3S2HJ

Rna polymerase ii initiation complex with a 6-nt rna containing a 2[prime]-iodo atp
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s2hJ00
1NK2P 3TP3A 1GV5A 3GTGJ 5M5YJ 4JP0A 3JRHA 2DMNA 3JRGA 1Y1WJ 3GBGA 2VPRA 5C4JJ 5M5XJ 1ETXA 2E19A 4JX6A 5F27A 4EEFG 4HNVA 2X9DA 5EDNA 1BW5A 3VPRA 2KDZA 2JA8J 3IH4A 2CJJA 4CYCA 4FCYA 3BTCA 4DZPA 1MBFA 1ZKGA 4D5FA 5E3NA 2JMWA 1K61A 5M3MJ 4UUTA 1JKQC 5C3EJ 1U78A 2Y0SN 3HOXJ 5FLMJ 5IOZA 1ZR2A 5EEAA 1X58A 2VI6A 1H8AC 2CQXA 1GT0C 3CDLA 1XS9A 2R5YA 3OSFA 4M3BA 3FKIJ 2IEKA 3S16J 5E3LA 1Q1VA 1RESA 1OJLA 1OCPA 4D7MA 3ZOBA 5IYBJ 1BA5A 2MG4A 2K9NA 2EQRA 5M5WJ 1LFBA 3RQIA 1POGA 1ENHA 2WV1A 1UMQA 1FTZA 1PUFB 3LSJA 3JRFA 2CUFA 4C2MJ 2CUEA 2LY9A 1MH3A 5EZGA 1TC3C 5FKNA 5DS9A 4A3DJ 3DCFA 2GBYA 2IBDA 2MGQA 4A3EJ 5EG0B 1FEXA 4RBOA 3S1QJ 3HOVJ 1GVDA 1AKHB 2ID3A 1ETYA 1JT6A 1XC5A 3JRDA 1MSFC 1LE8A 2YUSA 1Z0XA 2PMZN 3TW7A 4L5EA 5K7ZA 3HOZJ 4DZJA 4V2FA 1IGNA 3S1NJ 3I4NJ 2EZLA 4B1RA 5IYDJ 3OSGA 4FE7A 1ZQ3P 4A3IJ 2E2HJ 1X2MA 3Q0WA 5FLVA 2CRGA 2XPWA 2NVXJ 3JRBA 1TWCJ 2E1OA 4M3FA 1R9TJ 4LOCA 1MBJA 3BR2A 1P7JA 3JRAA 1SANA 2LK2A 1BJZA 4GFBA 2FJ1A 5F1JA 3BQYA 3CQZJ 1JT0A 1HF0A 2R7ZJ 3BR1A 4X1EA 1FIAA 1YRNA 2HYJA 3HKZN 4DW6A 3HM5A 3SJMA 1Z77A 3JRCA 3HOUJ 3GTQJ 5F08A 4D5CA 2DA3A 2TCTA 4JX4A 1ZGWA 3G1OA 2DJNA 2DA6A 2R5ZB 2XPVA 3PO3J 4FTHA 3CMYA 1I6HJ 1X2NA 3GTJJ 1S7EA 3BR0A 3G1MA 1IV6A 3ZQHA 1RETA 4UUSB 3BTIA 3S17J 1JKRC 2XSDC 5K7HA 2ECCA 1ETKA 2LTPA 5EG0A 3GTMJ 1ITYA 2XGCA 2L7ZA 4DYQA 2YS9A 3LSRA 1AKHA 5FKOA 1CQTA 1B8IA 1RKTA 5FKLA 3GTKJ 1U9NA 1RR7A 2LVSA 5J1RA 2TRTA 4NDLA 2Y9YA 1W0UA 5EZHA 2L7FP 4C3HJ 1TWFJ 1W0TA 3S15J 1GDTA 5BNGA 3HDDA 1HOMA 2MW8A 4ABZA 5E3OA 3LSGA 1XG1A 5GP9A 5F0FA 2DN0A 1K83J 2R0QC 3QQAA 5FKMA 2HXIA 4J19A 2LFBA 2FX0A 4AC0A 2HI3A 1HLVA 3GTOJ 3B6CA 2JJ7A 3UKGA 4IHXA 2IAIA 2M9HA 2RAEA 2NS7A 4MO7A 1MBHA 2JA6J 3BG5A 3BT9A 2R5ZA 2JA7J 3IV5A 3LOCA 1MH4A 1Y1VJ 1IC8A 4IHYA 3W6VA 1WPKA 4A3MJ 4A93J 4MLOA 4S0HB 3OIOA 1IJWC 3A03A 3F0CA 3BR6A 1AHDP 3TEDA 4BKXA 3HGGA 1JKOC 2HOAA 4QIWN 3B6AA 1BL0A 2EZKA 5IPAA 2GLOA 3D1NI 1VNDA 2GM4A 2Y30A 4MFDA 3ZQGA 4IEJA 1A5JA 5F0HA 3LNQA 3PM1A 3BR5A 4B4CA 5EGOB 1H89C 3S14J 1T33A 3NAUA 2Y31A 5JLWA 2H1KA 4XRSG 4XICA 2P81A 3S1RJ 2ME6A 1MNMC 2DTZA 1EF4A 3TW6A 2DMQA 1ETQA 1UG2A 3JREA 4FE4A 3BTLA 2LKXA 3ZQLA 4JX5A 4MFEA 4A3FJ 3Q0VA 2VUMJ 2B63J 3NARA 4A3CJ 1QVUA 5IP6A 1HDPA 3H0GJ 3ZQFA 3BTJA 2XB5A 1U9OA 2VKEA 1GV2A 4A3JJ 2AO9A 3RZDJ 5IP7J 1ETOA 4CYCB 1H88C 1MBGA 4C3JJ 1WH5A 2ECBA 4A3KJ 1APLC 3MVPA 4G12A 4BBRJ 1HDDC 3C2BA 1PUFA 3H3VK 2HOSA 4A3GJ 4V2GA 2OPTA 4QSHA 2DA7A 2COBA 3SDGA 1ZR4A 2O8KA 2QCOA 3LSPA 2DMTA 3A02A 2D5VA 5F0CA 2DA2A 3G1LA 4I76A 1OCTC 1IRZA 5IOYA 1JUPA 3A01B 1WCMJ 1B72B 4QTRA 2ZB9A 3O8GA 1IG7A 4RDUA 3SFIA 3IH3A 3RKQA 1I50J 4M3GA 2JA5J 1RPWA 3BQZA 3CCYA 2O9LA 5F04A 1QRYA 1JKPC 2X6OA 4DYCA 1IUFA 1JJ8C 1WH7A 2K9QA 1NK3P 3FK6A 1UHSA 2K9SA 2DA1A 3HB9A 2HQ5A 2FQ4A 4AUXA 2L9RA 1SFOJ 1LE8B 2R92J 2M34A 2G0EA 1GUUA 1ZK8A 2H8RA 1JUSA 2XGEA 4IHWA 3WHCA 2CQQA 1OFCX 4XRMA 1JTXA 1AU7A 1JTYA 5IP9J 5FJ8J 3DEWA 3QPLA 2HDDA 3JR9A 2HXOA 1NTCA 1E3OC 2Y9ZA 2E2IJ 3WHBA 2NS8A 2NVTJ 3Q0UA 4C3IJ 4UUSA 1BW6A 1A6IA 2WAQN 5M3FJ 1FJLA 3BR3A 1VFCA 1VI0A 3PO2J 3ZQCA 1TWGJ 1U8BA 1IDYA 2LP0A 2LD5A 1YRNB 1F43A 4XRSA 2L7MP 4DYRA 2JWTA 2OF7A 2HOTA 2YU9J 2N8GA 3GTLJ 4BXXJ 2O7OA 1RKWA 3HBLA 3A01A 3MKLA 4M6VA 2EZHA 4IHVA 2ID6A 2X48A 1B72A 1T56A 4A3LJ 5HODA 9ANTA 3S1MJ 2DA4A 1ZTRA 2QF7A 3FISA 1JGGA 2ELKA 2NVQJ 3BG9A 3M4OJ 4W97A 5E3MA 2WB1N 2M0CA 3K2AA 1FTTA 1ETWA 4AYBN 1ETVA 3BG3A 5FKKA 2K40A 2DA5A 3O8HA 2W48A 1B8IB 3FIWA 1DU0A 1DU6A 4MIMA 2XB0X 1IDZA 1ORKA 5GPCA 4X6AJ 2MSYA 3JRIA 2FD5A 1WI3A 1MSEC 2DMUA 3K7AJ 3MN2A 1JUMA 4M3EA 3QPSA 2XGDA 2Y2ZA 4Y7NJ 5IYCJ 4BY7J 1P7IA 4A69C 3E7LA 1O4XA 1FIPA 3I4MJ 2EBIA 5DTDA 1MBEA 4D7NA 1MBKA 2XPUA 1JJ6C 2CU7A 5JLXA 3HOWJ 5J1YA 2M2EA 3M3YJ 5C4XJ 4M3DA 3S2HJ 4W1UA 4A3BJ 4Y52J 5EYRA 1G2HA 2EH3A 2ME0A 3ZQIA 4BBSJ 2JN6A 3Q3SA 2NVYJ 2JK3A 2R5YB 4FISA 3HEFA 1HCRA 3HOYJ 2KT0A 5J1UA 4XIDA 1D5YA 2M8GX 3FK7A 2EZIA 3S2DJ 4XK4A 5GPAA 3L1PA 4BY1J 3TP0A 5K7FA 1VF9A 1TWAJ 5EGOA 1QVTA 1LFUP 3IH2A 2LR8A 2I10A 2LLKA 1F36A 5EF6A 2L0KA 2R93J 2AHQA 4I6ZA 2E2JJ 1QPIA 2DMPA 2XRLA 5J3LA 2NOGA 1I3QJ 1WGXA 1TWHJ 4JYKA 5C44J 2VKVA 4B3AA 3HGYA 3GTPJ 3OOUA 3RZOJ
chains in the Genus database with same CATH superfamily
2EFQA 4H4KC 1NK2P 3TP3A 3F8MA 3GTGJ 1FMWA 2GXBA 3FX3A 1R1TA 3GF2A 2DMNA 1Y1WJ 1OYIA 1YJ9I 2ISZA 1FBSA 5TRDA 4JX6A 4BUPA 2K86A 1EH7A 1O3RA 2AS5F 2DYRH 5BQTA 1XGOA 2EINH 2VOPA 3JSOA 4AWXB 1OCOH 2O0YA 2NOJB 2JA8J 1T8IA 4FCYA 1Z05A 4DZPA 1X3UA 3ABLH 5CVIA 5TISC 3RTRA 1ZKGA 3CZ6A 3DBLB 2JMWA 4LIVA 5M3MJ 1U78A 2ZXWH 4ZZLA 3I58A 3DQVC 4YELA 5IOZA 1R58A 1Y39A 2L9SA 5D5XB 3L2QA 1GT0C 2QBYB 2HDCA 2BW3B 2EV5A 5JR3A 3CCVI 2BZTA 3CDLA 1XS9A 2G7UA 1UB9A 4XRFA 2R5YA 4M3BA 4BXUA 2IEKA 4UV9A 3S16J 4XNFA 2YX4A 3F22A 1OJLA 3VODA 4HF1A 1BA5A 1QNTA 2MG4A 2V1DA 2JT1A 2XAUA 3K6GA 1U6GA 2FBHA 5M5WJ 1X1AA 1Y6IA 4RGXA 3RQIA 1POGA 1UMQA 1X3ZB 1WWXA 3ZMDA 2LOOA 3JRFA 2CUFA 4C2MJ 3D5SC 1WVRA 1DGRM 5EZGA 1USTA 4UV8A 1IN7A 4Z6YA 2GXAA 1XSDA 2DODA 3WTUC 5HDKA 5FRNA 2ADUA 2VBYA 4CCOA 4WCGA 2L01A 3P9IA 1IN4A 1XPXA 1Z67A 1ETYA 2LNBA 5GTHC 1MSFC 3TW7A 4L5EA 3OY9A 1WSUA 4L0YB 3AFHA 3HOZJ 4DZJA 2F48A 3FZVA 4V2FA 2UV1A 4CCJA 3DKXA 3LA7A 2DFFA 2L2OA 1ZG1A 1SFEA 4JK1X 2W57A 4LJZF 3RDIA 2BXYA 2EZLA 2GXGA 3C2GA 3I55I 4FE7A 4YFNF 4A3IJ 1NG6A 2NVXJ 2XGXA 1QGPA 2JSCA 2XV4S 1R9TJ 3PQKA 4IF4A 1JXSA 3BR2A 2KIMA 4HG2A 1P7JA 3KZIC 1FX7A 2LK2A 4GO1A 1YG2A 2BY3A 2FJ1A 2KL4A 3DTIA 4GFBA 5F1JA 2VBXA 2G9WA 2NNNA 2LY2A 2R7ZJ 2Z9OA 2EIMH 3BR1A 2ZXJA 3RPUA 2IA0A 1YRNA 3CF5F 2FNPA 2HYJA 3HKZN 2DOEA 4GYGA 3HM5A 3BPXA 3SJMA 4LG0A 1WQ2A 4U87A 1T38A 3HHHA 4G8XA 3GTQJ 4XSXF 4D5CA 1SD4A 3G1OA 1WKMA 4N0BA 2HQAA 3FXLA 1YHQI 1TQMA 3RPUD 1X2NA 5F1RA 4IJAA 5L3FA 3M8FA 3VSKA 1FYLA 3BR0A 1KYZA 2VQGA 1UCRA 3S17J 4DGWB 1OKRA 5K7HA 2ECCA 2LTPA 5EG0A 5KHDA 2XGCA 2L7ZA 2QSFX 2VQLA 4DYQA 3WTZA 1CQTA 2W85A 3T0YA 4OU0A 3C18A 1RKTA 3GVAA 1FNNA 4BNCA 1IN8A 3WODF 2A5WA 2Q0OA 1QHHD 2GZWA 2V9PA 5BS6A 5B3SH 3X2QH 2CV2A 3L09A 1CF7B 4ZYGA 1QHGA 5EZHA 4O6JA 2ZMEC 3DP7A 1W0TA 1G59A 1GDTA 2LREA 4DOZA 3FXRA 2Y48A 2MW8A 4RAZA 4U7BA 4U0VA 2LBFA 4G6QA 1XX5A 5F0FA 1WFXA 2DN0A 4LB6B 1MMSA 5H6QA 2HXIA 2LH9A 4UB6C 3K4KA 2HI3A 3I59B 5LHHA 2JJ7A 3E6BA 2M9HA 4XLPF 1FOXA 1KU7A 1VQ6I 3HXLA 2H1LA 2LRDA 4MO7A 2Z16A 2F5DA 1MBHA 2JA6J 2CW8A 2OC6A 1HBXG 2R5ZA 3IV5A 1ON1A 2ICWG 3K9TA 3ZN0A 2HZDA 1PP7U 4PCQA 4HDUA 3W2AA 2ZJPF 3F9KA 3JCUC 4A2UA 1D1BA 3A03A 3F0CA 1AHDP 2DW4A 2L5QA 1JKOC 1EA3A 2M3AA 3MQ0A 3TMOA 2EZKA 1BL0A 1W1WE 1DPRA 3IC7A 1OLTA 2A6HF 1NHAA 1U5TC 2LF7A 1IO2A 4NC6A 4MFDA 4EGYA 3K4LA 4YG2F 2ZMEB 5F0HA 3M8JA 5D4SA 3ZCOA 2KLOA 2HVSA 4CCNA 5GAGJ 4G7OF 4BQAA 4UVAA 4HAMA 2Y31A 1D1AA 4ENNA 3V8LA 3TOAA 3OYMA 1D8KA 3QP5A 4HQEA 5D6FA 2O5RA 4EJWA 1SVMA 1TL8A 3BTLA 3CMAI 3ZQLA 4JX5A 4KIFA 1DUXC 3BZ6A 1UG0A 2A61A 2KISA 2VUMJ 2ZO4A 3NARA 4A3CJ 2BHZA 4HPQA 3ZN1A 2MBFA 1V54H 4FQGA 1J75A 1YOVB 5HVQC 2HVQA 2XB5A 2E1CA 5DD4A 2M7BA 3RZDJ 4WK8F 1H88C 2P5LC 2STTA 4P9FA 4PGGA 2KFDA 4XKBA 3BY6A 3CLOA 3J80K 1R71A 2MC3A 4HW0A 1V4RA 4G12A 3DPTA 2NNYA 2KRFA 3DXJF 3C2BA 1PUFA 2HOSA 1KGSA 3BCBA 3A0HC 1F9NA 2PMHA 3W6KB 2FMLA 3PIOF 1YW9A 4M9ZA 4BL0B 1JE8A 5HS8A 1ZRDA 2DA7A 3OYBA 3M8EA 1ZR4A 2O8KA 3ONQA 4EGZA 1VQMI 2IS2A 5E1XA 4PZJA 2V7FA 3IL2A 4P5OA 4LK1F 3CCEI 1FYKA 2Y0MA 1WZ2A 4HBLA 3A02A 1XDSA 1DQUA 4I76A 5D8KB 5E17F 1USSA 4P9UA 2LMDA 4G7ZF 1WCMJ 3BG6A 4KIBA 2J5OA 2PQ8A 3DPUA 3WG7H 2JA5J 3BQZA 1MD0A 1BC8C 4XKVA 1QRYA 2X6OA 3IKVA 1SAXA 1JJ8C 3KLNA 2V26A 5L3CA 2OTJI 4HX7A 3LA3A 2V79A 4ZYAA 3DKWA 4D9JA 3DTEA 2DA1A 2OQGA 3HB9A 2IRFG 3OS1A 1S8NA 2L9RA 4LFUA 1RNLA 2BGCA 3M07A 1SMYF 2V1XA 2G0EA 2ZKZA 3VYRB 3H5RA 2XGEA 4M71A 1V5FA 1K6OA 1XSVA 3WE2A 3ZMSA 2QGUA 1JTXA 3T8TA 4J01A 2BY2A 1FWZA 2OD5A 3U2RA 1R22A 2ESNA 1UZCA 4MTDA 1WJDA 1BR4A 2NS8A 1YI2I 4UUSA 5B5EC 3BCAA 4AIKA 2X85A 2WAQN 1ZELA 5LEJA 2A05A 1IAWA 2L9VA 3BR3A 4HLXA 4A6DA 1VI0A 2MLKA 3PO2J 4U7DA 3ZQCA 1P2FA 3W2WA 2QQ8A 1U3EM 1R1UA 3BLYA 2P4WA 2LD5A 1YRNB 2O61A 3VFZA 1K6YA 1U8RA 2JWTA 4Q47A 3GTLJ 2HOTA 1BBYA 4Y33A 4BXXJ 2VOOA 4WX9A 3KYLA 1BIAA 3U9GA 3A01A 4RB2C 2EZHA 1B72A 4BACA 2QQ9A 1XMXA 5HODA 9ANTA 2VE8A 1DPUA 1J5YA 3GW2A 1ZTRA 3FXJA 4MGRA 2DI3A 2WY8Q 1KZHA 2CYYA 2IA1A 3MZYA 2JPBA 3O6BB 3G2BA 3MZHA 2VKDA 5KAFC 3QRFF 1LJ9A 3VYSB 3DBHB 1W5SA 4S04A 3ZXSA 2DA5A 1LEBA 3FIWA 1DU0A 4L18B 4MIMA 2JVHA 1OQYA 2ZFUA 5GPCA 1SVLA 1B1BA 1EKEA 3CC4I 3C7JA 3RKXA 5E1WA 3S32A 4Y7NJ 4KT6A 4EM0B 2KZVA 1K78A 2E5NA 3LWFA 4N4OB 1LFPA 2VIXA 3KYCB 