3S2ZA

Crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant in complex with caffeic acid
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
251
structure length
251
Chain Sequence
NLYFQGMATITLERDGLQLVGTREEPFGEIYDMAIIFHGFTANRNTSLLREIANSLRDENIASVRFDFNGHGDSDGKFENMTVLNEIEDANAILNYVKTDPHVRNIYLVGHAQGGVVASMLAGLYPDLIKKVVLLAPAATLKGDALEGNTQGVTYNPDHIPDRLPFKDLTLGGFYLRIAQQLPIYEVSAQFTKPVCLIHGTDDTVVSPNASKKYDQIYQNSTLHLIEGADHCFSDSYQKNAVNLTTDFLQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cinnamoyl esterase
publication title An inserted alpha/beta subdomain shapes the catalytic pocket of Lactobacillus johnsonii cinnamoyl esterase.
pubmed doi rcsb
source organism Lactobacillus johnsonii
molecule tags Hydrolase
total genus 88
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature ec 3.1.1.-:
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s2zA00
1CV2A 4U2FA 3C6XA 4O08A 4G1FA 2G5TA 1I6WA 2XUHA 4JYMA 1UKCA 4H7DA 4H7IA 4DM7A 4L0CA 1H23A 4UHDA 2Q0XA 4OU4A 3STVA 3C43A 1UOPA 2BGNA 3HEAA 3DD5A 4PNZA 3KOOA 2QS9A 2WIJA 4DYHA 2WUDA 2Y6UA 5E4YA 4UUQA 4BE4A 2WU4A 1WB5A 1M33A 1FFEA 5K3BA 3DKRA 1ZJ4A 3JYHA 4BZZA 1K4YA 3I2HA 4XX1A 2B4KA 3FNBA 4LYEA 1JFRA 4C87A 5H3HA 3WKDA 3R0VA 1QIEA 4H7KA 3D0KA 3DKKA 5ESRA 1TRHA 1F0NA 1XLWA 2QOEA 2VJBA 3DLTA 2VAVA 1CUWA 3D2AA 2AJLI 3AIMA 4U2CA 4DNFA 2WIGA 4L9AA 5HQ3A 1ZD3A 1U2EA 2WU3A 2HM7A 2XB6A 4OD0A 5FXMA 3N0TA 3D59A 1XLUA 3QMMA 1WCYA 4H7FA 2GYWA 4LXHA 1Q0ZA 1VKHA 3BJRA 4H7EA 1G4HA 3FVTA 4FBMA 5DTIA 5DNVA 2WG1A 1XZMA 5HCUA 5ALQA 3AIKA 3OTQA 1XZLA 3C6ZA 3I2FA 2XMCA 2ONCA 4HXGA 1QIJA 3H1BA 4BATA 1XRQA 2PM8A 3VKFA 3IUQA 1BN6A 4OYYA 1BS9A 3DQZA 5ALRA 2XUPA 4X6YA 1CIJA 3C70A 5AOCA 4KRXA 2O7RA 4BP8A 2PU7A 1ODCA 5FRDA 1SCKA 3W04A 5HZGA 5AK4A 1LPSA 1K6EA 4AZ3A 4KAFA 5I8PA 5ALXA 1UK6A 3GZJA 2WUEA 1QFSA 3TEJA 5AKYA 2PSHA 3ZPXA 1X2BA 4P9NA 5AM1A 5AK3A 2XLCA 4BB0A 4N8EA 2WTMA 2Y2UA 2I78A 4OU5A 3WWCA 3GROA 1SC9A 1BROA 2JEYA 3I6YA 4QDTA 1QIFA 3IB3A 4Q82A 4RE5A 5LZ9A 4XWGA 4CIBA 1YCDA 4X95A 4J3JA 1JT2A 2J3DA 2JF0A 3HJUA 1QIDA 3D3NA 4BE9A 3VJKA 4FTWA 2PKYX 3C6YA 1HDEA 2ZSHA 3CN7A 4Y2YA 3LIPA 4PSDA 1JMKC 4CCYA 2CBGA 4X93A 1QGED 2WQZA 2OLEA 1LBSA 5T4BA 1A8QA 2HFJA 4BBZA 1BCSA 1W52X 2R8BA 4XVCA 4J0GA 3ESCA 3R41A 4EY7A 2Z8ZA 2AXEA 3PE6A 5FDFA 4P92A 5ALPA 4IO0A 2B61A 5I9IA 4WFIA 2XUAA 3X3HA 3STWA 3JWEA 1UKBA 3QMVA 3G0IA 3SX4A 3HXKA 1E8DA 3LP5A 2GBCA 3CCCA 2H1IA 1XZDA 