3S2ZA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with caffeic acid
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An inserted alpha/beta subdomain shapes the catalytic pocket of Lactobacillus johnsonii cinnamoyl esterase.
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
molecule keywords Cinnamoyl esterase
total genus 88
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s2zA00
4J0HA 3VISA 2H7XA 3DJYA 2RAUA 3PFCA 1PV1A 4HRYA 2QXTA 5AK3A 5A62A 2OGSA 3OM8A 5JAOA 3G7NA 1LZKA 2HRQA 1UK9A 4J0GA 4Y2VA 4PV7A 5EIEA 4PW0A 1QJ4A 3G0IA 2GBIA 2RONA 3KWJA 2GBFA 2QJRA 3GBSA 1DINA 4IHAA 1DWOA 5AIBA 2XQKA 3FSGA 3H2IA 2BUBA 4W1RA 5ALIA 1XZJA 4IH9A 1IVYA 1BU8A 2ZYRA 1N5MA 2WG0A 4D9JA 2WQZA 4J0KA 3GUUA 5CURA 4GI1A 1J06A 4V2IA 3C8HA 3A70A 4GEGA 5SYNA 1XZKA 4ITVA 4U2GA 2XUJA 5ESRA 3FOBA 2BKLA 3ZV7A 4BRSA 3HYSA 1M33A 2PSJA 1A8QA 3ESBA 3KWFA 1P0MA 4PSDA 1X2EA 3AIOA 2VQ6A 3A2LA 5EHXA 3IBTA 1E66A 1LPAB 2XMRA 4MWSA 2QM0A 4BAZA 1MNAA 4C4XA 3VKFA 2AJBA 4A23A 1JKMA 3IA2A 4J03A 3KDAA 3W9BA 5DNUA 4K6GA 3BF7A 3AINA 4BDTA 5LKAA 4YASA 2WLSA 2VT6A 5ALHA 1TK3A 2OCLA 2PM8A 1JJFA 3BL8A 2HA7A 2UZ0A 3E4DA 1FFAA 2CEKA 1EB9A 4S0XA 3CN7A 3U0VA 4J3JA 3HJUA 2JGEA 2HU5A 3HLKA 1T2NA 2QTBA 2B4KA 2ZJ7A 1H2ZA 1TCAA 2WTMA 4H0CA 3WK9A 4XJVA 4X95A 2PX6A 4LIPD 2HA6A 4OD0A 4UPDA 3MUNA 4B9EA 1TCCA 2G63A 3STVA 3HZOA 4Y2YA 3FVRA 1F8UA 1CUCA 2QR5A 1XQVA 1MAAA 1H2WA 4W9RA 3WL6A 4BTVA 2GYWA 1LPPA 2HL6A 4X71A 1ZD4A 1XRRA 1ODSA 1C7IA 3H2KA 3I1IA 4Y2TA 3DOHA 5ALJA 4K6HA 4ROTA 5LIPA 5CXXA 5DJ5A 2WG2A 1XQYA 4OYLA 2BGNA 5JIBA 5AKEA 4TPKA 1IUPA 1CUEA 2X76A 4DM7A 1TQHA 3Q0TA 5BOVA 3PFBA 1L7AA 2WHQA 4OYYA 5CT6A 2V97A 3DEAA 4WFKA 3PDCA 1R4ZA 1YSCA 2XMQA 3GFFA 3HEAA 5ISMA 4N5IX 3DYIA 2PU5A 3C6XA 4JNCA 1R88A 3SC2A 2HA3A 2XMSA 4H7KA 1SOMA 1MTZA 4EY5A 1XLVA 4FFWA 1EVEA 4KE6A 1XZLA 2XUPA 3E0XA 2DQYA 1PFQA 4BTLA 4NZZA 2BAGA 4FTWA 2XLBA 5HCUA 3WZMA 4GLBA 5T4BA 1DWQA 4MJ3A 2JEZA 3H17A 4N5HX 4JYPA 4X6UA 2I78A 5A2GA 1XRPA 2QRUA 2XB6A 1WM1A 2DR0A 1ZGCA 1YCDA 1K63A 4IO0A 2XDWA 1J2EA 3A6ZA 3K2IA 4QLOA 1TIBA 4OU4A 2QXUA 2VSQA 2GBCA 5CBKA 5C7YA 6YASA 1GPLA 2O7VA 1TRHA 3UUEA 1ACJA 1W76A 5AKKA 2XUGA 2OAGA 3FSGD 3AUKA 5AHXA 3I6ZA 1QIMA 5AI4A 1MN6A 4AN1A 5IH7A 3RARA 1JU4A 1CUXA 4FBMA 4JYMA 2AJCA 4GECA 3HC7A 4XWGA 5HQ3A 3H2HA 5HZGA 3OG9A 3YASA 5ALTA 3PF8A 3V1KA 1IUNA 2C4HA 2OGTA 4C4ZA 1R50A 3WJ2A 1NU8A 5HF5A 1MX9A 3IIIA 3DYVA 3VJMA 3BIWA 1XZFA 3AJAA 2EDAA 3DLTA 4UFNA 3QBJA 2ROQA 4N8EA 4CG1A 3C5VA 2VEOA 3RK4A 2YASA 2W6CX 1G4HA 4E15A 4OU5A 5BWBA 4H7FA 4KAAA 4W1PA 2CZQA 1Y7IA 3QVMA 4QZVA 5LZ2A 5K3FB 2QVBA 4BAUA 2WFLA 4DIUA 2WUGA 5E4JA 2HA4A 4UFPA 5A7GA 4C4YA 5K3BA 1LPNA 1WCYA 3EIOA 5JADA 4Q3KA 2X5XA 1WPRA 3A2MA 5FXMA 1CPYA 2XQGA 3R41A 4BCCA 1U4NA 1LLFA 4BB0A 3WKBA 2PUJA 4KE7A 5LP1A 5AM2A 1C7JA 1FFDA 1ODCA 5DWDA 1E3QA 5ALGA 5ALLA 3GELA 3E3AA 3BDVA 5CTAA 1LBTA 5K3AA 1GGVA 5LLSA 4B85A 3R40A 4RE6A 2JIDA 2RIPA 4BP8A 2CUTA 3WK5A 4FKBA 1ZD3A 1MX1A 3O9MA 1QIGA 3D0KA 1FFEA 3B3QA 1BS9A 4J0IA 5CH3A 5JALA 1K6EA 2PBLA 3OURA 3Q8WA 4B80A 1H23A 1QIFA 4YX9A 3LP5A 5K5EA 5DTIA 2WFLB 2XUQA 3R3WA 5T4HA 3QH4A 1SFRA 3RKSA 2XUIA 1NU6A 3WKCA 4QDUA 3H0CA 3STXA 1Y37A 2XQFA 3D3NA 5K3FA 5ALZA 4ARAA 4C87A 3HRHA 5ALKA 4MWTA 4Y2PA 1K4YA 1QIEA 2H1IA 4K5QA 1W75A 4C89A 4U2FA 1UWCA 1VLQA 4G4IA 2R11A 3DKKA 4I4CA 1VZ2A 5JD5A 4AO8A 1E8NA 2AJLI 4Y2UA 5T4EA 2Z3WA 2ES4A 5JD6A 4PNZA 1QO7A 4QE3A 5YASA 2ZSHA 2PSDA 1CVLA 1DT5A 1YA8A 1W4LA 4M0EA 3ILSA 2OQIA 2XQIA 4CCYA 3NOXA 3WIOA 1ZOIA 1YAHA 3DKRA 1RWQA 2CJPA 4LKOA 3D2CA 4X3CA 3WQHA 5IVDA 4RNCA 3DD5A 5JAHA 1TCBA 2WFZA 4BDSA 2H7CA 1IUOA 3X3HA 4Y2XA 1QONA 3WZLA 1LGYA 4MQMA 4GW3A 1VOTA 4DMHA 1XLWA 1Q0ZA 2V9ZA 3R0VA 1DTEA 4ZV9A 3WJ1A 4BYMA 3IUQA 4CG3A 1VE6A 1ZD5A 4X97A 1UK8A 4WDRA 1QOZA 1AX9A 3I2HA 5AI0A 3VJLA 3QZUA 2WIJA 1JMYA 4HXEB 3PUHA 4B9AA 1DQYA 1WB6A 3V1LA 4Q05A 5EHNA 4L9AA 4OSEA 5A7FA 1CUJA 4MQLA 2QOEA 3RM3A 3DNMA 4XX1A 3WKEA 4B84A 3VVMA 3WL8A 1GZ7A 4KJXA 2IX9A 2GBGA 5AO9A 5FUMA 3F97A 4AZ0A 3VXKA 5ALYA 4RPCA 5AKGA 3FLBA 5EIAA 4B0PA 1XQWA 4P08A 4W1QA 4X91A 3CXUA 1QE3A 1PJAA 4X85A 1CEXA 4DSAA 2XMCA 3PE6A 2WU3A 1BEEA 1BN7A 5E2IA 5DNVA 4I3FA 2WHRA 1U65A 5CT9A 1TAHA 3C5WP 4WCVA 2Y2VA 5EGNA 3WKAA 2XE4A 3O4GA 4DNQA 3WA7A 3F8SA 5JAPA 4OB8A 2XUKA 4X00A 4L3WA 1MU0A 1OCEA 2ORYA 4NS4A 4QDZA 4HRXA 1BE0A 1THGA 3G9TA 3G9UA 4EZIA 5AOCA 3G9XA 3STYA 3O0DA 3IUNA 4E46A 4H18A 4O08A 1QO9A 4FWBA 5DYTA 2PSEA 3F67A 1UFOA 3EBLA 1N8SA 1EK1A 1GPKA 1WPXA 2JGMA 4MEAA 2V98A 4X94A 1YB7A 5CH8A 4CFSA 4LXGA 3JWEA 3WIBA 2I3ZA 1XROA 5BWCA 4RGYA 5ALXA 4QA9A 1EXWA 3IUJA 5HF9A 2QUBA 5DNWA 3WI7A 3WYDA 3IUMA 4AO6A 5I9IA 5JZ9A 1EDEA 1CUBA 3V1MA 1UT6A 2JGIA 4Y2SA 1QIKA 5AK4A 1QIIA 4FLEA 4UUQA 3LLCA 1BN6A 3I6MA 2DHEA 3K9BA 1JJBA 4XIIA 4I19A 2H7YA 5C8VA 2VATA 2GYUA 2O2GA 3LIIA 3D4LA 4FLFA 1CLEA 1G66A 5HQ3B 3ZLUA 1UOPA 1J1IA 3DS8A 3W06A 4LXIA 4AN0A 3H2GA 4UBNA 3IB3A 2WHPB 1VJ5A 1ZI9A 4PF1A 2OCIA 1Q83A 2OCGA 2WG1A 2JGLA 4H7EA 4L0CA 1K8QA 1A8UA 4K6KA 1ZI8A 4Y2RA 4KAJA 4U2BA 4DYHA 3WLAA 1EA5A 1P0PA 5FKJA 4F5ZA 4UHEA 4AX4A 