2UZKA 1O4XA 1FC3A 1RUOA 2R7TA 2X1DA 3ABKH 1KA8A 2P6TA 2E7XA 4D7NA 1MBKA 1XTAA 1IUYA 4XOPA 2UXNA 4BAYA 1ZGAA 3WG9A 1JJ6C 5JLXA 3HOWJ 4IKFA 3M3YJ 1XD7A 5LFAA 3I71A 4RM3A 1ZLKA 3ZMUA 3F3XA 3CCRI 2QENA 2YU3A 4F7ZA 1HW2A 1G2HA 2HZTA 2BV6A 3F23A 4P55A 2NVYJ 4FISA 1Z6TA 4BJ6C 4CZZA 4E7ZA 5J1UA 2M8GX 3FBNB 1P6RA 2WBMA 1S6LA 2EZIA 3KX2A 2CQKA 3TP0A 2W25A 3C3WA 3H9QA 2EIJH 4KT5C 1BC7C 1HW1A 2I10A 2HU9A 3EUHC 3KCCA 1R00A 1MGTA 4OAZA 1MMAA 3DLAA 2W7NA 4I6ZA 1QPIA 2DMPA 4O3MA 3JTGA 1VQ4I 2NOGA 3A2KA 1TWHJ 1MMNA 4B3AA 5DEQA 3U1KA 4I0BA 1LVKA 3OOUA 1PDNC 2PX9A 3DLLF 3G73A 1A35A 1XGNA 3E6MA 4JP0A 2FMYA 3WTVC 3JRHA 1PYVA 3JRGA 4NHJA 4BGDA 4G9YA 2E19A 5D5VB 5GAHJ 3HJEA 3AAFA 1XMAA 2E1MC 3E5UA 1BW5A 2MH9A 1YYVA 3VPRA 3ZRGA 3NQOA 4NQWA 2DAOA 2ZNZA 3S3MA 4NB5A 2L4MA 2CS3A 2CWEA 4OIQF 2PI0A 2WB1A 4UUTA 4OWRB 5C3EJ 3CUOA 1YQAA 4KFCA 4I02A 5EEAA 2VI6A 3E6DA 2JTVA 4LITA 1H8AC 2H09A 1A6QA 1DP3A 4RAGA 2KP6A 1I1GA 4HF2A 2HQRA 2ISYA 2BE5F 3OSFA 3S3OA 4LLLA 1J7KA 2MD5A 4XKWA 3M1CA 1Q1VA 4BDZA 4EJUA 1F5TA 1TLHB 3TQNA 4KN7X 4D7MA 5GAEJ 2OUMA 4BHBA 1X1DA 3B73A 2K9NA 3IWFA 3QPHA 2FBIA 2QYOA 2K4JA 5ED4A 1LFBA 4IRGA 4KJZA 5HLGA 3DU6A 1PUFB 3BOQA 2FRHA 4EM1A 3LSKA 4D1QA 1PP8F 2CUEA 4AVPA 1J9IA 1J0RA 1ZHFA 5DS9A 4OIPF 4UXNA 3PJRA 3DCFA 1BM9A 4WXCA 2IBDA 2WTEA 1BI1A 3G3ZA 4A3EJ 5IT9K 1D1CA 3HOTA 2BXZA 4N9HA 3H9JA 3S8PA 2M5WA 3ML6A 2ID3A 2K27A 4IRIA 3M1EA 3OWTA 1JT6A 1XC5A 2W1OA 4R8HA 3JRDA 2YUSA 3L2WA 1Z0XA 2FBKA 1LE8A 1BJAA 3GWZA 1TT0A 1GHCA 3F21A 3HG9A 1R4MB 1IGNA 1QPMA 1FBUA 1SAUA 4B1RA 1ZARA 3ERMA 3ROUA 4P1WA 3O3KA 2K3PA 1ZQ3P 3OYDA 2OZUA 1X2MA 3Q0WA 3NEUA 5D8LB 3WU1B 2XPWA 1O7LA 4ANJA 1BR2A 4XLAA 1Z3YA 2NRAC 3GX4X 1MBJA 2CUJA 3ZQ7A 1HKQA 1BJZA 4I98B 3GZ6A 5TGTA 3CQZJ 3WTTC 1HF0A 4RGSA 4UHTA 2RN7A 2X0LA 4BQNA 3DEEA 2WAEA 2X1CA 2JUGA 1Z77A 5LEKA 3KP6A 4ENMA 3CF2A 4MNUA 5F08A 2OU2A 2DA3A 2Q2EB 4JX4A 4LGWA 2V9VA 1ZGWA 2EB7A 2XPVA 2HKXA 5FLXZ 3NWTA 3OS2A 4ITVA 1O7FA 2W84A 2Y0SA 3CMYA 4UNOA 1JGSA 3EPZA 1VQ7I 3V42A 4DQ2A 2O6GE 3FXQA 2XKPA 1U2WA 3G1MA 5E8IA 1IV6A 3ISPA 3KFWX 4UUSB 3C1DA 4PSWA 2R7DA 1UAAA 2QSGX 4CYDA 5D6EA 2XSDC 3REOA 2VJ4A 1ETKA 1WJCA 1T39A 4LD5A 5JHFA 3GTMJ 4X0GA 4BE2A 1ONVA 2DLLA 1AKHA 2F5EA 2OCCH 4BE1A 5E20A 3HPGA 1W36C 2P7CB 3PNVA 3SYTA 3GTKJ 2HYGD 2R7WA 5DCMA 4LK0F 2CG4A 1YIOA 1D0YA 3H1CA 5J8FA 3V4GA 2Y9YA 4C3HJ 1TWFJ 2KDOA 4DIQA 4B8XA 1VQPI 4IPAA 3HDDA 2KHMA 2VLAA 2JQ7A 3HC7A 4MQVA 3GO5A 4FX0A 4IRHA 1XG1A 4K2EA 4M6XA 2VE9A 2QQBA 3DKYA 1K83J 2R0QC 1OMIA 3M7GA 3OOPA 4YIFA 1WHUA 2B0LA 2PMZA 5FKMA 2LFBA 2V1NA 3QOEA 1MKMA 4KUMA 1MW7A 1TTYA 1TNTA 3L9FA 3C2HA 4G6TB 3F8CA 2D1HA 1OR7A 2HNHA 3BT9A 2XSJC 3LMMA 3W6VA 2GA1A 3IWZA 2I5UA 2W00A 1K4TA 3QAHA 4ESFA 4A93J 4MLOA 4QLCU 1IF1A 2D2WA 3CLQA 3TKYA 3KPHA 4BKXA 2QQAA 1L3LA 4QIWN 2EIKH 3KP5A 1ZRCA 1Y0NA 4Y17A 2IW5A 2UUZA 2Y30A 3ZQGA 2XAJA 3AG2H 4EJVA 5ILVA 1A5JA 1RI7A 4L9TA 4XORA 4B09A 1IN5A 2NVUB 4EM2A 2STWA 2XAHA 2KIUA 3S14J 3K1MA 3ELKA 2CV1A 2F4OB 2DT6A 3NAUA 4A12A 5IT9Z 3CCUI 1YS6A 3DBRB 3I54A 5JLWA 4XRSG 5LHIA 2M1BA 3S1RJ 2ME6A 1T6SA 1F4KA 1O3TA 1EF4A 4H0EA 3BJAA 1D0XA 1ETQA 1UG2A 4KMUX 3MKWB 4A5NA 2LKXA 4MFEA 5E79C 1B6AA 3BJ6A 2B63J 1R6RA 3K10A 3LQRA 4PJJA 3WTXC 2IGMA 2K9LA 1HDPA 3H0GJ 3ZQFA 2FXAA 1BR1A 1ZYRF 1IV8A 1U9OA 3WGHA 4PJLA 2VKEA 1GV2A 2DBBA 4A3JJ 2AO9A 1LUJB 2CV0A 5IP7J 1ETOA 4NQWB 4BEHA 5CVUA 2E5ZA 2DK5A 4UVBA 3A4CA 2VC0A 5CVRA 4A3KJ 1SD6A 3MVPA 4II3A 2LG4A 2FUG2 2XF5A 3MAJA 2NAZA 3ECHA 3RYRA 1HDDC 2L02A 1HSJA 4A3GJ 4YFXF 5GTIC 1BN5A 2QZ8A 4QSHA 3PIPF 3SDGA 2BBYA 1LDJA 4WXHA 4DNCA 1KQ9A 2F5CA 1E0EA 2XRNA 2YX7A 2R3SA 2D5VA 5F0CA 2DA2A 3QODA 4ASNA 3B02A 3QOPA 4RS8A 1P9QC 1B9MA 1IRZA 5IOYA 2ZC2A 2VT2A 1JUPA 4HSRA 5CQGA 4MHGA 5B66C 2CGPA 1KQ8A 1YLFA 5FB2A 4QTRA 2OQRA 5CLSA 2H8WA 2VB6A 3CCYA 1JKPC 1GXPA 4DYCA 1MMGA 5LBQA 5FROA 1VQ8I 1MNDA 1FZPB 4KIGA 3I3LA 4FASD 3L2VA 2IGOA 5ILSA 2F5FA 3OMYA 3ASOH 3FK6A 4YIIA 2JUCA 5L3GA 5FO5A 1SFOJ 1LE8B 2R92J 4E7HA 2RC4A 1ZK8A 4PFPA 4A0YA 1DDNA 3G6EI 3H35A 5KCMA 2FOWA 2KQRA 4HX8A 1FLIA 1D3YA 4DJAA 2EA2A 3R0JA 1UHWA 5FJ8J 4YFKF 1NG7A 2C6YA 2IA2A 2HDDA 3FKJA 3KZYA 1R4NB 1YX5A 2JA2A 3Q0UA 3CJRB 2O8XA 2Z99A 1A6IA 1LDDA 5ICCA 2ELHA 2KRHA 2LF8A 5M3FJ 1X1CA 4XONA 5HLTA 3K70D 1VFCA 3FWEA 1AA7A 3AG4H 4OINF 4ENKA 3MCZA 1E2XA 2MC4A 4E4HA 3HSFA 1ZG3A 3AG1H 1VQKI 4ON0A 2LC2A 4MEYF 1IDYA 1X1BA 1F43A 1CGPA 4B3XA 4UUVA 3CUQA 5DD8A 1W7PB 2YU9J 3M9AA 2O7OA 1X3WB 2LKPA 2JRTA 3HBLA 3MKLA 2HYFA 3QPTA 4GGGA 3CJNA 2WADA 2ZSHB 2HWVA 4KISA 4A3LJ 3HOSA 3DTKA 2QF7A 4OAYA 1C0WA 3FISA 2NVQJ 2ELKA 1XCVA 3SQNA 3M4OJ 4U88A 4HYEA 5E3MA 2VPLA 3KE2A 2M4GA 2WB1N 2M0CA 3RJPA 4CCMA 2MLGA 1ETWA 2MFZA 4LLNA 2P8TA 4AYBN 1GLNA 4CZCA 4OMZA 3WGIA 3D0SA 3W2VA 4ZZDA 4CXFA 1FT9A 2W48A 4L9VA 4A6EA 3PQJA 4GYIA 1IDZA 3FM5A 3CMMA 3HRSA 2JVGA 1KONA 1REPC 3WU0A 2DMUA 3MN2A 4XLEA 3HSEA 4M3EA 5DCMB 1W4MA 4NC8A 4MQ9F 3U1DA 1HXDA 3EQLF 3MEXA 2CQNA 4BY7J 4A69C 5LGTA 3E7LA 3KP3A 1FIPA 1T98A 2PBIA 5AIQA 2EBIA 5BMZA 1Z91A 2DOFA 2EILH 2FNAA 5J1YA 1H9TA 5C4XJ 4M3DA 4Y15A 4A3BJ 2RV8A 3CJQB 4Y52J 2ME0A 4I0AA 1SVOA 4BBSJ 4O5VA 1LKXA 2R5YB 3HEFA 3HOYJ 5D5UB 1D5YA 4XIDA 1IXCA 3R4KA 1JHHA 2BVLA 2NS0A 4BY1J 3K4JA 4IHTA 2VXZA 1YITI 2LR8A 4JQFA 5H2FC 3FXOA 2R93J 1Y8QB 3ZMTA 2E2JJ 2BOLA 5J3LA 3GZ5A 3KP7A 1LNWA 4MEXF 3CC7I 1I3QJ 5C44J 3GEZA 2VKVA 3KIOA 3NWSA 2P5KA 4EV0A 3H0DA 2PJPA 3HGYA 3V8JA 1GV5A 2QA4I 3QU3A 3GLLA 3BP8A 1K4SA 5M5YJ 4KDPA 5FFXA 1R1VA 3GBGA 1EH6A 3J7AY 4A0XA 5M5XJ 5K5OA 1BOAA 3TDZC 2H6BA 4RMNA 3BROA 1B9NA 4HNVA 2X4HA 2OCEA 2JSPA 2X9DA 4M9XA 1IN6A 3JAMZ 1R49A 2W4SA 1GVJA 2GIZA 2WY7Q 3E6CC 2YSRA 2EV6A 3OYCA 2KDZA 1OYYA 4CA0A 2CJJA 3GFLA 2IS1A 2ELJA 4XKCA 1T08B 2XROA 4E7KA 3JSPA 5LRSA 2TDXA 3V7SA 2FOKA 2Y0SN 5FLMJ 1ZR2A 3FHNA 1X58A 4XN0A 3T8RA 3G4SI 4U0WA 2CQXA 1WJBA 3ERED 2A5YB 4UB8C 2X6WA 2BYVE 2O3FA 5FFZA 4P96A 2Z3YA 2V9KA 3R6SA 2ZSIB 4RLFA 3SEZA 4XN3A 3TBIA 1RESA 3BC8A 1OCPA 2COMA 2HFHA 3ZOBA 1G6NA 5IYBJ 4BEHB 4LG0B 4L5IA 2EFNA 1HSTA 2E71A 3P9KA 4F52A 2FF4A 2R7SA 3CO6C 2WV1A 4FX4A 1FTZA 3LSJA 1TC3C 5FKNA 4A3DJ 3ZGKA 2RVCA 2IT0A 2B7EA 3MKZA 3G71I 1QZZA 1HW5A 1XGMA 2MGQA 1Y8RB 1VQLI 5EG0B 1WJ5A 1LQ1A 4RBOA 2CH0A 3S1QJ 4XM3A 3HOVJ 1GVDA 3GCMA 4I01A 1TW3A 4HX4A 2EFPA 3HUGA 3TO7A 2PMZN 5K7ZA 4R1HA 1QO0D 2HR3A 1VTNC 3PUBA 1T0FA 2QM3A 2FQ3A 1HKSA 3I4NJ 1LVAA 5DCFA 2VL8A 3OSGA 3GYHX 3ZR8X 2E2HJ 5E1ZB 2O03A 3JRBA 1TWCJ 3OYHA 4LOCA 2GQQA 4R79A 1XN7A 3F8BA 2F5VA 3MZ8A 3OYIA 3JRAA 3ULQB 2QSHX 2QBYA 2LBFB 4PFOA 1W5TA 2BW3A 1FOYA 2Z2SB 3KEYA 1R5GA 3RSNA 4ESBA 4OOIA 1FY7A 1JT0A 1PUEE 4X1EA 1I1SA 2ZJQF 2ETHA 3W6JB 1LEAA 2GOMA 1NH3A 2VJ5A 5FLXK 4DW6A 3JRCA 1WJEA 4XBFA 3V7CA 2ZJ2A 2CFOA 2TCTA 3GZNB 3WTWC 2E1NA 2R5ZB 2L9NA 1A04A 3PO3J 3LFUA 2EK5A 3H92A 2WAFA 4FTHA 1I6HJ 3K1NA 3GTJJ 1S7EA 3OYAA 1R36A 1XGSA 5L3BA 3BTIA 2XHKA 4ZH4F 2ZJRF 1JKRC 3D5RC 1YTYA 2EV0A 3OR1C 2M45A 1ITYA 2YS9A 2VQCA 5DYMA 5J47A 1GXQA 3MWMA 2DU9A 2M30A 5EEGA 2PEXA 2VJJA 2ZXHA 3OS0A 5K5RA 3I4PA 2LVSA 4V19K 4G7HF 5A2QZ 5J6XA 3H5NA 4RAFA 2QWWA 4BHCA 4NDLA 1SEUA 3AKZA 3OYGA 4B44A 4BS9A 3CCMI 1W0UA 2L7FP 2DJIA 4NNJA 5AIPA 3JTHA 3HSRA 4IO9F 1S3JA 5E3OA 3RI4A 5GP9A 1S29A 1YS7A 4EATA 4G94A 1G8XA 1MJAA 2H94A 2CW7A 3PFYA 5HNHA 2FX0A 2RQPA 3FM3A 1H9GA 3AG3H 3I5UA 4UVCA 2A69F 1HLVA 5CPRB 2ESHA 2PFBA 3GTOJ 4IHXA 1IXSB 2IAIA 2RAEA 3ASNH 4E7JA 1Z7LA 4J00A 2BY1A 4CDGA 4E70A 3LOCA 2H6CA 1IC8A 3GMEA 1WPKA 2VASA 3FF5A 2KIFA 3H9GA 1OPCA 2KJBA 4RA2A 3KLOA 3OIOA 1IJWC 3BR6A 1A36A 3CP8A 5K1YA 3TEDA 2AXTC 1Z3XA 4YEJA 3B6AA 4KICA 3Q9SA 1FPQA 3SDBA 2OA4A 3SZTA 4WXDA 3D1NI 1VNDA 4ZYHA 2GM4A 1TNSA 2VXDA 1W5CC 1STZA 3IAS2 2X6YA 3VDXA 4IEJA 1R7JA 4GXOA 2EFOA 1J2XA 4IL6C 4CICA 4B4CA 4XLNF 1RZ4A 1UELB 1T33A 2DFHA 3E3VA 2P81A 2GOXB 4RGRA 3SZGA 3J7ZI 3COAC 4AD9A 3CP2A 1EH8A 4FT8A 1IRGA 3SHFA 1IRXA 3TW6A 4BXFA 1UHMA 3JREA 2KRCA 5GADJ 3FMSA 3QU6A 3DV8A 1Z21A 3QYFA 1FSHA 1VQNI 1QVUA 4Y3OA 2HEOA 3ZP5A 1Q1HA 1U0JA 2WC2A 4KMFA 4CGZA 4LB5A 4E7LA 1G4DA 3FDYA 3RCOA 4C3JJ 1WH5A 2F6CA 4CCLA 1APLC 1BI3A 4PGHA 4N4NB 1OYWA 2X1EA 2WWYA 4I09A 2OJED 1RIOH 2OPTA 3SEQA 4PJNA 1HC8A 1V55H 2MD0A 3J81Z 2QCOA 2ZMEA 3TGNA 4HSTA 2CUZA 1YJWI 1SD5A 1Z9CA 1YW7A 2MH2A 1L0OC 3G1LA 4ZDOA 1OCTC 5HDGA 1X1PA 3GXOA 2XAGA 1D0ZA 3A01B 4UY8I 5JFRA 3TL4X 1B72B 2ZB9A 3O8GA 1IG7A 4RDUA 3IH3A 1VZ0A 2WAQA 1I50J 2P6SA 3A1YA 3PSFA 4OIRF 3HTUA 5F04A 4C2UA 2HQNA 4B47A 1ACIA 1IUFA 1MMDA 5FRMA 2KZGA 1YIJI 2XAQA 3KEQA 2LDUA 3OYFA 1FP2A 5HNFA 1NK3P 1E3PA 5L3DA 5DUIA 3F6OA 1I27A 1TZLA 1UHSA 2K9SA 2XAFA 3EETA 2HQ5A 1XDUA 2FQ4A 2PG4A 3HUGB 3N97A 1QZYA 2M8EA 1KQ0A 2IVMA 3L00A 1GUUA 5IY5H 1R5HA 2CQQA 5HS7A 3CD6I 3VSLA 