A;  4HLX A;  2O3F A;  5JHF A;  3E1S A;  2STW A;  1VQP I;  2EIN H;  5KK1 A;  3RSN A;  2Z2S B;  4ON0 A;  4OAY A;  4AIH A;  3CUQ A;  3O8H A;  1FPQ A;  2W1O A;  5F04 A;  3MZH A;  1MW7 A;  4HX4 A;  2JPB A;  4S05 A;  4ESF A;  5J40 A;  3KEY A;  3PIP F;  4FET A;  2CQQ A;  3IH2 A;  3CZ6 A;  3X2Q H;  5FGM A;  4BQO A;  4B3X A;  4E4H A;  3R60 A;  2BZT A;  1D3Y A;  1ZG5 A;  2KRC A;  3DEW A;  3WE3 A;  5IT9 K;  4BJ6 C;  4KMU X;  3I54 A;  1R71 A;  3FKJ A;  1BJA A;  2W82 A;  3I58 A;  1SAU A;  2L4M A;  3BTL A;  4XKW A;  1IRZ A;  3SZP A;  4EJU A;  1XB4 A;  2Y0S A;  3M1C A;  1D1A A;  3REO A;  3BR5 A;  3LA2 A;  1K7A A;  2OD5 A;  5DM6 F;  1U78 A;  4EJT A;  1FIA A;  4BJ5 C;  4BHP A;  2EIM H;  5F1R A;  1W0T A;  3GFL A;  1NHA A;  4Y52 J; 
#chains in the Genus database with same CATH homology
 3S2D J;  3S1M J;  3FK7 A;  3A01 A;  1XS9 A;  3LSR A;  1F43 A;  3SDG A;  1ZGW A;  1VND A;  2JWT A;  2MW8 A;  4QIW N;  2XPW A;  2DA7 A;  4ABZ A;  2EH3 A;  1CQT A;  2I10 A;  1VF9 A;  3S1Q J;  3SJM A;  2E2H J;  3RQI A;  2R93 J;  4LOC A;  1RES A;  2X48 A;  3FKI J;  2XPU A;  5BNG A;  2R92 J;  1X2N A;  1JTX A;  3W6V A;  2X6O A;  4Y7N J;  3GTG J;  1MBH A;  5FKK A;  2JN6 A;  3S2H J;  5K7Z A;  2M9H A;  2WV1 A;  3B6A A;  4A3D J;  5JLX A;  2DA6 A;  4B3A A;  3S16 J;  3BR6 A;  1ZK8 A;  4A69 C;  2Y9Y A;  1BJZ A;  2JK3 A;  1EF4 A;  1JT6 A;  1U8B A;  3JRH A;  5HOD A;  2HI3 A;  4G12 A;  5J1R A;  3CCY A;  3IH4 A;  4A3M J;  1ETW A;  1TWC J;  1UMQ A;  3LSG A;  1K83 J;  2VPR A;  3CQZ J;  1HOM A;  2EZI A;  1JKR C;  2MG4 A;  2OPT A;  3RZD J;  1LE8 B;  2FD5 A;  4UUS A;  3TP0 A;  9ANT A;  2JJ7 A;  4UUS B;  5EG0 A;  5IYC J;  1LFU P;  2Y30 A;  5EZG A;  2CJJ A;  2JA6 J;  3JRI A;  3BT9 A;  5J1U A;  2E1O A;  4A3J J;  2XSD C;  2M0C A;  2EZK A;  3GTM J;  2IBD A;  4D5F A;  3K2A A;  3A01 B;  1ETY A;  3HKZ N;  4IHY A;  4FCY A;  1BW5 A;  1JKO C;  1X2M A;  1RET A;  3OOU A;  4A3I J;  1Q1V A;  4QTR A;  2WB1 N;  3RZO J;  1ETQ A;  2JA7 J;  5M3F J;  1HDD C;  4AC0 A;  2N8G A;  2LKX A;  2G0E A;  5K7H A;  3RKQ A;  2KT0 A;  4AYB N;  1Y1W J;  2JA8 J;  3FK6 A;  2EZL A;  5IYB J;  3HOX J;  1ZKG A;  1UG2 A;  4M3G A;  5F0C A;  1AHD P;  2Y2Z A;  5GPC A;  3BTJ A;  2PMZ N;  2K9N A;  5EYR A;  2W48 A;  5FJ8 J;  2IAI A;  3LSJ A;  3Q0W A;  5C4X J;  1TWG J;  4M3E A;  4DZJ A;  2E2J J;  1TC3 C;  