4W63A 4BZZA 5SYMA 1YAJA 3V1NA 3SK0A 2DCMA 4FDMA 4J0JA 1GKKA 1UK7A 1VXRA 3KD2A 1QGED 2WJ4A 4UBIA 1U2EA 2OQVA 3C45A 1A88A 3N0TA 5A7HA 1FFBA 4E14A 1MX5A 4Y2QA 5HKBA 7YASA 5CXUA 4Z49A 4YPVA 4GBGA 5I7UA 4ETWA 3V48A 3G02A 1EB8A 2WUFA 3HSSA 1XZCA 5K3DA 3DL4A 5DLPA 1HLGA 1CUHA 5FPQA 5ALQA 1CQWA 4X7BA 5LZ8A 4WY5A 2QKYA 4Y2JA 3QMVA 5HF6A 5IKXA 4U2DA 3K6KA 1E8MA 3QYJA 5I8PA 4HTAA 4G4GA 2ONCA 5H3HA 1AKNA 3FLAA 1N1MA 1HDEA 4MYDA 3I6YA 2ZVDA 2HU8A 1XRQA 2C5FA 2PUHA 3P2MA 1MAHA 3STUA 1F0PA 3AZPA 2WILA 1W1IA 2I3DA 1HQDA 2I03A 5EIHA 1G42A 2WSLA 3JW8A 4C88A 2DHDA 3IDAA 2XUDA 3W2TA 4QWWA 4G9GA 1BCRA 5AM3A 2G5PA 3QPAA 5AI6A 3WL7A 5FRDA 4B81A 1DX4A 2QS9A 4DNFA 5AKYA 1XZIA 4EB0A 2WU4A 4UHDA 4ZGBA 1KU0A 4KE8A 3I1YA 3CCBA 1VXOA 4IH4A 3WK4A 1OXMA 1YS1X 3MUOA 1G5FA 3WYNA 1F6WA 5ALRA 2PVSA 2O7RA 1XQXA 1AURA 4EY6A 2FUKA 2QMQA 3BE8A 3GZJA 4BP9A 2B9VA 4AQDA 2Y1KA 3PUIA 2XUOA 2ZJ6A 5A6VA 1VE7A 4X93A 1Q0RA 2BJHA 4BBZA 5KWIA 3BWXA 3KOOA 2WHPA 1CUDA 4OB7A 5HK8A 4QNNA 3HACA 1USWA 2G5TA 4H77A 1XZMA 5AI9A 4G5XA 3BJRA 3C6BA 4CCYB 2VJBA 1MO2A 4FHZA 1UK6A 4TGLA 3VDXA 4U2EA 1CUFA 1ZJ4A 2V96A 1CFJA 2QZPA 2J4CA 5CRIA 3WK7A 1LZLA 1MT3A 2YH2A 5JZSA 4G4JA 4YK7A 3QITA 5IVIA 5JD4A 2IIVA 4EA6A 1P0QA 4BAGA 1BEZA 4FNMA 3IULA 4UBKA 5K3EA 3WWPA 1GQRA 3R3UA 1TKRA 1I6WA 3KSRA 4F60A 4EY8A 1KU6A 3G0DA 1U8EA 3G9ZA 1K5PA 3H1BA 3C8DA 2RHTA 2WIFA 3EQ7A 4UHCA 3L1JA 5A71A 5BV7A 1BCSA 1AMNA 5EFZA 2PSHA 3WK6A 2WJ3A 2HIHA 2VJCA 4P92A 2J4FA 3SX4A 3WA6A 2WIKA 1JI3A 5CT8A 4DSZA 1X70A 2HFJA 4B83A 1RP1A 4ZRDA 3O95A 2BCEA 1J07A 2WKWA 4UBJA 2VTVA 4QDXA 3QM1A 4UHBA 1JMKC 2XI4A 3TRDA 1LPOA 2HHAA 1QFMA 4M0MA 4GDMA 3ANTA 1THTA 3FCYA 2YXPX 2AXEA 1FJ2A 1ZD2P 3S2ZA 4DNPA 2FX5A 2B20A 1XZGA 2ACEA 5KWJA 4X92A 3STWA 1QTIA 5AIAA 5D7BA 1BROA 2OCKA 5KREA 1EHYA 2WIDA 2RHWA 2LIPA 3RLIA 4A5SA 3PF9A 3QMWA 4MYSA 4H7JA 5AM5A 2J3DA 4B0OA 3M3DA 5ALMA 3I2KA 3D2BA 3FNBA 5ALNA 1P0IA 5EHQA 1JFRA 5K3CA 3NUZA 1UKCA 1ZIYA 3G0GA 1A8SA 2OG1A 4C6HA 4E11A 1Z68A 2HADA 5JASA 4KR0A 5ALSA 2HA5A 4DTCA 2HDWA 4H35A 5ALFA 4H7IA 3GROA 1WOMA 4WDQA 2HM7A 3M82A 4ARBA 1KEZA 4J7AA 1CUUA 3D7RA 2C58A 3HI4A 3BDIA 3IURA 2ZYSA 5D3ZA 1CQZA 3IVMA 1ZIXA 1XZAA 5AOAA 4HZGA 5EHZA 5CMLA 1E8DA 2NW6A 1R3DA 3B5EA 2HRRA 1D07A 5LZ5A 5AK6A 1XZHA 4AMZA 4WFJA 3STTA 3H18A 2DSNA 5LZ4A 2JGJA 3B12A 3SWWA 2C0PA 3DCNA 4ZV7A 1UKAA 4DMCA 1EVQA 1ZICA 2VAVA 3AILA 5DYYA 3I2JA 3M81A 1AC5A 1HKHA 2H9YA 4PO3X 4OPMA 1XRNA 2D0DA 3BIXA 2BUCA 3FBWA 5FPPA 3ZWQA 2J3QA 3FLEA 1H22A 3I2GA 1S8OA 2R8BA 5AP9A 1RYYA 5ALEA 1YASA 4DMKA 5D6OA 2CKMA 1SCKA 4BZWA 3WK8A 4QEKA 3R3ZA 1JU3A 2D5LA 4QDTA 3FAKA 3ED1A 4JH0A 5LKRA 1R9NA 3ICWA 5F4ZA 3V9AA 2OLEA 2P8SA 3NGMA 2PL5A 2WM2A 4AB1A 3WWCA 4JEIA 1HBJA 1CUSA 1CRLA 4DLNA 2OAEA 1FFCA 1XKLA 2PKYX 4LXHA 4NMWA 5ALWA 1CUVA 5AKLA 1ISPA 4J0DA 4P93A 2Y6UA 4GXNA 1ZGBA 2Y6VA 1DQZA 2WIGA 4NVRA 3TGLA 4UBMA 1EINA 1XRLA 1T4MA 2IITA 1AGYA 3O9VA 3ESDA 3E1GA 5AH0A 2K2QB 3I2IA 1QIDA 4WJLA 2HU7A 1EH5A 1DWPA 3HABA 5KBYA 5T4FA 1EK2A 2VA9A 3BJMA 2VT7A 5HFNA 1EX9A 3DL7A 1MPXA 2WUEA 4BE9A 4UHHA 2FJ0A 1YB6A 2BGRA 3TEJA 5JAUA 4FNGA 2VJDA 3R3XA 2ACKA 1DT3A 4QDOA 2PPLA 3QMMA 1UOQA 4EBBA 1XLUA 2Z8XA 4KE9A 4L72A 4PQEA 5AM0A 3UUFA 3LIPA 1CUWA 1C4XA 3UMJA 1AUOA 2XUHA 4DGQA 1B41A 4QLAA 1MNQA 3FCXA 4UHFA 4Q1VA 3AFIA 3S8YA 2XMBA 4B6GA 5CT5A 3W04A 1VZ3A 3LCRA 2PU7A 3EQ8A 1BRTA 1W6RA 1HL7A 3WMRA 1IZ8A 3DDUA 4J0CA 3FYUC 2CMFA 1L7RA 2XT0A 4BCDA 5ALDA 3QPCA 3W05A 2JGFA 4OUKX 5AM4A 5CT4A 2O2IA 3H19A 1Q84A 4CIAA 1DX6A 3JYHA 2W22A 3FYTA 4DNOA 1WHTA 4FBLA 4KRXA 1QIJA 1UOOA 1W52X 1GKLA 1ZJ5A 3OTQA 1R9MA 5ALUA 4HXFB 4IQ4A 3FWHA 2Q0XA 3OOSA 4EHBA 2O2HA 4W1SA 4CCWA 3KXPA 1O6GA 2WJ6A 3AIKA 3H1AA 1EDBA 5DYWA 3L1IA 3DOIA 1UKBA 2JGKA 1LBSA 1DU4A 3ESCA 1QTRA 4JUIA 1ZI6A 5EI5A 3M83A 3F96A 1O6FA 1X2BA 4GHWA 4MXDA 5ALPA 3C43A 5IVKA 3FVTA 3R3YA 3EF3A 3MGAA 4BVJA 2RI6A 4ZXFA 1ORWA 5AOBA 4X90A 4QWMA 2JBWA 2XMZA 1SCQA 1EI9A 1QLWA 2DHCA 5E4YA 4EY4A 3OC0A 1IMJA 3AIMA 3PICA 1VA5A 3I2FA 3O4HA 4B82A 4Q3OA 4AXBA 2ZYIA 2ZYHA 5JYCA 2Z3ZA 1GQSA 5AKHA 5AI5A 1WB4A 2C7BA 1XZBA 5FP0A 4H7HA 1WHSA 2GZRA 1LPBB 2C0QA 5HFAA 4PSCA 1QFSA 5J3JA 4PSUA 2QT9A 4BC0A 5FV4A 3AZQA 4KEAA 2EDCA 1E5TA 1VKHA 3ZPXA 1H2YA 1AZWA 4CG2A 2AJDA 1YR2A 3VVLA 3DQZA 5ALVA 4G1FA 3A2NA 2Z8ZA 3G8YA 4AMYA 5JZBA 2JF0A 4LYEA 5HKAA 4HVTA 2QUAA 1ORVA 1CUAA 1GPNA 3WKDA 3N2ZB 5C8ZA 1MJ5A 3C70A 4FOLA 1ETHA 1YA4A 1CUGA 2XUFA 2DQZA 4B7ZA 3FYUA 4Q34A 5LZ9A 3MVEA 1F0NA 1A7UA 4X6YA 3C6YA 4BRZA 1EDDA 4INZA 4EY7A 3VJKA 2HA2A 5FDFA 1ODTC 3G0CA 1HPLA 5HF8A 3EQ9A 4X6XA 5CW2A 3R3VA 4C01A 1XRMA 2WUDA 2XQJA 1SC9A 2DFPA 4G8DA 3OPMA 4CI9A 4F0JA 3H04A 2ZSIA 1H2XA 2VAXA 4BE4A 2WTNA 1CUIA 5JARA 3U1TA 4CIBA 1IZ7A 4BC1A 2B61A 2ZJFA 3H2JA 4OB6A 5AKIA 4EUSA 3ZLVA 5ALOA 5D3KA 4M0FA 4XVCA 2HA0A 3C6ZA 3T52A 4BVKA 4G8CA 3WWDA 1QIHA 1CUYA 2X8BA 4AO7A 1FSSA 4DMFA 2E3JA 1QZ3A 5AKXA 5JATA 4Y7DA 3D59A 4KYVA 1SCIA 3T4UA 5E4TA 1XFDA 1XZDA 1Y7HA 4FFVA 2OPHA 1AQLA 1R1DA 4LHEA 2GYVA 5AI8A 5C81A 2JEYA 3CN9A 3W9UA 3AZOA 4F21A 4HAIA 2RGUA 1YS2X 1LPMA 4G8BA 4WFIA 2C5GA 2G4LA 4G9EA 