5J4YA 3L7WA 1MZBA 4ZTFA 1FMVA 1AU7A 3R0AA 1K78B 1UFMA 1TBXA 1U5TA 3BJOA 4CO8A 5IP9J 1Z1DA 3QPLA 3JR9A 1YX3A 5ILUA 1OISA 2HXOA 3EDPA 4EVIA 3QWLA 3ZQQA 2Y9ZA 1E3OC 3WHBA 1IXRC 2AQEA 3LQQA 5HOOA 2E2IJ 4C3IJ 2NVTJ 2ZCWA 4YIRX 3ABMH 2K3FA 3GFJA 2G7HA 1BW6A 3VWBA 3QYEA 5CVJA 2VQHA 2UXXA 1TQPA 2FU4A 2NXNB 2CMPA 3CCJI 1TWGJ 3PUFA 3GLXA 4F93B 2LP0A 4XRSA 4EJOA 2XC7A 1MNEA 5ICFA 3R61A 5CKTA 2NYXA 2OF7A 4XR6A 5D4RA 1RKWA 4M6VA 3I0TA 2HGCA 2X48A 1O57A 3F6VA 1TW2A 3I56I 1O3QA 3S1MJ 3KEOA 2EWNA 4IOAF 2DYSH 5CQEA 2IGKA 1QZEA 3BZCA 2HS5A 4W97A 4F91B 4XLHA 3L2UA 2DT5A 4NBQA 1FTTA 3DFGA 3OYLA 2DT7B 3H5AA 1SFKA 4EJTA 2EPFA 1EJ9A 4HA8A 2K40A 5F6FA 1ZLJA 1SC7A 4F92B 1FBQA 4LMYA 3GFIA 2I8DA 2J5PA 2XB0X 3ABTA 1S5LC 2MSYA 4B48A 3JRIA 3VEPA 1MSEC 1JUMA 3BG7A 3VB2A 1VQ5I 2Y2ZA 3CCSI 3ZPLA 2CO5A 5H20A 1OCCH 5IYCJ 4WF2A 3H36A 5LLQA 3RKYA 3I4MJ 3Q5FA 2CSOA 3E97A 4PK4A 3LA2A 4RGUA 3EYIA 1I39A 2DFIA 5J40A 1R5ID 3WTSC 3K2ZA 2VT3A 3S2HJ 3RKWA 2M87A 5EYRA 2EH3A 2HVRA 4OIOF 3ZQIA 4IVNA 1LPQA 2JN6A 3P7NA 5CVVA 1XMKA 2E60A 4HV5A 3OIQA 3HPHA 3VYUB 4BJ5C 2DPUA 1OCRH 3S2DJ 4XK4A 4Y13A 2DOAA 5GPAA 3OV8A 3L1PA 5K7FA 2IGNA 1VF9A 1KU3A 3DEUA 5EGOA 1QVTA 4I7HA 3IH2A 1LFUP 2DXIA 3K4CA 3BDDA 5EF6A 4PSXA 2AHQA 2D45A 2XRLA 4RLQA 4L9JA 1TQIA 4JYKA 2DO7A 3VOEA 3CMEI 3GTPJ 3LSIA 4AVZA 2CQ7A 4BDYA 3TO6A 1O3SA 2BEOA 4Q4ZF 3JAMK 1KU2A 1ZH5A 3DWLE 2VPRA 2BY0A 2V6EA 2XUBA 5C4JJ 5J4VA 1ETXA 3PL8A 4M74A 1G3SA 5E8GA 5F27A 4EEFG 3S3NA 1B4AA 5EDNA 4XLFA 2GA2A 1R23A 3LL7A 3N05A 4E7SA 1QBJA 3IH4A 3FXKA 4CYCA 3BTCA 3PNTA 1MBFA 4C2TA 1MDMA 5IT3A 4D5FA 1V5GA 4E7IA 3HZJA 2RNGA 5E3NA 3KP4A 1FOKA 3QYBA 1K61A 2OV7A 1A31A 3TO9A 1JKQC 1FYMA 1YFHA 3HOXJ 4JOMA 3FMRA 3HRTA 4QPQA 1QU3A 2WV0A 2FA5A 1SMTA 2ZXIA 2VN2A 2MABA 3L2CA 3CDHA 4AU7A 3E5QA 2K4BA 3UNGC 5JVTA 4IZZA 2FE3A 3FKIJ 4IXAA 2R7QA 4M9SA 2IJLA 5E3LA 3MFKA 4N9IA 2A07F 4ZC3A 3V7RA 3CC2I 2QUFA 4WWCA 2V6CA 5FD5A 1HA8A 3IKTA 3VYTB 3WTYC 4HNTA 4B43A 3IHUA 2EQRA 2GWRA 5DM6F 1MJ9A 4Z2YA 1ENHA 2Q8KA 3HRMA 3DU5A 3LAPA 2H27A 4ZDPA 1D8JA 4BQOA 1FOWA 2M7AA 2LY9A 2ACJA 1MH3A 1AWCA 2LKSA 3K4BA 4RB1A 5LD2C 2VBWA 1M1EB 1OR7C 2GBYA 1RUNA 3K4NA 2DFEA 1FEXA 3PSIA 1AKHB 1I6XA 5EEHA 2XKOA 1ZN2A 2L54A 4Q5SF 3EUKL 3TDUC 3AL0C 4L0ZB 3K1PA 2XF6A 5JVGF 5B1BH 3S1NJ 5IYDJ 4HV6A 2R7RA 4ZJZA 3CCLI 2E7WA 2AXLA 4IX7A 5FLVA 1H0MA 4RB3C 2CRGA 4GRIA 3I64A 1ZG5A 2CW0F 2E1OA 4M3FA 1S7AA 3OYNA 4PJ0C 4KA4A 1SANA 3R60A 4M73A 4AM3A 2XIGA 3EUHA 3BWGA 1WI9A 2K5CA 2PMUA 1S9HA 3BQYA 4IQ4A 3ECOA 3CESA 4QWQA 5BPDA 2F2EA 4ZTJA 1ERDA 1FIAA 4PJMA 2E34A 4EQQA 4CSWA 1N78A 3OIPA 3HOUJ 3RPQA 3NRVA 4L9NA 3Q9VA 4PUSA 2HPIA 2DJNA 1U5TB 2DA6A 2OTLI 2VODA 1G3WA 4HDVA 4FETA 2R4GA 3T1BA 1E3HA 2MYSA 1RETA 3ZQHA 2VONA 2YPRA 2XF7A 3WGGA 2X51A 3AL0B 2V4JC 1BI0A 2A68F 5BOXA 2A3SA 2CFXA 4BJTA 4NUBA 2K7LA 3P9CA 3LSRA 2KPMA 5A2QK 3L2RA 5FKOA 5DM7F 3HRUA 1B8IA 2GIVA 5FKLA 1YO5C 1I3AA 1I5ZA 1YJNI 1EV7A 2XASA 1U9NA 1RR7A 3E5XA 5J1RA 2TRTA 2BHYA 3H3UA 3SXYA 2IP2A 4BQQA 2VBZA 2Z33A 2OBPA 2BVMA 2OAZA 2LY1A 3MKYB 3U21A 4L5JA 1VQOI 2L4AA 4C30A 1Z7UA 3S15J 3IRQA 1G3YA 5BNGA 1HOMA 3CDIA 4M6YA 4KYWA 4ABZA 3K0LA 3LSGA 3JW4A 3ZMZA 2Y75A 2Q1ZB 3BPVA 3QQAA 3OL4A 1N77A 4J19A 2PJRA 4AC0A 3J7AO 4HNUA 2KJCA 2LYCA 3CTAA 2HKOA 3B6CA 3UKGA 2NS7A 4IHSA 1G3TA 1FSEA 2Q2EA 1S72I 3LSHA 2HPMA 3HTSB 5J8CA 3BG5A 3MMYB 2V1UA 4KNYA 2LSOA 2JA7J 1MH4A 1Y1VJ 4RM2A 4IHYA 1HQCA 2HTSA 4ZYEA 4LIUA 4I99C 4A3MJ 4ZDLA 4A5MA 4BHPA 2K85A 3RQ4A 4S0HB 3ESWB 4HLYA 4FHTA 1Z6RA 1AOYA 2MA3A 3HGGA 2RQQA 2HOAA 1FP1D 2R7FA 5ICGA 5IPAA 1K7AA 2Z1DA 3WU2C 1LDKB 2GLOA 4CUGA 4HEA2 3K70C 3K4MA 3HKZA 3OYJA 5DDGA 3EYYA 2QVOA 3UR3C 2RGVA 4U0YA 2XVCA 3LNQA 3K69A 2PN6A 3PM1A 3BR5A 2ZNYA 5CYVA 5EGOB 1J09A 2L7KA 1H89C 4I2OA 2VJIA 2DQLA 2H1KA 3KZZA 6PAXA 2EA4A 4XICA 4S05A 4HOBA 2IS4A 1RR8C 3CO7C 5CJ9A 1MNMC 2DTZA 1N75A 4HQMA 2P5VA 1P4AA 3CUQC 4D0PA 2DMQA 3E0JB 1Y56A 3OL3A 4FE4A 2E35A 1UJ8A 2OZ6A 2A6TA 4PDKA 4BH9A 4A3FJ 3E1SA 3Q0VA 3I9V2 1K79A 1KU9A 4IQJA 1J59A 1WJFA 4BU2A 5IP6A 1P4WA 2D1VA 2KMUA 2M4KA 3BTJA 3LSTA 1Y0UA 4XL9A 2RNJA 1N25A 2RREA 1OCZH 3KYDB 2AQFA 1WJAA 1T95A 1D5VA 4CYCB 1MBGA 3GFMA 2PLYA 1MDMB 4HZFA 4GDFA 2WA0A 2ECBA 3FHZA 4E6KG 2UWMA 4CH7A 4F3QA 2R7OA 2K9MA 2JPCA 4BBRJ 1V5EA 1SD7A 2JZYA 3H3VK 1IZ1A 3I53A 3J81K 1BI2A 1P92A 1IRFA 4V2GA 3J80Z 1XB4A 4HF0A 1F1ZA 3IP4B 2YR2A 2F4IA 2COBA 4ZYDA 2KKOA 3LSPA 3V8KA 2HDWA 1W36D 5F64A 2FSWA 2B9SA 2DMTA 1S7OA 5JHUA 4BE0A 3HHGA 1ODDA 2R7VA 2JRMA 3CUQB 3EUAA 2E36A 2IXSA 5LRRA 5HDNA 5FD6A 4RB0A 5ICEA 3FXMA 3SFIA 2F4MB 3RKQA 4M3GA 1PJRA 5HLIA 1MJBA 1RPWA 3WE3A 4XMYA 2W82A 2O9LA 3S2WA 5DUKA 4XSZF 4DBQA 1WH7A 1WRJA 2QKLB 2K9QA 3FXUA 5KNLA 4CHUA 1IW7F 2A6EF 4II2A 4CCKA 1KYWA 1X4OA 5EJCA 4XQFA 3RYPA 4AUXA 1BOBA 1TP4A 3QP6A 2M34A 2ZBKA 1T2KA 2H8RA 5B1AH 1JUSA 2DQRA 1RRJA 4Q48A 3WHCA 4IHWA 2VC1A 1RC9A 3OYEA 3CCQI 1OFCX 1QQIA 5DV5A 2IS6A 4XRMA 4NC7A 3PFIA 2RDPA 4Y4RA 1JTYA 4AIJA 3DEWA 1SFXA 2VKHA 2R7UA 4AYBA 1NTCA 4F55A 3LSMA 5BPIA 3F72A 1MIJA 2M0MA 3HYIA 3ZMVA 1XCBA 2DDAA 3MD2A 1JHFA 3RIRA 2IPQX 4A0ZA 3DPLC 1FJLA 1X19A 3HIFA 3LFKA 1LB2A 5FGMA 5LGNA 4LLGF 3KETA 1XSXA 2HOEA 2Y69H 2QLZA 1ZAOA 2W24A 1U8BA 4BYYA 2XDVA 2L7MP 4DYRA 4ESJA 2GAUA 2L3DA 2EJRA 1BIBA 2KIQA 2N8GA 3F8FA 3GUDA 2DTRA 3S93A 5L3EA 2P0WA 4TV7A 2DPDA 3J7YJ 4IHVA 2ID6A 1E17A 1V3FA 5HS9A 1ZREA 1T56A 2HTJA 2DA4A 1CF7A 2P7VB 1DGWY 1ZRFA 3T5XA 4YRVA 5E18F 2E1MB 1JGGA 3BG9A 2X6XA 4KITB 5AONA 4C9YA 1P4XA 4ETSA 3A0BC 1QA6A 4KN4X 3K2AA 2QEXI 3SZPA 3IRRA 1ETVA 3BG3A 5FKKA 1YE9A 3O8HA 1B8IB 2RKHA 3SFZA 1DU6A 3IAM2 1ORKA 4LG3A 4X6AJ 3PNYA 2FD5A 4GCVA 3I59A 1WI3A 3K7AJ 3QPSA 1YW8A 1TT5B 2XGDA 4ENJA 2DCEA 5D5WB 1P7IA 2ZFWA 1PVEA 2DDBA 5H6RA 5LGUA 1B59A 3W3CA 5DTDA 4MTEA 1MBEA 3OR2C 2DK8A 3DF8A 2FEZA 2XPUA 4G6DA 2R7XA 3D5LA 5K5QA 3P5JA 2CU7A 1HKTA 4RAYA 2M2EA 1ON2A 1T0FC 3O2PE 4M72A 1ZGJA 5KK1A 4AIHA 4W1UA 3N4MA 1SFUA 3OYKA 3IUOA 2EFWA 2PJRB 3Q3SA 2JK3A 3ABUA 5KVRA 1HCRA 2QKMB 2KT0A 4XOTA 3BZKA 3FK7A 3FBIB 4QPOA 1W7PA 4HRIA 5ERIA 4IOCF 4EMSA 3FMQA 2K02A 1ULYA 5LHGA 1TWAJ 3CJTB 3KP2A 5JI6A 4AIDA 1X4PA 2LLKA 5KAIC 1F36A 3TOBA 2L0KA 3H3ZA 1JI8A 3LAJA 1DP7P 3HL2A 2Z5UA 1W7PD 4OMYA 1WGXA 4DBRA 1VQ9I 4JBAA 5HLHA 3F8NA 5TJJA 4XLCA 3RZOJ
chains in the Genus database with same CATH topology
1NK2P 3TP3A 1GV5A 3GTGJ 5M5YJ 4JP0A 3JRHA 2DMNA 3JRGA 1Y1WJ 3GBGA 2VPRA 5C4JJ 5M5XJ 1ETXA 2E19A 4JX6A 5F27A 4EEFG 4HNVA 2X9DA 5EDNA 1BW5A 3VPRA 2KDZA 2JA8J 3IH4A 2CJJA 4CYCA 4FCYA 3BTCA 4DZPA 1MBFA 1ZKGA 4D5FA 5E3NA 2JMWA 1K61A 5M3MJ 4UUTA 1JKQC 5C3EJ 1U78A 2Y0SN 3HOXJ 5FLMJ 5IOZA 1ZR2A 5EEAA 1X58A 2VI6A 1H8AC 2CQXA 1GT0C 3CDLA 1XS9A 2R5YA 3OSFA 4M3BA 3FKIJ 2IEKA 3S16J 5E3LA 1Q1VA 1RESA 1OJLA 1OCPA 4D7MA 3ZOBA 5IYBJ 1BA5A 2MG4A 2K9NA 2EQRA 5M5WJ 1LFBA 3RQIA 1POGA 1ENHA 2WV1A 1UMQA 1FTZA 1PUFB 3LSJA 3JRFA 2CUFA 4C2MJ 2CUEA 2LY9A 1MH3A 5EZGA 1TC3C 5FKNA 5DS9A 4A3DJ 3DCFA 2GBYA 2IBDA 2MGQA 4A3EJ 5EG0B 1FEXA 4RBOA 3S1QJ 3HOVJ 1GVDA 1AKHB 2ID3A 1ETYA 1JT6A 1XC5A 3JRDA 1MSFC 1LE8A 2YUSA 1Z0XA 2PMZN 3TW7A 4L5EA 5K7ZA 3HOZJ 4DZJA 4V2FA 1IGNA 3S1NJ 3I4NJ 2EZLA 4B1RA 5IYDJ 3OSGA 4FE7A 1ZQ3P 4A3IJ 2E2HJ 1X2MA 3Q0WA 5FLVA 2CRGA 2XPWA 2NVXJ 3JRBA 1TWCJ 2E1OA 4M3FA 1R9TJ 4LOCA 1MBJA 3BR2A 1P7JA 3JRAA 1SANA 2LK2A 1BJZA 4GFBA 2FJ1A 5F1JA 3BQYA 3CQZJ 1JT0A 1HF0A 2R7ZJ 3BR1A 4X1EA 1FIAA 1YRNA 2HYJA 3HKZN 4DW6A 3HM5A 3SJMA 1Z77A 3JRCA 3HOUJ 3GTQJ 5F08A 4D5CA 2DA3A 2TCTA 4JX4A 1ZGWA 3G1OA 2DJNA 2DA6A 2R5ZB 2XPVA 3PO3J 4FTHA 3CMYA 1I6HJ 1X2NA 3GTJJ 1S7EA 3BR0A 3G1MA 1IV6A 3ZQHA 1RETA 4UUSB 3BTIA 3S17J 1JKRC 2XSDC 5K7HA 2ECCA 1ETKA 2LTPA 5EG0A 3GTMJ 1ITYA 2XGCA 2L7ZA 4DYQA 2YS9A 3LSRA 1AKHA 5FKOA 1CQTA 1B8IA 1RKTA 5FKLA 3GTKJ 1U9NA 1RR7A 2LVSA 5J1RA 2TRTA 4NDLA 2Y9YA 1W0UA 5EZHA 2L7FP 4C3HJ 1TWFJ 1W0TA 3S15J 1GDTA 5BNGA 3HDDA 1HOMA 2MW8A 4ABZA 5E3OA 3LSGA 1XG1A 5GP9A 5F0FA 2DN0A 1K83J 2R0QC 3QQAA 5FKMA 2HXIA 4J19A 2LFBA 2FX0A 4AC0A 2HI3A 1HLVA 3GTOJ 3B6CA 2JJ7A 3UKGA 4IHXA 2IAIA 2M9HA 2RAEA 2NS7A 4MO7A 1MBHA 2JA6J 3BG5A 3BT9A 2R5ZA 2JA7J 3IV5A 3LOCA 1MH4A 1Y1VJ 1IC8A 4IHYA 3W6VA 1WPKA 4A3MJ 4A93J 4MLOA 4S0HB 3OIOA 1IJWC 3A03A 3F0CA 3BR6A 1AHDP 3TEDA 4BKXA 3HGGA 1JKOC 2HOAA 4QIWN 3B6AA 1BL0A 2EZKA 5IPAA 2GLOA 3D1NI 1VNDA 2GM4A 2Y30A 4MFDA 3ZQGA 4IEJA 1A5JA 5F0HA 3LNQA 3PM1A 3BR5A 4B4CA 5EGOB 1H89C 3S14J 1T33A 3NAUA 2Y31A 5JLWA 2H1KA 4XRSG 4XICA 2P81A 3S1RJ 2ME6A 1MNMC 2DTZA 1EF4A 3TW6A 2DMQA 1ETQA 1UG2A 3JREA 4FE4A 3BTLA 2LKXA 3ZQLA 4JX5A 4MFEA 4A3FJ 3Q0VA 2VUMJ 2B63J 3NARA 4A3CJ 1QVUA 5IP6A 1HDPA 3H0GJ 3ZQFA 3BTJA 2XB5A 1U9OA 2VKEA 1GV2A 4A3JJ 2AO9A 3RZDJ 5IP7J 1ETOA 4CYCB 1H88C 1MBGA 4C3JJ 1WH5A 2ECBA 