3M82A 5DYTA 3DEAA 4F5ZA 2RIPA 2O7VA 2XUFA 1EXWA 1EX9A 2OCGA 4EY6A 3U0VA 3B3QA 4AO8A 1ZI8A 4J0JA 4MQMA 5AJHA 1VA5A 2WIKA 4M0EA 4UPDA 5CXXA 2RONA 2CB9A 3A70A 1XZFA 2XUDA 3WWEA 3WJ2A 3NWOA 4A16A 5ALHA 3AFIA 3IURA 2BGRA 3WLAA 1EDDA 1E8MA 4QDUA 1AZWA 5IVIA 5HFAA 2X8BA 4MEBA 2WIFA 3PF9A 3ESBA 4PO3X 5HKBA 4EY5A 3C5VA 3U1TA 1QOZA 3RKSA 4QLAA 5ALUA 5T4EA 2VSQA 4J0HA 4ARBA 1QFMA 4UHHA 3VVLA 2ZYHA 3BIWA 2DR0A 2VA9A 4YPVA 4X00A 3G02A 4AN1A 1EDBA 1U8EA 4XJVA 2QM0A 4U2EA 3FBWA 3CXUA 1TK3A 4WJLA 3MUNA 1TAHA 4GHWA 3WA7A 3DYVA 2XUJA 4FWBA 1ISPA 4BVKA 1R9MA 1OILA 1X70A 1H2YA 5EHXA 3C6BA 3UMJA 1XZAA 3B12A 5DYYA 4X97A 3WK9A 3H17A 4E14A 3C45A 5EHZA 1CQZA 4B83A 1MX9A 4DMKA 3QH4A 3FCXA 4KR0A 4QDOA 1MAAA 3F9CA 4Q05A 4JH0A 2RAUA 2C58A 5A6VA 2D0DA 3STUA 1PFQA 3UUFA 4FMPA 3F98A 5C8VA 3EQ8A 4AO6A 1Q0RA 2K2QB 3AILA 2WJ3A 3MGAA 3GBSA 3JW8A 4Y2PA 3CN9A 1XFDA 1CUHA 2I3ZA 5SYMA 5ALSA 1LPAB 3D5EA 3RLIA 1QO9A 3I2KA 3MUOA 2WKWA 4U2BA 2HA7A 3WIOA 1BRTA 4DMFA 2EDAA 2GZSA 4AXBA 4UFPA 1QLWA 2XUKA 3WL5A 3DYIA 2ZYRA 3AUKA 2XQGA 1N5MA 4RE6A 5LLSA 2OGTA 3EIOA 3TGLA 4H18A 1WPRA 3V48A 3BF8A 1IVYA 1DX6A 4JUIA 5AKGA 3Q8WA 2RI6A 4WY8A 3ZV7A 4MWTA 2HA0A 1Z68A 1N1MA 4FOLA 5D6OA 2W22A 1VJ5A 2HA6A 4FLEA 2D5LA 5KWJA 3DS8A 5JZBA 2JBWA 3I2IA 3BDIA 3C87A 4LIPD 4EHBA 4TVKA 1YS1X 3IUNA 3H2GA 3K6KA 3H2HA 4G4GA 1XRPA 3K9BA 3GUUA 5CT5A 4DTCA 4KAJA 3WA6A 3BXPA 1EK1A 1K8QA 3PUHA 4UBIA 1CUIA 1L7QA 2VATA 5D3ZA 2VTVA 2QT9A 3KWJA 4HRYA 4DGQA 4X92A 1AGYA 5CH3A 3DDUA 1ZI9A 1ZIXA 4W1SA 3D4LA 4OB7A 4UBNA 3NUZA 3WWOA 1MT3A 4J7AA 1YB6A 5HK8A 3IIIA 3O4GA 2WFLA 1KEZA 2XQFA 1CUDA 4C6HA 4HZGA 5EIAA 5AIAA 3QPAA 4X6XA 4M0MA 4UBOA 3S2ZA 4LXGA 3I1YA 1IZ8A 2OCLA 2XMGA 3LLCA 4GXNA 4B82A 2GBFA 2QKYA 2NW6A 4ETWA 1XQWA 3RM3A 3O4JA 4G5XA 3IULA 2WHPA 2V9ZA 1P0IA 1DQZA 5AIBA 3H19A 1ZGCA 4GEGA 1GQSA 1VOTA 5FP0A 2PU5A 2RHTA 2JIDA 5EIHA 1GXSA 4AN0A 4LXIA 1AUOA 2DCMA 5HF5A 1KU6A 3R3XA 1TCAA 4X71A 3ANTA 1PJAA 1CPYA 1XRNA 1MO2A 2WJ6A 3WWPA 1NU8A 4N8DA 3ZLUA 4KE7A 4K6HA 4KAAA 1ODTC 4BC1A 1EI9A 4BCBA 5ALGA 2HIHA 5EGNA 4NZZA 3AJAA 2ZJ7A 2Z3ZA 4QEKA 3RARA 3WKAA 3L1HA 1AMNA 3W9BA 3OC0A 2HDWA 1QTIA 4ARAA 5K3FB 4Y7DA 4CI9A 1J07A 1LPOA 1LPBB 3G8YA 4WFKA 5LZ5A 3G9XA 3BF7A 1QTRA 1LLFA 4E15A 3GFFA 4J0IA 5ALOA 2BJHA 1JI3A 3VXKA 3W9UA 4A23A 1BEZA 3WZMA 4QDXA 2VEOA 2EDCA 1ZD2P 4Y2SA 3HSSA 4EBBA 1Q83A 2XMRA 1ACLA 4B0PA 5JATA 1CFJA 4LYDA 4Y2UA 2EEPA 1T2NA 2CJPA 3BJMA 4B9EA 3R3VA 