3S2YA

Crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
184
structure length
184
Chain Sequence
SPLHFVTLLGSLRKASFNAAVARALPEIAPEGIAITPLGSIGTFPHYSQDVQEEGFPAPVLTMAQQIATADAVVIVTPEYNYSVPGVLKNAIDWLSRVSPQPLAGKPVALVTASPGMIGGARAQYHLRQSLVFLDAYVLNRPEAMIGQVTGKVDAQTLELSDVATREFLARQLDALAALARTLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Determination and Functional Analysis of a Chromate Reductase from Gluconacetobacter hansenii.
pubmed doi rcsb
source organism Gluconacetobacter hansenii
molecule tags Oxidoreductase
molecule keywords Chromate reductase
total genus 53
structure length 184
sequence length 184
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s2yA00
1AKTA 2A5LA 2XOEA 3F2VA 4YAWA 5LVAA 3O73A 4Y7CA 3LCMA 5F12A 1YRHA 4LTDA 1X77A 1KBQA 2ARKA 3GFRA 4QOJA 4Y9UA 4PU0A 4ZVNA 3TZBA 3OJXA 3W7AA 5FUQA 3W77A 2GSWA 4XDGA 1T5BA 2Z9CA 3ZHOA 2OHHA 1AKVA 2BF4A 2V9CA 1FLDA 4YAUA 3KAQA 2QX8A 1CZOA 3KAPA 1FUEA 3KEGA 3NHLA 4FGJA 4C76A 1CZRA 1TIKA 1J9ZA 2QR2A 3EDOA 3L9XA 3NHWA 3OX3A 4QOIA 4H6PA 4YALA 4D02A 4HEQA 1CZLA 1JA1A 2Q9UA 4N9QA 4OXXA 6NULA 4Y9RA 3NLLA 5TGZA 3G5MA 2FCRA 2HNAA 3U7RA 1QRDA 1WSWA 3K20A 5A4KA 2MWMA 5JROA 1BVYF 1J9GA 1OFVA 2F1OA 2FX2A 4M0CA 2QX9A 3K1YA 5EA2A 1H69A 3SVLA 1XYYA 3KLBA 3TEMA 1FLAA 4U7FA 1I1OA 4U7HA 4XDHA 1DXOA 1ZWKA 5F4BA 2OHIA 3N3BC 1YOBA 4ZVLA 1ZX1A 2KQUA 3FJOA 4C14A 4CETA 3S2YA 3W78A 1BU5A 1CZNA 3B6JA 5LMCA 2HPVA 2FLVA 4J8PA 3OVMA 4HS4A 1T0IA 3TE7A 2ZKIA 1WSBA 4ZVMA 3LT5A 3B6IA 3HR4A 3QE2A 3NHRA 3UXHA 1AKRA 5LBUA 4BMPB 1CZUA 4FGLA 3HA2A 2KLBA 1NNI1 1KBOA 3N39C 4GI5A 4YAFA 5EAIA 2MT9A 3R6WA 3N3AC 2OHJA 1D04A 1E5DA 4ESEA 2RG1A 3D7NA 4LA4A 2V5VA 5F51A 3EYWA 3RPEA 1FX1A 1XI2A 4QOFA 1CZHA 4H2DA 2QX4A 4FGKA 4QODA 4C0XA 2QX6A 1QR2A 3F6RA 3B6MA 1TLLA 1FLNA 3NFRA 4ICIA 4NLLA 4NULA 1YCGA 1H66A 1AG9A 1CZKA 3U7IA 1C7FA 1FTGA 3P0RA 4GR9A 2AMJA 1F4PA 1GG5A 3JSXA 3FW1A 4CF6A 1J8QA 1OBVA 2FZ5A 1D4AA 2Z9BA 2Q62A 2MTBA 3ESYA 1AKWA 2Z98A 4ZVKA 4C0WA 1AKQA 4DIKA 1AMOA 2QMYA 3FNIA 5ULLA 1J9EA 1QBGA 1XT6A 2N1MA 2FVXA 3F6SA 3NHFA 1JA0A 5EMNA 1AZLA 3GFSA 1RLJA 2FDXA 3OWXA 1RCFA 2HNBA 4LAFA 2BPOA 4PTZA 4BMOB 1DXQA 2M6RA 5BUCA 1QHEA 2BZSA 3GFQA 1YKGA 2X2OA 1YCHA 3GAMA 3ESZA 2Z9DA 3NHYA 1FLVA 4YQEA 5LJLA 1YCFA 1OBOA 5FA6A 2MOKA 3NHSA 4QOGA 3B6KA 1YDGA 2QWXA 3ES9A 3OJWA 1AKUA 2BMVA 4LTMA 2X2PA 4U7GA 4QOHA 2WC1A 1B1CA 1DX9A 3ESXA 3HLYA 4YAOA 3NHUA 3FVWA 5NLLA 1D03A 2R96A 2V5UA 2B3DA 3F90A 4R81A 4DILA 2R97A 3UXEA 2M6SA 4PTYA 4GQIA 1SQSA 1C7EA 4N82A 1XYVA 2FZVA 3W79A 3OWHA 1RLIA 4LTNA 1SG0A 1V4BA 4FX2A 3QFCA 2W5UA 3NHJA 3O2NA 4S24A 3OX1A 2D5IA 5NULA 3L9WA 2XODA 5B3KA 1AHNA 5FX2A 3FX2A 2BN4A 1ZWLA 1VMEA 3OX2A 5LLDA 2OYSA 3QFRA 4QOEA 3NHPA 5LBTA 4N65A 5B3LA 1RTTA 2FAXA 4DY4A 4F8YA 3NHKA 5LJIA 2FOXA 2QMZA 1FVXA
chains in the Genus database with same CATH superfamily
4O4JB 3AEQA 2WJGA 3ZW9A 1QO0D 3DDOA 3BSYA 1O8BA 3ND6A 4BL5A 5BN3A 3ANXA 4LGCA 4CEIB 1I30A 3SMVA 3AEQB 2W2TA 2FN9A 3ZHOA 1KA9H 1C2YA 1T43A 4ZT7A 2XB2A 4FGJA 4DDTA 1CUGA 3RTAA 1DNPA 1P4HA 4L0QA 4ZOLF 4ZU6X 4BGEA 4ES6A 2NZYA 2ZJFA 4K0KB 2PV7A 2R4UA 3WYEA 3E3AA 2ZATA 3M3PA 4QGFA 2NOAA 2OECA 3GROA 3F6EX 2QLTA 3F7MA 1BX3A 4L3OA 4IG9A 3V8QA 2JHGA 1SVNA 3EOZA 4ZQEA 3SZRA 3VMFA 3JVDA 4E94A 4FIDA 5JTTA 2PFSA 3B7PA 4JI5B 3AWIA 1EI9A 1ES9A 2A6PA 4RHXA 1HOXA 1PVOA 3I6BA 4KP7A 3RVKA 4Q7LA 3RTBA 4BFVA 1L5OA 2Q3BA 4IXMA 1PG2A 1XZJA 2YDYA 1JU9A 2LIVA 3B6JA 2C4WA 2E37A 3OOHA 2HHCA 3CVVA 2ZU0C 4ADSG 3DOUA 3N8DA 4XQCA 1RBQA 3ICCA 1Y3DE 1F2UA 4UXHA 2C4TA 3FZGA 3L6CA 3THRA 3GQVA 1ID1A 3SX4A 1RM0A 3T7DA 3S1SA 1Z17A 3EIXA 4QUHA 3UAYA 1C50A 5JJBA 4C4ZA 4NX2A 2EGHA 2P9GA 3B7GA 1R4MA 1JALA 1WQ3A 3CUEF 1L9KA 2JFFA 2K4MA 3OD5A 1WP4A 3OM8A 4ASUD 2XNHA 3WB1A 1SELA 3HB5X 2YWHA 4LOAA 2L17A 1P8JA 1Z2CA 1I5OA 2HBQA 3HXLA 4PPFA 4QUBA 1FQOA 3PEVA 4N39A 1JLLA 5EHXA 3RSQA 2PGJA 3CM0A 1X7GA 3KTAA 2EP8A 3TTXA 5AVUA 3NVMB 3LW7A 1E2PA 3OJEA 1QK5A 1PBTA 2H9YA 3PFCA 3UMCA 4BNLA 3D0OA 2FVXA 2PJZA 3DOFA 1JR3D 3ZLVA 3OCXA 5KQSA 5A4JA 3CH7A 3PGMA 1W35A 4KYVA 1DXQA 3CNBA 2HV9A 2QJWA 1MVNA 4UBKA 5AKJA 5EPOA 1M1NB 4OXRA 4ECEA 5AW3A 2X2OA 3FKQA 2RE8A 3ZGVA 2EEPA 3PDWA 4C0KA 3T7TA 4URHA 4R1NA 1N8SA 1H2BA 2XQJA 3IUEA 4JL8A 3WWDA 1RHKA 4KIUA 4MXDA 3FDJA 1GGVA 2Z08A 2E2WA 1T0UA 3KWFA 3GRAA 3HSSA 1GPKA 4N03A 4AMZA 2BFPA 2CZGA 2CJYA 2V7UA 4U00A 1SQ5A 1KMQA 1M0TA 2NV2B 5J9FA 3RNLA 5KMGA 1JQBA 1Q14A 2YWCA 4O3FA 1RZRA 3EPHA 2GEBA 3HP7A 1JEOA 4J07A 2GBIA 3QEJA 3T1TA 3IAS6 2OMEA 5K2MA 5KMGB 3W79A 2R84A 2IRWA 3HI4A 4QOSA 2IYLD 2X9NA 4UPDA 3BB3A 2XODA 3EGVA 5DI9A 4V0SA 3IP3A 1IBSA 5KSWB 1W4CA 3ZJUA 1WOMA 3NAGA 4GRDA 4HUQB 1Z5OA 2CLEB 1Z6QA 5HE8A 4C0JA 2HZBA 4DGSA 1EFRA 4DOMA 8ABPA 4HNHA 3RH0A 2NZUG 1N92A 3KKMA 1JWBB 4PYKA 4ZRDA 1KYXA 2ZE7A 1A95A 3GF4A 4QGGA 4YV2A 3MCTA 4P08A 4EQ6A 5C4MA 3X3HA 3BH7A 5I8WA 3GLQA 2ODQA 1CY6A 1ZJYA 2PX0A 2RKWA 1QBKC 4NBLA 4CM8A 2B8JA 1M2NA 4HB4A 4NHEA 1NPDA 4RHUA 4RX1A 1A7JA 1EWQA 3RQIA 1KVQA 2A94A 2CDAA 2A0WA 1EINA 4KZPA 4NEGA 2ID4A 5AHRA 4XB6B 2XYPA 3A2LA 3OQJA 1YI0A 4NC9A 2FPGA 1NYQA 2FUCA 1MAHA 3OCVA 5CTJA 4H16A 2XBLA 