1LPSA 5AKZA 5AM1A 5CH5A 4IH1A 2ECFA 4FMPA 3F9CA 4H7DA 3O4JA 3I28A 4GWLA 4P9NA 5DTJA 4UBOA 5AK5A 1XKTA 2BFNA 5FOQA 2XMGA 1L7QA 4LYDA 4K2AA 2OGZA 2XLCA 5AICA 4TVKA 3QPDA 4BATA 3WWEA 3HXKA 3CCCA 1CV2A 2Y2UA 3ESAA 4RE5A 2AJ8A 3WWOA 4A16A 3ZLTA 1JT2A 1UZAA 1WB5A 4AZ3A 1UXOA 1CIJA 4N8DA 1GXSA 4OCZA 3C87A 2CBGA 1N5RA 1OILA 5LZ7A 4UFOA 2FJPA 3ANSA 4UBLA 1JJIA 4N8SA 4KAFA 1E89A 1XZEA 2OXEA 3D5EA 2VF2A 5HK9A 5AJHA 1B6GA 4Q82A 2XUAA 2EEPA 4Q3LA 1ACLA 3TJMA 2XMDA 2HFKA 3ICVA 3NWOA 3L1HA 4FLMA 1LNSA 4Y9SA 1GT6A 5AKJA 4BCBA 4ZI5A 5IVHA 5JANA 2GZSA 5LYYA 4BVLA 4HXGA 1NX9A 2YYSA 2Z5GA 5FLKA 3PI6A 3FYUB 3GA7A 4MEBA 2WFMA 3D2AA 4U2CA 4KRYA 3O4IA 4WY8A 1CR6A 2QJWA 4ZREA 3LS2A 1CUZA 2BUAA 3BF8A 3F98A 5C8XA 3BXPA 2PSFA 3WL5A 4HS9A 4KACA 2VJAA 4ZWNA 3G0BA 1VA4A 3ZI7A 2CB9A
chains in the Genus database with same CATH superfamily
3QVLA 3UPUA 1GPDG 4LF9B 1RIIA 1X86B 1IAVA 3B8EA 1OX5A 3BIJA 1WKBA 3KVOA 1TF7A 1OXBB 2QD4A 2LE0A 1MEEA 3DJYA 3EQ6A 2RAUA 4JYCA 4E09A 5JNUA 3LC7O 1N5JA 1O77A 3PFCA 4HQOA 4HRYA 2NV2B 1Z7EA 2VR1A 2BZGA 4Q00A 3ORHA 2PWPA 2QXTA 2V6IA 3FGOA 2VOJA 3Q15C 4RQBA 5A62A 3FFWA 5CVDA 4YUXA 3KSUA 4MGEA 2QZ9A 3CY6A 3QV2A 4Z9FA 2GPTA 4C3OB 3RAEC 4EMUA 2VJYA 5BRJA 4KFTA 3JXEA 2A3RA 1UK9A 1SXHA 1OBOA 4YLYA 1ZA2A 4EW6A 1SD1A 1QX4A 1W46A 3SX2A 3NONA 1UBKS 1OXXK 3WRWA 5EIEA 2ZCVA 3VZRA 1ZLXA 16PKA 3KR9A 4PW0A 5CIYA 3HJCA 4KW7A 2BR3A 4FYJA 2BM8A 4OVKA 1U7ZA 1XTPA 2GBIA 4GMXA 2R97A 4IDPA 4YH1A 5IMSA 1OYVA 1SULA 3QE0A 4R1PA 1E4VA 3BZBA 4HQNA 4N39A 2GBFA 1P2SA 3U6KA 5FPTA 4KX3A 1JG2A 1DINA 4NNOA 1JYSA 3VDRA 5JV5A 1O03A 5AIBA 3CXRA 3LFHA 2MSEB 2G9QA 1CE8A 3BWCA 1XZJA 5EMKA 4YHBA 4CLXA 4JBXA 2A1IA 1RU3A 2YZ2A 1IVYA 4OXXA 2C4KA 1G20B 3VC1A 4IUCS 5HMMA 4C7JA 5AUNB 1JF8A 3AUAA 1N5MA 2WG0A 1NVTA 4N4AA 3ZI4A 4LJKA 1WVGA 2ZOSA 1E2IA 3D81A 4X1IB 5H82A 4CXMA 1FUKA 4J0KA 3IRUA 3R0IA 1KVTA 1EX7A 4R0VA 2JVIA 3LYLA 3V8VA 3TEFA 2WFAA 1J06A 3N86A 4M0UA 3A70A 4IIFA 1GWNA 3ZTWA 1F8XA 3A3KA 5SYNA 3A4TA 3QEJA 4ZJYA 1KO5A 4B45A 4FJ2A 4ITVA 3E2MA 2EKLA 2WHEA 4U2GA 2IT1A 2KSQA 1NW7A 2PX0A 2IC5A 3FOBA 4RSGA 3ZV7A 1NI4A 2P3LA 4ZT4A 3VPSA 4BRSA 3C3AA 1ZXXA 3HY4A 2OV3A 2PSJA 1XI2A 4IJ5A 1A8QA 1S4MA 2V7WA 5JDIA 1JVBA 1GZUA 2FUCA 5FF9A 4AG3A 3GLUA 2V8OA 1NJGA 5K20A 5KX5F 1QQTA 1W88A 4LG1A 4G67A 4PSDA 2FUNB 1E2NA 1YFKA 1KETA 1J90A 2EZ4A 5CW1A 4JDUA 4E32A 3KR1A 1JEYA 4YROA 5DI9A 4FZ3A 3VR2D 2CNNA 3L8DA 4KITB 1FFGA 2WU1A 5EHXA 3V7FA 4TN5A 1YK0A 4JQYA 3DNFA 1LPAB 4AKIA 3NWJA 1KYYA 1QZUA 2IYAA 4K03A 1CY4A 4JFRA 3SIPA 2XMRA 5KNBA 2IGTA 2GMWA 5E9JA 1QFZA 4CLRB 2QN1A 2FNAA 1EUCB 2Z98A 3ZEAA 4NK4A 2AI3A 1NXPA 1PT7A 1YO6A 2OO7A 3G2NA 3IT1A 4ILEA 3T3DA 2HN9A 2V74B 1ZGZA 2Q2QA 1PTKA 1MNAA 4C4XA 3VKFA 5IRCD 3O1HB 2BF7A 4PRYA 2C0CA 4U6QA 121PA 1ENOA 1SWVA 1HTTA 1ZKDA 3O82A 4D3FA 2ZUBA 1NYTA 4PQFA 2PFGA 1JKMA 2CLCX 4RF5A 2R8PA 1CRWG 1QK3A 3KDAA 4OXRA 4S2EA 5LBUA 3T0IA 5FTLA 2O06A 2EBWA 1YIAA 3HDTA 5DNUA 3EA0A 1EYZA 2RHCA 3BF7A 3T7SA 1CIPA 2WTAA 4OI1A 4YASA 3R7LA 3UOWA 3M6UA 4BDTA 2RHJA 1D9ZA 2WLSA 3GFPA 4H08A 4XW2A 3IR6A 5ABPA 1X7XB 1B0UA 2VT6A 4UD2A 5B2FA 2BP7A 2RHOA 3T6KA 3H9QA 5J2UA 1W19A 2OCLA 4ZVSA 1COWD 1DAFA 4B6EA 3TCXB 5AQ1A 4CJXA 1LBQA 2LBPA 5J2TA 2CV2A 1P3JA 3VAAA 3ETLA 2BFBB 1C7EA 1EQ2A 1FFAA 2CEKA 2R5NA 3I39X 3QG1A 3PQ8A 4F4DA 2OBLA 3PRYA 2QDKA 2NV6A 1W2WB 4DLSA 1WMBA 1WY7A 2GRJA 3GN1A 3HJUA 3K8QA 2OFXA 3RW9A 3EZXA 3VR5A 2GCOB 4P83A 1T2NA 3CEJA 4V0RA 1BMDA 2PYDA 4JBGA 4RA6B 3PX7A 3TIGA 1YQEA 3DVAA 1SVKA 3BERA 4TWRA 3WZ2A 1TCAA 3OOWA 4V1CI 4J7CA 1U2DC 1MABB 1X7WA 2GASA 2ZEJA 4RV4A 3BJIC 4S35A 2Q7OE 5A4IS 1XEWY 4G4SP 1IEXA 3LNCA 2VQFB 1YR7A 4GR9A 1P2TA 3L46A 4UCXA 1JEDA 4BXOB 5D51S 1W49A 5F98A 3VR2A 4UPDA 3X2SA 2ZRJA 3H9UA 2BEUB 2JRCA 4QQNA 4ZDJA 2X23A 3K71B 1XQ1A 2OHHA 4XWOA 1VE5A 2XJ9A 2G63A 3NNSA 4EVQA 2R7MA 3EUAA 5EHGA 3PUKA 3RREA 1F8UA 3N7UA 1YDWA 4KN9S 5DLQC 5IHPA 2FW9A 5KYWB 3JVIA 1ONPA 2HWWA 1CUCA 2QSZA 2Y1XA 3A3YA 3NWBA 4P3KA 1MAAA 5DWQA 4BECA 4ZZ1A 2XF2A 3BVPA 5AJVB 4Z2YA 4Z8YA 3S8EA 2AV6A 2WPDA 1P1CA 4NV3A 5DNCA 3FCSB 4X6LA 1Y5LA 4QUAA 4UEJA 3UJ7A 1IB6A 1XRRA 1ODSA 2M98A 2ONYA 2AFHB 1T4DA 2EHJA 4LY6A 2H1WA 3KUKA 1L3BA 3M6XA 3OPYB 4OG2A 2WEKA 1UZNA 3I1IA 3IBGA 3RJ5A 1P4GA 3GLRA 2WLTA 3CMCO 1NLYA 3NFRA 3ZW7A 4ANFA 1ULUA 3SDZA 4FVTA 1L2TA 1JLKA 2PMKA 1ZRMA 3H87A 3B6EA 3OFSA 2ZS7A 2EG9A 5DF1A 4F2HA 2X0JA 4MUEA 1AF4A 4MV0A 5HIMA 4K6HA 3UJ9A 3AKZA 2A0FA 1ZZGA 2H5LA 4PZ9A 3DVSX 3AM3A 3KZXA 2QQFA 3CF4A 3G13A 4ETMA 2BEKA 2QD2A 2WG2A 1NBEA 3GRRA 1XQYA 4IIJB 4RA6A 4NNPA 3LF1A 2PS3A 1QZTA 5SY6A 3TZBA 1RJEA 1CY8A 3EAGA 5IXYA 3QG5A 1AGXA 4H9GA 3SYRA 4DHWA 3IUPA 1ZHOA 2ST1A 3B9QA 1X92A 2PRKA 3MD9A 3R75A 4K0KB 4M9QA 4TPKA 5EVJA 3K72B 1H3FA 3PDHA 3GNTA 3VPDA 3Q0TA 3NETA 2PL9A 4TL9A 1HETA 2V55B 2WHQA 3ANYB 5FLYA 2EW2A 1JB9A 2RAVA 1Y34E 2NNLD 2NQ2C 1TT5A 2XMPA 3NWPA 1PSWA 2QUHA 1U7XA 3L1KA 1ZONA 1G8YA 5DFAA 1B0PA 2PD3A 3DEAA 2WOJA 1OZ0A 1G3QA 1ZU4A 4HYYA 4NV1A 2RGXA 3PU6A 2Q6OA 2AG1A 3N05A 5F5NA 5GQSA 3RIGA 2W6OA 3G1UA 4NAVA 3BHJA 3PVZA 4OK6A 2PU5A 3C6XA 5KTPA 1K1EA 1WMSA 3QKWA 