5LZ7A 5HF9A 1MAHA 4JEIA 5KREA 2PSDA 2GYVA 4EZIA 1J06A 4X91A 4B81A 5AOBA 4B80A 1XZCA 4G8DA 1MX5A 1W6RA 2DQZA 2QXUA 5AK5A 3H2KA 4GW3A 3FVRA 3VJMA 2YXPX 4BTLA 5CT6A 5CT9A 1MTZA 1UFOA 3QITA 2PVSA 4XIIA 3DCNA 3I1IA 2ES4A 3NOXA 3R3WA 1D07A 2DHCA 3O4IA 2V97A 3H2IA 5JAOA 1LPNA 4QA9A 1QO7A 2BAGA 2QTBA 5K5EA 2HHAA 2BCEA 4DSZA 2FX5A 2HA4A 4Y2XA 4N8SA 4I19A 5AM4A 2VT7A 2H7XA 4H7JA 2VJCA 4BDTA 1FSSA 1GKLA 5DNWA 2XE4A 1LZKA 4BRSA 2ECFA 1IMJA 1XKTA 3O9MA 1JMYA 3H04A 1TQHA 1EA5A 1YR2A 3STYA 4W9RA 4DIUA 2O2GA 1HLGA 2ROQA 4U2GA 3A2NA 1CUFA 5DYWA 1WB6A 4BC0A 1UZAA 5ALEA 1ZOIA 3WK8A 3AZPA 4C4YA 3SWWA 1XZJA 2ZSIA 5LZ4A 1MX1A 3FWHA 1QZ3A 2PUHA 2H7CA 4LKOA 4M0FA 2H9YA 3O9VA 4BVLA 2O2IA 3LIIA 3WWDA 5E4TA 1DWQA 1R9NA 4ZXFA 4QLOA 1YA8A 1WHSA 3DOIA 3HYSA 1A88A 4L3WA 3R3UA 2JGLA 3G7NA 1JJBA 1YB7A 2XQIA 5K3FA 5ALJA 2PUJA 1LNSA 3FYTA 4KACA 3WQHA 5CBKA 2HA2A 4OUKX 5IVHA 2XQKA 1E5TA 3FYUB 3W2TA 5AHXA 5ALNA 2P8SA 1WM1A 2DQYA 4E11A 3CCBA 5HF6A 5AM0A 2QJWA 3C5WP 4CG1A 2BUCA 2C0PA 4AQDA 4KYVA 4ZI5A 4FLMA 3D7RA 1XQVA 1QONA 2HA3A 4S0XA 1DU4A 1VE7A 2GYUA 2XMZA 4QNNA 4BAGA 4QDZA 3HLKA 3FLEA 1IZ7A 2C4HA 1SCQA 5LKRA 5K3AA 4HAIA 1Y7HA 1E89A 2XUOA 3HACA 2JGKA 3WYDA 2WILA 2WM2A 4NMWA 1H2ZA 2FUKA 4W63A 4ROTA 4C88A 2BUBA 3WKEA 4ZGBA 3V1LA 4Y2VA 4LHEA 1JU4A 5CRIA 4CFSA 2ORYA 2WG0A 4L72A 3C8DA 3KDAA 1FFBA 1PV1A 3LCRA 4FDMA 1ZI6A 3EF3A 3FSGD 3HZOA 1K5PA 3VJLA 4E46A 3BDVA 5AKIA 4X7BA 3M3DA 1CRLA 2XUIA 2XUQA 7YASA 4B6GA 5JYCA 1EB8A 2WFZA 1XQYA 3EQ9A 4HXEB 1N8SA 3PF8A 4C4XA 5JAUA 3E4DA 5AI9A 5EIEA 3I6MA 2VJAA 5I7UA 1Q84A 2PL5A 5AH0A 2DHEA 4KE8A 2UZ0A 3EBLA 3G9UA 4ZV7A 3QVMA 3K2IA 4CIAA 2E3JA 1SOMA 4FNMA 3BL8A 4K6KA 4G9EA 5FLKA 1UOOA 1DT3A 3ESAA 1CUZA 5IKXA 3WK7A 1AC5A 2XMQA 5BOVA 3E3AA 3PICA 2ZYSA 2QUBA 5DNUA 1W76A 1EVEA 1Y7IA 3WIBA 3DJYA 5C8ZA 1FJ2A 1XQXA 5AI8A 3A6ZA 3SK0A 1UXOA 2CKMA 4DLNA 3HI4A 3PI6A 4MEAA 5AM5A 4UHCA 2WLSA 3FSGA 5CT8A 5AKXA 3T52A 1YASA 5KWIA 3FCYA 4FBLA 3KXPA 5ALKA 5CURA 1MJ5A 5A71A 5JIBA 2HU8A 2PX6A 1XZIA 3IBTA 3WK5A 2WIDA 4FLFA 5K3EA 1H22A 5JARA 2BUAA 1CUEA 2XT0A 2WUFA 3WK6A 5ALLA 1GPKA 1CUXA 1O6GA 2G5PA 5ALYA 3OM8A 2WFMA 2FJ0A 1VLQA 4EUSA 4MQLA 3G0BA 2GBGA 2OGZA 1NU6A 1USWA 1XROA 1XRMA 2CEKA 5K3DA 3T4UA 1MN6A 2QXTA 1HBJA 2Y6VA 2OQVA 1TCBA 1P0QA 2DFPA 4PSUA 4G8BA 3FAKA 1F8UA 1CLEA 3F97A 5AI6A 3GELA 5LP1A 1GQRA 3QBJA 1FFCA 2V96A 1XZKA 2OPHA 4C89A 2QVBA 4B7ZA 5AM3A 4ZV9A 3WJ1A 3OURA 5LYYA 5D7BA 3STXA 