3GLVA 1ZD9A 5DK6A 2ZI4A 3AHCA 3VV2A 1MG0A 2JZOA 5B4UA 1N0WA 1PTJA 3KIPA 1QH0A 3R1IA 4LFCB 4N5HX 4WADA 2EQ5A 4D5GA 1LU9A 4OQDA 3FA2A 2PX8A 2QLNA 4J1TA 4KK4A 4OOEA 1LBTA 3Q3GE 2AFHA 1WG8A 5JASA 2ZJ6A 2VI5A 3DT8A 1E1DA 2OFFA 1KQNA 5KINB 4DLSA 3GBVA 1L7MA 3M4NA 3ZJYA 3PC4A 3D6VA 2CXSA 3EISA 2IZ1A 2XY4A 4FJ1A 3PZBA 4LX8A 3SDBA 4ZO9A 1DRVA 3DKIA 4MUEA 4WTOA 1RPAA 4M46A 2DFNA 3GFOA 4JT4A 4S35A 5SYMA 5EJ2A 2OT3B 5JQGF 2PA3A 3DKRA 3LXRA 4BFLA 4AWAA 1WHSA 3HYLA 1T9ZA 1WB5A 1XQWA 1YOVB 3A1NA 3O83A 4HDKA 4ZODA 5BY2A 3VAZA 2H85A 1AGNA 1AUVA 3A3OA 3ZDRA 1RW4A 3MB8A 3P20A 3OX4A 4NBRA 5D5QA 4PWYA 3STVA 3GFFA 4AX4A 5KYWA 2DHRA 5EYPB 2CXQA 4CNQA 5CFRA 3RYIB 5ECDA 2FSVC 2XT9A 3GLIA 4C22A 4AXBA 5D87A 4ZALA 2OPHA 4A6EA 4FEAA 2ZIXA 3GEGA 4LQDA 3H5AA 1GNSA 1Y6ZA 3PLNA 3QWBA 4BRSA 3KQYA 4AG6A 3EYAA 1YQTA 3KOZA 1PL0A 3ZZMA 2NXCA 2XWPA 5CDFA 2FUEA 2HT6A 3N53A 2CYCA 1G20B 1GAJA 2CNBA 1DFGA 5KWIA 5LZ4A 4M54A 3QPVA 3PGLA 2P75A 2A84A 3GFTA 3IP1A 1VSTA 3Q10A 4KAAA 2WTXA 4N5DA 4D57A 3LZDA 3TOSA 3I39X 3BKXA 3OQHA 3AY6A 1DG9A 2REQA 2ZYDA 5KAPA 5FWYA 2EAUA 5L4LA 4I2NA 4P4NA 4AQDA 3RIEA 1RI3A 1NVAA 3BQNB 1OFTA 2YZMA 2X4LA 3NC1C 4JGGA 3VDRA 3EDRA 4K40A 1ZIXA 6YASA 3IPAA 3P9XA 2MYUA 5LP6A 1OFUX 2ZFUA 3GD5A 3VTZA 3FY4A 2PU5A 4IJVA 4GWKA 1XTIA 5KWSA 3USZA 4W7IA 2FMKA 5BOSA 3VZSA 2CXXA 1A76A 4U6NA 4B5LA 1CUDA 1OFGA 3MJSA 4RSMA 1QFSA 5KHAA 2PJDA 2MSNA 2V9ZA 4I6GA 1V25A 3K73O 3OU2A 4O0LA 4ARZA 2VBFA 5C7YA 4IRUB 1B14A 4I9FA 2AC4A 3W6PA 4DQDA 2ZB2A 3B3FA 2R4QA 1JFFB 1HT1E 1ZDMA 4XIIA 1UWVA 2R6FA 4HLCA 4I14A 2BLNA 3L41A 4PVDA 1U2GA 3L7CA 4NJEB 1IDN1 3C6MA 4KQHA 1KYYA 1FRVA 3LHFA 1WZIA 1MRNA 5BN3B 4TYYA 1OZHA 2WM8A 3BD7A 3GAFA 3BTUA 4BXOB 4Q9JA 1ZH8A 3ZVNA 1G5IA 2A0XA 3TM5A 2J5KA 3WOVA 3L0CA 3DL7A 4Y2VA 4U7FA 4ZVLA 1NR5A 3L0YA 3VPBA 2OHIA 4PZCA 5IF9A 4CETA 2HIAA 2REXB 1IIRA 4OQFA 4JUDX 3SHTA 3E9ZA 1RWQA 1YASA 3SBEA 1XZCA 3H13A 1Y8QA 2W8BA 2CNLA 4JITA 2W2XA 1J25A 1P1HA 4AKTA 1FX0A 1E96A 2WD8A 3AZPA 3BXEA 3K1TA 3LY7A 1Q44A 2X3YA 1C4OA 4BJ1A 1VB5A 3QPAA 1RQRA 2EU8A 2RGUA 5BNFA 5BSMA 3UGQA 4YMLA 1K97A 2P2LA 5KOHA 4J0DA 1WZCA 1JQAA 2YY5A 1E2LA 2MINA 3CLKA 3HN6A 4JYMA 3QXXA 4Y6OA 3T9BA 1QNFA 4TMWA 1RACA 3HVHA 2X19A 3L7OA 4B8YA 2R5WA 3TIVA 5L53A 1UKVY 2N47A 3A2MA 4OY3A 1LDMA 2FMFA 1E9AA 3UF0A 5FEUA 5JAUA 1D07A 1WDMA 2UVPA 2ZCVA 3Q88A 4BVBA 4HV4A 4RZUA 1TEHA 5AKKA 3LBHA 3KLOA 3K9LA 3R0QA 2F1HA 4BMCA 1YMUA 1X70A 2I1VB 4IOKA 3B1KA 2AMVA 2HEIA 1G55A 1Z38A 4YNBA 5P21A 3QVTA 1ESZA 2ZUDA 1V3QE 2BR5A 3EVZA 4R1TA 4Y0NA 3ZCUA 3GLFE 2Q2NA 1WU8A 3CH5A 3D8BA 4KOAA 4Q0MA 5JJ5A 4KDRA 2E6UX 4NFYA 4N41A 2QVLA 1JQKA 3OEHD 3K9HA 2ORWA 2EG5A 3AXTA 5HUQA 3DAFA 1I10A 1TMKA 4FFPA 4NFSA 4C89A 1RWNA 1Y5RA 2NUTA 2BGKA 3VHXB 4S1OA 1E2JA 4K7JA 1N3LA 2QAGB 1PYDA 3OKCA 2I3AA 2NXEA 3SVZA 1OYWA 1T3ZA 1TMGE 2EZ4A 2Z5VA 3DUFA 3HGQA 3IUMA 4C4RA 5HYVA 3I64A 3HM9A 3FVWA 4GW3A 2OGZA 4LCEA 3QE9Y 5F3DA 3CNNA 3B13B 3KP1A 3PL1A 3T15A 5D8DA 2BD0A 1AZWA 4GOLD 3KDAA 1AM4D 2BR4A 3FR7A 1XXHE 4C0BA 4YRPA 2SKDA 1X1DA 2R6ZA 2R5NA 3EF3A 1PHPA 2W5UA 3L0DA 4FX2A 4W8HA 5E1DA 2FPIA 4TWBA 1Y33E 1ULBA 1Y9DA 3LBNA 4HB3A 2HL6A 2Z4TA 1KO8A 4K9PA 4M9ZA 4XFKA 3JYQA 1SOVA 2VJCA 4Q12A 5TE9A 1AIPA 4L8GA 4YUAA 2V6JA 2I34A 1SC1A 2ZYUX 4QOEA 5KJ6A 1NVTA 1SXIA 3LIIA 3B1WA 1J1ZA 3O8CA 1JJ7A 4CFSA 4L8LA 5TT1A 4DDUA 4JXZA 1NJGA 4B6QA 1ISJA 3H3FA 3LWNA 2H4WA 2NAFA 2O2XA 4ZVRA 5KO2A 121PA 1E1RD 1VG8A 2D4AA 3J7TA 4YJKA 3SJAA 3TBFA 3NG1A 3GFRA 4R1SA 1VCOA 3SC2B 1VLLA 2JEYA 4RH1A 3CZMA 3Q3JB 3ZGLA 3FPHA 4R2IA 4TWAA 1J97A 2HXYA 5BSGA 1Q3TA 2IHVA 2XKJE 1K8RA 1SB8A 1GTMA 1PYOA 2JGJA 1X7WA 1RJDA 3KHUA 1FSZA 3IBTA 3I6QA 1QVRA 1OY1A 3FCYA 3QU5A 4LWQA 3O4VA 2YWJA 4WXEA 4Z1MA 3PC7A 2VDQB 3E81A 1GHTA 4OV6B 3G9UA 4AF7A 4EW1A 1NFFA 3BZUA 4CMCA 5FWXB 5MN6A 1RLUA 1F2TA 2EWVA 3D3NA 3ZIUA 4ZKDA 2ZIZA 3FFBA 5THQA 2V5AA 3ISTA 4M9RA 3VC2A 3S2GA 1TADA 1L7RA 3KYCB 4CI9A 4IV8A 2AZTA 1CB0A 3BSWA 1WPQA 1OWOA 5K3DA 1UF9A 1F6DA 1FMLA 3F9CA 1GG8A 3CLRD 1CUUA 1I2ZA 2Q3MA 1LBEA 2AL7A 2RGNC 2V0NA 4TS9A 3INNA 4LOIA 4LYHA 4EHNA 2GK4A 3HDYA 2PQ2A 4FGSA 4CLXA 1L6RA 3FLMA 4DDKA 3HWRA 1YA4A 5IKOA 1R0YA 1FMFA 5E6SB 3ZJVA 3C3YA 1YFJA 1YSCA 1JAIA 1G8AA 1KHHA 1QO9A 1UKBA 3AFNA 2PYIA 5BSWA 2QP9X 3QVMA 4M53A 1AV7A 5A7HA 1OYVA 4EPVA 3O3NB 3IELA 1PS0A 4D3DA 2IE8A 2Q3FA 1RQLA 1EFUA 1WXXA 3O0DA 2OR3A 1CK4A 3D2CA 2QK4A 4U7JA 4ZAZA 1WEHA 1IN4A 4MEJA 4EAAA 1SQGA 3D02A 4FYVA 1R4AA 4FLEA 3KUKA 5ALZA 1P81A 4XRGA 2Z2KA 5CIQA 1MC5A 2QSYA 3CE6A 4FJ0A 4LXGA 2AR7A 4K3UA 5JECA 1AZTA 2PO7A 3I2IA 5ARBA 3FTNA 2J7KA 3A3YA 3RFCA 4B3CA 3PUXA 1DKRA 3EXFA 1G5TA 4RHEA 2DUJA 1GCIA 1YS2X 3DQQA 1ZU5A 1QHEA 3M6UA 4X1OA 2W8ZA 2AWNA 4ZQCB 2BEWB 3R75A 2F43B 3CLTD 3G7UA 1QPGA 3NHYA 1Q1GA 3ZDZB 1LX7A 4XYLA 3ZH2A 5KU1A 1Q7TA 1CUIA 3VR4D 4YP9A 4ITVA 2NW6A 2O1WA 3G2KA 4XGNA 1NOKA 1F38A 1RZ3A 2GOYA 1UK7A 2B2NA 4WAUA 1I3KA 3LNCA 5B1YA 4D96A 3AYZB 3IRUA 1D1TA 1CG6A 1ULTA 1M2OB 3DUWA 5JS6A 2BTEA 4HEA6 3JQRA 1V26A 2H2GA 4IVQA 2OE2A 5I9MA 3O1IC 3QX3A 3M82A 1YU6A 3A7DA 2JLWA 2X8AA 2ZCUA 3LOQA 3MMXA 5T4EA 5EFOA 3PJGA 1MORA 2WWYA 1EQ2A 4CEJA 3W5HA 3I5MA 4X0EA 