5HDQA 1F1BA 4JNCA 1R88A 4EVIA 2Y66A 3J81k 3GGPA 3GJ5A 3EWSA 2NPFA 3PKJA 1I7QB 4WKCA 3VVBA 4IX1A 2HA3A 1TTPB 2OZKA 4PHCA 2QX8A 5THXA 1IIRA 4C06A 4RTPA 2VQEB 4MV9A 2X0RA 1ZM3A 1CJMA 3EYAA 4HP8A 1PF7E 4FFWA 2X86A 2Q4EA 5EA2A 2ANCA 4RF3A 1GZHB 1Y6JA 2RJNA 4KE6A 3DCIA 3ZTYA 1DAKA 3ABSB 1C3JA 4IILA 1U3UA 5C7IO 1K86A 4RVFA 5ENZA 1D2EA 4FTWA 3GLTA 2IV7A 2XTNA 3L7KA 2Q21A 5HCUA 1L5ZA 3C41J 2PNJA 1XP5A 1YR1A 2VUTA 1B4DA 2JEZA 4MJ3A 3H17A 5HIAA 4N5HX 4DLUA 3S2IA 2AIRA 3M1AA 4FGUA 2K7FA 3WS7A 2XYHA 2OLJA 1QYIA 3QPBA 3S6JA 4LRTB 2QRUA 5KTRA 4AU1A 1XRJA 4J29A 4UXHA 1FZTA 1RPJA 2CSUA 3BYZA 3WWZA 1Y9JA 1ZH6A 4CQMA 3WC4A 4DSUA 1V48A 3HJAA 3ZD6A 4KXMA 2IH5A 2K5UA 1CZLA 3LUHA 5I7FA 3BTUA 1TIBA 3ELUA 2Q1XA 4OU4A 2B30A 4EGFA 5CBKA 4O4IB 1T5TA 1L4EA 2DUNA 3RBXA 3NALA 1NLMA 4KK4A 3QENA 4CR6A 2ZIFA 4K28A 1HXHA 1B14A 2FWIA 4LS3A 1W76A 4E7OA 2CXHA 3R6DA 4HR7A 4D8TA 2DBZA 1KAQA 1USKA 4KK3A 4ZTBA 4DR3B 1MG5A 2OAGA 1FF9A 3TTYA 1VHWA 4ZEVA 1P6UA 2G0AA 3ZHUA 2EX4A 3LLMA 4YN3A 3O90A 3BC1A 3I6ZA 3NC1C 3Q85A 1Q15A 1U0EA 2NZXA 3I12A 5CFQA 3ZZ0A 3L8MA 1RFLA 3MZ0A 1KSFX 1C9NA 1ZUIA 3IT2A 3PUZA 4Y0NA 5LYJA 1QZZA 1PQUA 2R4UA 4YXWD 2NYVA 3HR7A 1T91A 3NGXA 4S24A 1D4OA 3EEBA 3O2NA 4FBMA 4H1TA 3D8UA 2H11A 2JBAB 2VCYA 4JYMA 5BP7A 1LFAA 3GG2A 4NICA 1YQTA 5K51A 4S1OA 1TJPB 1USIA 2A59A 3C5HA 5EKUA 4HWTA 3VC7A 1U3DA 7AT1A 3FMFA 4CMGA 1E58A 3MG9A 2F3RA 1VCIA 4JJ8A 4OL0A 2OYSA 2GTIA 4HFRA 5ALTA 1E18A 1T8PA 2HNAA 3PF8A 3T3EA 2C2WA 2HLDD 1KTVA 1IUNA 2MTBA 1B7GO 2QU7A 2R8EA 3CF6R 4LBZA 3TOXA 3OX3A 4RANA 1QG2A 3V7NA 2OGTA 2H57A 2SCUA 4QOSA 3WJ2A 3GEBA 2PFSA 3U7JA 1XG5A 3N53A 1RRGA 3KT8A 2GNPA 3HDQA 4RK5A 4KI7A 3H75A 2Y05A 5EKXA 4NAHA 3W5AA 4AS3A 3AVYA 3OWHA 1AHHA 4MJXA 1XZFA 4MW6A 2IHTA 3VKWA 4CLHA 4RVGA 3THXA 2EBHX 4PICA 2C4NA 1V8PA 1LQTA 3FPFA 5JNSA 2ZJ2A 3AF6A 3CT4A 3I5YA 2KM1A 1LXCA 2IUSA 4M1TA 3IAHA 3VTAA 1H9AA 1UPCA 4ZO8A 4EO7A 2I4MA 1SEPA 3RK4A 1GLVA 1RE0A 2YASA 1SC1A 3K15A 2EG5A 3A3PA 2FFQA 3LDFA 3ODPA 4JJFA 4L1KA 2W6CX 4LHYA 4IIUA 4MS1B 4P3OA 1FX0A 4E15A 4NCAA 2B2XA 1SC4A 1Z6GA 3ZGYA 4EYGA 1F2UB 4OU5A 4RY0A 5I3ZA 3DBRA 3ZG6A 4EF5A 3I83A 3QIVA 4F3YA 2ATIA 5AXBA 1NT2A 2GPBA 4IDGA 4RQUA 1PVDA 4XAQA 1WXQA 1FDOA 2CZQA 5KWEA 1KYWA 1W85A 3EGVA 3FUXA 4I55B 3E70C 3M6LA 1V8BA 5GJCA 4BX9A 2BKXA 5CB4F 2C9CA 3K5HA 3R5SA 4RKWA 4BVGA 9MHTA 1G60A 1JJAA 1FRQA 1M1NB 1A9SA 4EKNB 2CDNA 4DIUA 4UJ5A 4NCJA 2IPOA 2G5GX 5E4JA 4RIEA 4DRXB 4FEYA 1ZK3A 1XVTA 5AJYA 1SXJD 1M2NA 4C4YA 2B4QA 5CA1A 1C1XA 1JKIA 2P77A 1G8HA 5CYGA 3ZNPA 1UUFA 1WEKA 4BV9A 1SKQA 3R4VA 4EYEA 3D1LA 3EIOA 4E4RA 3NUGA 4IS2A 4UQLA 2ZSDA 4M0DA 2X5XA 2A86A 5A6SA 3I1FA 3A2MA 5I9NA 2PX3A 5FXMA 4RK0A 3GVPA 2P79A 1E1NA 5BSGA 1KXJA 1XN4A 3CB2A 1H42A 3H2ZA 4WASA 1IHPA 2E4WA 3ZVKA 2G8NA 4E5PA 3DXFA 4A8JC 5ANRB 1DRKA 1HFWA 4RADA 4F9FA 4QFDA 2QZJA 4BB0A 1CY7A 2R79A 1AK1A 3RU7A 1S2MA 3BH7A 4RMGA 5CNIA 2OM2A 1G17A 1L5MA 1NHWA 1V7ZA 2RCNA 1WKVA 3T4PA 3ZQ4A 2I4NA 2NUAA 3HDVA 4KOAA 4MRMB 4FOOA 3PP8A 2Z2IA 3FGZA 5I47A 2IH4A 5DWDA 4AIRA 4OAQA 1EKXA 5DMHA 6PFKA 1XA4A 2BEWB 3L8GA 3ASVA 3H4TA 4TL6A 1JHAA 1LC0A 1B2LA 1E3QA 2X58A 1QBKC 3LYHA 1F4LA 3K8ZA 3THYA 1GUDA 3BXEA 2FEPA 3UAOA 2CE7A 4O1IA 1GPYA 2MSKA 1TO1E 2P9EA 4CMCA 1LBTA 2GWRA 1D03A 4Q02A 1GGVA 3BOSA 2GK6A 1UPFA 1Q22A 4WN9A 1IQRA 2J0SA 4MUNA 1RRMA 3K0SA 2IHVA 1ULZA 3DDOA 4RE6A 4CKCB 1KY2A 1YONA 4G63A 1A7JA 3GT7A 2M1ZA 4WOPA 1U1DA 1CP3A 4UAVA 1ZR2A 2JLVA 1YJBA 4CNQA 1MO5A 4EARA 1OJLA 3AHGA 4MS4A 3VJRA 4KDRA 2CUTA 3JR7A 1ORTA 1G2PA 4IXTA 3ZJ4A 3HCNA 3FGPA 4R51A 1ZOOA 1FFEA 2PZFA 1BS9A 1IAQA 3BFXA 4PCUA 3VU9B 3GGOA 1NVFA 1K6EA 3B1YA 3COWA 3WGLA 2R8YA 4ILKA 4RH3A 5BWNA 1XTBA 5I01A 1QIFA 3JQAA 1I6LA 3LP5A 3PC6A 3UTCA 5BUQA 4FZ5A 5DTIA 4ZI3A 2Z6VA 1E9DA 1Q74A 4D8XA 3AB8A 3PV0A 221PA 3AFMA 1QO0D 1Q0LA 2V3WA 1XBTA 3HY3A 2GZMA 1T9KA 2XUIA 3LKDA 5FOWA 4TWJA 3JATB 4HB3A 4MARA 4QDUA 2W6ID 3M6MD 4TXLA 3BMXA 1QFYA 4IVPA 3ZBQA 4RULA 4JT9A 3G5MA 3H0CA 3GGGA 4OMUA 4CBVA 2XRYA 3FR8A 2XQFA 4FHDA 1VHLA 4KG7A 4A9AA 5ALZA 3WRVA 2P6OA 4AUEA 3JZFA 4JLVA 2W0SA 1T8YA 4EO4A 4C87A 4Z7NB 2VSNA 2QSYA 2OAP1 4RACA 3HRHA 5ALKA 1QYXA 3EEFA 4Y2PA 4FYYA 1JEJA 1QIEA 2XITA 3D3WB 3I6BA 4OHWA 4YAJA 5A02A 4CN8A 1VBFA 3ZDBA 2LV8A 2WWFA 1UBRS 1NFFA 5TPZD 4EDFA 3K8YA 1VLQA 2Y99A 3QKUA 3ZKWB 5BMVA 4HDSB 2BFEA 3GDWA 3EPJA 2WYHA 4AO8A 3LJKA 5HZKA 4RTSA 5KYYA 3HCPA 3Q3IA 2DF8A 2EP5A 6ADHA 3V1UA 2ES4A 1FOEB 1Z12A 4MCJA 3URKA 4C07A 4GMGA 4A0GA 5JD6A 2VS1A 4UVGA 1ZVQA 1EFPB 3QBDA 4IFBA 9LDTA 2DE0X 1QFJA 3ZGZA 5EUQB 1H2BA 4R1QA 2ZYGA 3ROPA 2D7CA 5EIOA 1W4LA 1ZFNA 4HDMA 2XQIA 2H52A 3EN0A 4QU5A 3EAFA 2G1AA 5KJCA 3PQEA 4N5MA 3MQ2A 1KYTA 2CJPA 4LKOA 4LDJA 4G0XA 1YS6A 1NZJA 4OJKA 1W0KA 3WQHA 3A26A 5IVDA 1A8IA 2OZVA 1NRXA 1YMUA 3FKQA 1OX4A 4O33A 4CKBB 2ZXFA 4I3HA 1M6YA 2V0GA 1CDOA 4FOTA 1JU9A 1SD5A 4ZVPA 1RI5A 5AHWA 1G7CA 1P19A 2AQKA 2FRXA 5DBIA 4A2PA 1ESDA 4Y2XA 4A73A 2X3FA 1UPUA 3S1AB 2I2XB 4NESA 4XDHA 4CT0A 1ZUWA 4NATA 1QH0A 3FPCA 4MPDA 2WYOA 2HYIC 1VOTA 2D0OB 1XLWA 3ESRA 4WOKA 3DVQX 3PL1A 2JI4A 3LPNA 2DM6A 2ISQA 1XZPA 2V9ZA 3RH0A 