5IVKA 5ALIA 1S8OA 4GLBA 3M83A 5AI0A 4K5QA 1ZJ5A 4QWMA 1QIKA 4UHEA 4H35A 1ORWA 6YASA 4G4IA 1B41A 4EB0A 3IUMA 2B20A 4KEAA 5AI5A 1C7IA 4QWWA 1CUSA 2ACKA 5LZ8A 4QE3A 2OGSA 3ANSA 1WB4A 2B9VA 4G8CA 5FV4A 3H1AA 1CUAA 1GZ7A 1OXMA 1CUJA 4FKBA 4RGYA 1IUOA 1MPXA 1XZEA 4B9AA 4Y2JA 5JANA 3ZI7A 4C4ZA 2PSJA 1JJFA 4K6GA 3O4HA 1ZICA 2DHDA 1E3QA 4DSAA 5CXUA 1QE3A 5ISMA 4UBLA 3W06A 2XDWA 3V1MA 1ODSA 4UHFA 1TKRA 3WZLA 1ZIYA 3ZLTA 1GGVA 2OCIA 5BWCA 2C5GA 2J4CA 2VT6A 4MJ3A 1VE6A 3H18A 2AJCA 4ZWNA 4Q34A 2PSFA 1CR6A 4X85A 1VXRA 5IH7A 1FFAA 3O0DA 4Q3KA 5D3KA 2OQIA 4I4CA 4PW0A 4Q3LA 1CUVA 1R88A 1RWQA 4A5SA 2QZPA 5CH5A 4Q1VA 2WHQA 2WHRA 5AKZA 5JD5A 3R3YA 5AKKA 5YASA 3B5EA 2ZJ6A 4OCZA 2HA5A 3BWXA 4HXFB 2HRQA 4CG2A 4WCVA 2CZQA 3Q0TA 3WKBA 3WI7A 1VXOA 5K3CA 4GI1A 4U2DA 4PV7A 1UKAA 2PPLA 2ZJFA 4G9GA 5A62A 4YASA 5JADA 1YS2X 4RNCA 5FKJA 4AZ0A 2XMSA 4EY4A 5SYNA 1DTEA 2CUTA 4X90A 1HL7A 1G42A 1RYYA 5A7HA 3HC7A 3QM1A 2XQJA 4CCYB 3H0CA 3FYUC 5DWDA 2IITA 5AKJA 5AI4A 4B84A 2C0QA 5ALZA 4AO7A 2VAXA 2FJPA 3ED1A 1JJIA 1UOQA 1E8NA 2HFKA 1GPNA 5CH8A 4BP9A 4GWLA 5CTAA 2JEZA 4Y9SA 4IQ4A 2BKLA 3WL6A 4NS4A 4B85A 1LPPA 1CUUA 1UT6A 2QUAA 1FFDA 1EB9A 3AINA 3WL8A 5EHNA 3L1JA 4JNCA 3F96A 5AK6A 5BV7A 3V9AA 5T4FA 5C8XA 1YA4A 2QRUA 4UBMA 2C7BA 3HRHA 3EQ7A 3IUJA 4UHBA 1F6WA 1C4XA 4TPKA 5AKLA 1R3DA 1X2EA 4HTAA 4J0KA 1TIBA 5ALWA 4JYPA 1LBTA 3PUIA 1K63A 3L1IA 1DWOA 1A7UA 2XMBA 5ALFA 2OCKA 4UFNA 4AMZA 1G5FA 1MNQA 3DNMA 3M81A 4RPCA 4BCCA 1XRRA 4H7HA 5JD6A 1THTA 1HPLA 4F21A 1EVQA 3N2ZB 1CUYA 5ALTA 5AKEA 1L7RA 1UK9A 4J03A 5EI5A 3FLBA 1XZGA 5AKHA 5EHQA 3G0CA 2Z3WA 5AOAA 2HADA 3IDAA 2WSLA 3STTA 5AM2A 5C81A 2XLBA 4DNQA 2X5XA 3F8SA 1C7JA 2J3QA 3BE8A 4C01A 5ALDA 2WG2A 2OAGA 2BFNA 3OOSA 2V98A 5J3JA 4YX9A 3D2CA 3I28A 5DTJA 5JASA 3KD2A 4GDMA 4ITVA 3UUEA 2DSNA 4HRXA 5E2IA 4Y2QA 2H7YA 1ZD4A 3I6ZA 1EINA 2HL6A 2VF2A 1J1IA 4K2AA 4IH9A 4PSCA 2J4FA 3ESDA 2Y2VA 5HK9A 1THGA 3FOBA 1ZGBA 2GZRA 4BTVA 1Y37A 4F0JA 5FPQA 5LKAA 5F4ZA 2RHWA 1MNAA 3QZUA 3E1GA 3WL7A 1O6FA 2ZVDA 4CCWA 4X3CA 2G4LA 1WHTA 1QIMA 1AKNA 2HU5A 3ILSA 4BYMA 4OSEA 1LGYA 1QIIA 3MVEA 4KE9A 1BCRA 4HVTA 2ACEA 1QIHA 4V2IA 5LZ2A 1ETHA 3KSRA 3A2LA 3ICVA 1R1DA 2HRRA 2AJ8A 3PDCA 3QPDA 5CT4A 1ORVA 1R50A 2YH2A 2OXEA 4NVRA 3FLAA 3G0DA 3H2JA 1XZHA 4ZRDA 1AX9A 1YAHA 2WTNA 3OPMA 3ZLVA 1IUNA 5AP9A 3C8HA 1P0PA 4EY8A 3DL7A 3IVMA 3NGMA 4W1QA 5DJ5A 1CVLA 1VZ3A 5FUMA 2VQ6A 5FPPA 1CUGA 4N5HX 1G66A 3ZWQA 1XZBA 4DMCA 