4A3KJ 1APLC 3MVPA 4G12A 4BBRJ 1HDDC 3C2BA 1PUFA 3H3VK 2HOSA 4A3GJ 4V2GA 2OPTA 4QSHA 2DA7A 2COBA 3SDGA 1ZR4A 2O8KA 2QCOA 3LSPA 2DMTA 3A02A 2D5VA 5F0CA 2DA2A 3G1LA 4I76A 1OCTC 1IRZA 5IOYA 1JUPA 3A01B 1WCMJ 1B72B 4QTRA 2ZB9A 3O8GA 1IG7A 4RDUA 3SFIA 3IH3A 3RKQA 1I50J 4M3GA 2JA5J 1RPWA 3BQZA 3CCYA 2O9LA 5F04A 1QRYA 1JKPC 2X6OA 4DYCA 1IUFA 1JJ8C 1WH7A 2K9QA 1NK3P 3FK6A 1UHSA 2K9SA 2DA1A 3HB9A 2HQ5A 2FQ4A 4AUXA 2L9RA 1SFOJ 1LE8B 2R92J 2M34A 2G0EA 1GUUA 1ZK8A 2H8RA 1JUSA 2XGEA 4IHWA 3WHCA 2CQQA 1OFCX 4XRMA 1JTXA 1AU7A 1JTYA 5IP9J 5FJ8J 3DEWA 3QPLA 2HDDA 3JR9A 2HXOA 1NTCA 1E3OC 2Y9ZA 2E2IJ 3WHBA 2NS8A 2NVTJ 3Q0UA 4C3IJ 4UUSA 1BW6A 1A6IA 2WAQN 5M3FJ 1FJLA 3BR3A 1VFCA 1VI0A 3PO2J 3ZQCA 1TWGJ 1U8BA 1IDYA 2LP0A 2LD5A 1YRNB 1F43A 4XRSA 2L7MP 4DYRA 2JWTA 2OF7A 2HOTA 2YU9J 2N8GA 3GTLJ 4BXXJ 2O7OA 1RKWA 3HBLA 3A01A 3MKLA 4M6VA 2EZHA 4IHVA 2ID6A 2X48A 1B72A 1T56A 4A3LJ 5HODA 9ANTA 3S1MJ 2DA4A 1ZTRA 2QF7A 3FISA 1JGGA 2ELKA 2NVQJ 3BG9A 3M4OJ 4W97A 5E3MA 2WB1N 2M0CA 3K2AA 1FTTA 1ETWA 4AYBN 1ETVA 3BG3A 5FKKA 2K40A 2DA5A 3O8HA 2W48A 1B8IB 3FIWA 1DU0A 1DU6A 4MIMA 2XB0X 1IDZA 1ORKA 5GPCA 4X6AJ 2MSYA 3JRIA 2FD5A 1WI3A 1MSEC 2DMUA 3K7AJ 3MN2A 1JUMA 4M3EA 3QPSA 2XGDA 2Y2ZA 4Y7NJ 5IYCJ 4BY7J 1P7IA 4A69C 3E7LA 1O4XA 1FIPA 3I4MJ 2EBIA 5DTDA 1MBEA 4D7NA 1MBKA 2XPUA 1JJ6C 2CU7A 5JLXA 3HOWJ 5J1YA 2M2EA 3M3YJ 5C4XJ 4M3DA 3S2HJ 4W1UA 4A3BJ 4Y52J 5EYRA 1G2HA 2EH3A 2ME0A 3ZQIA 4BBSJ 2JN6A 3Q3SA 2NVYJ 2JK3A 2R5YB 4FISA 3HEFA 1HCRA 3HOYJ 2KT0A 5J1UA 4XIDA 1D5YA 2M8GX 3FK7A 2EZIA 3S2DJ 4XK4A 5GPAA 3L1PA 4BY1J 3TP0A 5K7FA 1VF9A 1TWAJ 5EGOA 1QVTA 1LFUP 3IH2A 2LR8A 2I10A 2LLKA 1F36A 5EF6A 2L0KA 2R93J 2AHQA 4I6ZA 2E2JJ 1QPIA 2DMPA 2XRLA 5J3LA 2NOGA 1I3QJ 1WGXA 1TWHJ 4JYKA 5C44J 2VKVA 4B3AA 3HGYA 3GTPJ 3OOUA 3RZOJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK2 P;  3TP3 A;  1GV5 A;  3GTG J;  5M5Y J;  4JP0 A;  3JRH A;  2DMN A;  3JRG A;  1Y1W J;  3GBG A;  2VPR A;  5C4J J;  5M5X J;  1ETX A;  2E19 A;  4JX6 A;  5F27 A;  4EEF G;  4HNV A;  2X9D A;  5EDN A;  1BW5 A;  3VPR A;  2KDZ A;  2JA8 J;  3IH4 A;  2CJJ A;  4CYC A;  4FCY A;  3BTC A;  4DZP A;  1MBF A;  1ZKG A;  4D5F A;  5E3N A;  2JMW A;  1K61 A;  5M3M J;  4UUT A;  1JKQ C;  5C3E J;  1U78 A;  2Y0S N;  3HOX J;  5FLM J;  5IOZ A;  1ZR2 A;  5EEA A;  1X58 A;  2VI6 A;  1H8A C;  2CQX A;  1GT0 C;  3CDL A;  1XS9 A;  2R5Y A;  3OSF A;  4M3B A;  3FKI J;  2IEK A;  3S16 J;  5E3L A;  1Q1V A;  1RES A;  1OJL A;  1OCP A;  4D7M A;  3ZOB A;  5IYB J;  1BA5 A;  2MG4 A;  2K9N A;  2EQR A;  5M5W J;  1LFB A;  3RQI A;  1POG A;  1ENH A;  2WV1 A;  1UMQ A;  1FTZ A;  1PUF B;  3LSJ A;  3JRF A;  2CUF A;  4C2M J;  2CUE A;  2LY9 A;  1MH3 A;  5EZG A;  1TC3 C;  5FKN A;  5DS9 A;  4A3D J;  3DCF A;  2GBY A;  2IBD A;  2MGQ A;  4A3E J;  5EG0 B;  1FEX A;  4RBO A;  3S1Q J;  3HOV J;  1GVD A;  1AKH B;  2ID3 A;  1ETY A;  1JT6 A;  1XC5 A;  3JRD A;  1MSF C;  1LE8 A;  2YUS A;  1Z0X A;  2PMZ N;  3TW7 A;  4L5E A;  5K7Z A;  3HOZ J;  4DZJ A;  4V2F A;  1IGN A;  3S1N J;  3I4N J;  2EZL A;  4B1R A;  5IYD J;  3OSG A;  4FE7 A;  1ZQ3 P;  4A3I J;  2E2H J;  1X2M A;  3Q0W A;  5FLV A;  2CRG A;  2XPW A;  2NVX J;  3JRB A;  1TWC J;  2E1O A;  4M3F A;  1R9T J;  4LOC A;  1MBJ A;  3BR2 A;  1P7J A;  3JRA A;  1SAN A;  2LK2 A;  1BJZ A;  4GFB A;  2FJ1 A;  5F1J A;  3BQY A;  3CQZ J;  1JT0 A;  1HF0 A;  2R7Z J;  3BR1 A;  4X1E A;  1FIA A;  1YRN A;  2HYJ A;  3HKZ N;  4DW6 A;  3HM5 A;  3SJM A;  1Z77 A;  3JRC A;  3HOU J;  3GTQ J;  5F08 A;  4D5C A;  2DA3 A;  2TCT A;  4JX4 A;  1ZGW A;  3G1O A;  2DJN A;  2DA6 A;  2R5Z B;  2XPV A;  3PO3 J;  4FTH A;  3CMY A;  1I6H J;  1X2N A;  3GTJ J;  1S7E A;  3BR0 A;  3G1M A;  1IV6 A;  3ZQH A;  1RET A;  4UUS B;  3BTI A;  3S17 J;  1JKR C;  2XSD C;  5K7H A;  2ECC A;  1ETK A;  2LTP A;  5EG0 A;  3GTM J;  1ITY A;  2XGC A;  2L7Z A;  4DYQ A;  2YS9 A;  3LSR A;  1AKH A;  5FKO A;  1CQT A;  1B8I A;  1RKT A;  5FKL A;  3GTK J;  1U9N A;  1RR7 A;  2LVS A;  5J1R A;  2TRT A;  4NDL A;  2Y9Y A;  1W0U A;  5EZH A;  2L7F P;  4C3H J;  1TWF J;  1W0T A;  3S15 J;  1GDT A;  5BNG A;  3HDD A;  1HOM A;  2MW8 A;  4ABZ A;  5E3O A;  3LSG A;  1XG1 A;  5GP9 A;  5F0F A;  2DN0 A;  1K83 J;  2R0Q C;  3QQA A;  5FKM A;  2HXI A;  4J19 A;  2LFB A;  2FX0 A;  4AC0 A;  2HI3 A;  1HLV A;  3GTO J;  3B6C A;  2JJ7 A;  3UKG A;  4IHX A;  2IAI A;  2M9H A;  2RAE A;  2NS7 A;  4MO7 A;  1MBH A;  2JA6 J;  3BG5 A;  3BT9 A;  2R5Z A;  2JA7 J;  3IV5 A;  3LOC A;  1MH4 A;  1Y1V J;  1IC8 A;  4IHY A;  3W6V A;  1WPK A;  4A3M J;  4A93 J;  4MLO A;  4S0H B;  3OIO A;  1IJW C;  3A03 A;  3F0C A;  3BR6 A;  1AHD P;  3TED A;  4BKX A;  3HGG A;  1JKO C;  2HOA A;  4QIW N;  3B6A A;  1BL0 A;  2EZK A;  5IPA A;  2GLO A;  3D1N I;  1VND A;  2GM4 A;  2Y30 A;  4MFD A;  3ZQG A;  4IEJ A;  1A5J A;  5F0H A;  3LNQ A;  3PM1 A;  3BR5 A;  4B4C A;  5EGO B;  1H89 C;  3S14 J;  1T33 A;  3NAU A;  2Y31 A;  5JLW A;  2H1K A;  4XRS G;  4XIC A;  2P81 A;  3S1R J;  2ME6 A;  1MNM C;  2DTZ A;  1EF4 A;  3TW6 A;  2DMQ A;  1ETQ A;  1UG2 A;  3JRE A;  4FE4 A;  3BTL A;  2LKX A;  3ZQL A;  4JX5 A;  4MFE A;  4A3F J;  3Q0V A;  2VUM J;  2B63 J;  3NAR A;  4A3C J;  1QVU A;  5IP6 A;  1HDP A;  3H0G J;  3ZQF A;  3BTJ A;  2XB5 A;  1U9O A;  2VKE A;  1GV2 A;  4A3J J;  2AO9 A;  3RZD J;  5IP7 J;  1ETO A;  4CYC B;  1H88 C;  1MBG A;  4C3J J;  1WH5 A;  2ECB A;  4A3K J;  1APL C;  3MVP A;  4G12 A;  4BBR J;  1HDD C;  3C2B A;  1PUF A;  3H3V K;  2HOS A;  4A3G J;  4V2G A;  2OPT A;  4QSH A;  2DA7 A;  2COB A;  3SDG A;  1ZR4 A;  2O8K A;  2QCO A;  3LSP A;  2DMT A;  3A02 A;  2D5V A;  5F0C A;  2DA2 A;  3G1L A;  4I76 A;  1OCT C;  1IRZ A;  5IOY A;  1JUP A;  3A01 B;  1WCM J;  1B72 B;  4QTR A;  2ZB9 A;  3O8G A;  1IG7 A;  4RDU A;  3SFI A;  3IH3 A;  3RKQ A;  1I50 J;  4M3G A;  2JA5 J;  1RPW A;  3BQZ A;  3CCY A;  2O9L A;  5F04 A;  1QRY A;  1JKP C;  2X6O A;  4DYC A;  1IUF A;  1JJ8 C;  1WH7 A;  2K9Q A;  1NK3 P;  3FK6 A;  1UHS A;  2K9S A;  2DA1 A;  3HB9 A;  2HQ5 A;  2FQ4 A;  4AUX A;  2L9R A;  1SFO J;  1LE8 B;  2R92 J;  2M34 A;  2G0E A;  1GUU A;  1ZK8 A;  2H8R A;  1JUS A;  2XGE A;  4IHW A;  3WHC A;  2CQQ A;  1OFC X;  4XRM A;  1JTX A;  1AU7 A;  1JTY A;  5IP9 J;  5FJ8 J;  3DEW A;  3QPL A;  2HDD A;  3JR9 A;  2HXO A;  1NTC A;  1E3O C;  2Y9Z A;  2E2I J;  3WHB A;  2NS8 A;  2NVT J;  3Q0U A;  4C3I J;  4UUS A;  1BW6 A;  1A6I A;  2WAQ N;  5M3F J;  1FJL A;  3BR3 A;  1VFC A;  1VI0 A;  3PO2 J;  3ZQC A;  1TWG J;  1U8B A;  1IDY A;  2LP0 A;  2LD5 A;  1YRN B;  1F43 A;  4XRS A;  2L7M P;  4DYR A;  2JWT A;  2OF7 A;  2HOT A;  2YU9 J;  2N8G A;  3GTL J;  4BXX J;  2O7O A;  1RKW A;  3HBL A;  3A01 A;  3MKL A;  4M6V A;  2EZH A;  4IHV A;  2ID6 A;  2X48 A;  1B72 A;  1T56 A;  4A3L J;  5HOD A;  9ANT A;  3S1M J;  2DA4 A;  1ZTR A;  2QF7 A;  3FIS A;  1JGG A;  2ELK A;  2NVQ J;  3BG9 A;  3M4O J;  4W97 A;  5E3M A;  2WB1 N;  2M0C A;  3K2A A;  1FTT A;  1ETW A;  4AYB N;  1ETV A;  3BG3 A;  5FKK A;  2K40 A;  2DA5 A;  3O8H A;  2W48 A;  1B8I B;  3FIW A;  1DU0 A;  1DU6 A;  4MIM A;  2XB0 X;  1IDZ A;  1ORK A;  5GPC A;  4X6A J;  2MSY A;  3JRI A;  2FD5 A;  1WI3 A;  1MSE C;  2DMU A;  3K7A J;  3MN2 A;  1JUM A;  4M3E A;  3QPS A;  2XGD A;  2Y2Z A;  4Y7N J;  5IYC J;  4BY7 J;  1P7I A;  4A69 C;  3E7L A;  1O4X A;  1FIP A;  3I4M J;  2EBI A;  5DTD A;  1MBE A;  4D7N A;  1MBK A;  2XPU A;  1JJ6 C;  2CU7 A;  5JLX A;  3HOW J;  5J1Y A;  2M2E A;  3M3Y J;  5C4X J;  4M3D A;  3S2H J;  4W1U A;  4A3B J;  4Y52 J;  5EYR A;  1G2H A;  2EH3 A;  2ME0 A;  3ZQI A;  4BBS J;  2JN6 A;  3Q3S A;  2NVY J;  2JK3 A;  2R5Y B;  4FIS A;  3HEF A;  1HCR A;  3HOY J;  2KT0 A;  5J1U A;  4XID A;  1D5Y A;  2M8G X;  3FK7 A;  2EZI A;  3S2D J;  4XK4 A;  5GPA A;  3L1P A;  4BY1 J;  3TP0 A;  5K7F A;  1VF9 A;  1TWA J;  5EGO A;  1QVT A;  1LFU P;  3IH2 A;  2LR8 A;  2I10 A;  2LLK A;  1F36 A;  5EF6 A;  2L0K A;  2R93 J;  2AHQ A;  4I6Z A;  2E2J J;  1QPI A;  2DMP A;  2XRL A;  5J3L A;  2NOG A;  1I3Q J;  1WGX A;  1TWH J;  4JYK A;  5C44 J;  2VKV A;  4B3A A;  3HGY A;  3GTP J;  3OOU A;  3RZO J; 
#chains in the Genus database with same CATH topology