1KH2A 4D4JA 1E1MA 3AY0A 1MC4A 3IUQA 3R20A 1UJ4A 3UOGA 1P9LA 3KTAB 2HX1A 3I2HA 1L4FA 1SQSA 3U4HA 4I4TA 4URZR 3HDGA 2HEGA 2V6BA 4FYWA 3OZUA 2RDMA 4LYHA 5A9TA 1SBTA 4MW5A 3FB1A 2ZUUA 4F4HA 1NUTA 1T4CB 2AA3A 3L5KA 1YDMA 3HL0A 5CNMA 2PUEA 3TPFA 2NGRA 2ZIAA 3H3FA 5F7XA 1DQYA 3IESA 2P91A 4CW7A 5GINE 1EUQA 1UT8A 3IHWA 1Q1ZA 4LE0A 1QHYA 3PC8C 3PXXA 2WTUA 4ZZIA 1LW7A 2OSBA 5JXHA 2QOEA 4C78A 2BEWA 2QTNA 1F2TA 1V7CA 4PM4A 2AF4C 4XIFA 1IH8A 3TLJA 2FX2A 2H5EA 4IHJF 3TIVA 4B84A 1F2DA 3VVMA 9LDBA 1E3LA 3HNPA 3BTOA 4KJXA 1RKUA 2FG7C 3N6XA 4BFSA 2IX9A 4OHXA 3BT7A 4JLOA 4RELA 1EXVA 2XKJE 3ZK8A 1GPUA 1YU9A 2LWIA 4QXRA 5AO9A 3SJ7A 1WZUA 2GVDC 5FUMA 1ZWKA 3M6IA 3SQDA 2B7LA 4LF4B 3VXKA 3NANA 5ALYA 5AVJA 4RPCA 4GKJB 4E5MA 1A27A 4QICA 1N2CE 2FOLA 2YTZA 5EIAA 1T1IA 1H0SA 1A2BA 3DJFA 1W47A 4QXPA 2NU9A 4J49A 2L18A 2R84A 1A4XA 1UBCA 4BO1A 1MB4A 1KERA 2PZKA 4YMTA 1VL0A 4UAGA 2A7QA 4W1QA 3T1YB 1GT91 4KUHA 2HHCA 5BUCA 4DR5B 1XJ5A 1U0FA 2LGJA 1CEXA 3GHYA 4X85A 1UDWA 2GXQA 2XHZA 4MQ4A 1K6MA 2NU6B 4UMEA 4B4KA 4X1OA 1RYDA 4ZQHA 3F4KA 3NPMA 5A05A 1SVIA 5EN4A 1V71A 2OBXA 4IYRA 3DZKA 1BN7A 5L40A 2OZLB 2ZBQA 4TROA 2PXCA 5F4BA 5JJ5A 1RKVA 3QWAA 3TW6A 5B2EA 3C3DA 1RZRA 1KMNA 1QM5A 4KLRA 2GETA 3HBAA 4HNRA 2IYLD 3TM5A 3SYTA 2GN2A 1E3SA 1JR3E 5CT9A 1EJ0A 4UQOA 2PZBA 2QQGA 3WB1A 4ESHA 1SCUB 1UIRA 3R0QA 1G6HA 2PH5A 4N7RA 4R2WA 5D1HA 5J5VA 4C03A 2P5SA 5J2UB 2YN4A 4R31A 1KOLA 4WCVA 3QKRB 1PTJC 1SK8A 1H2EA 2XE4A 1Z47A 2ZI5A 4CM9D 4YUAA 1N5OX 3EC7A 4DNQA 1E1QD 3OWXA 1IHUA 1P9WA 3PHJA 4LDZA 2FRVA 1GILA 4EAQA 2CXSA 3I37X 1CJUC 1QMGA 1EUDB 1OF1A 1P5FA 4KPUB 3BIOA 3A4IA 4C20A 4UOZA 2WDPA 1TEVA 1QCZA 2Y1EA 1KI2A 4G1CA 2GT1A 3K16A 1ODFA 2Q4TA 3OQ6A 2Q2OA 4BFZA 4Y0VA 1L1FA 4H31A 3W6NA 5GONB 1RYNA 1HH4A 2N46A 3G9TA 3WDKA 3B9RA 4UARA 3RVRA 3G9UA 2VT2A 5AOCA 3GT4A 2NV0A 4C6TA 4EZIA 3Q7EA 5JH7A 1CQXA 1Z22A 2ZT6A 5J47A 3T3OA 1JAHA 2Q49A 3LNTA 2XCSB 1JFFB 1KYZA 3AF5A 4LBYA 4ZQFA 3QV1A 5HX7A 4NV0A 5IZCC 1MORA 4CGZA 5ES4B 1IQ0A 1ORRA 1QHFA 1A9YA 2KBFA 1VTKA 4ZAZA 4ND8A 4YCLA 4O08A 4FNAA 1QO9A 4NOJA 1GQQA 1Z39A 1DO0A 4C1NA 4PQYA 5IWCA 2QBYA 4IVRA 1M5RA 5EMJA 1RWVA 3E7DA 3PNKA 4R9NA 2DKOA 1N8SA 1OT3A 1YZTA 2IXFA 1O4VA 3FUVA 1E77A 3FKSA 3C5EA 4JWKA 4QYIB 1XDBA 3GG9A 3CG0A 3VO2A 3N8KA 4MEAA 3WHKA 5GJVC 4GBMA 4P5EA 2XJ4A 3TOZA 2ZYAA 1CZUA 1C3OA 4LF6B 4KPEC 3KEQA 5CH8A 3RTCA 4EG8A 3TI9A 4IGEA 5ILOA 1G6OA 4ZT7A 1LI4A 5AYVA 3DAYA 1NN1A 3JWEA 5JRJA 1JDSA 3UT5A 3PDUA 1SUDA 1XROA 3UT6A 4QX6A 5EP2A 3X44A 4ARIA 4MVCA 1YZVA 2WJHA 1YK1A 2D1SA 1JFVA 5HF9A 2XY4A 2WRZA 5T57A 3D6HA 2QM3A 2D0PB 5B2ZA 3WI7A 3WYDA 3IUMA 3I58A 4DG5A 3W7VA 4BLSA 4QGGA 5JZ9A 4YJFA 1MF7A 2OILA 4AD8A 3IDOA 3QKRA 1AQYA 1TYDE 2LRHA 4OHMA 4OHZA 1J22A 5JS2A 3KUCA 3THOA 2YC2C 3H4IA 2JGIA 1NSYA 5CA1F 1QIKA 1G1AA 3FPAA 2VOEA 1HV8A 3G8AA 2YWCA 1W44A 2ZWOA 1T1RA 3Q10A 1NI3A 3W8DA 3FYHA 3TQTA 1EK5A 4JC8A 1R16A 1Y48E 2JD1A 4XEUA 1PFGA 3AB7A 3U7RA 1BN6A 4RJTA 2DHEA 4XIJA 1TK9A 2NO1A 3CR7A 1PR3A 1BTOA 2H7YA 4ZAWA 5C8VA 3OF5A 1NJSA 1R12A 3RJMA 1KMQA 1CLEA 3GJ3A 2OXTA 2CWDA 2XZOA 1B23P 3HJGA 2P9QA 3UH1A 2DFKB 4EABA 1L5KA 4XX0B 5CLGA 4PCLA 3CA8A 1AG9A 1Z2CA 1ZNZA 4WKPA 3P27A 4JL6A 1MRZA 4KSBA 4LHWA 1EWYA 3KQQA 5REQA 3RKRA 4AN0A 1YZQA 2XE8A 2QN6A 2FZWA 3QVVA 1S3FA 1A71A 1Q2XA 3JD4A 3QVXA 1ZI9A 3PUVA 5FORA 1C30B 4FW9A 1APBA 1N3YA 4PF1A 1Q83A 1Y3DE 1YQQA 5AKGA 1POWA 3E15A 3QYFA 4G0MA 5T41A 4CEHB 3D4PA 3NTQA 5TQVA 3NEAA 3UKOA 5IKPA 4CR8A 3ONVA 1FRZA 1A8UA 4JR0A 1PEAA 4Z4QA 3P96A 3N28A 1M75A 1H2RS 3IMKA 4DYHA 1MXFA 1JSXA 2YW9A 4JFAA 4RXUA 3WLAA 2DH6A 3DLHA 1B0AA 4IDEA 4QGBA 3WJAA 1QCYA 1M83A 4DWOA 3VPAA 4UTNA 1JDBB 4L4ZA 2FWNA 5AUOB 4KQ9A 4CQMB 1T1SA 2ZB2A 1YQ9A 4ZO6A 4GOKA 4X3PA 4EJ0A 3NHWA 1W93A 4QUEA 2AFIB 1EHCA 1P7YA 4QRIA 4ZMBA 2ZP1A 3BGWA 2X0NA 1HF3A 3ETJA 4BNTA 4CM9A 4F4CA 2OXRA 3LT1A 2Q1UA 2DCMA 2DY1A 3H1TA 4C21A 2A9OA 3WLJA 4CV3A 4DFDA 3KQSA 3DEJA 1I2AA 4GLOA 3EWAA 3ITNA 4FFRA 4XPIB 3FH0A 1DRJA 1QGED 2WJ4A 4LRQA 3HLYA 4NZYA 2RGYA 1LK0A 1EQUA 1Y98A 4LX0A 4YAOA 3DULA 2OZLA 3DWEX 4IL5A 2HI0A 2X3YA 1LLUA 3DDZX 4E14A 1NLFA 4FYKA 5FEMA 3ZCPA 1MX5A 1DLJA 5GM1A 3GZNA 4PC3A 4F2WA 2OCBA 5KWSA 3KZMA 1V9SA 4NLLA 3WRYC 4F85A 3EPPA 5CXUA 3FHOA 3DTVB 1DIRA 4GM4A 3IAM6 4LPSA 3JQAB 3SE0A 3G6KA 5I5EA 2JHPA 4FONA 4HDKA 4MS3A 4BN4A 4LF5B 2QN2A 3LCCA 4HNAA 1CYEA 1YNSA 1O7JA 5E1BA 3C24A 4IWYA 1TCUA 2CWWA 3DGEC 2FWJA 4P4TA 3V48A 4DLRA 2YFHA 4FOPA 5HNKA 1S02A 2LVBA 3CO0S 3AX6A 5J1SB 1KY3A 2GK4A 2O48X 3H6HA 3OFJA 4J2HA 4R3WA 4UVEA 3HSSA 1NF3A 2P6UA 3LQ1A 4NTZA 5FA5A 3B7GA 1C0KA 1M5TA 1SUEA 3GO4A 5HGJA 3BXFA 4EI2A 2B5VA 4DMRA 3DL4A 3IKMB 1RQLA 3QFFA 2CCKA 1H0HA 2Y76A 2UAGA 2VYVA 1AQJA 4E08A 1DV2A 2PX2A 5SYAA 1NAHA 3VR6D 3DC2A 2P2NA 2XTAA 5ILGA 3PPYA 4GSKA 1CZOA 4IUDS 3A9VA 2NTEA 5E2AA 2AZMA 1K9SA 1MAUA 1KS9A 2VSYA 5E6SB 2NZJA 2ZI9A 2ZR8A 2A30A 2YIJA 3HMKA 5EJAA 5LZ8A 4E1VA 1S7CA 3OQVA 1A4UA 1F2UA 1QH1B 1RKXA 1SPXA 2X7XA 2ZBGA 2C5AA 3DUFB 4WY5A 4XVRA 5G0VA 2QKYA 2HF8A 3G7UA 2G9VA 3VKVA 1TB4A 3RYCB 4RHEA 5BUSA 5DYNA 2GPJA 1NQAO 3C98A 1P60A 4TUYA 5IKXA 