2XMDA 5HFNA 1DT5A 1NX9A 2WFLB 3QMWA 1SCIA 3KWFA 2RGUA 3F67A 3O95A 1OCEA 5AO9A 1EK2A 2YYSA 2AJBA 4H77A 4DNPA 4P08A 5HKAA 1A8SA 4MYSA 4WDQA 1LPMA 4WFJA 4QZVA 2WHPB 5ALMA 3V1NA 1W1IA 5ALVA 2WUGA 1CEXA 2X76A 3PFCA 2JGEA 3OG9A 4OPMA 2Z8XA 4I3FA 4W1PA 1CUCA 4BRZA 3QPCA 1GKKA 2XUGA 5JZSA 1EH5A 2LIPA 4TGLA 3G0GA 3SC2A 1CQWA 4Q3OA 1AQLA 4EA6A 1XLVA 5T4HA 4IHAA 4OB6A 1E66A 4W1RA 3FYUA 2I3DA 1SFRA 4BZWA 3V1KA 4UBKA 1ZD5A 4DNOA 3VDXA 2PBLA 1DQYA 4P93A 2AJDA 2XI4A 4N5IX 4X6UA 4PF1A 4GBGA 4Y2RA 3DL4A 2Y1KA 3HABA 2I03A 1GT6A 4INZA 2ZYIA 4IH4A 3ICWA 2OAEA 1JKMA 4B0OA 1AURA 3I2GA 1T4MA 3R40A 1IUPA 4DMHA 2JGIA 4OYLA 2O2HA 4WY5A 3I2JA 1R4ZA 5HF8A 2JGFA 5LIPA 4F60A 1ACJA 4FFWA 1YSCA 2C5FA 4AMYA 1YAJA 1TCCA 2JGMA 1A8UA 1DWPA 4AB1A 4BAZA 5A7GA 1BE0A 4KE6A 4AX4A 1MU0A 1EDEA 4FHZA 2IX9A 4BAUA 4G4JA 5CW2A 1VZ2A 4CG3A 1HKHA 4MYDA 3RK4A 1DINA 5C7YA 1XRLA 5HQ3B 3D2BA 2CMFA 2Z5GA 3AIOA 3G9ZA 5AICA 4Z49A 1EHYA 3A2MA 3TRDA 1QIGA 4D9JA 5JZ9A 4UBJA 2YASA 1QJ4A 1BN7A 3IA2A 1WPXA 4GECA 1DX4A 4PQEA 3LS2A 2R11A 1W4LA 1BU8A 4KRYA 1UK8A 3R3ZA 2W6CX 1U4NA 5DLPA 5JAPA 1N5RA 3QYJA 2GBIA 3W05A 5JALA 3AZOA 1L7AA 5IVDA 1U65A 1KU0A 2VJDA 5E4JA 1XKLA 4KJXA 4X94A 1F0PA 2QMQA 3VVMA 4MWSA 4IH1A 1HQDA 1GPLA 5FOQA 1P0MA 3WK4A 1J2EA 3G9TA 1LZLA 4WDRA 5KBYA 5A2GA 1B6GA 3YASA 2OG1A 4Y2TA 2IIVA 4BCDA 2G63A 1WOMA 2QJRA 5BWBA 5JAHA 1H2WA 5EFZA 1UK7A 1UWCA 4OB8A 3WMRA 3DOHA 3VISA 4FNGA 2JGJA 1BEEA 4J0CA 4HS9A 3TJMA 3WKCA 3E0XA 3P2MA 4FFVA 2HU7A 1VA4A 5A7FA 4BVJA 4ZREA 5JD4A 2PSEA 4J0DA 4MXDA 4H0CA 2QR5A 3AZQA 2WJ4A 1JU3A 3PFBA 3GA7A 5CMLA 4UFOA 1CUBA 1RP1A 3S8YA 4YK7A 3BIXA 3WYNA 4BDSA 1H2XA 1W75A
chains in the Genus database with same CATH superfamily
2J30A 2HDNB 3AUAA 4MIEA 2OUKA 5I5EA 3ZKWB 3KPVA 2G5TA 3QEBZ 4HX9A 1MZVA 3DBRA 4DR3B 5I7SA 4IFBA 4LRWA 3VYVA 3DGFC 1OZGA 5CLHA 2YWGA 2EJTA 4MEJA 5J4YA 3GVHA 1KJIA 4H7IA 3KKLA 3QE4A 521PA 3RUCA 1SIWA 2LCIA 2C04A 3BMCA 3EWSA 1YDFA 1DQSA 3HVRA 2IXEA 3G7UA 1UOPA 3DD5A 4Z7NB 5I7WA 3LT2A 5B58C 3M1IA 3QKRB 1D9XA 1Z8HA 4AMUA 1DCMA 2O1SA 2QS9A 3HDTA 1KJQA 1GCIA 1Y5NA 2WIJA 4OGGA 3R9WA 2LDBA 2VK8A 2ZBQA 1MDBA 4ZZ1A 5KNCH 1D2NA 1WS6A 3QNUA 1P44A 1I10A 1SUFA 3WMXA 2QRPA 5DOZA 3LCMA 1M33A 4C6SA 3BZWA 1RD4A 1ZJ4A 2DSTA 2Q4OA 2WJAA 1KFKB 1GZVA 3DKRA 4JUCA 5JAQA 4I4IA 3ZQUA 3V8MA 1JEYB 4JOBA 1EXDA 1P7PA 1Y6JA 2WVJA 3A6EA 1TO1E 3OMXA 1JFRA 1S2IA 4BFYA 1SO8A 3DWIA 3IXLA 1WW2A 1L1FA 1C14A 1GQFA 4TSFA 