 2EFQ A;  4H4K C;  1NK2 P;  3TP3 A;  3F8M A;  3GTG J;  1FMW A;  2GXB A;  3FX3 A;  1R1T A;  3GF2 A;  2DMN A;  1Y1W J;  1OYI A;  1YJ9 I;  2ISZ A;  1FBS A;  5TRD A;  4JX6 A;  4BUP A;  2K86 A;  1EH7 A;  1O3R A;  2AS5 F;  2DYR H;  5BQT A;  1XGO A;  2EIN H;  2VOP A;  3JSO A;  4AWX B;  1OCO H;  2O0Y A;  2NOJ B;  2JA8 J;  1T8I A;  4FCY A;  1Z05 A;  4DZP A;  1X3U A;  3ABL H;  5CVI A;  5TIS C;  3RTR A;  1ZKG A;  3CZ6 A;  3DBL B;  2JMW A;  4LIV A;  5M3M J;  1U78 A;  2ZXW H;  4ZZL A;  3I58 A;  3DQV C;  4YEL A;  5IOZ A;  1R58 A;  1Y39 A;  2L9S A;  5D5X B;  3L2Q A;  1GT0 C;  2QBY B;  2HDC A;  2BW3 B;  2EV5 A;  5JR3 A;  3CCV I;  2BZT A;  3CDL A;  1XS9 A;  2G7U A;  1UB9 A;  4XRF A;  2R5Y A;  4M3B A;  4BXU A;  2IEK A;  4UV9 A;  3S16 J;  4XNF A;  2YX4 A;  3F22 A;  1OJL A;  3VOD A;  4HF1 A;  1BA5 A;  1QNT A;  2MG4 A;  2V1D A;  2JT1 A;  2XAU A;  3K6G A;  1U6G A;  2FBH A;  5M5W J;  1X1A A;  1Y6I A;  4RGX A;  3RQI A;  1POG A;  1UMQ A;  1X3Z B;  1WWX A;  3ZMD A;  2LOO A;  3JRF A;  2CUF A;  4C2M J;  3D5S C;  1WVR A;  1DGR M;  5EZG A;  1UST A;  4UV8 A;  1IN7 A;  4Z6Y A;  2GXA A;  1XSD A;  2DOD A;  3WTU C;  5HDK A;  5FRN A;  2ADU A;  2VBY A;  4CCO A;  4WCG A;  2L01 A;  3P9I A;  1IN4 A;  1XPX A;  1Z67 A;  1ETY A;  2LNB A;  5GTH C;  1MSF C;  3TW7 A;  4L5E A;  3OY9 A;  1WSU A;  4L0Y B;  3AFH A;  3HOZ J;  4DZJ A;  2F48 A;  3FZV A;  4V2F A;  2UV1 A;  4CCJ A;  3DKX A;  3LA7 A;  2DFF A;  2L2O A;  1ZG1 A;  1SFE A;  4JK1 X;  2W57 A;  4LJZ F;  3RDI A;  2BXY A;  2EZL A;  2GXG A;  3C2G A;  3I55 I;  4FE7 A;  4YFN F;  4A3I J;  1NG6 A;  2NVX J;  2XGX A;  1QGP A;  2JSC A;  2XV4 S;  1R9T J;  3PQK A;  4IF4 A;  1JXS A;  3BR2 A;  2KIM A;  4HG2 A;  1P7J A;  3KZI C;  1FX7 A;  2LK2 A;  4GO1 A;  1YG2 A;  2BY3 A;  2FJ1 A;  2KL4 A;  3DTI A;  4GFB A;  5F1J A;  2VBX A;  2G9W A;  2NNN A;  2LY2 A;  2R7Z J;  2Z9O A;  2EIM H;  3BR1 A;  2ZXJ A;  3RPU A;  2IA0 A;  1YRN A;  3CF5 F;  2FNP A;  2HYJ A;  3HKZ N;  2DOE A;  4GYG A;  3HM5 A;  3BPX A;  3SJM A;  4LG0 A;  1WQ2 A;  4U87 A;  1T38 A;  3HHH A;  4G8X A;  3GTQ J;  4XSX F;  4D5C A;  1SD4 A;  3G1O A;  1WKM A;  4N0B A;  2HQA A;  3FXL A;  1YHQ I;  1TQM A;  3RPU D;  1X2N A;  5F1R A;  4IJA A;  5L3F A;  3M8F A;  3VSK A;  1FYL A;  3BR0 A;  1KYZ A;  2VQG A;  1UCR A;  3S17 J;  4DGW B;  1OKR A;  5K7H A;  2ECC A;  2LTP A;  5EG0 A;  5KHD A;  2XGC A;  2L7Z A;  2QSF X;  2VQL A;  4DYQ A;  3WTZ A;  1CQT A;  2W85 A;  3T0Y A;  4OU0 A;  3C18 A;  1RKT A;  3GVA A;  1FNN A;  4BNC A;  1IN8 A;  3WOD F;  2A5W A;  2Q0O A;  1QHH D;  2GZW A;  2V9P A;  5BS6 A;  5B3S H;  3X2Q H;  2CV2 A;  3L09 A;  1CF7 B;  4ZYG A;  1QHG A;  5EZH A;  4O6J A;  2ZME C;  3DP7 A;  1W0T A;  1G59 A;  1GDT A;  2LRE A;  4DOZ A;  3FXR A;  2Y48 A;  2MW8 A;  4RAZ A;  4U7B A;  4U0V A;  2LBF A;  4G6Q A;  1XX5 A;  5F0F A;  1WFX A;  2DN0 A;  4LB6 B;  1MMS A;  5H6Q A;  2HXI A;  2LH9 A;  4UB6 C;  3K4K A;  2HI3 A;  3I59 B;  5LHH A;  2JJ7 A;  3E6B A;  2M9H A;  4XLP F;  1FOX A;  1KU7 A;  1VQ6 I;  3HXL A;  2H1L A;  2LRD A;  4MO7 A;  2Z16 A;  2F5D A;  1MBH A;  2JA6 J;  2CW8 A;  2OC6 A;  1HBX G;  2R5Z A;  3IV5 A;  1ON1 A;  2ICW G;  3K9T A;  3ZN0 A;  2HZD A;  1PP7 U;  4PCQ A;  4HDU A;  3W2A A;  2ZJP F;  3F9K A;  3JCU C;  4A2U A;  1D1B A;  3A03 A;  3F0C A;  1AHD P;  2DW4 A;  2L5Q A;  1JKO C;  1EA3 A;  2M3A A;  3MQ0 A;  3TMO A;  2EZK A;  1BL0 A;  1W1W E;  1DPR A;  3IC7 A;  1OLT A;  2A6H F;  1NHA A;  1U5T C;  2LF7 A;  1IO2 A;  4NC6 A;  4MFD A;  4EGY A;  3K4L A;  4YG2 F;  2ZME B;  5F0H A;  3M8J A;  5D4S A;  3ZCO A;  2KLO A;  2HVS A;  4CCN A;  5GAG J;  4G7O F;  4BQA A;  4UVA A;  4HAM A;  2Y31 A;  1D1A A;  4ENN A;  3V8L A;  3TOA A;  3OYM A;  1D8K A;  3QP5 A;  4HQE A;  5D6F A;  2O5R A;  4EJW A;  1SVM A;  1TL8 A;  3BTL A;  3CMA I;  3ZQL A;  4JX5 A;  4KIF A;  1DUX C;  3BZ6 A;  1UG0 A;  2A61 A;  2KIS A;  2VUM J;  2ZO4 A;  3NAR A;  4A3C J;  2BHZ A;  4HPQ A;  3ZN1 A;  2MBF A;  1V54 H;  4FQG A;  1J75 A;  1YOV B;  5HVQ C;  2HVQ A;  2XB5 A;  2E1C A;  5DD4 A;  2M7B A;  3RZD J;  4WK8 F;  1H88 C;  2P5L C;  2STT A;  4P9F A;  4PGG A;  2KFD A;  4XKB A;  3BY6 A;  3CLO A;  3J80 K;  1R71 A;  2MC3 A;  4HW0 A;  1V4R A;  4G12 A;  3DPT A;  2NNY A;  2KRF A;  3DXJ F;  3C2B A;  1PUF A;  2HOS A;  1KGS A;  3BCB A;  3A0H C;  1F9N A;  2PMH A;  3W6K B;  2FML A;  3PIO F;  1YW9 A;  4M9Z A;  4BL0 B;  1JE8 A;  5HS8 A;  1ZRD A;  2DA7 A;  3OYB A;  3M8E A;  1ZR4 A;  2O8K A;  3ONQ A;  4EGZ A;  1VQM I;  2IS2 A;  5E1X A;  4PZJ A;  2V7F A;  3IL2 A;  4P5O A;  4LK1 F;  3CCE I;  1FYK A;  2Y0M A;  1WZ2 A;  4HBL A;  3A02 A;  1XDS A;  1DQU A;  4I76 A;  5D8K B;  5E17 F;  1USS A;  4P9U A;  2LMD A;  4G7Z F;  1WCM J;  3BG6 A;  4KIB A;  2J5O A;  2PQ8 A;  3DPU A;  3WG7 H;  2JA5 J;  3BQZ A;  1MD0 A;  1BC8 C;  4XKV A;  1QRY A;  2X6O A;  3IKV A;  1SAX A;  1JJ8 C;  3KLN A;  2V26 A;  5L3C A;  2OTJ I;  4HX7 A;  3LA3 A;  2V79 A;  4ZYA A;  3DKW A;  4D9J A;  3DTE A;  2DA1 A;  2OQG A;  3HB9 A;  2IRF G;  3OS1 A;  1S8N A;  2L9R A;  4LFU A;  1RNL A;  2BGC A;  3M07 A;  1SMY F;  2V1X A;  2G0E A;  2ZKZ A;  3VYR B;  3H5R A;  2XGE A;  4M71 A;  1V5F A;  1K6O A;  1XSV A;  3WE2 A;  3ZMS A;  2QGU A;  1JTX A;  3T8T A;  4J01 A;  2BY2 A;  1FWZ A;  2OD5 A;  3U2R A;  1R22 A;  2ESN A;  1UZC A;  4MTD A;  1WJD A;  1BR4 A;  2NS8 A;  1YI2 I;  4UUS A;  5B5E C;  3BCA A;  4AIK A;  2X85 A;  2WAQ N;  1ZEL A;  5LEJ A;  2A05 A;  1IAW A;  2L9V A;  3BR3 A;  4HLX A;  4A6D A;  1VI0 A;  2MLK A;  3PO2 J;  4U7D A;  3ZQC A;  1P2F A;  3W2W A;  2QQ8 A;  1U3E M;  1R1U A;  3BLY A;  2P4W A;  2LD5 A;  1YRN B;  2O61 A;  3VFZ A;  1K6Y A;  1U8R A;  2JWT A;  4Q47 A;  3GTL J;  2HOT A;  1BBY A;  4Y33 A;  4BXX J;  2VOO A;  4WX9 A;  3KYL A;  1BIA A;  3U9G A;  3A01 A;  4RB2 C;  2EZH A;  1B72 A;  4BAC A;  2QQ9 A;  1XMX A;  5HOD A;  9ANT A;  2VE8 A;  1DPU A;  1J5Y A;  3GW2 A;  1ZTR A;  3FXJ A;  4MGR A;  2DI3 A;  2WY8 Q;  1KZH A;  2CYY A;  2IA1 A;  3MZY A;  2JPB A;  3O6B B;  3G2B A;  3MZH A;  2VKD A;  5KAF C;  3QRF F;  1LJ9 A;  3VYS B;  3DBH B;  1W5S A;  4S04 A;  3ZXS A;  2DA5 A;  1LEB A;  3FIW A;  1DU0 A;  4L18 B;  4MIM A;  2JVH A;  1OQY A;  2ZFU A;  5GPC A;  1SVL A;  1B1B A;  1EKE A;  3CC4 I;  3C7J A;  3RKX A;  5E1W A;  3S32 A;  4Y7N J;  4KT6 A;  4EM0 B;  2KZV A;  1K78 A;  2E5N A;  3LWF A;  4N4O B;  1LFP A;  2VIX A;  3KYC B;  2UZK A;  1O4X A;  1FC3 A;  1RUO A;  2R7T A;  2X1D A;  3ABK H;  1KA8 A;  2P6T A;  2E7X A;  4D7N A;  1MBK A;  1XTA A;  1IUY A;  4XOP A;  2UXN A;  4BAY A;  1ZGA A;  3WG9 A;  1JJ6 C;  5JLX A;  3HOW J;  4IKF A;  3M3Y J;  1XD7 A;  5LFA A;  3I71 A;  4RM3 A;  1ZLK A;  3ZMU A;  3F3X A;  3CCR I;  2QEN A;  2YU3 A;  4F7Z A;  1HW2 A;  1G2H A;  2HZT A;  2BV6 A;  3F23 A;  4P55 A;  2NVY J;  4FIS A;  1Z6T A;  4BJ6 C;  4CZZ A;  4E7Z A;  5J1U A;  2M8G X;  3FBN B;  1P6R A;  2WBM A;  1S6L A;  2EZI A;  3KX2 A;  2CQK A;  3TP0 A;  2W25 A;  3C3W A;  3H9Q A;  2EIJ H;  4KT5 C;  1BC7 C;  1HW1 A;  2I10 A;  2HU9 A;  3EUH C;  3KCC A;  1R00 A;  1MGT A;  4OAZ A;  1MMA A;  3DLA A;  2W7N A;  4I6Z A;  1QPI A;  2DMP A;  4O3M A;  3JTG A;  1VQ4 I;  2NOG A;  3A2K A;  1TWH J;  1MMN A;  4B3A A;  5DEQ A;  3U1K A;  4I0B A;  1LVK A;  3OOU A;  1PDN C;  2PX9 A;  3DLL F;  3G73 A;  1A35 A;  1XGN A;  3E6M A;  4JP0 A;  2FMY A;  3WTV C;  3JRH A;  1PYV A;  3JRG A;  4NHJ A;  4BGD A;  4G9Y A;  2E19 A;  5D5V B;  5GAH J;  3HJE A;  3AAF A;  1XMA A;  2E1M C;  3E5U A;  1BW5 A;  2MH9 A;  1YYV A;  3VPR A;  3ZRG A;  3NQO A;  4NQW A;  2DAO A;  2ZNZ A;  3S3M A;  4NB5 A;  2L4M A;  2CS3 A;  2CWE A;  4OIQ F;  2PI0 A;  2WB1 A;  4UUT A;  4OWR B;  5C3E J;  3CUO A;  1YQA A;  4KFC A;  4I02 A;  5EEA A;  2VI6 A;  3E6D A;  2JTV A;  4LIT A;  1H8A C;  2H09 A;  1A6Q A;  1DP3 A;  4RAG A;  2KP6 A;  1I1G A;  4HF2 A;  2HQR A;  2ISY A;  2BE5 F;  3OSF A;  3S3O A;  4LLL A;  1J7K A;  2MD5 A;  4XKW A;  3M1C A;  1Q1V A;  4BDZ A;  4EJU A;  1F5T A;  1TLH B;  3TQN A;  4KN7 X;  4D7M A;  5GAE J;  2OUM A;  4BHB A;  1X1D A;  3B73 A;  2K9N A;  3IWF A;  3QPH A;  2FBI A;  2QYO A;  2K4J A;  5ED4 A;  1LFB A;  4IRG A;  4KJZ A;  5HLG A;  3DU6 A;  1PUF B;  3BOQ A;  2FRH A;  4EM1 A;  3LSK A;  4D1Q A;  1PP8 F;  2CUE A;  4AVP A;  1J9I A;  1J0R A;  1ZHF A;  5DS9 A;  4OIP F;  4UXN A;  3PJR A;  3DCF A;  1BM9 A;  4WXC A;  2IBD A;  2WTE A;  1BI1 A;  3G3Z A;  4A3E J;  5IT9 K;  1D1C A;  3HOT A;  2BXZ A;  4N9H A;  3H9J A;  3S8P A;  2M5W A;  3ML6 A;  2ID3 A;  2K27 A;  4IRI A;  3M1E A;  3OWT A;  1JT6 A;  1XC5 A;  2W1O A;  4R8H A;  3JRD A;  2YUS A;  3L2W A;  1Z0X A;  2FBK A;  1LE8 A;  1BJA A;  3GWZ A;  1TT0 A;  1GHC A;  3F21 A;  3HG9 A;  1R4M B;  1IGN A;  1QPM A;  1FBU A;  1SAU A;  4B1R A;  1ZAR A;  3ERM A;  3ROU A;  4P1W A;  3O3K A;  2K3P A;  1ZQ3 P;  3OYD A;  2OZU A;  1X2M A;  3Q0W A;  3NEU A;  5D8L B;  3WU1 B;  2XPW A;  1O7L A;  4ANJ A;  1BR2 A;  4XLA A;  1Z3Y A;  2NRA C;  3GX4 X;  1MBJ A;  2CUJ A;  3ZQ7 A;  1HKQ A;  1BJZ A;  4I98 B;  3GZ6 A;  5TGT A;  3CQZ J;  3WTT C;  1HF0 A;  4RGS A;  4UHT A;  2RN7 A;  2X0L A;  4BQN A;  3DEE A;  2WAE A;  2X1C