1B93A 2QTVB 2D74A 4U3JB 1EU1A 8OHMA 1Y3IA 2NZ2A 2XSZA 3K6KA 3QYJA 2QAIA 3TZ6A 3REQA 5IX8A 1J1ZA 4L5AA 4RPJA 4BUCA 1RXIA 2BR5A 1NMEA 4KXVA 5DK4A 4I50B 1SVOA 4DREA 1C8LA 4QXAA 1N1MA 5IARA 3OPNA 4GYKA 4DLTA 4YV1A 3FZNA 4OREX 5KSOA 1EE2A 1U1IA 4MYDA 1XXHE 1VBNA 3AUJB 4H6PA 4B44A 3QW2A 5F77A 1E2EA 5C31A 2QR3A 3F8TA 4KJZA 5H70A 4FILA 2BGTA 1RBMA 4ZA2A 2F3PA 1V3TA 1MVLA 2PUHA 3IJ5A 1H6DA 1V4NA 2XDYA 1ZN9A 1D6SA 3OT5A 3SKXA 3FKJA 1SQ0A 2FYTA 3GLHA 3W6PA 4OXKA 4TYNA 1W1IA 1I32A 2I3DA 1UBEA 3NX4A 4F6RA 3L8FA 2WV7A 1A9QA 4OQMA 1J21A 2VDMB 2WSLA 3KX2A 3DF9A 3B6MA 1N5DA 1J99A 1ESNA 1OZHA 5COBA 3OOYA 2VHVA 3INGA 3FFBA 4P0PB 4WK4B 2JAPA 4HMPA 4KQCA 2EFJA 4OHUA 2ZIVB 4HNAB 4GMHA 5EZYA 1BNCA 3PT9A 1M10A 3K9CA 5IKOA 4NZ9A 2RKBA 2C54A 3PNOA 1IM5A 1SC6A 2MSLA 4KGDA 3TQRA 2HOQA 3WSTA 1FC0A 5I5GA 3I2YX 4KCGA 1O9GA 5J40A 3WL7A 5LOVA 2A35A 2ALJA 1DX4A 2BFMA 4CCAA 1O89A 2FMKA 2QS9A 4JKYA 5B1IA 5AVRA 4BGUA 1SH7A 4RPKA 1AHPA 1T0JB 3WP1B 3HFSA 2ZW9A 4O0LA 1LEHA 3CM0A 4HRAA 4BO5A 2QG6A 1AK9A 2W8BA 4JJ4A 1IEWA 3FYSA 1WETA 1KU0A 2EC5A 3B51X 4G81A 4RQAA 5H1YA 2PS1A 3TTTA 1BRMA 2BSAA 4UEQA 3HSKA 3RS4A 2JS7A 5IPFA 2RGRA 3A4MA 4M1KA 3BX1A 2UYQA 3IDFA 4IH4A 4BFLA 1TX4B 1WUIS 3EQZA 3WK4A 3U56A 3TD9A 3E7WA 2Y0DA 3BFVA 3GVHA 4W5HA 3TXXA 4QTUB 1NC3A 3ENVA 4MVJA 2QP3A 1LSJA 4Z99A 4EVSA 4ENRA 1GV1A 2HPHA 2HGSA 3OM0A 4A8JB 4ALNA 1V5WA 1AURA 1W96A 2H29A 3K4HA 3B5IA 3C1TA 2VH2A 4JEHA 2WKPA 4II7A 1TF2A 2QGFA 1EWQA 2ZZNA 1KRXA 4NPCA 3K2EA 4KO1S 4Q66C 2OENG 5TF0A 2VZ9A 3NAGA 4JLKA 1GQYA 4E03A 1HO3A 4JITA 4L5YA 3GFTA 4POAA 3V1TC 3VH3A 1WMFA 2E49A 2HDNB 5KPDA 3L18A 4NKRA 4Q3DA 2HQRA 2EOAA 3VGJA 2EKPA 2VCEA 4RBNA 4RYDA 4EG4A 4MUYA 2AZ4A 4UHJA 1B2RA 1GUAA 2H2IA 4Y8VA 4DJAA 4W5TA 1GZ5A 2ZJ6A 4D82A 5L3VA 4LDNA 3ONEA 1X7ZB 3JASA 3WAGA 1NRIA 3U5TA 1PHPA 1PX0A 3ESZA 5KDLA 1ZH8A 3L40A 1TUGA 3BRSA 5JMTA 4BBZA 2O2SA 1JG3A 3BHIA 3NDPA 5CLIA 3TMKA 4W5WA 2R48A 4NF2A 1HT2E 1P61B 2QUKA 4HAOA 2Q5CA 1MKYA 4X0EA 1X9GA 1EDOA 1TXGA 2H06A 3CRNA 1TD9A 2XNKA 3BB1A 4FINA 2PS9A 3E22A 4OB7A 4P7KA 3WBKA 1Z5WA 3DGFC 1TC2A 2G9NA 4TWAA 1USWA 1WKCA 2H0QA 4H77A 3WGIA 4URYR 3CEMA 4WFQA 3TINA 5AI9A 3U48A 5BSWA 4L0MA 4RZHA 5JEDA 2WW8A 4G5XA 5LQNA 1RRFA 4UATA 4GOLD 2JI9A 3GT0A 1OI7A 4PLTA 1T8TA 2VTBB 3BULA 3H0EA 1K2WA 3SC2B 1ZUHA 3BEOA 4P3PA 1ZN7A 1CUFA 1W0JA 3ZIAA 1K6XA 2Q28A 2JJ8A 2J4CA 2ZRHA 1M54A 2AFIE 5CRIA 5IT4A 1MZVA 2PL3A 4YP5A 2YXBA 2NT3A 4MTCA 4OV6B 2YH2A 3DG9A 3I52A 4DEVA 3N2KA 1O94D 1J0AA 1OIWA 3KUDA 1GGHA 2AOTB 5DGCA 3QITA 4D56A 2WK1A 3FUUA 4L78A 5ITWA 3W5BA 1P7VA 3F9RA 4B71A 2QD5A 2FHPA 2QTWB 2X13A 3AKCA 2GFIA 1T3GA 3A1CA 4Q03A 1NUAA 2QLBA 4UXIA 4BAGA 4OQEA 2Y9MB 2H18A 3U3RA 1ISSA 3IULA 3VC2A 4TV8B 4RETA 1MOSA 3AERA 5K3EA 4H4DA 3CS3A 3HVHA 1B00A 2DH5A 1P5HA 2V1XA 3QK7A 1V7PC 1MIOA 4CEHA 1J0DA 3IPYA 4S12A 2CD7A 2JLUA 4B4UA 1EVJA 1I6WA 3IIJA 4INOA 1GP2A 3LX6A 1UBNA 2JFNA 4BFUA 1U8EA 4ZYVA 3OLXA 1M2VB 4RGQA 3A27A 3WLQA 1US8B 3EYWA 2JVKA 1P0FA 3EQ7A 2Q5FA 1OX6A 3GLQA 3P9IA 3ZDZB 2PGOA 2X5JO 3BA1A 5F9MA 5F7ZA 5BV7A 5JBNA 4LGMA 2V7TA 5H5JA 3IVXA 2X77A 5BNIA 1CNMA 1TEZA 1Z4KA 1J5XA 3OD5A 5ITZA 3D8SA 3PFNA 2CNWA 3S70A 4ZK6A 1RXWA 2FSFA 1FJXA 4LZOA 3WK6A 4UXJA 2JFQA 4Z4CA 4J43A 2DPHA 1K6IA 1ENPA 5FULA 2VJCA 1JG6A 3JQ7A 3AHEA 5DW0A 1KKLA 1TJ3A 1Z06A 1RM4A 2AUMA 1LRKA 1SO8A 4OO3A 2HCBA 4P92A 3EC2A 1WMDA 5JCXA 2J4FA 3LWZA 3CNNA 4Q4CA 5JSUA 2WF6A 4LNUA 4MKGA 5FD8A 3SJUA 3WA6A 1R8QA 1Z9BA 3TR0A 1IXKA 3U3JA 5B7NA 5BWMA 4W8GA 5BWLA 1B8OA 3KYIB 3UA4A 1KNQA 4ZMSA 3CVUA 4B83A 2YOHA 4IMIB 4JT4A 5JY1A 5ESDA 4GX2A 1UMCB 2QA5A 5BW8A 5JPCA 3R9XA 4AFNA 1C9DB 1XYYA 4ZRDA 2ZTLA 5SZIA 5SZKB 5BSVA 2GCOA 4U7PB 1J07A 2WKWA 4NOKA 4UBJA 1CJKC 3HUFA 2A0UA 2Z2KA 4NPHA 4QDXA 3LECA 3AVUA 2G4VA 1JMKC 1E0DA 2GI4A 5EXDA 3DTNA 5IF9A 1PP4A 1FSPA 1NQVA 2OOSA 4O4IA 2WSSD 3KD3A 4FD2A 5JT1A 1Y6GA 5HS6A 1H2AS 4F92B 3FOAA 4AI6A 4Q4AB 1E2QA 4EGJA 1Y82A 3TRFA 3HUEA 3U19A 1F5NA 1SOUA 1P29A 1ZH0A 4GDMA 4U02A 2CL6X 1SXJB 3IBYA 4GS5A 3FCYA 3LTEA 1LNQA 2AXEA 3KE9A 1VYHA 1T0IA 1ZD2P 2G1JA 2GN4A 2IRWA 1Z5GA 2FX5A 3DBIA 4LQDA 4M76B 4EEKA 2PZGA 3QU4A 3KZNA 1CR2A 2Q7DA 5KWJA 3GRVA 4CU5A 3CVJA 1PHRA 3VDQA 4LE2A 1ZRSA 4HRVA 4GNKA 1QTIA 1WSDA 2W2LA 5G41A 2OCKA 1G8PA 3P45A 1MMFB 3OVMA 4OQNA 2WIDA 1ZJWA 4NYMQ 2RHWA 4WK2B 1DIOB 1H1LB 4XWAA 2DVMA 1VC2A 2IYEA 3D4IA 5HIJA 4O25A 3DW3X 3E8MA 4REQA 3R76A 2CHEA 3CNLA 1IN6A 1Y6RA 3Q3JB 1M34E 3ROGA 3I4FA 3S55A 4D80A 4XZ3A 2W8ZA 2O14A 4Z1MA 3IXQA 1T25A 2C57A 5CBPB 1OFIA 3RV4A 3FTFA 1N33B 1JLLB 2FSVC 4B0OA 1EUZA 2JEOA 1UPAA 3FFAA 2A8YA 3I2KA 4JP2A 3W7BA 4D2IA 2VUHB 1Z7YA 4RWEA 5EHQA 1JHUA 4ENVA 1QRAA 3KQLA 3ADDA 2PMFA 5K1ZA 5C8DA 1XFAA 4G0OA 1GUYA 4L8GA 2TSYB 5JBQA 1S8NA 3AP1A 3BFJA 1KI7A 2CXXA 4X41A 5KYVA 1I5EA 2JANA 1Z2PX 2NG1A 3MC1A 4XXHA 3S1LA 1GKYA 3A25A 5J43A 3NUZA 5I9SA 2W83A 4O63O 1YULA 4EUHA 4HN2A 4MPRA 2H59A 1B43A 4RJ2A 4JJAA 1WHSB 3HI6A 3GWGA 2WF5A 2O54A 2Q8NA 4F6RB 4N7JA 4NCHA 3TRHA 1OI2A 2D3TA 2QM8A 3E58A 2P4EA 3EH1A 3OCVA 5DRYA 4AF8A 5A5EA 1FMCA 3UJBA 3G2OA 1SUCA 3GLFA 4EKYA 1WDWB 3RAFC 2X15A 