1S0UA 1H8HD 4YALA 1CNFA 3VV2A 4OLBA 1QIEA 1GDHA 4RMJA 4OBWA 3SLRA 1FSFA 3FDIA 3I9V1 4RY8A 1T91A 3BBPA 1KDRA 1GCOA 4URFA 2HD4A 3RG2A 2OZLB 5D5QA 1FRQA 5ESRA 1I2AA 1F0NA 5KWVA 4ALJA 2VJYA 1SH7A 2R96A 2GUGA 4LHXA 2GHQA 1CCWA 1CUWA 5EZ6B 2H2AA 5DHRA 1LY1A 4YDQA 1HF3A 2JI6A 3FUUA 3DZIA 1G3UA 3NRCA 4O4JF 1RSZA 3P9SA 1JHVA 2YV2A 4KG7A 3TCXB 2JGDB 1Z4MA 2PX4A 2CHEA 4L9AA 5EIFA 3RIXA 5C3UA 1RZUA 2WJWA 3TEFA 5HQ3A 5DBIA 3TD6A 4BVEA 3FHJA 4YYEA 3PNVA 5JH7B 3JAMA 2HM7A 1EVZA 5FXMA 2CL7X 4DBZA 3FNIA 4FFRA 3HBAA 4DLBA 2ORED 1XLUA 2CV2A 3W7BA 1M74A 2YFHA 3WLLA 3DMTC 1PT8A 4IRMA 3E3LA 1PT6A 1NVUQ 1H93A 1Y8AA 2CNWA 2NTVA 2ODAA 4LXHA 1Q0ZA 1VKHA 4P7KA 1BDBA 4WEQA 1YV9A 4K9OA 4WCDA 2YFYA 3NT5A 1HQYE 4MH0R 1K6JA 1JIXA 1U3FA 2QYSA 2RKWA 3BE6A 3NBFA 4GRDA 1RVV1 5DNVA 2IRWA 5DTIA 3Q40A 1ULAA 2YY5A 4WY2A 3HCWA 1FP1D 4B6OA 3B5JA 1WMBA 3C6ZA 5LA6B 1C4WA 3U9SA 5JSZA 4FUQA 2G40A 1QHIA 1RZRD 3B1JA 3K1ZA 2XMCA 1GARA 4KXFB 1OI4A 2HHLA 1HXHA 2ONCA 4GR5A 3ZIAA 5BW5A 5TXGA 3H1BA 2OGWA 4FDLA 3M34A 3EA0A 1KSGA 2ZJ3A 3UT5A 4DKXA 1RE1A 2VHUA 3F8TA 1SCDA 2SICE 4TTJA 4EG5A 4L4SA 4S3MA 4C29A 4DR7B 1LK7A 5FI0B 1BN6A 1B4DA 4OFXA 1EU1A 5GOZA 2RGGA 4OYYA 3OQMA 1BS9A 4PFSA 4IZHA 4A0GA 4OI2A 3RO7A 4PC3A 2OWEA 2R5FA 5JD3A 1DAFA 1G3MA 1IB0A 1KQFA 1K0FA 2YVLA 1RQ2A 5AOCA 3V6MA 4ZQBA 2O7RA 4BQEA 3NDBB 1ODCA 4HRAA 4L75A 1T4GA 1B1AA 1YU6A 1SCKA 2Q2VA 3IOCA 4RV9A 5DT2A 1FNNA 2X8WA 3IT2A 4ZVQA 1KZHA 2DBQA 3SF0A 4R01A 2YYYA 5AK4A 2GMWA 1UFVA 1LPSA 3CF4G 1F48A 4Q3NA 3KLBA 3RS4A 5LYJF 2Z5FA 1QRSA 3NYRA 4AZ3A 4KITB 4C2BA 3AFNA 1B8NA 1RIIA 3EIFA 3MWEA 4WZAA 5EWMA 2MSDB 3GZJA 1E1RA 3OKCA 1QFSA 4E2XA 1UFRA 3UMBA 1P0FA 2IU4A 2ZULA 3IGFA 1PK9A 3IBCA 4E70A 3UEOA 4PHTA 2VQFB 4GOOD 4O1HA 4EIWA 4JJKA 5AM1A 3ONFA 4X8OA 4G26A 2XLCA 2B4RO 2FZLA 4BB0A 1ESEA 2AOUA 2V7EA 5DW0A 1T8YA 4G8JA 4MIYA 1OWMA 5DF1A 2W8BB 2P2SA 1PL7A 2OYSA 4MO2A 2ZRLA 3V2HA 1K7XB 3G85A 2I78A 4OU5A 4S1PA 2H4ZA 4O6VA 4WI1A 2XNDD 1B93A 3DWEX 4HAZA 4H6VA 1IWOA 1PZGA 2ZJ8A 3T6KA 1BROA 1JDUA 4MV8A 3QA3E 2AFRA 1KEUA 2JEYA 4H7PA 5BVHA 2ZUCA 3AVYA 3D6VA 3DWFA 4XGNA 1ISSA 2GBLA 3SYNA 4RQUA 1QIFA 2R47A 4CDNA 3QNWA 1JDBC 4RE5A 2ZJ5A 4JZYA 4P3NA 5LZ9A 4MDYA 1E5VA 2RHDA 2ZJAA 1Q95A 4GOMD 2G07A 4H1VA 4BFXA 2D5CA 4IDHA 3LT4A 1MEEA 1C9JA 4RWZA 3TNFA 4YQYA 1BMFA 3JVDA 1DG3A 2WDZA 3HBJA 1NDHA 1XZNA 1QANA 2YFKA 3B2EA 1NXVA 4HN9A 4K6CA 1RC1A 3E2MA 3LQ2A 1YHNA 2L19A 4HDMB 4KKXB 3VJKA 1XIVA 