A;  2JUG A;  1Z77 A;  5LEK A;  3KP6 A;  4ENM A;  3CF2 A;  4MNU A;  5F08 A;  2OU2 A;  2DA3 A;  2Q2E B;  4JX4 A;  4LGW A;  2V9V A;  1ZGW A;  2EB7 A;  2XPV A;  2HKX A;  5FLX Z;  3NWT A;  3OS2 A;  4ITV A;  1O7F A;  2W84 A;  2Y0S A;  3CMY A;  4UNO A;  1JGS A;  3EPZ A;  1VQ7 I;  3V42 A;  4DQ2 A;  2O6G E;  3FXQ A;  2XKP A;  1U2W A;  3G1M A;  5E8I A;  1IV6 A;  3ISP A;  3KFW X;  4UUS B;  3C1D A;  4PSW A;  2R7D A;  1UAA A;  2QSG X;  4CYD A;  5D6E A;  2XSD C;  3REO A;  2VJ4 A;  1ETK A;  1WJC A;  1T39 A;  4LD5 A;  5JHF A;  3GTM J;  4X0G A;  4BE2 A;  1ONV A;  2DLL A;  1AKH A;  2F5E A;  2OCC H;  4BE1 A;  5E20 A;  3HPG A;  1W36 C;  2P7C B;  3PNV A;  3SYT A;  3GTK J;  2HYG D;  2R7W A;  5DCM A;  4LK0 F;  2CG4 A;  1YIO A;  1D0Y A;  3H1C A;  5J8F A;  3V4G A;  2Y9Y A;  4C3H J;  1TWF J;  2KDO A;  4DIQ A;  4B8X A;  1VQP I;  4IPA A;  3HDD A;  2KHM A;  2VLA A;  2JQ7 A;  3HC7 A;  4MQV A;  3GO5 A;  4FX0 A;  4IRH A;  1XG1 A;  4K2E A;  4M6X A;  2VE9 A;  2QQB A;  3DKY A;  1K83 J;  2R0Q C;  1OMI A;  3M7G A;  3OOP A;  4YIF A;  1WHU A;  2B0L A;  2PMZ A;  5FKM A;  2LFB A;  2V1N A;  3QOE A;  1MKM A;  4KUM A;  1MW7 A;  1TTY A;  1TNT A;  3L9F A;  3C2H A;  4G6T B;  3F8C A;  2D1H A;  1OR7 A;  2HNH A;  3BT9 A;  2XSJ C;  3LMM A;  3W6V A;  2GA1 A;  3IWZ A;  2I5U A;  2W00 A;  1K4T A;  3QAH A;  4ESF A;  4A93 J;  4MLO A;  4QLC U;  1IF1 A;  2D2W A;  3CLQ A;  3TKY A;  3KPH A;  4BKX A;  2QQA A;  1L3L A;  4QIW N;  2EIK H;  3KP5 A;  1ZRC A;  1Y0N A;  4Y17 A;  2IW5 A;  2UUZ A;  2Y30 A;  3ZQG A;  2XAJ A;  3AG2 H;  4EJV A;  5ILV A;  1A5J A;  1RI7 A;  4L9T A;  4XOR A;  4B09 A;  1IN5 A;  2NVU B;  4EM2 A;  2STW A;  2XAH A;  2KIU A;  3S14 J;  3K1M A;  3ELK A;  2CV1 A;  2F4O B;  2DT6 A;  3NAU A;  4A12 A;  5IT9 Z;  3CCU I;  1YS6 A;  3DBR B;  3I54 A;  5JLW A;  4XRS G;  5LHI A;  2M1B A;  3S1R J;  2ME6 A;  1T6S A;  1F4K A;  1O3T A;  1EF4 A;  4H0E A;  3BJA A;  1D0X A;  1ETQ A;  1UG2 A;  4KMU X;  3MKW B;  4A5N A;  2LKX A;  4MFE A;  5E79 C;  1B6A A;  3BJ6 A;  2B63 J;  1R6R A;  3K10 A;  3LQR A;  4PJJ A;  3WTX C;  2IGM A;  2K9L A;  1HDP A;  3H0G J;  3ZQF A;  2FXA A;  1BR1 A;  1ZYR F;  1IV8 A;  1U9O A;  3WGH A;  4PJL A;  2VKE A;  1GV2 A;  2DBB A;  4A3J J;  2AO9 A;  1LUJ B;  2CV0 A;  5IP7 J;  1ETO A;  4NQW B;  4BEH A;  5CVU A;  2E5Z A;  2DK5 A;  4UVB A;  3A4C A;  2VC0 A;  5CVR A;  4A3K J;  1SD6 A;  3MVP A;  4II3 A;  2LG4 A;  2FUG 2;  2XF5 A;  3MAJ A;  2NAZ A;  3ECH A;  3RYR A;  1HDD C;  2L02 A;  1HSJ A;  4A3G J;  4YFX F;  5GTI C;  1BN5 A;  2QZ8 A;  4QSH A;  3PIP F;  3SDG A;  2BBY A;  1LDJ A;  4WXH A;  4DNC A;  1KQ9 A;  2F5C A;  1E0E A;  2XRN A;  2YX7 A;  2R3S A;  2D5V A;  5F0C A;  2DA2 A;  3QOD A;  4ASN A;  3B02 A;  3QOP A;  4RS8 A;  1P9Q C;  1B9M A;  1IRZ A;  5IOY A;  2ZC2 A;  2VT2 A;  1JUP A;  4HSR A;  5CQG A;  4MHG A;  5B66 C;  2CGP A;  1KQ8 A;  1YLF A;  5FB2 A;  4QTR A;  2OQR A;  5CLS A;  2H8W A;  2VB6 A;  3CCY A;  1JKP C;  1GXP A;  4DYC A;  1MMG A;  5LBQ A;  5FRO A;  1VQ8 I;  1MND A;  1FZP B;  4KIG A;  3I3L A;  4FAS D;  3L2V A;  2IGO A;  5ILS A;  2F5F A;  3OMY A;  3ASO H;  3FK6 A;  4YII A;  2JUC A;  5L3G A;  5FO5 A;  1SFO J;  1LE8 B;  2R92 J;  4E7H A;  2RC4 A;  1ZK8 A;  4PFP A;  4A0Y A;  1DDN A;  3G6E I;  3H35 A;  5KCM A;  2FOW A;  2KQR A;  4HX8 A;  1FLI A;  1D3Y A;  4DJA A;  2EA2 A;  3R0J A;  1UHW A;  5FJ8 J;  4YFK F;  1NG7 A;  2C6Y A;  2IA2 A;  2HDD A;  3FKJ A;  3KZY A;  1R4N B;  1YX5 A;  2JA2 A;  3Q0U A;  3CJR B;  2O8X A;  2Z99 A;  1A6I A;  1LDD A;  5ICC A;  2ELH A;  2KRH A;  2LF8 A;  5M3F J;  1X1C A;  4XON A;  5HLT A;  3K70 D;  1VFC A;  3FWE A;  1AA7 A;  3AG4 H;  4OIN F;  4ENK A;  3MCZ A;  1E2X A;  2MC4 A;  4E4H A;  3HSF A;  1ZG3 A;  3AG1 H;  1VQK I;  4ON0 A;  2LC2 A;  4MEY F;  1IDY A;  1X1B A;  1F43 A;  1CGP A;  4B3X A;  4UUV A;  3CUQ A;  5DD8 A;  1W7P B;  2YU9 J;  3M9A A;  2O7O A;  1X3W B;  2LKP A;  2JRT A;  3HBL A;  3MKL A;  2HYF A;  3QPT A;  4GGG A;  3CJN A;  2WAD A;  2ZSH B;  2HWV A;  4KIS A;  4A3L J;  3HOS A;  3DTK A;  2QF7 A;  4OAY A;  1C0W A;  3FIS A;  2NVQ J;  2ELK A;  1XCV A;  3SQN A;  3M4O J;  4U88 A;  4HYE A;  5E3M A;  2VPL A;  3KE2 A;  2M4G A;  2WB1 N;  2M0C A;  3RJP A;  4CCM A;  2MLG A;  1ETW A;  2MFZ A;  4LLN A;  2P8T A;  4AYB N;  1GLN A;  4CZC A;  4OMZ A;  3WGI A;  3D0S A;  3W2V A;  4ZZD A;  4CXF A;  1FT9 A;  2W48 A;  4L9V A;  4A6E A;  3PQJ A;  4GYI A;  1IDZ A;  3FM5 A;  3CMM A;  3HRS A;  2JVG A;  1KON A;  1REP C;  3WU0 A;  2DMU A;  3MN2 A;  4XLE A;  3HSE A;  4M3E A;  5DCM B;  1W4M A;  4NC8 A;  4MQ9 F;  3U1D A;  1HXD A;  3EQL F;  3MEX A;  2CQN A;  4BY7 J;  4A69 C;  5LGT A;  3E7L A;  3KP3 A;  1FIP A;  1T98 A;  2PBI A;  5AIQ A;  2EBI A;  5BMZ A;  1Z91 A;  2DOF A;  2EIL H;  2FNA A;  5J1Y A;  1H9T A;  5C4X J;  4M3D A;  4Y15 A;  4A3B J;  2RV8 A;  3CJQ B;  4Y52 J;  2ME0 A;  4I0A A;  1SVO A;  4BBS J;  4O5V A;  1LKX A;  2R5Y B;  3HEF A;  3HOY J;  5D5U B;  1D5Y A;  4XID A;  1IXC A;  3R4K A;  1JHH A;  2BVL A;  2NS0 A;  4BY1 J;  3K4J A;  4IHT A;  2VXZ A;  1YIT I;  2LR8 A;  4JQF A;  5H2F C;  3FXO A;  2R93 J;  1Y8Q B;  3ZMT A;  2E2J J;  2BOL A;  5J3L A;  3GZ5 A;  3KP7 A;  1LNW A;  4MEX F;  3CC7 I;  1I3Q J;  5C44 J;  3GEZ A;  2VKV A;  3KIO A;  3NWS A;  2P5K A;  4EV0 A;  3H0D A;  2PJP A;  3HGY A;  3V8J A;  1GV5 A;  2QA4 I;  3QU3 A;  3GLL A;  3BP8 A;  1K4S A;  5M5Y J;  4KDP A;  5FFX A;  1R1V A;  3GBG A;  1EH6 A;  3J7A Y;  4A0X A;  5M5X J;  5K5O A;  1BOA A;  3TDZ C;  2H6B A;  4RMN A;  3BRO A;  1B9N A;  4HNV A;  2X4H A;  2OCE A;  2JSP A;  2X9D A;  4M9X A;  1IN6 A;  3JAM Z;  1R49 A;  2W4S A;  1GVJ A;  2GIZ A;  2WY7 Q;  3E6C C;  2YSR A;  2EV6 A;  3OYC A;  2KDZ A;  1OYY A;  4CA0 A;  2CJJ A;  3GFL A;  2IS1 A;  2ELJ A;  4XKC A;  1T08 B;  2XRO A;  4E7K A;  3JSP A;  5LRS A;  2TDX A;  3V7S A;  2FOK A;  2Y0S N;  5FLM J;  1ZR2 A;  3FHN A;  1X58 A;  4XN0 A;  3T8R A;  3G4S I;  4U0W A;  2CQX A;  1WJB A;  3ERE D;  2A5Y B;  4UB8 C;  2X6W A;  2BYV E;  2O3F A;  5FFZ A;  4P96 A;  2Z3Y A;  2V9K A;  3R6S A;  2ZSI B;  4RLF A;  3SEZ A;  4XN3 A;  3TBI A;  1RES A;  3BC8 A;  1OCP A;  2COM A;  2HFH A;  3ZOB A;  1G6N A;  5IYB J;  4BEH B;  4LG0 B;  4L5I A;  2EFN A;  1HST A;  2E71 A;  3P9K A;  4F52 A;  2FF4 A;  2R7S A;  3CO6 C;  2WV1 A;  4FX4 A;  1FTZ A;  3LSJ A;  1TC3 C;  5FKN A;  4A3D J;  3ZGK A;  2RVC A;  2IT0 A;  2B7E A;  3MKZ A;  3G71 I;  1QZZ A;  1HW5 A;  1XGM A;  2MGQ A;  1Y8R B;  1VQL I;  5EG0 B;  1WJ5 A;  1LQ1 A;  4RBO A;  2CH0 A;  3S1Q J;  4XM3 A;  3HOV J;  1GVD A;  3GCM A;  4I01 A;  1TW3 A;  4HX4 A;  2EFP A;  3HUG A;  3TO7 A;  2PMZ N;  5K7Z A;  4R1H A;  1QO0 D;  2HR3 A;  1VTN C;  3PUB A;  1T0F A;  2QM3 A;  2FQ3 A;  1HKS A;  3I4N J;  1LVA A;  5DCF A;  2VL8 A;  3OSG A;  3GYH X;  3ZR8 X;  2E2H J;  5E1Z B;  2O03 A;  3JRB A;  1TWC J;  3OYH A;  4LOC A;  2GQQ A;  4R79 A;  1XN7 A;  3F8B A;  2F5V A;  3MZ8 A;  3OYI A;  3JRA A;  3ULQ B;  2QSH X;  2QBY A;  2LBF B;  4PFO A;  1W5T A;  2BW3 A;  1FOY A;  2Z2S B;  3KEY A;  1R5G A;  3RSN A;  4ESB A;  4OOI A;  1FY7 A;  1JT0 A;  1PUE E;  4X1E A;  1I1S A;  2ZJQ F;  2ETH A;  3W6J B;  1LEA A;  2GOM A;  1NH3 A;  2VJ5 A;  5FLX K;  4DW6 A;  3JRC A;  1WJE A;  4XBF A;  3V7C A;  2ZJ2 A;  2CFO A;  2TCT A;  3GZN B;  3WTW C;  2E1N A;  2R5Z B;  2L9N A;  1A04 A;  3PO3 J;  3LFU A;  2EK5 A;  3H92 A;  2WAF A;  4FTH A;  1I6H J;  3K1N A;  3GTJ J;  1S7E A;  3OYA A;  1R36 A;  1XGS A;  5L3B A;  3BTI A;  2XHK A;  4ZH4 F;  2ZJR F;  1JKR C;  3D5R C;  1YTY A;  2EV0 A;  3OR1 C;  2M45 A;  1ITY A;  2YS9 A;  2VQC A;  5DYM A;  5J47 A;  1GXQ A;  3MWM A;  2DU9 A;  2M30 A;  5EEG A;  2PEX A;  2VJJ A;  2ZXH A;  3OS0 A;  5K5R A;  3I4P A;  2LVS A;  4V19 K;  4G7H F;  5A2Q Z;  5J6X A;  3H5N A;  4RAF A;  2QWW A;  4BHC A;  4NDL A;  1SEU A;  3AKZ A;  3OYG A;  4B44 A;  4BS9 A;  3CCM I;  1W0U A;  2L7F P;  2DJI A;  4NNJ A;  5AIP A;  3JTH A;  3HSR A;  4IO9 F;  1S3J A;  5E3O A;  3RI4 A;  5GP9 A;  1S29 A;  1YS7 A;  4EAT A;  4G94 A;  1G8X A;  1MJA A;  2H94 A;  2CW7 A;  3PFY A;  5HNH A;  2FX0 A;  2RQP A;  3FM3 A;  1H9G A;  3AG3 H;  3I5U A;  4UVC A;  2A69 F;  1HLV A;  5CPR B;  2ESH A;  2PFB A;  3GTO J;  4IHX A;  1IXS B;  2IAI A;  2RAE A;  3ASN H;  4E7J A;  1Z7L A;  4J00 A;  2BY1 A;  4CDG A;  4E70 A;  3LOC A;  2H6C A;  1IC8 A;  3GME A;  1WPK A;  2VAS A;  3FF5 A;  2KIF A;  3H9G A;  1OPC A;  2KJB A;  4RA2 A;  3KLO A;  3OIO A;  1IJW C;  3BR6 A;  1A36 A;  3CP8 A;  5K1Y A;  3TED A;  2AXT C;  1Z3X A;  4YEJ A;  3B6A A;  4KIC A;  3Q9S A;  1FPQ A;  3SDB A;  2OA4 A;  3SZT A;  4WXD A;  3D1N I;  1VND A;  