4CMIB 5J4YA 2VPQA 5CITA 1ND6A 5KAMA 2EHDA 1LLQA 1JKFA 1KI6B 2VP9A 2YYYA 1B6TA 5AVTA 1I1QB 3AU9A 2WSYB 5EESA 4WDQA 2HM7A 1J2YA 2Q3JA 2R6HA 3LK6A 3M82A 2Q2VA 2W6PA 3O1IC 4WLFA 5AOVA 2IV3A 3IEVA 4JBLA 2GCEA 4ARBA 2EGHA 4AYXA 2D8MA 5JJIA 5TV2A 4CM3A 1YQGA 1BXGB 3BQMB 1FMJA 1G20A 5TMEA 5BSKA 5JCJA 4V02A 3R5JA 2DLNA 3HI4A 1ZM9A 1OLSB 1UKEA 3GLIE 4YCBA 4FW8A 3ZD7A 1VI5A 1Y1SA 1XZ8A 4AUNA 1MT0A 2WAMA 5D3ZA 5KMGA 1I7NA 4QPDA 4KR2A 3QYPA 1NVWQ 2C2XA 3DMGA 1ZIXA 3QGMA 4E22A 2Z3VA 4BEWA 2NP6A 3DDNA 2E55A 4DV1B 4RENA 1DAEA 4Z1MD 4O2BA 3W5IA 2YOGA 3EZ9A 1E8DA 2ZJOA 1IVSA 4N40A 2NW6A 3SIWA 2AVDA 4QSHA 4IXDA 1PNRA 3R3HA 3B5EA 1Z45A 4BLRA 4NPAA 4L8FA 5LZ5A 4NDAA 4BMXA 4GRDA 1QV9A 1UODA 3SEZA 5C1PA 5K0ZA 3PEUA 1Z2DA 1K66A 4AMZA 2XODA 5A6SB 3WQBA 4YRBA 2PUFA 1KYVA 2QU8A 2DSNA 3PT5A 4MQUA 4H1VA 5AHKA 2YBDA 3ORQA 1LK7A 2Z9CA 1YMQA 3B12A 4W82A 3WRYA 1YA6A 2QP9X 2VBIA 2HWXA 3H2SA 1DEHA 1G291 4JIMA 3QUBA 2G72A 4ZV7A 4YR7A 4M54A 4D98A 1QPGA 5JHGB 3KLMX 1JYEA 1IWPB 3QJGA 4ARUA 1WXWA 2AR0A 2JLCA 3TQOA 4D3YA 2HSJA 2XYRA 4M8IA 2P6NA 4UNPA 5DW3A 4HLQB 4ZP1A 3ZCUA 3M3PA 4OBEA 1CNEA 4RTLA 4KRFA 2FUG1 1I7PA 3FZGA 3ME5A 4N9QA 3GDHA 3DEZA 5GPBA 5I4BA 4QEZA 5FPSA 2QAJA 2Z95A 3SSAA 3X1YA 3OEEA 4JLBA 3WDLA 1JPUA 2I67A 4R9SA 4RFLA 3OWOA 2H9YA 4TQAA 1G5HA 3CWQA 4HDCA 3OCYA 4JB8A 4QT0A 1XXLA 1EBUA 2VP3A 5F33A 1JHVA 4PO3X 5D3QA 3WIVA 1XRNA 3WL4A 4C0LA 3SQLA 2D0DA 5ELXA 1DGQA 5DISB 1E6WA 1JHOA 3ONFA 3W34A 4FEEA 4Y6GB 3FBWA 4MHSA 3U61B 1J7JA 2J3QA 1I0IA 3FHCB 3I2GA 1E2JA 4FYVA 4D5GA 1S8OA 2VYQA 2OO5A 2R8BA 1RBYA 4DA8A 4E13A 5JQWA 1XHLA 721PA 5IK2D 3A10A 4J4HA 4W6QA 4ZTUB 2QI9F 3Q9SA 3BMNB 3H1GA 3WK8A 4QEKA 4Z3KA 5AW7A 3R3ZA 1IG3A 5D5QA 2D5LA 3OPVA 3H11B 4QDTA 2R25B 4M9XA 2GARA 4WECA 2J31A 3T1NA 3LOUA 4L3VA 3FAKA 2IU6A 1YGPA 4RFSA 2FPXA 1R9NA 3PEEA 3TMYA 3UFBA 2OC9A 2YVUA 3UWSA 3EGXB 4YREA 2X14A 1QP8A 3ISJA 4DR4B 3NHUA 2IKQA 1ABBA 3MHTA 1H2HA 1CDEA 3UBMA 1R5NA 4OP3A 2CY0A 5KVAA 3N0RA 1IRIA 2X2PA 3VNSA 3VNQA 4EFLA 1JDZA 5JFGA 3DMNA 2GESA 1IHDA 1WUHS 2VRCA 3EPRA 2FZ4A 2IYZA 1U8CB 3MTGA 4AB1A 5DTQA 5NLLA 3K20A 1KIMA 1OC4A 4PYNA 3ESYA 3HDHA 4DLNA 3S81A 2IZ6A 3HXPA 5DCUA 2BZ0A 2OAEA 1ZSNA 4LAFA 2ZE6A 1QG0A 2PKYX 4LXHA 1DG1G 2OMEA 5HR5A 1FYWA 5LZ4A 1WZEA 1E2BA 1RBQA 1CUVA 1WXXA 2IV2X 4NMMA 5AKLA 2F1KA 3D5TA 1ISPA 3FPGA 1BKSB 1HYEA 4J0DA 1G63A 4M36A 3UYLA 4GXNA 2A5LA 1DBQA 3HO6A 1T9DA 1ZH4A 2KQUA 3PUJA 1XTRA 3GPBA 4W8HA 1XQ6A 1W4RA 3P5BA 5KOYA 4M1EA 3OKCA 3EDRA 2Z83A 1PIWA 3JQRA 3WNBA 3VNUA 2F43A 4A7PA 1ZK2A 1PU2A 4BVHA 1D5CA 1JW9B 2ZUCA 1JPNA 1T4MA 1XRLA 4NWIA 2IITA 3P0IA 4KU4A 2YVLA 2ZB7A 2V4MA 4TS3A 2WICA 2HO5A 1G20E 5AH0A 2EERA 4G0ZA 1YC2A 2DPLA 4XB1A 5H83A 4OLJA 2HJGA 3BILA 1UMKA 3M0EA 4AJ1A 1NATA 2GX6A 3EASA 4HSEA 3X1ZA 2RIRA 2AFIA 4HGRA 3DLBA 2JAQA 2WUWE 1KC1A 2EYQA 1LJLA 1UC4B 1UDAA 1DWPA 1R2QA 5KU1A 3LPCA 4XLLA 3ZY4A 4AKSA 1HEUA 3BJMA 4DQDA 2JIBA 2N3ZA 1NN3A 4DY4A 2OMKA 3U44A 3NYRA 4JJKA 2ORWA 4BFCA 3ZH9B 5K0FA 5B58C 3C3WA 2BPOA 4BMVA 1H66A 3A11A 1X1AA 5C9ZA 1YBFA 1HYGA 3A58B 3PS9A 2W58A 1OVGA 4Q93A 4LCJA 3SLKA 4C4OA 3DBHA 4MAFA 2ACKA 4OBBA 1DT3A 4MV8A 4QDOA 4BVBA 4NBUA 4RM3A 3PDJA 1OHHD 1CRQA 3QMMA 5F1YA 1UOQA 1IBCA 4KMMA 4EBBA 4GGPA 4EG5A 1YIDA 2QZZA 5CA0F 1SM4A 5BNZA 2YIVX 1U7DA 2H07A 1KP2A 4Q1DA 4EYOA 1YZHA 2O57A 2VSFA 3N1UA 3BH6A 5H80A 1WWKA 3VOBA 2B82A 1TK2A 3QHPA 4HH0A 2P0EA 2ASVA 1CUWA 1C4XA 3UMJA 1AUOA 1XD9A 2Q41A 3ZYCA 1U5BA 1B41A 1F4PA 1ODKA 2J3KA 2Q1SA 4PYKA 1CZRA 4RDCA 4ZJZA 1GTJ1 4JJIA 1MNQA 2VQDA 1C7RA 4EGSA 4NG5A 3NPAA 4Q4HB 4JUCA 4Q1VA 4R7ZA 4PHGA 4X45A 5FJJA 1YU6A 3S8YA 4JLMA 4Q3AA 2AGVA 3H5VA 1VZ3A 2XOKA 1LQUA 1G0OA 4UU8A 2NQTA 2B21A 1M8JA 1TZBA 2LCIA 2DQKA 2WOOA 3VRHA 1P74A 4MQFB 2J6BA 3EW7A 1EJBA 4DADA 1AUXA 2OHXA 1OU0A 2R1VA 3PD7A 4DABA 2O5RA 1DP4A 1YJXA 1XB2A 4BUJA 5BRAA 5CG2A 3I9NA 3M9WA 2CHUA 1HL7A 2JLSA 5AUPB 2BHNA 1PJQA 3DDUA 2WTBA 3U31A 3FYUC 3W78A 2BYTA 1QDLB 2GAJA 3M4NA 4KHPB 1L5OA 4NG4A 4KSCA 3RF6A 1A5ZA 3DT9A 3LYUA 3CZAA 3QPCA 2TS1A 3P2IA 4OJNA 5I7SA 1W7AA 1ZUNA 3KDPA 4YMSA 3V8PA 2ZI6A 4FOSA 1NPDA 3PHCA 1G9SA 4GP9A 3O8OA 4B3XA 3O83A 2Y4NA 2IF0A 3FE2A 2O2IA 3VYUB 3ROMA 3BDAA 3TLCA 1C2TA 1Q84A 4YJ2A 2BJVA 1DX6A 3JYHA 5E7JA 3V8NA 4E6EA 3GCXA 4BEJA 3E6AA 1FJHA 4K86A 2YJ6A 1N9KA 4LYGA 4AYWA 1Y33E 2FPGB 3TVTA 4HDRA 3FYTA 4BASA 4JB3A 1LJ8A 3HYCA 4GC9A 4FBLA 4RTKA 4OI0A 4KRXA 4HHEA 2PUAA 1U8UA 3Q7SA 1GKLA 3UT5B 4OQZA 5FHRA 4ZRMA 4BBAA 3DR5A 3KSBC 1FVFA 5ALUA 3UJCA 3FWHA 2HTFA 2QN3A 3DTVA 4OGKA 5K8JB 1KDPA 1KGSA 1P1IA 2B9EA 3L82B 4D0NA 2NU7B 3IPCA 1C9JA 3GR6A 3IDSA 3H1AA 1QORA 3CO5A 1SG9A 3LXUX 4KQKA 1DBIA 2FPMA 1OFVA 3L1IA 4V0SA 4WOJA 2FW6A 1ZMOA 2JGKA 1LBSA 4PLZA 1EFRD 2LNDA 3FZYA 1DU4A 4MICA 2IU0A 5LOVB 1Z6TA 1HT3A 4M8KA 4W9MC 3PA8A 2WT9A 4H3SA 4H4CA 3AF1A 4GKBA 2PO7A 2FZ5A 3IA7A 4QFBA 3BJZA 5D8DA 1WXFA 1S2LA 4MUAA 4K6OA 4PXYA 1QPBA 1OV4A 1WVIA 3WFIA 1GVNB 3QKIA 2O0LA 2ZE7A 3VPXA 2PWYA 3UPTA 5ALPA 3S99A 5DDIP 3RD5A 5IVKA 3JRXA 4EG1A 4MRNA 4A91A 4CEIA 1VKNA 3L49A 4IAOA 1T43A 5BQ5A 1U3CA 4KQMA 3VR0A 3MGAA 5A3JA 4GPAA 5DNYB 3Q8KA 