3VVMA 5CGQB 5EZYF 5H5JA 4S24A 4C6TB 1H4SA 1WB4A 2FEXA 5CUQA 4LOHA 3RUPA 4BMSA 3ZJ4A 1AX9A 3AHHA 1NPTO 1ZJJA 2QDXA 4J3FA 5LMNB 1W75A 1UDXA 3C15C 2OFXA 2XMGA 3HJCA 4KC0A 1W4AA 5FUXA 3NEAA 1EGQA 1X2EA 2VUUA 2B82A 3E9YA 2FOXA 3EHEA 3L4KA 3KPYA 4KGDA 4UVDA 4CM9D 2AX4A 5KWEA 2HB6A 1NN1A 4UJ3A 2ZRCA 1XALA 2FZCA 4U5XA 3ILYA 4B44A 5ALQA 4EB0A 3EOBI 3BGIA 1L1FA 3NHAA 4BLQA 2ILTA 1L7EA 5IHPA 4QXQA 4Y98A 4MRMB 3I58A 4NU8X 1NW5A 3OAAD 3H18A 5ECGC 3ITNA 4BN5A 4BO1A 1U1GA 3JS5A 4GGMX 5JISA 3GPDG 4M1WA 5BV0A 3F96A 5HFNA 3NV9A 1T9BA 3WLIA 4LFAB 7REQA 5IAGA 3GUHA 4XA8A 1XRPA 4MCIA 4H1WA 2ZB8A 5BQXA 1P74A 2NU9A 1BGWA 3LWBA 1D6SA 4QX6A 4L51A 5AUPB 4F3YA 1DCKA 4U7WA 4A27A 3KLBA 3HU5A 3KAKA 2QUJA 1AGPA 1JZQA 1WD5A 4YJ2A 4DJTA 7ADHA 3EVBA 2PTHA 2O2ZA 4DEXA 3H9GA 3NALA 3GP3A 1EVEA 3M2PA 1WUKS 5IVHA 4Q1BA 4QYMA 4KXYA 2P3QA 1IY2A 1PVDA 4GXQA 1SO8A 2VDUE 3A6JA 1J2EA 1DUSA 3B6IA 3Q98A 4ZVMA 1XE3A 3C3WA 1F7UA 1ZQ9A 3HEAA 5KVQA 2WB4A 3K31A 3HJUA 4IHQA 4XCXA 1V45E 1Z35A 3RASA 3M3HA 4KPUB 4BX9A 4MWDA 2G0TA 4BX8A 5KOYA 3KDSE 4X9XA 3LFHA 3R5TA 3PFNA 3ZI7A 3I9V1 1FX0B 1JWAB 1N9GA 1H2YA 3F4BA 5JBNA 4FGKA 2GN6A 1XELA 3C45A 1DOZA 3DAGA 4J4TA 5IABA 4EELA 1AG9A 2GEJA 3OTGA 2ICAA 3EH2A 3JY6A 4HNAB 4QBGB 1XZBA 4MYRA 3TUIC 1BX1A 3UENA 3BAFA 2JD1A 2W9XA 2WVGA 3MYRA 5EJ9A 3HS3A 1PDOA 1AS0A 4RZ2A 4BV3A 2ZI9A 2UUBB 1SJ9A 3KSRA 5K8LA 4LOKA 2TMKA 4JXXA 1XT6A 3N0TA 3BE5A 4HNQA 2IKSA 3NORA 4WRRA 5BNTA 2IQIA 2XNCA 4LY0A 2JBWA 1HMPA 1E92A 2VPQA 4NDAA 4PTZA 4TLDA 5EJMA 3W9SA 4AIIA 5F1YA 3K15A 1ENYA 2WD9A 3P0IA 4G97A 2W6IA 4I66A 4IF4A 3QKIA 3FFWA 4UDOA 3F6YA 3W8RA 3OCZA 3DMFA 4RJJA 1ABBA 4MS3A 1EWYA 4FYMA 3VDMA 2GM3A 1F0PA 4C4TA 2ANBA 2FCAA 1IQ0A 3GEMA 4PIMA 1Y7LA 2VCHA 4LMBA 1SOAA 2QTWB 4NZYA 1M2VB 4R8MA 3U40A 5I8PA 1RQPA 1PI3A 1EKXA 2VNHA 3CKMA 2B3DA 4PQGA 1K6EA 4J0IA 1LLQA 2AEJA 4MP8A 2ADFA 4P7BA 2PT5A 3CX3A 2NO7A 4X8HA 1YK1A 1Q2XA 2J5BA 2GBLA 1Q77A 3ABRB 4JMPA 3DXZA 4QUEA 4MQFA 2HTEA 4UTNA 2QYSA 5JO9A 3MZ0A 4HDQB 4F86A 1GTRA 1HL3A 4PLHA 5GPBA 1QLJA 2Z2JA 1QR6A 2YVQA 1V3TA 2WU3A 1PQPA 4UJ5A 1DAKA 1FYDA 3D6TB 3QXJA 3BIFA 4PAOA 5H81A 2ZUBA 3SS8A 4YRAA 1I8TA 5K09A 1T26A 1VGQA 2FLWA 3JVIA 4TM8A 3ZDBA 2WWWA 4FYYA 1QDEA 2NVUB 3PJRA 3KJZA 6Q21A 5KNDA 2H08A 1QUFA 2A5LA 2OXFA 4N4AA 4DMRA 1QDUA 3M4YA 5ALGA 4FWTA 4KFRA 3DZ8A 1Z83A 5EC8A 3H8JA 5FORA 5EYPA 1Q1NA 2EFEB 3CKKA 3PCXA 4FMPA 3F8TA 1MLDA 4UD6A 5CG1A 3T5BA 5DYTA 4HYEA 1IWOA 1QHIA 4FJ2A 4KW7A 1L8QA 5CVDA 5EHNA 3RTDA 3ZXXA 2O2SA 4MKFA 5JQWA 1KO7A 1RYYA 4IUDS 1CY7A 4ZMRA 1NXWA 3H8WA 1W0JD 4MQBA 3CX8A 3AO0B 4TKUB 2HO5A 4WXMA 3KJQA 1GJRA 2O19A 3CLSD 3LLUA 5F4BA 4RKFA 8ADHA 2F9LA 3JALA 1JHQA 5JVDA 3G1UA 1CUHA 2ATIA 4WZAB 4AJPA 1VYVA 2Z6QA 3HWWA 3OCUA 2YWGA 3A32A 4DAEA 3A05A 1XU4A 4WOBA 4EYQA 4RJTA 1IM8A 2WT9A 3CONA 1ZMOA 3C3JA 3CW2A 3K6KA 3HDJA 2YHSA 4D0GA 4ZYWA 2PRJA 1VGVA 4H1TA 1HNXB 3MCWA 3U49A 1OJLA 1M0EA 3GLGB 4L0CA 3V6LA 1FXWA 3C3AA 3EXEB 3VR3D 4MLCA 5KQLA 4UD2A 1OBCA 2V03A 2JLXA 1V48A 1Y4DE 4QDTA 3N3AC 1N0IA 3PGJA 1QIDA 3TZHA 2I2CA 2WUEA 1YACA 1WE2A 1XV5A 5H3LA 1N5OX 3D59A 2ZAOA 4N3NA 1Y42X 4WXPA 5U4XA 4FT2A 3LXUX 2IU0A 1ZD8A 2NO4A 3P0JA 3WGHA 4ZO6A 4ZYTA 4CKEB 3MOIA 4MK4A 3LO5A 3B1XA 3PGKA 1WDTA 1B2RA 2RI6A 2JG3A 4IPTA 5GGYA 3ZD6A 1RYNA 3ETEA 3OIDA 3BWYA 2Z9BA 4HWPA 3G0DA 4KUEA 1R0WA 3EXHB 1IJEA 1V8PA 2AN9A 2G40A 3ELBA 1H93A 4YJGA 5E38A 5JALA 2EF1A 5IT9A 1AE1A 2WPNA 1NJ5A 4RDHA 1XTPA 1TTTA 3SSAA 1G2QA 1QH1A 5BWBA 3HA3A 3QM1A 2CLCX 4TX1A 1IXZA 1USVA 5LKRA 2IGTA 2B30A 4MMZB 4NATA 2BI8A 3CWQA 4JVOA 5JLJA 1S8AA 1JQ3A 4OHCA 1ZN8A 2RHOA 3KOUA 4OREX 4OXKA 4EEZA 1YBHA 3GGOA 3CPHA 5FA6A 1L4YA 3VR4A 3RLIA 4US1R 2QN8A 1NBMD 2D1QA 4JUBA 3B36A 1UZMA 4KQEA 4DCSA 1WPXA 3HABA 1ZD1A 1KBZA 3ZWXA 2I8AA 3LLCA 3LRPA 1UKEA 2VRWA 3BERA 3RCBA 3K0KA 4JBYA 3LPLA 2BIFA 4I4TA 4LE1A 4BO8A 2RBKA 1TVEA 2W2QA 3GFBA 4LGMA 4B71A 3I3SR 1Y1LA 3AFGA 3HKEB 4CF3A 4EMTA 5CURA 3TCKA 4DJFC 2FJUA 4MKIA 2JFXA 3ZXYA 1J8FA 3AHJA 3Q1KA 1OD6A 3OX2A 4UMEA 1HETA 3LC7O 5D5PA 4BFTA 4DJ5X 1C1HA 3I72A 2VT3A 5LBTA 1PJ3A 1C7JA 3CF6R 3ZD7A 3MAJA 1FFDA 3ANSA 4PFQA 4JLWA 4K9RA 1OXKB 2MSEB 3ZGYA 2G8NA 2EERA 3PHIA 4OJQA 2AHOA 3LDHA 4FFBB 2REBA 3VYVA 4DCGA 9LDBA 1PJ2A 1LX6A 4ENTA 4WHMA 3HXKA 5A7FA 3OOJA 2VJOA 3OPYB 4R7ZA 4EG1A 3K9CA 4Z53A 4AKIA 1SVWA 3LUDA 3S2FA 2YVKA 1E5VA 2IYNA 4H7KA 2A8YA 4P36A 4S0ZA 3TXAA 4C2UA 3EB9A 1K7CA 1NXOA 2G4LA 2Q9CA 3PQDA 5C80A 2WHRA 3Q6MA 2GLUA 2VLBA 4EFKA 3IBFA 1NMQA 1OJ7A 1XCGB 2J45A 3L07A 3RW9A 1J9GA 3FUWA 4IIFA 4PAWA 2Y99A 3FFAA 5GIPE 2F90A 1L4UA 4XJVA 4R8SA 1ZMXA 2Q1SA 4BDSA 3FVTA 5AJXA 2WTAA 4HMQA 5JSUA 1W8DA 5AP9A 1O6ZA 2JIRA 3USES 1VZ2A 4ZEWA 1R3DA 4JI2B 4YJHB 3V1UA 3WO1A 3K9GA 2GZHA 2XSZD 5ABPA 3QTLA 4NIMA 3H9BA 1K27A 4QRIA 2LTAA 3OLVA 4R69A 4OEHA 5HTKA 3T7SA 2Q7DA 4NG5A 4NPCA 1KC3A 1JE1A 3EZFA 4B3MB 3UWPA 1ECJA 1GAWA 3IIJA 3TTTA 4JGIA 3ST7A 4EIWA 1Q57A 1X86B 1E3SA 1PWHA 4OXNA 2D1YA 4EWLA 2B5VA 1TAQA 3PENA 1VIYA 5TMBA 4OJMX 2V54A 2V74B 4IXTA 4B3DA 4RMHA 3O2JA 4PFSA 4B3BA 4BB9A 1Z34A 4OI2A 4JK3A 4CT0A 5KX5B 1OH8A 1EFAA 2E5WA 1D2CA 1EDDA 3FOEC 1C7QA 3EDMA 1PZMA 3CX6A 