4ZYH A;  2GM4 A;  1TNS A;  2VXD A;  1W5C C;  1STZ A;  3IAS 2;  2X6Y A;  3VDX A;  4IEJ A;  1R7J A;  4GXO A;  2EFO A;  1J2X A;  4IL6 C;  4CIC A;  4B4C A;  4XLN F;  1RZ4 A;  1UEL B;  1T33 A;  2DFH A;  3E3V A;  2P81 A;  2GOX B;  4RGR A;  3SZG A;  3J7Z I;  3COA C;  4AD9 A;  3CP2 A;  1EH8 A;  4FT8 A;  1IRG A;  3SHF A;  1IRX A;  3TW6 A;  4BXF A;  1UHM A;  3JRE A;  2KRC A;  5GAD J;  3FMS A;  3QU6 A;  3DV8 A;  1Z21 A;  3QYF A;  1FSH A;  1VQN I;  1QVU A;  4Y3O A;  2HEO A;  3ZP5 A;  1Q1H A;  1U0J A;  2WC2 A;  4KMF A;  4CGZ A;  4LB5 A;  4E7L A;  1G4D A;  3FDY A;  3RCO A;  4C3J J;  1WH5 A;  2F6C A;  4CCL A;  1APL C;  1BI3 A;  4PGH A;  4N4N B;  1OYW A;  2X1E A;  2WWY A;  4I09 A;  2OJE D;  1RIO H;  2OPT A;  3SEQ A;  4PJN A;  1HC8 A;  1V55 H;  2MD0 A;  3J81 Z;  2QCO A;  2ZME A;  3TGN A;  4HST A;  2CUZ A;  1YJW I;  1SD5 A;  1Z9C A;  1YW7 A;  2MH2 A;  1L0O C;  3G1L A;  4ZDO A;  1OCT C;  5HDG A;  1X1P A;  3GXO A;  2XAG A;  1D0Z A;  3A01 B;  4UY8 I;  5JFR A;  3TL4 X;  1B72 B;  2ZB9 A;  3O8G A;  1IG7 A;  4RDU A;  3IH3 A;  1VZ0 A;  2WAQ A;  1I50 J;  2P6S A;  3A1Y A;  3PSF A;  4OIR F;  3HTU A;  5F04 A;  4C2U A;  2HQN A;  4B47 A;  1ACI A;  1IUF A;  1MMD A;  5FRM A;  2KZG A;  1YIJ I;  2XAQ A;  3KEQ A;  2LDU A;  3OYF A;  1FP2 A;  5HNF A;  1NK3 P;  1E3P A;  5L3D A;  5DUI A;  3F6O A;  1I27 A;  1TZL A;  1UHS A;  2K9S A;  2XAF A;  3EET A;  2HQ5 A;  1XDU A;  2FQ4 A;  2PG4 A;  3HUG B;  3N97 A;  1QZY A;  2M8E A;  1KQ0 A;  2IVM A;  3L00 A;  1GUU A;  5IY5 H;  1R5H A;  2CQQ A;  5HS7 A;  3CD6 I;  3VSL A;  5J4Y A;  3L7W A;  1MZB A;  4ZTF A;  1FMV A;  1AU7 A;  3R0A A;  1K78 B;  1UFM A;  1TBX A;  1U5T A;  3BJO A;  4CO8 A;  5IP9 J;  1Z1D A;  3QPL A;  3JR9 A;  1YX3 A;  5ILU A;  1OIS A;  2HXO A;  3EDP A;  4EVI A;  3QWL A;  3ZQQ A;  2Y9Z A;  1E3O C;  3WHB A;  1IXR C;  2AQE A;  3LQQ A;  5HOO A;  2E2I J;  4C3I J;  2NVT J;  2ZCW A;  4YIR X;  3ABM H;  2K3F A;  3GFJ A;  2G7H A;  1BW6 A;  3VWB A;  3QYE A;  5CVJ A;  2VQH A;  2UXX A;  1TQP A;  2FU4 A;  2NXN B;  2CMP A;  3CCJ I;  1TWG J;  3PUF A;  3GLX A;  4F93 B;  2LP0 A;  4XRS A;  4EJO A;  2XC7 A;  1MNE A;  5ICF A;  3R61 A;  5CKT A;  2NYX A;  2OF7 A;  4XR6 A;  5D4R A;  1RKW A;  4M6V A;  3I0T A;  2HGC A;  2X48 A;  1O57 A;  3F6V A;  1TW2 A;  3I56 I;  1O3Q A;  3S1M J;  3KEO A;  2EWN A;  4IOA F;  2DYS H;  5CQE A;  2IGK A;  1QZE A;  3BZC A;  2HS5 A;  4W97 A;  4F91 B;  4XLH A;  3L2U A;  2DT5 A;  4NBQ A;  1FTT A;  3DFG A;  3OYL A;  2DT7 B;  3H5A A;  1SFK A;  4EJT A;  2EPF A;  1EJ9 A;  4HA8 A;  2K40 A;  5F6F A;  1ZLJ A;  1SC7 A;  4F92 B;  1FBQ A;  4LMY A;  3GFI A;  2I8D A;  2J5P A;  2XB0 X;  3ABT A;  1S5L C;  2MSY A;  4B48 A;  3JRI A;  3VEP A;  1MSE C;  1JUM A;  3BG7 A;  3VB2 A;  1VQ5 I;  2Y2Z A;  3CCS I;  3ZPL A;  2CO5 A;  5H20 A;  1OCC H;  5IYC J;  4WF2 A;  3H36 A;  5LLQ A;  3RKY A;  3I4M J;  3Q5F A;  2CSO A;  3E97 A;  4PK4 A;  3LA2 A;  4RGU A;  3EYI A;  1I39 A;  2DFI A;  5J40 A;  1R5I D;  3WTS C;  3K2Z A;  2VT3 A;  3S2H J;  3RKW A;  2M87 A;  5EYR A;  2EH3 A;  2HVR A;  4OIO F;  3ZQI A;  4IVN A;  1LPQ A;  2JN6 A;  3P7N A;  5CVV A;  1XMK A;  2E60 A;  4HV5 A;  3OIQ A;  3HPH A;  3VYU B;  4BJ5 C;  2DPU A;  1OCR H;  3S2D J;  4XK4 A;  4Y13 A;  2DOA A;  5GPA A;  3OV8 A;  3L1P A;  5K7F A;  2IGN A;  1VF9 A;  1KU3 A;  3DEU A;  5EGO A;  1QVT A;  4I7H A;  3IH2 A;  1LFU P;  2DXI A;  3K4C A;  3BDD A;  5EF6 A;  4PSX A;  2AHQ A;  2D45 A;  2XRL A;  4RLQ A;  4L9J A;  1TQI A;  4JYK A;  2DO7 A;  3VOE A;  3CME I;  3GTP J;  3LSI A;  4AVZ A;  2CQ7 A;  4BDY A;  3TO6 A;  1O3S A;  2BEO A;  4Q4Z F;  3JAM K;  1KU2 A;  1ZH5 A;  3DWL E;  2VPR A;  2BY0 A;  2V6E A;  2XUB A;  5C4J J;  5J4V A;  1ETX A;  3PL8 A;  4M74 A;  1G3S A;  5E8G A;  5F27 A;  4EEF G;  3S3N A;  1B4A A;  5EDN A;  4XLF A;  2GA2 A;  1R23 A;  3LL7 A;  3N05 A;  4E7S A;  1QBJ A;  3IH4 A;  3FXK A;  4CYC A;  3BTC A;  3PNT A;  1MBF A;  4C2T A;  1MDM A;  5IT3 A;  4D5F A;  1V5G A;  4E7I A;  3HZJ A;  2RNG A;  5E3N A;  3KP4 A;  1FOK A;  3QYB A;  1K61 A;  2OV7 A;  1A31 A;  3TO9 A;  1JKQ C;  1FYM A;  1YFH A;  3HOX J;  4JOM A;  3FMR A;  3HRT A;  4QPQ A;  1QU3 A;  2WV0 A;  2FA5 A;  1SMT A;  2ZXI A;  2VN2 A;  2MAB A;  3L2C A;  3CDH A;  4AU7 A;  3E5Q A;  2K4B A;  3UNG C;  5JVT A;  4IZZ A;  2FE3 A;  3FKI J;  4IXA A;  2R7Q A;  4M9S A;  2IJL A;  5E3L A;  3MFK A;  4N9I A;  2A07 F;  4ZC3 A;  3V7R A;  3CC2 I;  2QUF A;  4WWC A;  2V6C A;  5FD5 A;  1HA8 A;  3IKT A;  3VYT B;  3WTY C;  4HNT A;  4B43 A;  3IHU A;  2EQR A;  2GWR A;  5DM6 F;  1MJ9 A;  4Z2Y A;  1ENH A;  2Q8K A;  3HRM A;  3DU5 A;  3LAP A;  2H27 A;  4ZDP A;  1D8J A;  4BQO A;  1FOW A;  2M7A A;  2LY9 A;  2ACJ A;  1MH3 A;  1AWC A;  2LKS A;  3K4B A;  4RB1 A;  5LD2 C;  2VBW A;  1M1E B;  1OR7 C;  2GBY A;  1RUN A;  3K4N A;  2DFE A;  1FEX A;  3PSI A;  1AKH B;  1I6X A;  5EEH A;  2XKO A;  1ZN2 A;  2L54 A;  4Q5S F;  3EUK L;  3TDU C;  3AL0 C;  4L0Z B;  3K1P A;  2XF6 A;  5JVG F;  5B1B H;  3S1N J;  5IYD J;  4HV6 A;  2R7R A;  4ZJZ A;  3CCL I;  2E7W A;  2AXL A;  4IX7 A;  5FLV A;  1H0M A;  4RB3 C;  2CRG A;  4GRI A;  3I64 A;  1ZG5 A;  2CW0 F;  2E1O A;  4M3F A;  1S7A A;  3OYN A;  4PJ0 C;  4KA4 A;  1SAN A;  3R60 A;  4M73 A;  4AM3 A;  2XIG A;  3EUH A;  3BWG A;  1WI9 A;  2K5C A;  2PMU A;  1S9H A;  3BQY A;  4IQ4 A;  3ECO A;  3CES A;  4QWQ A;  5BPD A;  2F2E A;  4ZTJ A;  1ERD A;  1FIA A;  4PJM A;  2E34 A;  4EQQ A;  4CSW A;  1N78 A;  3OIP A;  3HOU J;  3RPQ A;  3NRV A;  4L9N A;  3Q9V A;  4PUS A;  2HPI A;  2DJN A;  1U5T B;  2DA6 A;  2OTL I;  2VOD A;  1G3W A;  4HDV A;  4FET A;  2R4G A;  3T1B A;  1E3H A;  2MYS A;  1RET A;  3ZQH A;  2VON A;  2YPR A;  2XF7 A;  3WGG A;  2X51 A;  3AL0 B;  2V4J C;  1BI0 A;  2A68 F;  5BOX A;  2A3S A;  2CFX A;  4BJT A;  4NUB A;  2K7L A;  3P9C A;  3LSR A;  2KPM A;  5A2Q K;  3L2R A;  5FKO A;  5DM7 F;  3HRU A;  1B8I A;  2GIV A;  5FKL A;  1YO5 C;  1I3A A;  1I5Z A;  1YJN I;  1EV7 A;  2XAS A;  1U9N A;  1RR7 A;  3E5X A;  5J1R A;  2TRT A;  2BHY A;  3H3U A;  3SXY A;  2IP2 A;  4BQQ A;  2VBZ A;  2Z33 A;  2OBP A;  2BVM A;  2OAZ A;  2LY1 A;  3MKY B;  3U21 A;  4L5J A;  1VQO I;  2L4A A;  4C30 A;  1Z7U A;  3S15 J;  3IRQ A;  1G3Y A;  5BNG A;  1HOM A;  3CDI A;  4M6Y A;  4KYW A;  4ABZ A;  3K0L A;  3LSG A;  3JW4 A;  3ZMZ A;  2Y75 A;  2Q1Z B;  3BPV A;  3QQA A;  3OL4 A;  1N77 A;  4J19 A;  2PJR A;  4AC0 A;  3J7A O;  4HNU A;  2KJC A;  2LYC A;  3CTA A;  2HKO A;  3B6C A;  3UKG A;  2NS7 A;  4IHS A;  1G3T A;  1FSE A;  2Q2E A;  1S72 I;  3LSH A;  2HPM A;  3HTS B;  5J8C A;  3BG5 A;  3MMY B;  2V1U A;  4KNY A;  2LSO A;  2JA7 J;  1MH4 A;  1Y1V J;  4RM2 A;  4IHY A;  1HQC A;  2HTS A;  4ZYE A;  4LIU A;  4I99 C;  4A3M J;  4ZDL A;  4A5M A;  4BHP A;  2K85 A;  3RQ4 A;  4S0H B;  3ESW B;  4HLY A;  4FHT A;  1Z6R A;  1AOY A;  2MA3 A;  3HGG A;  2RQQ A;  2HOA A;  1FP1 D;  2R7F A;  5ICG A;  5IPA A;  1K7A A;  2Z1D A;  3WU2 C;  1LDK B;  2GLO A;  4CUG A;  4HEA 2;  3K70 C;  3K4M A;  3HKZ A;  3OYJ A;  5DDG A;  3EYY A;  2QVO A;  3UR3 C;  2RGV A;  4U0Y A;  2XVC A;  3LNQ A;  3K69 A;  2PN6 A;  3PM1 A;  3BR5 A;  2ZNY A;  5CYV A;  5EGO B;  1J09 A;  2L7K A;  1H89 C;  4I2O A;  2VJI A;  2DQL A;  2H1K A;  3KZZ A;  6PAX A;  2EA4 A;  4XIC A;  4S05 A;  4HOB A;  2IS4 A;  1RR8 C;  3CO7 C;  5CJ9 A;  1MNM C;  2DTZ A;  1N75 A;  4HQM A;  2P5V A;  1P4A A;  3CUQ C;  4D0P A;  2DMQ A;  3E0J B;  1Y56 A;  3OL3 A;  4FE4 A;  2E35 A;  1UJ8 A;  2OZ6 A;  2A6T A;  4PDK A;  4BH9 A;  4A3F J;  3E1S A;  3Q0V A;  3I9V 2;  1K79 A;  1KU9 A;  4IQJ A;  1J59 A;  1WJF A;  4BU2 A;  5IP6 A;  1P4W A;  2D1V A;  2KMU A;  2M4K A;  3BTJ A;  3LST A;  1Y0U A;  4XL9 A;  2RNJ A;  1N25 A;  2RRE A;  1OCZ H;  3KYD B;  2AQF A;  1WJA A;  1T95 A;  1D5V A;  4CYC B;  1MBG A;  3GFM A;  2PLY A;  1MDM B;  4HZF A;  4GDF A;  2WA0 A;  2ECB A;  3FHZ A;  4E6K G;  2UWM A;  4CH7 A;  4F3Q A;  2R7O A;  2K9M A;  2JPC A;  4BBR J;  1V5E A;  1SD7 A;  2JZY A;  3H3V K;  1IZ1 A;  3I53 A;  3J81 K;  1BI2 A;  1P92 A;  1IRF A;  4V2G A;  3J80 Z;  1XB4 A;  4HF0 A;  1F1Z A;  3IP4 B;  2YR2 A;  2F4I A;  2COB A;  4ZYD A;  2KKO A;  3LSP A;  3V8K A;  2HDW A;  1W36 D;  5F64 A;  2FSW A;  2B9S A;  2DMT A;  1S7O A;  5JHU A;  4BE0 A;  3HHG A;  1ODD A;  2R7V A;  2JRM A;  3CUQ B;  3EUA A;  2E36 A;  2IXS A;  5LRR A;  5HDN A;  5FD6 A;  4RB0 A;  5ICE A;  3FXM A;  3SFI A;  2F4M B;  3RKQ A;  4M3G A;  1PJR A;  5HLI A;  1MJB A;  1RPW A;  3WE3 A;  4XMY A;  2W82 A;  2O9L A;  3S2W A;  5DUK A;  4XSZ F;  4DBQ A;  1WH7 A;  1WRJ A;  2QKL B;  2K9Q A;  3FXU A;  5KNL A;  4CHU A;  1IW7 F;  2A6E F;  4II2 