1G20A 1SG9A 2C8LA 2FUG1 4FTWA 4RABA 1ST2A 4JQYA 2LTAA 2OBMA 5L7YA 4HFJA 4ESHA 3CN7A 5JZMA 5LUAA 4Y2YA 4JJEA 3H5RA 3KJXA 4PYMA 5K05A 3GRYA 3KK0A 4KMSA 1U0SY 2WE7A 3UJHA 3L4EA 4CCYA 4BEWA 1JDNA 3TOCA 4BVFA 1DEKA 5THQA 2H08A 1M6NA 2OLEA 1GAXA 5EEHA 1TCUA 4B7UA 2GXUA 5DEOA 1KPHA 2B83A 1A8QA 2JLUA 3QG5A 2TECE 4P4SA 1X7HA 4XVCA 2R2GA 2P68A 3Q9LA 2QMZA 4U7HA 5E1MA 3DLCA 3KSUA 3QKRA 1VHDA 4WVFA 5G0WA 3GLSA 3CJRA 2AXEA 4HWGA 4S2UA 3LQ1A 5HA5A 2H1HA 4P92A 2ZQZA 4HFMA 4KR9A 1MJNA 4DY4A 4CIVA 2WWVD 4RTLA 4MV0A 1N32B 5C9ZA 3KG2A 1FJGB 4ND8A 2ZBUA 5B12A 3X3HA 3STWA 4DLUA 2O2DA 1B6RA 1FDSA 4Q93A 3N75A 1V95A 5I48A 2C7OA 2FPGB 4ENUA 1I0LA 5BMOA 4CEHB 3I9NA 5DXJA 3MS7A 1KO1A 3HXKA 3GGPA 1NOJA 4MW5A 4WBNB 5BY2A 1WXQA 3QHPA 3SLKA 2C57A 4KQ6A 3MTQA 2GBCA 2QQ0A 4GSYA 5DYTA 3D6HA 4ZT7A 3DEAA 3OFJA 4X84A 4RTRA 2B8WA 3OZGA 4KWCA 4YUYA 5ELXA 2Q45A 3U2QA 3EOBI 3LFUA 3T1OA 5GV8A 3HH8A 1WSDA 1S02A 3EIHA 2IQIA 4KQGA 4Y1RB 4XYLA 2VP6A 1AZSC 1HDYA 4JLWA 3B3QA 3VDNB 3WGQA 4G3XA 4HPWA 3DFIA 2YJGA 4AO8A 2DM6A 5CEJA 5D3MB 4MQMA 1T8PA 1XU7A 4YBZA 2JDIA 2Q5HA 4TKMA 4UPDA 5SZHB 3ANMA 1YDHA 3WBKA 1FU7A 2XCOA 3A70A 3SZ3A 1JQJC 4BV8A 2C5HA 2JGDA 2CWDA 3AQ4A 4DIEA 2A58A 5GADl 3UTCA 2BFPA 5H4GA 2LGJA 3WJ2A 5CHEA 3RKUA 4EJFA 4NBUA 3QU5A 4DLYA 3EIXA 4IXTA 5B6JA 1V11B 1EDDA 3K5WA 3CFYA 1DBRA 2A59A 2OLKA 4XXHA 3LBIA 4RPJA 4UOZA 1MAWA 3HJNA 4LY6A 1NTOA 1S8AA 4J8PA 4ZU3A 5FOWA 2LCFA 4CCAA 1WVIA 3DBOB 5FTLA 1DIGA 3SQOA 1R8YA 2HLDD 3PHBE 3T0IA 3IJRA 1GOTA 2V0CA 1OKKD 2WIFA 2X8BA 3HSKA 1WVGA 3TOZA 5JJKA 1CLUA 1LSUA 5I7VA 4A8JB 4BUCA 1CT9A 5TMEA 1NI4B 4D9BA 1E5DA 4QYIB 1OBFO 1TUIA 2ZQ5A 3C5VA 3JQ9A 4KDEA 2R79A 1J22A 3U1TA 3W8RA 1WMAA 2WA2A 4J6EA 3RKSA 1ESZA 4QLAA 3HBNA 2JHFA 2QTAA 3FTQA 1OLUA 3W8NA 4DLPA 5KTOA 3LHKA 3QXHA 2FWIA 2UVPB 1H2AS 3OJCA 4JJ8A 4Q9DA 4AVYA 2AD1A 1E1YA 2MYNA 4RL6A 1WJGA 5I4IA 1WETA 1M2FA 1O97D 5JZVA 3NIWA 2ZYHA 3ZHZA 3VYTB 1J21A 2LV8A 4IDGA 1GV0A 1WVMA 3VR4A 2CW5A 1NSTA 2HV9A 2XTAA 1ESNA 3K9QO 4DFDA 4EQ6B 3T3OA 4P0PB 4IJ5A 3VUFA 2X9VA 1JG6A 1LDGA 2R4UA 3G02A 4DA4A 4PAMA 4AN1A 4DV0B 1I1OA 1JU9A 1EDBA 1U8EA 2OFOA 3LECA 1IOZA 4XJVA 2OV4A 3WB0A 1PR5A 3FBWA 4NL4H 2C3OA 5J4VA 4F8EA 3D3QA 3V1YA 1YXMA 2J0UA 5B7PA 1UBGA 1IEXA 1O6BA 2ABWA 1O4VA 3OWHA 4S35A 1W34A 3N05A 1AQYA 2GRUA 2ZTMA 4DE5A 5DU2A 3FFTA 2C96A 1WY7A 3M6MD 3JZAA 2P65A 4L27A 1DTWA 3NAGA 1N9GA 3CZAA 3D6AA 1N7HA 4ZEMA 3L1KA 5EHXA 3C6BA 3GUCA 3B12A 