4XRS G;  2EZH A;  1GV5 A;  2XGC A;  5M3M J;  1TWF J;  4BBR J;  1MSF C;  4IHX A;  4A3G J;  2ME0 A;  3GTK J;  1ZR2 A;  1Y1V J;  1ETK A;  2NVT J;  2VKE A;  4M3D A;  4MFE A;  1MBF A;  4A3F J;  3JRE A;  1B8I A;  2HDD A;  3C2B A;  2R5Z A;  4I6Z A;  2LLK A;  3OIO A;  1X58 A;  2CUF A;  1QPI A;  3OSG A;  5IOZ A;  1B72 B;  2ID6 A;  2LD5 A;  1OJL A;  2L7M P;  4A3L J;  1NTC A;  3HM5 A;  3HGG A;  3Q3S A;  5FKL A;  1MBE A;  1HLV A;  3G1L A;  1OFC X;  3QQA A;  5IP7 J;  4BY1 J;  5E3N A;  2HXI A;  3B6C A;  2XGE A;  2TRT A;  3CMY A;  1U9O A;  4M3F A;  4B4C A;  3H3V K;  2FX0 A;  2XPV A;  1GVD A;  1VI0 A;  2FQ4 A;  2HXO A;  3BQY A;  3H0G J;  4X1E A;  4DW6 A;  2HOS A;  2O8K A;  1WPK A;  2NOG A;  3PO3 J;  2CRG A;  1R9T J;  5E3L A;  4DYQ A;  2YUS A;  1MBK A;  4GFB A;  4BKX A;  1WH7 A;  1Z0X A;  5J1Y A;  3BTC A;  3IH3 A;  3HOZ J;  5M5X J;  1FTT A;  2L7Z A;  5FLV A;  5F27 A;  3HOW J;  2CQX A;  3G1O A;  3K7A J;  3BG3 A;  1MH3 A;  3GBG A;  3ZQL A;  1IGN A;  4J19 A;  2VKV A;  4QSH A;  1U9N A;  5IYD J;  1POG A;  4XRM A;  3LOC A;  2R5Z B;  2GLO A;  3BG5 A;  5IP6 A;  1B8I B;  3HDD A;  1WCM J;  3I4N J;  2L0K A;  5FKM A;  5K7F A;  1B72 A;  4M6V A;  1JKQ C;  1WI3 A;  2ID3 A;  3HOU J;  3DCF A;  3BQZ A;  1PUF A;  3PO2 J;  3SFI A;  4V2G A;  4AUX A;  1NK2 P;  2LFB A;  2K9Q A;  5EF6 A;  1G2H A;  4DYC A;  2RAE A;  3BR2 A;  2DA3 A;  1I50 J;  3ZQC A;  4FE7 A;  5GPA A;  2H1K A;  4D7M A;  1YRN A;  3I4M J;  2DMU A;  2ME6 A;  1P7I A;  4A3K J;  1IDZ A;  4RDU A;  1HF0 A;  4CYC B;  4JX5 A;  1GUU A;  2COB A;  2WAQ N;  1AKH B;  1AKH A;  1I3Q J;  3GTL J;  2XB5 A;  1ETX A;  1BL0 A;  3JRF A;  5EGO A;  5DS9 A;  2R5Y A;  3D1N I;  1FIP A;  3S1R J;  2DA2 A;  2DMP A;  1E3O C;  1RR7 A;  2QF7 A;  2M34 A;  3VPR A;  2MGQ A;  3CDL A;  1QVU A;  3JR9 A;  2CUE A;  1JUP A;  3ZQI A;  4IHV A;  2XGD A;  2H8R A;  3L1P A;  1MSE C;  5F08 A;  5M5Y J;  2R0Q C;  2NVY J;  1ENH A;  1HCR A;  2VI6 A;  2ECC A;  2TCT A;  5FKO A;  1MBG A;  5F0H A;  4FE4 A;  2QCO A;  1DU6 A;  2XRL A;  4D7N A;  3Q0V A;  1ZTR A;  4M3B A;  4HNV A;  4A3B J;  2NVQ J;  2LTP A;  3BR1 A;  4MFD A;  4XIC A;  5IPA A;  4NDL A;  4DZP A;  1I6H J;  3GTP J;  5GP9 A;  1VFC A;  2EQR A;  4DYR A;  5FLM J;  2B63 J;  1IV6 A;  1H8A C;  2DMT A;  4C2M J;  1XC5 A;  3FIS A;  2Y9Z A;  3A02 A;  1OCP A;  3TP3 A;  3PM1 A;  1IC8 