A;  4CCK A;  1KYW A;  1X4O A;  5EJC A;  4XQF A;  3RYP A;  4AUX A;  1BOB A;  1TP4 A;  3QP6 A;  2M34 A;  2ZBK A;  1T2K A;  2H8R A;  5B1A H;  1JUS A;  2DQR A;  1RRJ A;  4Q48 A;  3WHC A;  4IHW A;  2VC1 A;  1RC9 A;  3OYE A;  3CCQ I;  1OFC X;  1QQI A;  5DV5 A;  2IS6 A;  4XRM A;  4NC7 A;  3PFI A;  2RDP A;  4Y4R A;  1JTY A;  4AIJ A;  3DEW A;  1SFX A;  2VKH A;  2R7U A;  4AYB A;  1NTC A;  4F55 A;  3LSM A;  5BPI A;  3F72 A;  1MIJ A;  2M0M A;  3HYI A;  3ZMV A;  1XCB A;  2DDA A;  3MD2 A;  1JHF A;  3RIR A;  2IPQ X;  4A0Z A;  3DPL C;  1FJL A;  1X19 A;  3HIF A;  3LFK A;  1LB2 A;  5FGM A;  5LGN A;  4LLG F;  3KET A;  1XSX A;  2HOE A;  2Y69 H;  2QLZ A;  1ZAO A;  2W24 A;  1U8B A;  4BYY A;  2XDV A;  2L7M P;  4DYR A;  4ESJ A;  2GAU A;  2L3D A;  2EJR A;  1BIB A;  2KIQ A;  2N8G A;  3F8F A;  3GUD A;  2DTR A;  3S93 A;  5L3E A;  2P0W A;  4TV7 A;  2DPD A;  3J7Y J;  4IHV A;  2ID6 A;  1E17 A;  1V3F A;  5HS9 A;  1ZRE A;  1T56 A;  2HTJ A;  2DA4 A;  1CF7 A;  2P7V B;  1DGW Y;  1ZRF A;  3T5X A;  4YRV A;  5E18 F;  2E1M B;  1JGG A;  3BG9 A;  2X6X A;  4KIT B;  5AON A;  4C9Y A;  1P4X A;  4ETS A;  3A0B C;  1QA6 A;  4KN4 X;  3K2A A;  2QEX I;  3SZP A;  3IRR A;  1ETV A;  3BG3 A;  5FKK A;  1YE9 A;  3O8H A;  1B8I B;  2RKH A;  3SFZ A;  1DU6 A;  3IAM 2;  1ORK A;  4LG3 A;  4X6A J;  3PNY A;  2FD5 A;  4GCV A;  3I59 A;  1WI3 A;  3K7A J;  3QPS A;  1YW8 A;  1TT5 B;  2XGD A;  4ENJ A;  2DCE A;  5D5W B;  1P7I A;  2ZFW A;  1PVE A;  2DDB A;  5H6R A;  5LGU A;  1B59 A;  3W3C A;  5DTD A;  4MTE A;  1MBE A;  3OR2 C;  2DK8 A;  3DF8 A;  2FEZ A;  2XPU A;  4G6D A;  2R7X A;  3D5L A;  5K5Q A;  3P5J A;  2CU7 A;  1HKT A;  4RAY A;  2M2E A;  1ON2 A;  1T0F C;  3O2P E;  4M72 A;  1ZGJ A;  5KK1 A;  4AIH A;  4W1U A;  3N4M A;  1SFU A;  3OYK A;  3IUO A;  2EFW A;  2PJR B;  3Q3S A;  2JK3 A;  3ABU A;  5KVR A;  1HCR A;  2QKM B;  2KT0 A;  4XOT A;  3BZK A;  3FK7 A;  3FBI B;  4QPO A;  1W7P A;  4HRI A;  5ERI A;  4IOC F;  4EMS A;  3FMQ A;  2K02 A;  1ULY A;  5LHG A;  1TWA J;  3CJT B;  3KP2 A;  5JI6 A;  4AID A;  1X4P A;  2LLK A;  5KAI C;  1F36 A;  3TOB A;  2L0K A;  3H3Z A;  1JI8 A;  3LAJ A;  1DP7 P;  3HL2 A;  2Z5U A;  1W7P D;  4OMY A;  1WGX A;  4DBR A;  1VQ9 I;  4JBA A;  5HLH A;  3F8N A;  5TJJ A;  4XLC A;  3RZO J; 
#chains in the Genus database with same CATH homology
 1NK2 P;  3TP3 A;  1GV5 A;  3GTG J;  5M5Y J;  4JP0 A;  3JRH A;  2DMN A;  3JRG A;  1Y1W J;  3GBG A;  2VPR A;  5C4J J;  5M5X J;  1ETX A;  2E19 A;  4JX6 A;  5F27 A;  4EEF G;  4HNV A;  2X9D A;  5EDN A;  1BW5 A;  3VPR A;  2KDZ A;  2JA8 J;  3IH4 A;  2CJJ A;  4CYC A;  4FCY A;  3BTC A;  4DZP A;  1MBF A;  1ZKG A;  4D5F A;  5E3N A;  2JMW A;  1K61 A;  5M3M J;  4UUT A;  1JKQ C;  5C3E J;  1U78 A;  2Y0S N;  3HOX J;  5FLM J;  5IOZ A;  1ZR2 A;  5EEA A;  1X58 A;  2VI6 A;  1H8A C;  2CQX A;  1GT0 C;  3CDL A;  1XS9 A;  2R5Y A;  3OSF A;  4M3B A;  3FKI J;  2IEK A;  3S16 J;  5E3L A;  1Q1V A;  1RES A;  1OJL A;  1OCP A;  4D7M A;  3ZOB A;  5IYB J;  1BA5 A;  2MG4 A;  2K9N A;  2EQR A;  5M5W J;  1LFB A;  3RQI A;  1POG A;  1ENH A;  2WV1 A;  1UMQ A;  1FTZ A;  1PUF B;  3LSJ A;  3JRF A;  2CUF A;  4C2M J;  2CUE A;  2LY9 A;  1MH3 A;  5EZG A;  1TC3 C;  5FKN A;  5DS9 A;  4A3D J;  3DCF A;  2GBY A;  2IBD A;  2MGQ A;  4A3E J;  5EG0 B;  1FEX A;  4RBO A;  3S1Q J;  3HOV J;  1GVD A;  1AKH B;  2ID3 A;  1ETY A;  1JT6 A;  1XC5 A;  3JRD A;  1MSF C;  1LE8 A;  2YUS A;  1Z0X A;  2PMZ N;  3TW7 A;  4L5E A;  5K7Z A;  3HOZ J;  4DZJ A;  4V2F A;  1IGN A;  3S1N J;  3I4N J;  2EZL A;  4B1R A;  5IYD J;  3OSG A;  4FE7 A;  1ZQ3 P;  4A3I J;  2E2H J;  1X2M A;  3Q0W A;  5FLV A;  2CRG A;  2XPW A;  2NVX J;  3JRB A;  1TWC J;  2E1O A;  4M3F A;  1R9T J;  4LOC A;  1MBJ A;  3BR2 A;  1P7J A;  3JRA A;  1SAN A;  2LK2 A;  1BJZ A;  4GFB A;  2FJ1 A;  5F1J A;  3BQY A;  3CQZ J;  1JT0 A;  1HF0 A;  2R7Z J;  3BR1 A;  4X1E A;  1FIA A;  1YRN A;  2HYJ A;  3HKZ N;  4DW6 A;  3HM5 A;  3SJM A;  1Z77 A;  3JRC A;  3HOU J;  3GTQ J;  5F08 A;  4D5C A;  2DA3 A;  2TCT A;  4JX4 A;  1ZGW A;  3G1O A;  2DJN A;  2DA6 A;  2R5Z B;  2XPV A;  3PO3 J;  4FTH A;  3CMY A;  1I6H J;  1X2N A;  3GTJ J;  1S7E A;  3BR0 A;  3G1M A;  1IV6 A;  3ZQH A;  1RET A;  4UUS B;  3BTI A;  3S17 J;  1JKR C;  2XSD C;  5K7H A;  2ECC A;  1ETK A;  2LTP A;  5EG0 A;  3GTM J;  1ITY A;  2XGC A;  2L7Z A;  4DYQ A;  2YS9 A;  3LSR A;  1AKH A;  5FKO A;  1CQT A;  1B8I A;  1RKT A;  5FKL A;  3GTK J;  1U9N A;  1RR7 A;  2LVS A;  5J1R A;  2TRT A;  4NDL A;  2Y9Y A;  1W0U A;  5EZH A;  2L7F P;  4C3H J;  1TWF J;  1W0T A;  3S15 J;  1GDT A;  5BNG A;  3HDD A;  1HOM A;  2MW8 A;  4ABZ A;  5E3O A;  3LSG A;  1XG1 A;  5GP9 A;  5F0F A;  2DN0 A;  1K83 J;  2R0Q C;  3QQA A;  5FKM A;  2HXI A;  4J19 A;  2LFB A;  2FX0 A;  4AC0 A;  2HI3 A;  1HLV A;  3GTO J;  3B6C A;  2JJ7 A;  3UKG A;  4IHX A;  2IAI A;  2M9H A;  2RAE A;  2NS7 A;  4MO7 A;  1MBH A;  2JA6 J;  3BG5 A;  3BT9 A;  2R5Z A;  2JA7 J;  3IV5 A;  3LOC A;  1MH4 A;  1Y1V J;  1IC8 A;  4IHY A;  3W6V A;  1WPK A;  4A3M J;  4A93 J;  4MLO A;  4S0H B;  3OIO A;  1IJW C;  3A03 A;  3F0C A;  3BR6 A;  1AHD P;  3TED A;  4BKX A;  3HGG A;  1JKO C;  2HOA A;  4QIW N;  3B6A A;  1BL0 A;  2EZK A;  5IPA A;  2GLO A;  3D1N I;  1VND A;  2GM4 A;  2Y30 A;  4MFD A;  3ZQG A;  4IEJ A;  1A5J A;  5F0H A;  3LNQ A;  3PM1 A;  3BR5 A;  4B4C A;  5EGO B;  1H89 C;  3S14 J;  1T33 A;  3NAU A;  2Y31 A;  5JLW A;  2H1K A;  4XRS G;  4XIC A;  2P81 A;  3S1R J;  2ME6 A;  1MNM C;  2DTZ A;  1EF4 A;  3TW6 A;  2DMQ A;  1ETQ A;  1UG2 A;  3JRE A;  4FE4 A;  3BTL A;  2LKX A;  3ZQL A;  4JX5 A;  4MFE A;  4A3F J;  3Q0V A;  2VUM J;  2B63 J;  3NAR A;  4A3C J;  1QVU A;  5IP6 A;  1HDP A;  3H0G J;  3ZQF A;  3BTJ A;  2XB5 A;  1U9O A;  2VKE A;  1GV2 A;  4A3J J;  2AO9 A;  3RZD J;  5IP7 J;  1ETO A;  4CYC B;  1H88 C;  1MBG A;  4C3J J;  1WH5 A;  2ECB A;  4A3K J;  1APL C;  3MVP A;  4G12 A;  4BBR J;  1HDD C;  3C2B A;  1PUF A;  3H3V K;  2HOS A;  4A3G J;  4V2G A;  2OPT A;  4QSH A;  2DA7 A;  2COB A;  3SDG A;  1ZR4 A;  2O8K A;  2QCO A;  3LSP A;  2DMT A;  3A02 A;  2D5V A;  5F0C A;  2DA2 A;  3G1L A;  4I76 A;  1OCT C;  1IRZ A;  5IOY A;  1JUP A;  3A01 B;  1WCM J;  1B72 B;  4QTR A;  2ZB9 A;  3O8G A;  1IG7 A;  4RDU A;  3SFI A;  3IH3 A;  3RKQ A;  1I50 J;  4M3G A;  2JA5 J;  1RPW A;  3BQZ A;  3CCY A;  2O9L A;  5F04 A;  1QRY A;  1JKP C;  2X6O A;  4DYC A;  1IUF A;  1JJ8 C;  1WH7 A;  2K9Q A;  1NK3 P;  3FK6 A;  1UHS A;  2K9S A;  2DA1 A;  3HB9 A;  2HQ5 A;  2FQ4 A;  4AUX A;  2L9R A;  1SFO J;  1LE8 B;  2R92 J;  2M34 A;  2G0E A;  1GUU A;  1ZK8 A;  2H8R A;  1JUS A;  2XGE A;  4IHW A;  3WHC A;  2CQQ A;  1OFC X;  4XRM A;  1JTX A;  1AU7 A;  1JTY A;  5IP9 J;  5FJ8 J;  3DEW A;  3QPL A;  2HDD A;  3JR9 A;  2HXO A;  1NTC A;  1E3O C;  2Y9Z A;  2E2I J;  3WHB A;  2NS8 A;  2NVT J;  3Q0U A;  4C3I J;  4UUS A;  1BW6 A;  1A6I A;  2WAQ N;  5M3F J;  1FJL A;  3BR3 A;  1VFC A;  1VI0 A;  3PO2 J;  3ZQC A;  1TWG J;  1U8B A;  1IDY A;  2LP0 A;  2LD5 A;  1YRN B;  1F43 A;  4XRS A;  2L7M P;  4DYR A;  2JWT A;  2OF7 A;  2HOT A;  2YU9 J;  2N8G A;  3GTL J;  4BXX J;  2O7O A;  1RKW A;  3HBL A;  3A01 A;  3MKL A;  4M6V A;  2EZH A;  4IHV A;  2ID6 A;  2X48 A;  1B72 A;  1T56 A;  4A3L J;  5HOD A;  9ANT A;  3S1M J;  2DA4 A;  1ZTR A;  2QF7 A;  3FIS A;  1JGG A;  2ELK A;  2NVQ J;  3BG9 A;  3M4O J;  4W97 A;  5E3M A;  2WB1 N;  2M0C A;  3K2A A;  1FTT A;  1ETW A;  4AYB N;  1ETV A;  3BG3 A;  5FKK A;  2K40 A;  2DA5 A;  3O8H A;  2W48 A;  1B8I B;  3FIW A;  1DU0 A;  1DU6 A;  4MIM A;  2XB0 X;  1IDZ A;  1ORK A;  5GPC A;  4X6A J;  2MSY A;  3JRI A;  2FD5 A;  1WI3 A;  1MSE C;  2DMU A;  3K7A J;  3MN2 A;  1JUM A;  4M3E A;  3QPS A;  2XGD A;  2Y2Z A;  4Y7N J;  5IYC J;  4BY7 J;  1P7I A;  4A69 C;  3E7L A;  1O4X A;  1FIP A;  3I4M J;  2EBI A;  5DTD A;  1MBE A;  4D7N A;  1MBK A;  2XPU A;  1JJ6 C;  2CU7 A;  5JLX A;  3HOW J;  5J1Y A;  2M2E A;  3M3Y J;  5C4X J;  4M3D A;  3S2H J;  4W1U A;  4A3B J;  4Y52 J;  5EYR A;  1G2H A;  2EH3 A;  2ME0 A;  3ZQI A;  4BBS J;  2JN6 A;  3Q3S A;  2NVY J;  2JK3 A;  2R5Y B;  4FIS A;  3HEF A;  1HCR A;  3HOY J;  2KT0 A;  5J1U A;  4XID A;  1D5Y A;  2M8G X;  3FK7 A;  2EZI A;  3S2D J;  4XK4 A;  5GPA A;  3L1P A;  4BY1 J;  3TP0 A;  5K7F A;  1VF9 A;  1TWA J;  5EGO A;  1QVT A;  1LFU P;  3IH2 A;  2LR8 A;  2I10 A;  2LLK A;  1F36 A;  5EF6 A;  2L0K A;  2R93 J;  2AHQ A;  4I6Z A;  2E2J J;  1QPI A;  2DMP A;  2XRL A;  5J3L A;  2NOG A;  1I3Q J;  1WGX A;  1TWH J;  4JYK A;  5C44 J;  2VKV A;  4B3A A;  3HGY A;  3GTP J;  3OOU A;  3RZO J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...