5I51A 2BOVA 1JH9A 4BNZA 3JYLA 2OCXA 4KHZA 1GY8A 1HQYE 4RABA 1U0RA 4NL4H 5AHKA 4XWAA 1J8VA 3VR6A 1FFCA 1FDRA 1C2TA 2B4KA 3G49A 3M1IA 4XWYA 4HYYA 2Y1LA 2X86A 3BAZA 4P0QB 3AIKA 1TCBA 1U8ZA 1VSVA 2A1UA 3UN1A 1JHDA 3DTVA 2P1ZA 3TW6A 1X8KA 1P5RA 1XZQA 3FDFA 2GN0A 4R5MA 1U02A 2PZJA 3F97A 3NJRA 2Y77A 2VHYA 5TQVA 3REQA 1MV8A 2GN8A 2CD7A 4PW0A 2CHUA 3EGDA 3F5FA 3MW8A 3RYHB 1B0PA 1ONSA 3FUVA 4J6EA 3T8YA 3WBJA 10MHA 3PUHA 2R7KA 3TD6A 4DSTA 5ALIA 3EGXB 3ZU2A 4UVEA 3GBSA 1XTTA 5EKDA 1SRRA 4IVRA 1VLQA 4YAOA 2Z30A 1EE1A 3P71T 1UPBA 4WACA 2FF5A 1A2QA 1DT3A 3AKCA 5FQOA 4BGVA 2GZ2A 2HA5A 4YQYA 3HUTA 4HNTA 1Y7IA 3PEEA 1QM5A 3ZYCA 2ZXUA 5EKSA 3NM4A 4K6OA 2RHDA 4UTOA 1UKZA 4YJ3A 3IEMA 1R37A 2C5LA 4EA7A 2OLJA 3INTA 2WMYA 3GGJA 4HRVA 1FJXA 3GH1A 4MWBA 1K89A 4RXTA 3TNDA 5ALOA 5CFQA 2XMZA 4EW3A 4CEHA 1HYEA 3HN2A 3LT0A 2J1LA 1E9DA 3EA4A 2YWXA 4K5QA 3DE1X 4OLJA 2Q2OA 4O5OA 4XUCA 1TLFA 4FYWA 4Z4GA 4HJRA 4LXQA 4OU5A 3NWEA 4REMA 4O4LB 5DTQA 5ER9A 4OQMA 4WY5A 5IAEA 5LVAA 2IDMA 4A8HA 3R3JA 3CLSC 2IP2A 4JI6B 2I0FA 5AVXA 1O03A 2AOUA 2VP5A 4MWSA 1MR3F 4KN9S 1PT9A 3ZE8A 1C9MA 1K7YA 3ELDA 5KDOA 3PIIA 1VPLA 5SV2A 1JX6A 1LPBB 5IAJA 3PT5A 3KAPA 3U17A 3VVBA 2ZJ1A 1G7SA 1R6AA 4A03A 4EUKA 1TOAA 2HU7A 1EWKA 3NI2A 3HA7A 5CIWA 1VP3A 2LKCA 5HCUA 4OK6A 5C8YA 2YIVX 5JZVA 2F64A 4J2TA 2DBYA 3OZIA 1A88A 1HDRA 4FNGA 3LUHA 4PZ9A 4UREA 4R1MA 1EE2A 2ZJ8A 4BO9A 3QPWA 4QC2A 1BCRB 2BFEB 5KTTA 3ZWOA 4JN6B 3RV3A 4DTIA 4EY4A 1DQRA 1FXSA 4KL8S 3QEKA 3H87A 2FGJA 4PPNA 1ZWKA 4CM9A 4KNYA 4HEJA 1VI6A 3CG4A 1PGOA 2NXNA 3K9QO 2IHKA 2GLTA 5CPBA 4KJXA 1XN4A 1DBWA 3SU8A 1CUWA 4B76A 3V4ZA 3DHNA 1A7AA 3VR5D 4JJEA 1WSBA 4JODA 4F9TA 4P4SA 4WCVA 3ICEA 3Q0EA 4NS1A 2Q4BA 1HE3A 1P7PA 1P2DA 4C2BA 1CZUA 1O9BA 3TAUA 5A6SA 3LUKA 5EJ8A 2FVYA 2QYOA 3N0XA 5K4HA 2D2IA 1Q11A 3FHLA 5IFLA 1NJ6A 3IPRA 4IYJA 3GFGA 3M4JA 4JC4A 4WXYB 3UAVA 2PEYA 2PX3A 1JKJB 4JX9A 2Q3LA 4C0XA 3ZHQA 3WVNA 4Z2AA 4JJKA 1IAQA 4KXWA 4Q4LA 4DCUA 2NU9B 3EZ9A 1H66A 1QGYA 1K5GA 4BLSA 2XB8A 1C4XA 4N5LA 4A16A 5FL7D 4YACA 2ZTMA 3UA3A 1O95D 4AO7A 3R3YA 1U11A 2WJJA 2PBRA 4C0QC 3P7MA 3CBGA 1U4OA 3K5PA 2YQ4A 3JZFA 4LN1A 2B34A 2RGCA 1EJ2A 1PWEA 3C6YA 2WIJA 3N8GA 4LYFA 1JT9A 4RDCA 3ULKA 3DDUA 2PJUA 1AXGA 3H9JA 4FBMA 1X39A 1E9CA 4R98A 4RHYA 1ZISA 1OZFA 4EGQA 5IC6A 4W8GA 2R11A 5I7EA 4WLOA 2YIJA 4MRAA 4R8VA 2VK1A 2HFKA 5JCXA 4ASUA 1LI7A 1XZDA 3QMMA 2C4VA 3ZE9A 1PGJA 1H9CA 1NXQA 3CYFA 3A1SA 4Y6QA 1WPRA 4FCCA 2AOWA 2J7PD 4YJ2F 2QXUA 1ZN7A 3LDGA 5FPQA 2IH2A 1ZM9A 3WQQA 1KEWA 2PL9A 3EGXA 3U16A 5JE8A 5AUQA 3IEXA 2W6OA 5E95A 5A3SA 2RJNA 1TUGA 3F2IA 4YI5A 4D92A 2YMMA 5F35A 1I4EB 5T64A 4CCYA 3DOJA 5DYNA 1K5PA 1Z4JA 1M2OA 3L6UA 4C4OA 4ZDJA 2W22A 3JQ6A 4MW7A 3GLFB 4JV5B 2ZUCA 4YJ3B 3HG7A 4GXTA 4RPHA 3URMA 1T0HB 2OV6A 4IFBA 3PXDA 4N65A 1PFYA 3J81A 4QHYA 3PB3A 3K2QA 3FCSB 4HRYA 4WEOA 5KVCA 2LZ0A 2XOEA 2YVLA 4JJ6A 4QGBA 3IV9A 4OMFG 3PLAE 1NT4A 1TZBA 4L07A 1QHGA 4YREA 3ZQ4A 3E84A 4B31A 4C43A 1JU4A 3QTBA 5B57C 5HZGA 2GB4A 3ECAA 4CW7A 3W5CA 5FPTA 1KVSA 2PH7A 2DWCA 1ZH6A 3JD3A 5EWMB 2WIAA 2HOQA 4G67A 2F6RA 3V2IA 4LI0A 3DT6A 3C2QA 1T91A 1U1DA 2A1UB 2CY0A 1S2DA 2WPDD 2ZSBA 3G5MA 3QG5A 2BKLA 1XCBA 2Q2VA 1EAYA 2GCEA 4UUMA 3TRHA 4YHHB 4PSAA 1JLHA 4BQOA 5DF1A 4NQRA 1PG0A 1RYZA 1QB7A 3AV3A 4BZWA 5EXEA 3ZWBA 2GSDA 1M54A 4Q00A 2N46A 5HZMA 5KCMA 1LI4A 1PFQA 1WNTA 3INGA 2VUSA 1RRFA 4UVIA 3UM9A 1E63A 3AF0A 3C6BA 3FJOA 2X0RA 2VZ9A 1ZOLA 3PNVA 2WWRA 1RFGE 4MR7A 1MTOA 4ZQGA 3VM6A 1DRUA 5G1OA 4MQUA 1L4KA 4F06A 2QR5A 4RIGA 2KBEA 5K99A 1GZ7A 5AYVA 4EFMA 3HR4A 4X65B 1N77A 4JBWA 1V5EA 2BTOA 4YAFA 1M5TA 2YZNA 3D7SA 2GM5A 3E7DA 3M89A 3VTKA 4LXXA 4HP8A 1IB6A 2O0KA 3OIYA 4RUKA 5BN5B 2JKZA 3ORHA 4YAGA 2CUKA 1QLWA 4P93A 1I7PA 4O2RA 4YROA 3LLMA 4DLKA 3KYCA 1GZHB 1XRJA 2H00A 4NLLA 1OYYA 3NYQA 3GP8A 2R7LA 2C04A 5T3UA 2Z2XA 2Y05A 2W2LA 3PHBE 2ZWOA 4D9JA 1NONA 2WRZA 4BE9A 3HB9A 2XKBA 4PGMA 3OLXA 1RM3A 1YJCA 2PGDA 1A9OA 1FRNA 3AR3A 2Q62A 3MOSA 4QPNA 1XLUA 2FNAA 4RZSA 5EZ5A 1CUJA 2ZUFA 3PD0A 4FYJA 1U7UA 3JAMA 1DJOA 3D3QA 4WJKB 2G4VA 1FQJA 4AF8A 2NU8A 3ZU6A 1QQAA 2JH9A 4GF5A 4OKSA 2BPOA 3G5UA 2COKA 1B8NA 2QI9C 2X4GA 3IOCA 5AOCA 1U8TA 3UXYA 3IILA 1QTQA 2G6TA 1V6CA 2GA9A 3PC8C 1E1KA 5F76A 5TEWA 2AR9A 2JPDA 1ZU4A 1E3TA 4J0QA 4MR8B 3EVEA 3GUVA 5ICGA 1QZZA 4UUPA 1E0SA 2GCPA 4LC1A 4EQZA 3E03A 2ZW9A 3RROA 4X20A 2EDCA 4L5CA 4LV5B 2QG9A 2V6GA 3F90A 4QLBA 3G17A 5BSFA 1GCOA 1Z56C 1KDVA 2WF9A 3F71A 4N5IX 4AN1A 1Y4ZA 5AM3A 5BYKA 1XWWA 3C8MA 5L3VA 2QN7A 4KYIB 2GEKA 2C97A 1U2DC 5TVKA 1I4TD 4G37A 4NE9A 2WIKA 1PK7A 1JHAA 1L4GA 2IYFA 3OTHA 1HY3A 3O8LA 4ZDWA 4YLYA 1KOFA 1YRWA 2EDAA 2GCNA 2GESA 2J32A 2YICA 3AY3A 3LMKA 3O4FA 3PPIA 4J90A 5DHTA 3QFRA 3WLEA 2P79A 1HNWB 3D4IA 1L4BA 3WB9A 4E5PA 2BM1A 2HRZA 2QAGA 1TXGA 3C5HA 1J1UA 1GTZA 4ZAXA 2XD4A 3RWMB 2ZRHA 3HRIA 1IHDA 1K7SN 3DOIA 1UAYA 3VR0A 3COWA 5EVJA 2Y6UA 1E3IA 1XPJA 4ZGGA 2NO0A 4I55A 4P92A 3WGNA 2P2GA 3ETHA 3PKIA 5JI3E 4NCJA 1BNCA 1FFAA 2IXGA 3GFPA 2AZMA 4KR0A 5AW9A 4BQSA 5ITZB 4BNMA 4Q4HA 4MUJA 5JRDS 1YGYA 2GKOA 3ZHSA 5KKAA 3V32A 3ZG6A 2AYYA 1PX2A 4QO7A 3PWZA 5J5VA 2NYVA 4QJ3A 4F46A 5AVRA 4DPKA 