2IW3A 2RFLA 3IGFA 1R0WA 2D00A 2JIPA 3WP0A 2BZ1A 2MU1A 3C3XA 1SCQA 2VRCD 4QWMA 5TQJA 2FSSA 2Q9AA 2J1LA 2Q6IA 1X7HA 4OA8A 1T3LA 1X1CA 4EYSA 2LD4A 3SS9X 4EY4A 1U9ZA 3RDPA 1IBLB 3TG8A 4GLLA 1K5DA 3EXEB 2F3TA 3WLPA 1X9HA 3I64A 2O7SA 3KTAA 4YDQA 3V3TA 4Z7JA 1P1RA 5JZOA 1IMJA 1SRQA 3PICA 1ISHA 2RI1A 2X2OA 1M7HA 1VA5A 4IIVA 1UBUS 2ADFA 3I2FA 3BAZA 4P3NA 5KC9A 2GCPA 2Q5LA 2Z4TA 3H97A 3DEFA 4B82A 4F9EA 1WB9A 3KZ1E 2XB2A 1LV8A 3RNOA 4YRTA 2VNHA 3KPVA 2ZYIA 2BDEA 1K2VN 4YC7A 3CPHA 1PNOA 1TYAE 1KMIY 1YZNA 3UXYA 4TZTA 3CVXA 3SN6A 2I2CA 2FOIA 1SHJA 3MEQA 1WXEA 3QX8A 3OZEA 4HCJA 3ROFA 4EFNA 5BV0A 1LRJA 3KLPX 1OGYA 1EIZA 2C7BA 3UM9A 3EULA 2DPMA 1JV2B 3ZXIA 2H4FA 1JG1A 1KJ9A 1DEKA 3IT0A 4RWZA 2XCTB 2AZXA 2KLHA 1VKRA 2NTVA 2VPXA 4H27A 4PSCA 3ROKA 3IEPA 1IK6A 3L7NA 4RV5A 4BC0A 3TIFA 3CWZA 4BLQA 2AMJA 1T9ZA 4YRPA 3AZQA 1HURA 4FYIA 1NUSA 4YAUA 1W73A 1VFPA 3P2JA 4RKEA 1RPZA 1VKHA 1HG1A 2GD0A 5BORA 4X24A 5IULC 2OHFA 1UC9A 1H2YA 1ORDA 1CJBA 1EX1A 1EVZA 3VVLA 3NKLA 1XJQA 2GILA 3QF7A 4G1FA 1GAEO 3MBKA 4LJ7A 4CTJA 1TGYA 2DFTA 2PVCA 3GVIA 3UWDA 8ABPA 1KEEB 3KJFA 1G6KA 3PXUA 3UXMA 3W6OA 1GLGA 2F48A 3V00A 2F64A 4YRJA 4LYFA 4AMYA 1UEJA 3DM9B 1CY0A 1QS0A 4FE7A 1JSLA 1ZJZA 1ORVA 2J30A 2OV6A 2WMYA 3FPBA 2GUWA 4GMDA 4U63A 3VZBA 3KB8A 4MP3A 1FVOA 1S4QA 3FPKA 3DQPA 3RBVA 1QLJA 4BPBA 3PD0A 4MIKA 5A03A 5C7OO 3I5XA 3TRKA 1N9GA 1YA4A 4LHSA 4D4LA 3RV3A 4X44A 1R6DA 1B8PA 5AW5A 2WMDA 3VR4D 1PKXA 4CMHA 1MDBA 3D8NA 3K2QA 1Z4QA 3QVWA 1TZ2A 2H4JA 4I8DA 5CEJA 4DQVA 3SNKA 3L9XA 3Q3GE 2YFQA 4B5KA 2C7RA 4M49A 2J3EA 2FE4A 2O7QA 1Q57A 3L05A 5FBRB 4NDNE 3ED5A 4XJSA 2BI8A 1SBYA 4BRZA 4CLDA 1YL7A 4ZQCB 9ABPA 4FCWA 1G9TA 4INZA 2R6CA 4EY7A 8GPBA 4LSGA 1TAGA 5I6DA 2IGBA 3BRQA 2BFFA 3M1YA 3TB4A 3RQIA 2BMJA 3PGMA 3HFGA 3X1MA 4KNWA 3ASZA 3ZWDA 4AQ7A 1SQ6A 1YRYE 1HPLA 4L4YA 2XTJA 2YNMD 1FMTA 2JK0A 3CF2A 4TWIA 2CMHA 2PNFA 4HAWA 3TBHA 3EQ9A 4X6XA 4QJBA 3TE6A 3EUEA 1SOAA 1PKEA 4TMKA 5CW2A 4WCFB 4NIMA 5AMXA 5CR9A 5BN1A 1SUWA 2AL7A 3NTUA 2ZUTA 4GM0A 3RS0A 2PGXA 5MFZA 4LE1A 3UXEA 2XQJA 4KHZA 2DFPA 6AT1A 3HXQA 4I1SA 4JLUA 4OHYA 3RU2A 1V6SA 3WGJA 1NJFA 3TUIC 2V4ZA 1MV5A 1KDOA 4ZOCA 5GONA 1J2JA 3VUFA 3GLGE 3UBTA 1YR8A 2O7NA 1HDIA 3F7OA 2QUZA 2IEZA 4HNSA 4MCIA 4UASA 5DN6A 4NXMB 1PWYE 2LP4Y 4HDAA 2FR1A 1D5WA 1XTSA 4GPIB 4ZVUA 1A9PA 1U6JA 2JLXA 4BNIA 5JMPA 2COEA 4BMPB 1QGZA 1ZCFA 2QYTA 1ID8A 4WOCA 4I5GA 2VP6A 2DJ5A 1IZ7A 1FRNA 2FWPA 1V11B 1JDUA 1YDFA 3HYTA 4BC1A 3SPXA 2VHYA 4P31A 2NMVA 4OB6A 2POCA 1X13A 3LQKA 3ADPA 3GRFA 5AW8A 4M0FA 1RMYA 2B35A 5EWLB 3UUWA 2PD6A 2B0JA 3RPEA 3QVKA 3CTMA 1V37A 2BP7B 3C6ZA 4FJ1A 1DZ3A 3T52A 4G8CA 4GMFA 2O8CB 1CUYA 4GX0A 2TMDA 2R6ZA 4AO7A 1GCIA 1RVDA 2QL9A 5BQPA 1UFKA 1XKXA 4DMFA 1TUBB 2GK3A 1VG0B 3A6KA 5E1DA 5T5QA 3U7GA 2OE2A 2YJGA 3V8BA 4NABA 3HYNA 4Y7DA 4QNMA 2GDZA 5FOVA 4MQEA 1WDLA 2VCHA 4GOMD 4O5OA 2WJPA 3JQGB 4ZC1A 4F7DA 2IPLA 5HHTA 2F7SA 2O2ZA 1E1DA 2Y77A 2FPSA 3LY5A 3OOHA 3V2UA 9GPBA 5JJLA 3O8RA 5HG0A 4C7VA 3WO1A 4CMBA 3OETA 3PJEA 2GYVA 4LHEA 5L3RA 3RIMA 2QV7A 3E48A 3MINB 4LTDA 1XNQB 1X7YB 5BW4A 2EFCB 5IFLA 3K30A 5AD1A 3PPVA 3VU3A 5CM2Z 3CUWA 3W9UA 1KAEA 3AZOA 3I01M 2PKQO 1EJ2A 5GZ6A 1DXHA 1XMVA 2HZ7A 2ZDGA 5K4GA 4DHEA 5A4AA 2QHXA 2P2YA 4RTOA 3EIUA 3M6WA 5FI0B 1ZKMA 1ONOA 1LPMA 1YS2X 2G36A 5K8VA 1U9YA 5HRAA 3B60A 2E82A 3FZQA 4MKIA 4WFIA 4BJ1A 5CNJA 4I4TF 4QQKA 3T1TA 1Z28A 1NE7A 1YZYA 2DHRA 2G4LA 3KKPA 3IYLW 4G9EA 1FS4A 5EEHA 1GQFA 2A92A 2PKWA 2XR1A 3A06A 4IOLA 3RC8A 3KKQA 3CNBA 4H6XA 1YR6A 4WH0A 5H02A 4ME6A 3GW8A 4Q7JB 5AKZA 4LZZA 4CDRA 2QUIA 1YD7A 3AF0A 3D7MA 1XTJA 5CH5A 2XAAA 5EUMA 5ESXA 1GU0A 1OWPA 4RIGA 2CMGA 2QLFA 1LU9A 1L5WA 3QKTA 4FMPA 4DIFA 4O4LA 4ARVA 1OLUB 3ZJTA 1VRWA 4B73A 1X8KA 2BRUA 3Q5EA 2WE8A 3IR5A 4TV9B 4ZCMA 4CKWA 3OMWA 1DQPA 4L2IB 4PYOA 1Z8DA 1DARA 2ODPA 3OKAA 1PDWA 4HAYA 4V03A 3V4PB 3KZOA 1X80A 3HBNA 1YVUA 3W5JA 4W5NA 1VHJA 1GXSB 1ML4A 1ENYA 2CHFA 2XVXA 3O26A 1GDDA 3UHOA 4EYQA 5ELLA 3DAPA 5H0IA 2VDWB 1XTIA 1BVRA 4ZCLA 2XMGA 1ZITA 2NVBA 3THYB 3Q88A 4LYDA 4F3RA 4RCZA 1JAIA 2RJ3A 1GN9A 1Q7GA 3A31A 3I23A 4HJRA 4TKZA 4MUJA 5AICA 1MD9A 4WTOA 5IG2A 1SELA 4QARA 4M88A 3NKVA 4L07A 2PAFA 4AAYA 1O96B 4IPTA 1T2CA 1TECE 4OK3A 3BRWD 2BSQA 1CEYA 3W9SA 1B15A 3WWOA 3ZCTA 4DBLE 3WGOA 4XUDA 2XX3A 1JT2A 1T0UA 1UZAA 2QPAA 3ZLTA 5L7WA 4HB4A 5C35A 4AZ3A 2I8CA 1X80B 5KYTA 1GXSA 4UDYX 4F4JA 2DEUA 2DT8A 4ARSA 4HZUA 3BTSA 4IHJB 4OIFA 3KQVA 2CJWB 1UM8A 3NT4A 5JOQA 3C87A 4IJMA 4PO9A 3G2IA 5JMWA 3G0HA 2RH8A 2X40A 1I14A 2CBGA 1LWOA 4CWAA 5FT9A 4NXNB 3NIDB 3QRWA 5D3MA 4ROSA 4EKIA 5AVXA 4UFOA 2I6XA 4FP9A 4TLEA 1XV5A 1PYOA 1QF7A 1JJIA 1H1TA 4QUGA 5ICFA 1ZIOA 1M8GA 1XK7A 2WINI 5HBRA 4YX9A 2OXEA 1O08A 4KO4S 3FNIA 4NYIQ 3EMKA 4UW9A 1C0PA 3FVWA 2CXNA 2VA8A 2VF2A 1VMAA 4LZNA 3RQSA 4ZEXA 5HK9A 2QVXX 3PHGA 4PRZA 1FTYA 2QG9A 1CB0A 1JTEA 2JASA 2F3UA 5D5PA 1J49A 3NG1A 4I6GA 3RUIA 3TJMA 3U4IA 5B1EA 1CZNA 5AVQA 2HFKA 2OD7A 3ICVA 3I45A 2YZMA 5J2TF 1OXTA 2LR0A 4JCCA 2VYND 4R3UC 3F9IA 5IW8A 3PFHA 3KQNA 1X38A 4WLNA 3UENA 1N5LA 4U7HA 5D3MB 5ARCA 1ZHFA 2GF2A 4NU5A 4X90A 4OH1A 1Z5ZA