A;  1T33 A;  1APL C;  1OCT C;  5J3L A;  2ECB A;  2MSY A;  4W1U A;  3FIW A;  1Z77 A;  3MVP A;  2O7O A;  4V2F A;  1JGG A;  5C3E J;  4X6A J;  4JX6 A;  3ZQG A;  1JJ6 C;  1D5Y A;  2M2E A;  3HOY J;  2DJN A;  1LE8 A;  2ELK A;  1ORK A;  5JLW A;  3S17 J;  2IEK A;  4B1R A;  4MIM A;  2Y31 A;  4IEJ A;  3ZOB A;  4JYK A;  2AO9 A;  3IV5 A;  2AHQ A;  1SFO J;  3S15 J;  1TWH J;  2Y0S N;  3OSF A;  1T56 A;  4BBS J;  2DA1 A;  1QVT A;  2DN0 A;  1IDY A;  2YU9 J;  2K40 A;  1IUF A;  1JTY A;  1ZR4 A;  2GBY A;  4A93 J;  4BY7 J;  1RKW A;  5EZH A;  1H88 C;  1A5J A;  1HDP A;  4JP0 A;  3TW6 A;  3JRC A;  2NS7 A;  2M8G X;  4W97 A;  1AU7 A;  4JX4 A;  3ZQF A;  2E19 A;  3GTJ J;  3G1M A;  1IG7 A;  4XID A;  2YS9 A;  1F36 A;  2EBI A;  1PUF B;  4MLO A;  2HOA A;  1QRY A;  3NAU A;  3M3Y J;  1ITY A;  2NVX J;  2DMQ A;  1TWA J;  1LFB A;  3HB9 A;  4FTH A;  5IOY A;  2LK2 A;  3JRB A;  1XG1 A;  3LSP A;  5EGO B;  4L5E A;  2FJ1 A;  1JKP C;  3BR0 A;  5IP9 J;  3GTO J;  5M5W J;  4UUT A;  4C3I J;  4RBO A;  2HYJ A;  1DU0 A;  1JUM A;  5E3M A;  5EEA A;  1WGX A;  3HGY A;  3TED A;  2HOT A;  4D5C A;  1ETO A;  1FJL A;  5F0F A;  3S1N J;  2OF7 A;  2L7F P;  3M4O J;  1WH5 A;  2NS8 A;  3QPL A;  1H89 C;  3O8G A;  5F1J A;  3JRD A;  1S7E A;  5C4J J;  1JUS A;  2LR8 A;  2K9S A;  1UHS A;  5EG0 B;  1SAN A;  4A3C J;  1JT0 A;  2ZB9 A;  1MBJ A;  1JJ8 C;  2JA5 J;  1ETV A;  1BA5 A;  3LNQ A;  2L9R A;  1O4X A;  2CU7 A;  1IJW C;  5DTD A;  1BW6 A;  4I76 A;  5C44 J;  3Q0U A;  2DA4 A;  3NAR A;  4S0H B;  2R5Y B;  2DA5 A;  3GTQ J;  2P81 A;  3JRG A;  2O9L A;  2DTZ A;  4CYC A;  2E2I J;  1W0U A;  2JMW A;  2D5V A;  3E7L A;  1ZQ3 P;  3BR3 A;  4XK4 A;  1YRN B;  3QPS A;  2GM4 A;  1MH4 A;  1FTZ A;  1FEX A;  2R7Z J;  2HQ5 A;  3O8H A;  3MKL A;  5F04 A;  3HEF A;  3WHC A;  3UKG A;  5EDN A;  1GV2 A;  1GDT A;  2CQQ A;  3IH2 A;  1RPW A;  2VUM J;  2LVS A;  3TW7 A;  2LP0 A;  2KDZ A;  3HOV J;  4IHW A;  1P7J A;  3DEW A;  2DMN A;  5FKN A;  4BXX J;  3S14 J;  3BG9 A;  3ZQH A;  4FIS A;  3BTL A;  1IRZ A;  4C3J J;  4MO7 A;  3BR5 A;  1A6I A;  2X9D A;  2LY9 A;  3A03 A;  4C3H J;  3JRA A;  1K61 A;  1U78 A;  5E3O A;  3MN2 A;  1FIA A;  3HBL A;  1NK3 P;  3WHB A;  3BTI A;  1W0T A;  1MNM C;  1RKT A;  2XB0 X;  3F0C A;  4XRS A;  1GT0 C;  4A3E J;  4EEF G;  4Y52 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...