5KB3A 1YQ9A 2FPKA 2XZTA 3PCTA 4HDOB 3BWVA 1KQFA 1W29A 3BJIC 3BIWA 1CFZA 1NHWA 2GBLC 3G2MA 1A2KC 1DKOA 1A1SA 3JTMA 4EF5A 5HX7A 3DR3A 4MNTA 4UHCA 4B4VA 2HRDA 3ZHTA 4KLAA 4RL4A 1JG7A 5COQA 3K71B 1BE0A 2PWPA 1SUPA 3ZIAA 2O2DA 4LK2A 2RD2A 3AESA 3LL7A 2JIMA 2KLHA 1CDZA 1OE0A 3KJNA 4OHMA 1JKIA 2Q28A 4LDJA 3D0RA 5AKLA 5C1BA 1TCAA 2C1ZA 4H3VA 3SK0A 4AKHA 1JDUA 4JWTA 1BVHA 1XQ9A 1E6KA 1USIA 3D3WB 2EJWA 3BZWA 4X1IA 5AJVB 1P0QA 1BOOA 5M04A 3UJ3X 1N5LA 4UBIA 2O4UX 4FHGA 2ETVA 4FGLA 3HA2A 1U0SY 2KWIA 1DIBA 3W3AD 3ET5A 3W0LB 1N1MA 1TIBA 2QNRA 1R5NA 4LW8A 3QVGA 1T36B 6AT1A 4L27A 2I6UA 1GR1A 2HJSA 2OG2A 3JV7A 2C20A 3CEPB 4D81A 4LF4B 4X8LA 1KKLA 3HZZA 5TGDA 4L9RA 2HV8A 1DV1A 1KEUA 3KZOA 4PTLA 3B6MA 2VA9A 3WNCA 1G3UA 1KFKB 1X6VA 5CJ2A 2NUBA 4BCDA 1RC0A 4HGPA 3V80A 3D2BA 4CN8A 4EHIA 1E0DA 1KI1A 1GNVA 1SPXA 1JIQA 1KDZA 3DBHB 3PEYA 3VI4B 5A5FA 2P90A 4G26A 4U6QA 4YYZA 4KLNA 1Z3IX 4Y1EA 5C53B 3TIFA 4RVUA 4DDVA 1PQUA 4RAOA 4GO1A 5K6RA 3I0NA 4JYAB 2AW3A 3KT6A 4M8KA 1P6QA 2DUNA 4WZBE 1KP9A 2C82A 1XAIA 4GEKA 4KQ1A 4OHWA 4XWKA 5TXGA 4OFXA 3L02A 4UXJA 4CQNA 1I6WA 3U4QB 4LG1A 2HMTA 2YHAA 1U7WA 3GMDA 4WVLA 4G0UA 2FZKA 3CNEA 1V41E 4KSYA 4MUHA 2ZT5A 3OQNA 2IPXA 1SPBS 3AWDA 1OWLA 4LRQA 4WOCA 3BGWA 4XSGA 3EG9B 4NEQA 5JAIA 2DJ5A 3GNSA 6CHYA 3W5BA 1FW8A 2VSFA 4RTQA 3FGPA 1XNRB 1E3WB 1E7MA 3D8HA 2O7NA 3WMRA 2ANCA 3SF0A 3KX2A 3LSYA 4AP5A 3I76A 1GNQA 1QGUB 4TL8A 3IO5A 3NWJA 3P0EA 4X85A 3RREA 4F71A 3GO4A 4Z5XA 3U60B 3PC6A 4RIHA 2LRHA 1MHTA 1MZPA 4MS3B 1XYVA 1FTQA 3EW7A 1MC4A 2LWIA 3RI3A 1ZGZA 1B15A 1E9RA 1KO5A 2DP4E 5BSRA 4ER7A 1MA3A 5JARA 3TYXA 4IDAA 3QZUA 3DYBA 3FX2A 1Q0ZA 4FDUA 4P38A 3MELA 3NBXX 3OBBA 3K2IA 1UBEA 2UZ1B 1FYFA 1W5FA 1KU6A 1XMVA 2F1IA 4AYWA 1Z33A 3WSWA 3ZZ1A 4E5UA 4NU6A 3NH9A 3VYUB 5L3SB 1J2YA 3L4BA 4KIWA 4R2JA 4NDNE 1WXGA 3KQSA 3MA0A 5JFOA 1ACLA 3EXG1 1B6SA 1YB6A 5DMHA 4EKGA 2FP3A 3FWPA 4KWCA 2HZ7A 1LSSA 2QX8A 1U4SA 3L0IB 1UCFA 3E3LA 4FMCF 4AWBA 1AMUA 2FN7A 2OD7A 1ORHA 3DEAA 4EX6A 3EDOA 4JAVC 3VR4H 4DNFA 1I5EA 3KCQA 3I62A 4LPKA 2OHOA 3THOA 1KY3A 1V8OA 1VBNA 2HUNA 3AEXA 2W6QA 3AUSA 1QK3A 3EW9A 5AM0A 2HDOA 3RRNA 3U0BA 4D9GA 3DM5A 4P33A 5ITSA 5FJJA 1V2GA 2VJMB 3KK0A 3OWOA 4M0CA 5FTJA 2CYAA 5FV7A 4EYEA 1BA3A 3G6KA 1UPAA 5JYEA 1E5LA 1LDGA 2C3OA 1KSGA 2DBZA 1GVHA 2K7ZA 3T95A 3TNJA 5K03A 1H42A 1EFCA 3TGPA 4ZCRA 3KKZA 1A5AB 3I2HA 4YUZA 1F5SA 1N9GB 2YHBA 4KO3S 3REGA 2H1IA 4BNNA 4E07A 3PSAA 5L3QA 4NCBA 3NHBA 1FFYA 3SC4A 2Q2QA 3MWYW 1GGJA 5DOZA 3KOYA 3THYA 3KETA 3QYAA 1DX6A 2J6HA 2JI6A 1IULA 4IH1A 4LRTB 1H2EA 1LLUA 3GI1A 3ZI4A 1QWOA 1S2LA 1JLRA 1NV9A 2XQKA 1VJ0A 2Y1EA 3EYWA 1ZG3A 1JIIA 1UBNA 1XI2A 4JLUA 1PDWA 2ZULA 1N5IA 3B1FA 4QQNA 4D8UA 3MRVA 3WWOA 5KQRA 2J6CA 3ZZTA 1AU9A 3DHWC 2WKWA 3DZGA 4UCXA 2Y76A 4JEHA 3H6KA 1TYAE 2CKMA 4BIMA 2C2KA 2IFTA 2JLYA 1SURA 1C5KA 2QTNA 3AF1A 3CX4A 3JQPA 4O4HF 3MBKA 4CJXA 1DQYA 3FNIA 2RHRA 2YYYA 4M22A 5BRNA 4AIRA 2Y6VA 3A9SA 2JDID 4D9IA 3NHFA 5AKHA 3JARA 1Y0BA 4UASA 1WR8A 3UWKA 2BTQB 1M1UA 4NJOA 5JS1A 4I55B 2EGGA 3KUXA 3GDOA 4HF7A 4A8JB 4TVSA 2EX0A 4WDRA 5I48A 3TFOA 4X7RA 3DBLB 3B6KA 3CUUA 1ENPA 4HZIA 4C03A 4BBPA 2C2BA 3HRHA 1PWXA 4FWBA 1NIJA 1C8LA 1S9HA 4N3BA 4Q1AA 2KMLA 3NC0C 3WYAA 2CLHB 4AO6A 1M34E 2BW0A 2GVZC 3EPKA 1F14A 4MEAA 3NB0A 4EFLA 1Y80A 2GHIA 5BV7A 2C9CA 3OZSA 4LKRA 1TW3A 1P77A 4ZMSA 5AVTA 1AHIA 4KTVE 3O93A 4BNTA 1VIVA 2QIOA 2YV1A 3GLTA 5AW2A 1DTSA 4EPYA 4EH1A 1R0BA 4F4JA 2C7BA 3MUOA 4X20B 3EPLA 1PK8A 1QE0A 4W5RA 3KSAC 4CEJB 2YQ5A 5IYZF 3QV1A 2FRVA 3RYTC 2VP2A 3H11B 4LK3A 2WY2D 1ZN9A 4E5DA 5SICE 3O3OB 1XU7A 3C3MA 2JNWA 3EFEA 2EW2A 4RS4A 4AXXA 5CCBA 1FVFA 1ZIDA 4CTMA 1A8PA 3I1IA 4QXPA 3MD9A 5BV2P 4XCQA 3TZBA 2O3RA 3HSYA 2XECA 3OJXA 5J2UB 3V3KA 3A1WA 3AW8A 1PWZA 1P5JA 1EM8A 1KI4A 2HLDD 5H68A 4K6CA 5B64A 4QM7A 1TKAA 4PYNA 5GM2A 1QSGA 4OFZA 1XTRA 3CXUA 4JP3A 3VPGA 2XVXA 1JV2B 3SC3A 4DZZA 1J9ZA 2VXOA 3EIQA 3OX3A 4G0OA 4IJQA 2PPVA 5FUWA 3TAXA 4A15A 4Y3UA 1XFDA 2BMFA 1N4AA 6NULA 3LV8A 5K3FB 3O5AA 2XXJA 1BE8A 2G3YA 5KJEA 5AT1A 2X22A 1QIJA 3AHGA 2ZTHA 1M0WA 3INYA 1FFSA 4HQRA 4MA4A 3TO5A 5KWVA 3EX7C 2QRNA 3JQBC 4QGAA 5SZKB 1W5AA 4ZAYA 4Q1EA 5EWJB 1WF3A 4RESA 2AUMA 1SCUA 3LYHA 3MYYA 4UHFA 4CDNA 3AR5A 1IZ9A 3KT8A 5HCIA 3KXKA 3VJMA 4ED9A 4D3ZA 4RXUA 1J6UA 5E1BA 3ZDFA 4E30A 2XIQA 1P2VA 1T5HX 4K9KA 2BM0A 4DRXA 5F33A 1KRWA 4B8WA 5DRTA 1W34A 3GR6A 2ADMA 3H4VA 1Z2EA 1IVYA 3VBCA 1RRVA 4D4LA 2V0GA 5C0OE 2ZYGA 2O5VA 2R8XA 5FL3A 3TZCA 4HT3B 5KNCH 4WOJA 5A2QA 4DV5B 3KEQA 3THXB 3IXMA 2WWVD 5AK0A 4W99A 3ONWA 4MWCA 2IYXA 3UIEA 1YE8A 2PVSA 4D56A 3ISJA 1VJ1A 3H4MA 4L5BA 4JI4B 1JR6A 1ID8A 2GJSA 2I54A 4Q6WA 4BVGA 3JASB 4B84A 5HHTA 2HA7A 4NARA 4K0RA 2IBMA 2NO1A 2O1XA 4YRIA 1YR8A 1TNDA 2OUKA 2VNIA 4LJ5A 1IL0A 4ON9A 4N7MA 1GLNA 2W6JA 3RSSA 2GNAA 2ZT6A 1DAEA 2WSSA 4MDEA 2F1KA 4J6FA 4PX5A 3CZAA 5DHPA 3ND8A 5HK9A 3SQWA 3F8SA 3KHSA 3KJXA 1TIPA 4BPBA 2HWUA 1AZLA 1FSSA 5K0JA 1XJWA 2I87A 1HDYA 3WLKX 2ZRAA 2W93A 1QHSA 1XCLA 2WJYA 3K1AB 1KI6A 2NPOA 4XVQA 5GOTA 1IATA 4O2AB 5IAKA 4FW9A 5B7NA 1NQUA 4RQBA 4PO8A 4DV2B 1T6NA 5F7OA 3VU9B 1ZH0A 4CZ2A 1ND6A 3DOHA 1R4ZA 1XP5A 2VBGA 4U2KA 1KEKA 4AK9A 3OETA 4HLUA 3RC1A 3QUQA 4WLNA 3C1AA 3LA8A 4OB7A 2IJGX 2R97A 3CE9A 5CFOA 2F3RA 1I2CA 1QJCA 4E2YA 4QPPA 5CH5A 4LTNA 5GZ6A 3P9RA 1DOAA 4U2BA 3G1WA 2V6IA 4KRXA 3IKLA 1O97C 3KV1A 4N3CA 5BORA 1E3LA 3CTPA 4PLYA 2ECQA 1J20A 1TYEB 2FOLA 4YMWA 3OPVA 4TKVB 1BU8A 3LL4A 3AW9A 5HJ7A 3CRZA 2CC2A 2EJTA 3R5SA 3SHQA 4MYUA 1QZ3A 3DHVA 4TM7A 4WECA 1M5RA 4CV0A 1P9NA 1BDHA 5JCPA 3GGCA 2VHVA 1MJGA 3F2VA 1Y1PA 4OQLA 1E3DA 3D6FA 4BNIA 3FI0A 1JB1A 3GUZA 4KUHA 3A6DA 4UMDA 1PR9A 5IZCA 2I9PA 3GMSA 4QXAA 5CXUA 1EFDN 4J0KA 3WRXC 5HKKA 3BD6A 1GSHA 3KAQA 1CS0A 2GILA 3D2LA 3GZNB 3RM3A 3Q7IA 2WG1A 2E87A 4YK7A 2AJCA 1ZJ4A 2C7OA 3C7CB 3EWIA 1JAZA 4UMVA 4C3UA 2H51A 3H04A 5ENDA 5K0LA 4DRZA 5EVCA 3S40A 1B0AA 2A0KA 3A4TA 5CT5A 1BWPA 2NUPA 4CIVA 5K8TA 3AI3A 3W5DA 1I3OA 4P86A 3WV4A 5C5IA 1GT91 3DO6A 3JVUA 3JVVA 2Y4OA 5LWHA 2HCTA 1ZBQA 3STWA 4O59O 3PKZA 1A9SA 5THKA 4G4IA 4J91A 1FVHA 5CAEA 2WSIA 2LUOA 3BJEA 1ZY2A 5LDDC 4FGUA 2FQQA 4BO2A 1IXYA 2QBYA 2H1VA 3NNDA 1OIVA 9GPBA 2C5HA 2VUHB 4MR9A 4RCYA 4ER0A 2OV3A 1N75A 2GCOB 4HB2A 2QD3A 3AETA 2G1JA 3VKHA 4Q24A 4BWYA 3OIGA 3LOPA 4IH9A 1D1SA 3SNKA 2R9VA 2PBZA 3VC3A 5A4AA 3H9UA 4IHAA 1P3DA 4DT1B 4AJ4A 3KQNA 1KWKA 5AVJA 1FX1A 1N5KA 5JFGA 1OXVA 1H4TA 1S3IA 2HA4A 2DX7A 2O3JA 4R8LA 4RETA 2QN6A 2Y9PB 2BFCB 1M2KA 4Q4AA 3R7BA 1E2BA 2OCKA 4IV0A 3O74A 4PN3A 4ISBA 1RQNA 5KNBD 1A71A 3D8RA 3ZTYA 2IXBA 4DR5B 5EJ4A 4DIKA 3BGDA 3I53A 4FB4A 2GJ8A 2QMYA 3IAM6 1A9XB 3T3IA 2B5WA 1GP2A 4RQAA 1MJHA 2EWWA 4F91B 5KTKA 2IU6A 5TQ0B 4KQGA 4J16C 4M9SA 4DUPA 4IKEA 3ZTTA 3B3AA 1DPFA 3V5NA 4RK5A 3MHPA 3RIGA 1XEXA 1LBQA 3DWFA 4HDNA 4IMIB 1WCWA 4HEHA 4O5AA 4WX2B 2JLRA 2R48A 3UT5A 4LF5B 4EHFA 3OF3A 5EJ5A 4IOLA 4IO1A 1M67A 1PBNA 5B53A 3TR6A 5CEEA 5K20A 1Y5LA 4YX9A 1N1GA 3FDZB 1WVGA 2A67A 5HRCA 5IT4A 1KY2A 4HX2A 1TU4A 1J99A 2OHVA 5AR1A 4ZGWA 5JS7A 4ZP1A 4EF4A 5GP1A 1IMOA 1BJKA 2D7CA 2J0SA 3EHDA 1BKSB 1YIAA 2PKRA 3MWLA 3OOWA 4ZK2A 4LZPA 1XMJA 1GG9A 1QHHA 1SCUB 4KRYA 2WIDA 3EQ8A 5AJWA 3WIVA 2Z1NA 2CYBA 1GRCA 2JI7A 4XQ9A 5TIIA 2VHCA 3O2SB 4E5MA 2QM0A 4IJMA 5E2IA 3ROMA 2B92A 3R0XA 3WLJA 1SG0A 1QONA 3WA6A 1UH5A 1JYEA 1RQGA 1JIUA 2COUA 2V9PA 2NUAB 2QHXA 3IMEA 3L7JA 3P9IA 2VL7A 3IULA 4FT4A 4DV1B 1CHNA 2YRFA 4R83A 1Z5WA 4HAZA 2PKQO 4RHCA 5IX8A 1MAAA 2ROQA 4AZ0A 2VJKA 3MJFA 3F46A 3HJRA 1NBME 3VVLA 1QQ6A 1T2FA 4E03A 1R6UA 2ARKA 1DELA 3L3BA 1ADCA 4Q5IA 1M8GA 1UXHA 1XDBA 1ZCBA 2OWDA 2VPXA 3OY2A 4GOKA 4OH7A 3MMZA 1M8PA 3EAQA 5EE0A 3VUEA 3WX0A 2ZZKA 5KKNB 2OKGA 4M0DA 5K3EA 2KB0A 3NHLA 3H11A 3TLJA 4O02B 4PNEA 1G0OA 4YXWA 4KX3A 3SFVA 5I7SA 2VBIA 3ZLUA 3KXDA 2VP3A 3E9MA 2EJUA 1M6VB 4NCKA 3DEYX 4UBMA 3UFXA 3ZBTA 4JLSA 1GPAA 1Q7CA 2CNWA 3RABA 3STTA 4R7TA 3WDSA 2ZYAA 1GKYA 1DWUA 1EGMB 2CF6A 5EA2A 1SZDA 1P4SA 2I9KA 2PWZA 3AEYA 4C7JA 1ZRSA 1EHCA 5GAJA 2G83A 4RD4A 1J8MF 2B99A 4RVGA 1I1NA 2R65A 1HSOA 2X8WA 3L7LA 4MULA 4QDOA 1N2XA 4A0RA 1VLMA 3QBVA 4MWZA 2WF8A 4XI9A 3DNMA 4RCZA 1P3JA 3R4CA 1E2FA 4UZEA 3FPAA 3A3PA 3IJEB 1B0UA 3V8RA 4BMPB 3KG2A 1E7SA 3LF1A 3JD0A 1GR0A 4IDCA 3UHPA 4YRMA 4TROA 3CZRA 4B3FX 1TM4E 2BWJA 4N8EA 5EAIA 3GCZA 1W6RA 4MUXA 4A3SA 2Y92A 2UUOA 2GYVA 3DBRB 1SCKA 4LBZA 4E5SA 1W96A 4B9EA 5JNVA 4FFVA 3WLAA 2R1ZA 4B4OA 1DXHA 3KYIB 1BX0A 5B1EA 1IFXA 1VSQA 2IEYA 3DL2A 1R6VA 3KVYA 3PUIA 1GA4A 3P5BA 4MVJA 4XPIB 4ENPA 2MYNA 3IQWA 4GM4A 1EXNA 3COYA 4RLFA 2B1JA 4H7FA 3TD9A 1VKJA 3MWKA 1NASA 3PITA 1SVSA 3T7AA 4U8HA 1RHJA 3L84A 1E60A 2PAFA 1ILWA 3LT4A 2BGIA 1J9EA 2XE8A 1VECA 3EF1A 3JPYA 4Y6GB 3GCXA 4P54A 2FEWB 1MEOA 2CN1A 4YV0A 1I0IA 3DSRA 3BRWD 3CH6A 4FWIB 5GV8A 4FFBA 1YIOA 4FYXA 3S99A 4BJHB 1YCHA 1ODFA 2IIQA 1RD4A 2WM3A 2AMFA 3NC4A 3EZYA 3RYCB 5L6LB 4TLEA 2VTBA 1EYZA 4M1TA 2XTMA 2GQ0A 1E4OA 2IUSA 2Z57A 3Q7PA 2V8BA 3P19A 4IFEA 5EXSA 3HY4A 3R5JA 4AC9A 1EVJA 2VCYA 1IZ0A 1ZXBA 4BBJA 3HLYA 4GMHA 2JASA 5I7HA 1DJPA 1C9YA 2G80A 1JSZA 2BJVA 2X1LA 3EWSA 3LCCA 2Z0MA 1W5SA 1TE2A 2H48A 1BMTA 2MR5A 4YT5A 5ALYA 4OGGA 3DW1X 3T5PA 2Z3ZA 4I46A 1IHXA 2I3ZA 1H8ED 1KZ6A 4LEIA 2C8KA 4K9QA 2I33A 1T34A 2X9LA 2D62A 5TPWB 5C37A 1G9TA 2F2TA 1GGNA 4WSOA 2PSJA 1X1CA 2VZ8A 3CRRA 4L3WA 4IJWA 5HR5A 5HRAA 5JNLA 3SYMA 1CEXA 3WGYA 3MWGA 4NMWA 3ZQ6A 2H8KA 1GYPA 3HMKA 2I65A 3TQFA 4NBUA 1G9XA 4PC6A 4L78A 2BGJA 1IJBA 2XRMA 2RK3A 3Q11A 1JSRA 4CCSA 1PF7E 1H2HA 2PWAA 2YS7A 1WXWA 3PFHA 1U99A 4RF2A 4ZEOA 1CVIA 1N0UA 1IZZA 1L4HA 1XTKA 2XYQA 4NCIA 3N2IA 3H9EO 3G0GA 1NZJA 4DLUA 5JO0A 5AKEA 2ZBQA 3NTOA 3AR4A 4ZDKA 4C5AA 4ZDIA 4YRDA 3DFKA 3MSCA 4U7TB 1U2SA 2X23A 2R6JA 1OZAA 4LISA 1Q0TA 2MSKA 3R9XB 1MU0A 3W2IA 3NDJA 3FOZA 2WHEA 4TSRA 3RYCA 3UB3A 2XKKA 3P9PA 4DC0A 1CQXA 1OLOA 2Y1KA 3FWNA 4GPBA 4QJ5A 1SXPA 2PX4A 5CA1B 1U31A 1CR4A 1H0RA 1W19A 4I9UA 3L5OA 3LGSA 4GXNA 4OSPA 4XR9A 1F2UB 3IIEA 2J59A 4ETNA 1XYYA 2IYUA 2GD2A 3H1FA 1DQNA 2C1XA 1X42A 2DUWA 3FHJA 2ODPA 3QF7A 1E1YA 4P3PA 5LQNA 1EK5A 2ONZA 3HXPA 3RT9A 1ODCA 2X0DA 1J8YF 4TTRA 1IU9A 1N2ZA 3WNQA 3JYNA 4BDTA 3BXZA 3CMMA 4JJAA 1P44A 4OLBA 4PQFA 1S8OA 2VS1A 1XZIA 2BZGA 3NHRA 2CXPA 1K4YA 4HAXA 3TRFA 2PFKA 3UOWA 2FDRA 1QYCA 1X1TA 2JVIA 5ENVA 4GI5A 5JEEA 4Q1FA 3FDIA 4I55F 5CT4A 5JSKA 4B79A 2O54A 4G5OA 1S3FA 3JALB 1EEHA 4WN9A 3VDXA 5MFZA 3G2JA 1GPYA 4L0MA 4ND5A 2WT4A 1S6YA 4Y2QA 3P2KA 4E7OA 1JDBB 1TECE 3DFZA 1YBVA 4NULA 1KK2A 1NI5A 2GAIA 5CDYA 2H5IA 2AEEA 1PJTA 3C98A 5EIXA 1YR1A 1AURA 3IAUA 3ZZ0A 5I45A 2OXTA 2J6BA 1CRWG 3MB5A 4YONB 5KYYB 1NWCA 1LY1A 1JBEA 1ZI8A 2H31A 4QULA 1DSSG 2ZPTX 3EIWA 2YXNA 1FU7A 1DLJA 3ILHA 3ON5A 5BYBA 3RTGA 5CDHA 3WK6A 2HSGA 1EWTA 3QOXA 4Y2PA 3QU7A 1LQUA 4B34A 1Y8RA 1T36A 2P41A 1ZRMA 4QDKA 1HF3A 1OIXA 1QP8A 4KSBA 3IFSA 3PHLA 3U4HA 3DXYA 4GOJA 4M76B 3BWMA 3JATA 2HK7A 2H7YA 3A4MA 3F78A 4R9RA 3ZR4B 5M7EA 4JFAA 4GE3A 3EQ2A 5I7UA 1SXQA 5K3SA 3STHA 4MLZA 1I6MA 1B1CA 2X7JA 2ATXA 1TTQB 2FQXA 1KI3A 2G82A 4WQMA 3R7LA 2P4QA 4C7MA 5HM8A 3I61A 5M34A 5DU2A 5MHTA 4QVKA 2QVYX 1OBHA 3H7IA 2PCLA 4A1FA 5BQ5A 2QJRA 4NESA 4M3NA 2I6TA 4PG7A 1RLOA 4P98A 3RODA 2PZKA 3DMNA 3CT4A 4HH0A 1Q50A 1U9IC 3SYNA 1DU4A 3BK2A 5LFAA 3EMDA 4GI2A 1WXEA 4YIHA 1U2DA 5IDYA 2QF7A 2XB9A 3FUTA 3HHEA 3IAS1 1PEKE 2JFHA 4QEDA 2PHZA 1U1IA 2PY6A 4ETWA 1PKEA 3BF8A 3OPXA 2C1EA 1VE9A 3R5HA 3BC1A 3BEDA 4FXOA 4EG7A 3ZCTA 4PU0A 2WVHA 5FUMA 2GPJA 4ARCA 3F5DA 1QOZA 4C7KA 1DAMA 4J7CA 3NVKI 3LPCA 4FYIA 4B73A 2DSNA 1NW6A 1R5JA 1Z68A 1F9AA 1EFPA 4BO0A 4FMDB 2D0PB 3UJBA 1BOFA 3AUXA 3KVRA 9MHTA 1DGQA 1I13A 4ZOLB 5H70A 3U7FB 3GG9A 1IN6A 1GYQA 5FI5A 4RTLA 1GAEO 2RHLA 3AB7A 3OLZA 5A5GA 1I80A 1QVWA 4CKWA 3AONB 4K9OA 3PX7A 1C9EA 4IMRA 5K4AA 5A4MS 4TLBA 3PS9A 2YKGA 4FQ7A 4B2LA 5I4CA 3SVLA 4MQ5A 4TSFD 4D5EA 1L7NA 2R1TA 2CUTA 2YC2C 3E5MA 2JCBA 1VB3A 5DI3B 2QZJA 4I8XA 4WBNA 4GPIB 3W78A 1KFBB 4PPGA 2WD7B 4IQGA 1GN8A 3RU7A 5CLLA 3A6FA 3D81A 2B98A 1RZUA 2BONA 4HC4A 3WIUA 4BYGA 2FSSA 2PLRA 1NX6A 3TDNA 4F3NA 2H2WA 3DB1A 4UTRA 1D3AA 3RAGA 4JLDA 4NYJR 1FOEB 1AV6A 3SQDA 1PU2A 2XMBA 4MICA 1D6JA 2AC2A 3D8SA 3G0IA 3NO4A 1DC8A 2ZXEA 3JAWA 1C3XA 3Q9LA 1WXHA 5E8JA 1JSCA 1PNQA 2RGAA 3ANNA 4ICIA 2FK7A 3LUFA 4M8NE 1MC8A 1W0KA 5JD6A 2PMBA 2AJDA 4X6LA 4I5DA 1EVLA 2HHAA 3P96A 3VKUA 4JNCA 4O29A 1REQA 3M6IA 4IICA 3GJQA 2BFOA 4O2BA 3G1TA 4Q3CA 3Q8MA 3DV2A 4I7EA 2GDZA 4QFMA 2VDKB 2Q7OE 3GK3A 4HN4B 4JP8A 1PTKA 3FBWA 2VWHA 4X8OA 5BVHA 1W47A 3DG9A 4KDEA 4RV9A 1N6NA 5J4KA 4HRAA 5KVAA 1JEYB 2HM7A 2HKIA 1U9ZA 4B45A 4N76A 3L2OB 2JH3A 3JQAB 1Z0AA 3NEPX 4UTXA 3REFA 2EF0A 4MW4A 3AT1A 2YY7A 4CUZA 1NAHA 5FDFA 1Z4IA 2Q3HA 2IITA 3DONA 3ADDA 2YIMA 2PXHA 2P6OA 5AKYA 2R85A 2R2GA 5JCOC 2P6RA 2QRLA 4ALNA 2AJ8A 3JYOA 4QPDA 2BUBA 3QU2A 3NJ4A 5D7NA 3WNBA 4NE7A 1VKHA 3DZBA 3WGKA 4QJIA 3HJNA 4CKEA 4AJJA 1Y8ZA 4XWOA 1F51E 1V5GA 4FNAA 1SQ6A 3TL3A 5HQ3B 1PR0A 3G3EA 3EA0A 4G5FA 5DWVA 2UYCA 2XZPA 4JELA 5LB2A 1N6IA 3HM2A 2QGFA 1RWVA 3UJAA 4LJAA 4QLOA 2DFPA 2HQ1A 1XTUA 3BX1A 4LOJA 6GPBA 4Y2YA 1OU4A 1RZVA 1G8PA 2DKOA 2L82A 3FPLA 5JY6A 4FIZA 3M83A 4HPJB 2MSWA 3BSFA 3MTGA 1SCNE 1UBGA 1EP1B 4IGIA 3CS3A 3N58A 3T4EA 2X0KA 1Y48E 1OH7A 1AQLA 3ZWVA 2B25A 1G1MA 2OAGA 3D3JA 4IV5A 4YC7A 2IPLA 1DINA 1FNMA 1YZHA 1ZRNA 2JCYA 3L40A 1M73E 3GZTB 2Y68A 3QENA 3IBYA 4ND1A 3T41A 4B7ZA 5AM2A 1CP3A 1Z82A 3W8FA 2PO5A 3RFFA 2Z9CA 1A8IA 2CSXA 4P0TA 4QYTA 1QS0A 2W11A 2WJ4A 4BZXA 4ZFNA 4C76A 4LDNA 5JDCA 3A6GA 1WMAA 4WINA 2Y93A 3SC2A 4IWNA 2ZIVB 1N2BA 3DDSA 3MILA 4Q9KA 3RU3A 5A1TA 3W3AA 2BE7A 3TEFA 3CNHA 1E2IA 3D5EA 1XAGA 4NCHA 5A9RA 5HFAA 1DBRA 3O1HB 2J46A 3OZEA 4P2GA 3F74A 9ATCA 3ZHZA 3CF4A 4R1QA 5TMPA 1FVOA 2G8LA 4LGVA 2APJA 4RDXA 4OJTA 1G4AE 5B7GA 3KLPX 4MW2A 1J42A 2XLCA 4ARUA 1RQ2A 5LU8A 3DMYA 2GXQA 4DYHA 4IUYA 4JYBA 4U2FA 1MVOA 1OFIA 1Y89A 3H1PA 3JXEA 4WERA 4EVIA 4PAQA 4K81B 3VU1A 5K7SA 2R47A 4DV7B 2X9GA 5JIBA 3B48A 3U09A 3GCDA 2XITA 1VC2A 3BFKA 1OI2A 5JH7F 1O0CA 1DEOA 1LRKA 4V39A 3IUNA 3DUFB 3L8ZA 2MT9A 3TQSA 3NTLA 1MX3A 5C81A 3TXYA 4AUNA 1YZYA 4ARSA 1KEEB 5AXAA 4DG5A 4QU5A 3PLRA 2C0CA 2P6NA 2VAVA 1FJ2A 2XDQB 2XT6A 3FMOB 4MJLA 2IS1A 1WULS 1GZUA 2QJFA 2QX6A 3HV0A 2ERCA 2QQEA 3HWX1 2ODTX 3DWIA 3G2QA 1IWPB 5E4JA 5A9SB 4X60A 1HDZA 3PUZA 2D0DA 2DEUA 1J8QA 2HRQA 4JQOA 1V11B 1I7SB 3SXUA 5A4DA 1D4AA 4XQGA 3H9QA 1UMCA 2AVDA 2PYDA 3MSXA 1EXMA 5TY0A 4YRSA 2QYHA 4B40A 2Z04A 3FMIA 4EFNA 1O54A 2W70A 4BEBA 5JNUA 1YAHA 5ELMA 3FHOA 3H17A 4JI1B 1ORWA 4WPGA 3VI3B 1V4VA 3LX8A 4W1QA 1PFVA 1TTPB 1K3UB 4XQEA 2EYUA 3VH4A 4BMVA 3VJRA 2QZZA 4I6EA 2RC5A 4X91A 2SKEA 2YWBA 2GPYA 4RJKA 3SYTA 4RMIA 4XKJA 3VR2A 3HXMA 1IHUA 2IGBA 3GD7A 4XIYA 3S2SA 1WBBA 3WL7A 4L7VA 1CUYA 1GUAA 2BFCA 2P9TA 3C7TA 3G8CA 3KQKA 2P9BA 1M6HA 4ILKA 1PJRA 4FEEA 3DP9A 4M9CA 4EY3A 5AVWA 5ELLA 4W4TA 2C4MA 1LD3A 1VBKA 3MTJA 1QTIA 4NAVA 4IQ4A 2PEZA 3OJFA 4X1IB 3ZEAA 4RADA 1V4BA 1XGKA 4FHDA 1WNFA 3RK1A 2I7VA 3RC7A 2RGNA 2DU8A 1K68A 4M86A 5LA6F 2RMKA 1O1YA 5KUTA 1PCXA 1QTNA 2V96A 4RA9B 4OXQA 4ERNA 1DEXA 1GWNA 1Q7RA 5FX2A 1M1YB 5KS2A 1SU8A 4HWGA 4R3WA 2CXRA 3QWAA 3E2PA 2NXJA 3G9XA 4HH3C 3ZD9A 3QKRA 4HN2A 2AXPA 1CY2A 2VRNA 4L6CA 5E7QA 1THMA 1Z5NA 2AQKA 5DIFA 3IHKA 2BT4A 2H4FA 4MINA 3E1SA 2O8CA 4FZRA 3KPVA 1L8LA 3N6RA 1SA0A 3WIDA 3BOSA 3ZCVA 4EO7A 1NP3A 1CCWA 3ETGA 4XFJA 2VNSA 4CIWA 5FLEX 1PL6A 3Q40A 4KIGA 4NHOA 4BE4A 4E4TA 4ARZB 2FSVA 1I4LD 1JA1A 4FC6A 2DQYA 2CVOA 2O2EA 3VOBA 4J7XA 5IJ0A 5LDHA 1I9CA 1QF9A 4KO4S 4RY0A 3W1WA 2XUQA 3I28A 2MWMA 3R5KA 3WWEA 4CKCB 5ECWA 3GJ3A 3MPOA 4X92A 5GQSA 2OOKA 1MTZA 5FV4A 4AY3A 1SZCA 1B2LA 4LHSA 5A5EA 4U9HS 4QSHA 2H9IA 4I1OA 1QQTA 2O5RA 1KMNA 4K9DA 4BS9A 2W2LD 1OT5A 2QW1A 3OLQA 3UGTA 5IM4F 4WESB 3T99A 1ZAYA 1E1CA 3ILSA 3W5JA 3B70A 3RRYA 3ZQKA 1VCIA 3LQQA 4Q7MB 1AF4A 1YR2A 3EY9A 4GVXA 2XNSA 1YFZA 4Q48A 1W5BA 3CJRA 3QK7A 1H3NA 1OA1A 3BWDD 5IPFA 1C1XB 5F2KA 1VHLA 4A4DA 1QCDA 3IALA 3GJZA 3N76A 4KKVA 1ST2A 2EGUA 1BXKA 2WWHA 3PEUA 5JCOA 4OHYA 1UKCA 4ZT4A 1FFWA 1GRQA 4PGFA 5EP3A 5KYGA 4KR6A 4LCJA 2CL7X 3MTEA 5LXTF 2IQ5A 4RENA 3KOWA 4B5KA 3TDMA 4WT7A 3ZN2A 5JXGA 2PMCA 1ZNXA 1OXTA 3CWZA 4TMZA 4LJ8A 4F4UA 4F56A 3KZCA 1P2GA 5M5BA 3LQ1A 5KWJA 2A5DA 4RY9A 4D2IA 2ZB7A 3MINB 2PX5A 2UXCB 2Y0DA 5FH9A 2VWQA 3ZGXA 2V45A 2B21A 2Z5FA 4UBJA 1E79A 2YWFA 2PLWA 5KX5A 4DR7B 2AI2A 4JL5A 3OLYA 3RSHA 3HTXA 4FZJA 1NVVQ 3HCOA 3ZHBA 2MSCB 1E61A 1L7BA 4PLCA 3SXUB 2JGDB 2QTRA 4LPSA 5HVNA 4WK4B 1X80B 4G07A 3NWPA 5EIBD 1YR7A 2IYEA 4OK5A 4I4NA 4ROTA 3WGTA 1JR2A 3ZGNA 5LJLA 1KQGA 4ENVA 2GHTA 3GMIA 3T3GA 3OEED 2VDWB 3IPCA 3Q2OA 3WHLA 5IK2D 5LZ8A 1WHSB 2E9SA 1CQIB 1X8XA 2OCLA 2PBLA 2R8YA 3VR5H 4C0HA 4F5DA 3THWA 2G5TA 1T6BY 1L0BA 1KEEA 3GBPA 16PKA 3OFJA 1K75A 4KMSA 1B3RA 1TL7C 3GNLA 5E9QA 4BGDA 5TV2A 2ZYVX 1XOIA 4LZLA 1I4OA 1XRSB 4PICA 4B33A 4RJIA 3SR4A 4EG5A 5HF6A 2IOQA 1J39A 1T8UA 4N82A 3OZFA 5C1DA 3F47A 6ADHA 3B82A 3L46A 1OX5A 3HZOA 3HVUA 1L6IA 1U7TA 2D8MA 4L57A 3OURA 2EJCA 3DVAA 5B5SA 1JMKC 4JUAA 4W9MC 2N1BA 3GEPA 3PIDA 1D8AA 4G1FA 4LRXA 4BLVA 1K6JA 3PHCA 2YVAA 5IJ9A 3HBFA 4JP5A 2ON6A 1P5FA 2LV8A 2HU5A 4JHXA 3UUWA 2OBMA 2RGGA 3AFOA 4RPCA 4MGEA 5HEKA 1KMHA 2HWXA 1OX6A 1YBFA 4F6LA 1AKTA 5I7FA 4K6MA 2G07A 1OMOA 3EEFA 3S2IA 1DAGA 1G0NA 3AF6A 4F45A 5BVHB 2VHUA 3A4VA 7YASA 4D45A 1J7JA 1KXJA 1DC6A 4Y9TA 1XA0A 3VJKA 1HZZA 4LFBB 4C2AA 2D5BA 4D02A 2XGGA 2FDCA 4DIOA 1JPNA 4LXHA 4MVJG 1NYTA 1EFVB 3FYSA 3GHYA 3PHGA 2X1VA 3PYXA 4Z9BA 2DULA 4X7BA 1A5TA 1RADA 3GJ4A 3ZVMA 2PMFA 4JLOA 4BO4A 2NGRA 1C14A 1D2NA 5DNWA 1MB0A 2Q6VA 3PPXA 1GU0A 4K03A 4DBLE 3ADPA 4C14A 2AJBA 1Z26A 4PAGA 4UE3S 3EVFA 2M9MA 4LDQA 2HFJA 5BSTA 1Q6YA 4O63O 4DM4A 3GDGA 4CR8A 3UH0A 3UYLA 1L4LA 1T13A 3LCUA 4LWZA 3TECE 1H65A 2XGOA 4EJ2A 3FVQA 3Q8WA 1BWSA 2X9QA 4LC9A 2Q5OA 4WBSA 2B69A 2CXOA 2GTHA 4B6GA 5A2GA 1OTYA 4EA9A 1AKRA 1GG2A 3OUZA 5GVSA 5KTRA 5DNAA 4Y7DA 1G6Q1 4MRVA 3AIIA 1BE6A 4ABTA 1Z75A 3UJHA 5CNMA 4G9GA 4N40A 1JA9A 4ZQFA 1VMDA 2VTKA 4B81A 4JXJA 3BHJA 4OJKA 1OB5A 3G0HA 2VF8A 4GFDA 3NP9A 3RG8A 3JAKB 1CZHA 3FAZA 3N28A 3LKZA 3P8ZA 3CCCA 4JP2A 4LZNA 4OB8A 3SZUA 1TAUA 2P8JA 2DTEA 2FFJA 2O6HA 2OC9A 1HO3A 2YVUA 4UEOA 2O14A 4UUQA 1Y4UA 3ZIDA 4L4RA 3NHZA 5K4GA 1Z0IA 1RXWA 3K1ZA 3UZUA 3UMBA 4KNVA 5LU9A 2C8VA 3ZDAA 2RHWA 4FE7A 1P33A 3RARA 1UDCA 3IMKA 3NXSA 2A9VA 1K86A 1K7EB 1NQOA 1PJBA 2ZVDA 4MUYA 5KX5F 1CULC 1MO2A 1Z6TA 2Z1MA 4RELA 1O96B 4EI2A 5I3CA 2O8EA 2NT4A 5LZ9A 1HDOA 4OQYA 1N6RA 9ABPA 2QTHA 2ZI6A 4JFRA 1XAJA 4EQ6B 1Z6ZA 1J21A 1FQWA 3C39A 2BZ0A 3A37A 5FHRA 2RH4A 2A5FA 4KKXB 2QGZA 1J00A 2ZQYA 2QQGA 4L8YA 1QG2A 1O2DA 4WXHA 4TXLA 5BN5A 3EIOA 2PRYA 4KQMA 4IYRA 4U7GA 1I0ZA 2A9FA 2C3YA 1USKA 3KVNA 3RR2A 3BA1A 3ILXA 4PWZA 2ZE6A 4MGHA 5F4ZA 2F8SA 3MXTA 4PRLA 4BO3A 4J7UA 2C2GA 3KQTA 5BUQA 4DWVA 3ROQA 1MIOA 2MU1A 3BICA 5A3JA 1JFRA 3L1JA 4DDHA 2GYWA 4X94A 1RBMA 1EK0A 1DARA 1OVGA 4FINA 5ARDA 2HJHA 2SCUA 5A3QA 2WD7A 1ZOIA 4I50F 3ANMA 3CG0A 4LY9A 4R1PA 3VC1A 3WWYA 3RHZA 5LM3A 3JWIA 3P32A 4DB2A 1F0NA 3DMHA 1B0ZA 2OD2A 2ES4A 3K0HA 5EKXA 3RVJA 3T3MB 4CMEC 1U1EA 4KO1S 3C0KA 1QV7A 1QYIA 2AFRA 5AKXA 1ETUA 1WL8A 3FGNA 3HUDA 1GO2A 4MW1A 1X7XA 3IS3A 5ERYA 4A8PA 4L15A 3TFQA 1TVKB 4ZT2A 1XDZA 3T4XA 4DJJA 4JDPA 2WSBA 1IYZA 1X3SA 5AI0A 1L5QA 3GJ0A 3SJCA 4Q3EA 3AFIA 2BSXA 4FOOA 3JQEA 4CG3A 5AXBA 3NKLA 2FWIA 2PQMA 1YI1A 4ZZ0A 2R1VA 3NTQA 5TJHA 4QWMA 2NVUA 5BT8A 2I2BA 3IHLA 5A9TA 2RC6A 1NE7A 1ZCJA 2NYAA 4RAQA 3R3WA 3TLGA 4DMMA 2Q9AA 1JDBC 3FWZA 4JLMA 1GAQA 4WJZA 1Z37A 4QJ4A 2DPXA 1Q3KA 5BR1A 1P7YA 5CVUA 2H11A 4MS4B 4I50B 4AB1A 2GAAA 2J31A 2CXNA 5EQDA 3LW8A 3IDQA 1RXYA 1NRIA 4UNQA 2C96A 4ZOCA 2NTVA 3K2EA 1BGVA 4U2EA 1T24A 1KZHA 5BSUA 1KXZA 1SM4A 2ORVA 3TG2A 4ZIRB 3WYCA 3AB3A 4OFWA 1WTCA 1DZ3A 3AUAA 2BSAA 3IUYA 2GF9A 4Q18A 3L6BA 3OY7A 3OVMA 4TN5A 2XWJI 1K9VF 1YJXA 4TQUS 1IG0A 2HUPA 4EUSA 3UXHA 1ZR4A 1GQYA 3IBCA 2EWMA 2Q5QA 2IZ5A 2JZNA 4AUEA 1SIUA 1KDPA 2XZDA 2TS1A 4D79A 4B85A 4EB3A 4TGLA 4KR9A 4GL4A 4YBRA 4C6HA 1N0VC 2DR2A 1M7BA 3K0AA 3AVPA 4DLBA 2QZ4A 5JAPA 2C99A 1ULAA 4MMXB 1UKAA 4L4XA 1RWWA 4AZSA 5KNCD 1SKQA 1UMBA 2WMDA 1DS6A 1M2GA 1YCGA 1YGPA 2XT0A 5DMXA 4GOXA 3SBXA 3WWCA 4C7XA 3V8BA 5IDXA 1VBMA 1R8SA 2BGMA 3JWHA 2ZJ3A 3RUIA 2IY8A 2R6CA 4MV6A 2IS2A 2V0CA 4QYSA 4N12A 4QPJC 3RWOA 3M1AA 3PXUA 3U5TA 3DLHA 2IWRA 1KZ7B 4L95C 2PAAA 5DNCA 3EGOA 1P7CA 5AK3A 4CF4A 5BSEA 2PA0A 4Q3NA 5HF8A 4KH1A 5E3JA 2VIIA 1UM9B 5F1KA 2H57A 2VH2A 3AR7A 1GPMA 3VR6H 5EQJB 1YI8A 4UE2A 1KK0A 3IUPA 3OEEA 3A6EA 4WW0A 2YV4A 1MIHA 1NXXA 2JGAA 4Y2RA 4E88A 5CFLA 1E7YA 4BV2A 3IOYA 3TG8A 3GU3A 4G56A 3OJWA 2ACKA 1RC1A 4BV9A 5I6DA 3E8SA 4HDCA 2R6AA 4Q7KA 2WC1A 5ESXA 3ZNNA 1ZN2A 4NKRA