1NJ6A 3NXKA 2PR7A 5FBQB 3W5IA 5ENVA 1Q50A 2PRZA 4GRAA 1WRBA 3X0DA 1EUYA 3OU7A 5EHZA 1CQZA 4WOJA 1IONA 1EP9A 3QQPA 4DMKA 2WZCA 1EBFA 1UEXC 2ERXA 1KBZA 1UMBB 2W8BA 3B8EA 3JQEA 4JJAA 4MWGA 5IT5A 4MWOA 1DVRA 1BE8A 3EVFA 4INJA 1GITA 4KR0A 4DV1B 3LRXA 4QDOA 3IT1A 3MCAA 3A11A 3JWHA 2CYAA 4AIRA 2XCTB 1ZEMA 1G5IA 3P5SA 3VR4H 4TQ9A 2VK2A 3B82A 2UUBB 1BVYF 1JALA 4WPGA 3KYIB 4EKYA 2XCRB 1KFCB 4PZDA 4NLLA 4ADSG 4Q18A 5IRCD 4YRRA 3BFKA 4NABA 4N76A 3C3YA 1B3BA 4H6WA 3DZBA 3RJ5A 2QL5A 1YB1A 1PZFA 3F4BA 3PWSA 5LDDC 1HETA 4RHYA 4X1KA 1G6KA 2PWPA 2PS9A 1YR9A 2WJ3A 2RHJA 1K75A 3DE6X 3MGAA 2CYBA 3PTLA 3LDHA 4JJ7A 4L15A 2P90A 2QTVB 4EFDA 1O87A 3PZRA 2RHBA 3GBSA 3ABSB 1A9ZA 1XU9A 3C3KA 3ROKA 1FX1A 1ZXLA 3BTVA 1DFGA 3PWKA 3JQBA 3KZXA 5SYMA 2VOJA 2YHSA 3L7MA 5ALSA 1JDSA 2VDVE 3AWDA 2FCAA 5A4AA 5MN5A 4N65A 1G7SA 1DSSG 2XADA 3VHXB 1LPAB 4PXSA 4JJFA 3RLIA 4JX8A 6NULA 4LZPA 3QUTA 3OEYA 3L01A 5SY9A 1MOPA 4KV7A 5AVZA 1J8DA 1SB8A 1RHQA 1E9CA 5CBPA 4L4XA 5CPBA 4DCPA 4KWHA 1O9GA 3A4MA 2HA7A 5FI1B 1JGTA 1JSRA 4A2WA 1KSHA 3M2PA 1BQ3A 1FK8A 2FEPA 3AXTA 4B09A 4BX2A 4WJZA 4LJ9A 2VNJA 3TNDA 1CS0B 2QX6A 2EDAA 1FLDA 1YS9A 2F1OA 2GZSA 4OHRA 2GBLC 3GT3A 4UFPA 4BEJA 1Z8FA 2ZB3A 2XUKA 2WHXA 3H0EA 3JQ8B 4MUEA 4OQZA 2BEUB 4OHPA 4PTZA 4QBIA 3DYIA 4CT0A 5KOYA 3SSNA 2OCYC 1UF9A 1KYZA 2ZIGA 3B1YA 4MR9B 4R6WA 4YJ3B 3RDPA 5AVSA 2CN1A 2X0KA 4QPPA 1YQXA 4EQZA 3GAAA 1DQPA 3WHKA 1WPRA 4BMYA 4U6QA 1MR3F 4IDFA 4JYBA 4P6VF 1P62B 5AKGA 3Q8WA 4F38A 4WY8A 4L5CA 3L7NA 1G41A 1X19A 2PA0A 3PSAA 2CNLA 2I66A 4AKGA 2HA0A 1L7BA 3KR0A 1L8XA 3AJ9A 3JAWB 3AKZA 3TQHA 3EIEA 1FDWA 4COOA 1AO0A 1MOSA 3KR1A 1U4SA 1RAGA 5F51A 1Z68A 2O54A 2YMPA 3S28A 3GH3A 4FOLA 5D6OA 3SEAA 1TZ2A 2IUSA 5JJCA 5KEIA 5JPCA 5TX7A 3FG9A 4CV0A 3ETLA 2VUIB 5M7EA 2Z1DA 1F4PA 2C4NA 2Q3EA 4JQSA 4FR5A 1V4VA 3W9YA 2JBWA 3LM8A 1UBMS 4GQAA 4OHVA 3C87A 4LIPD 4GLLA 5D3MA 5B4UA 3K73O 5HM6A 1NE2A 1NZJA 5B4TA 2JARA 1XCMA 3IUNA 3KUCA 5T3UA 1RWPA 3ADPA 3JD0A 4YO7A 2C20A 1GU7A 3SX0A 4D96A 4D5EA 5EE9A 1E7QA 3RC2A 4YJ2F 4ZRMA 1XRPA 1QO0D 5DLDA 5FWYA 2ZW9A 4K26A 4RTPA 1CP3A 1V11A 3RFFA 2FRDA 3QEKA 2IYAA 2WAAA 4KSCA 1PNOA 3BXPA 1O0BA 1NVEA 2JHCA 4MGHA 2GJKA 1EGHA 2V7VA 2OR3A 2PGLA 1DBQA 1L7QA 1ZHHA 2I8CA 2PANA 3KFXA 4C2AA 4D82A 3ZD9A 3M4YA 2I1WA 2PXHA 1V3VA 4NBWA 5ECDA 1CKEA 2ZB4A 3LDGA 2QTMA 2QT9A 2P6RA 2EYQA 4A8JA 1UQTA 1Q0HA 3KWJA 2FDRA 5CLGA 1GUAA 5HYVA 4DAOA 1OAKA 4QYIA 1LI7A 2CDCA 3AJ8A 3H1EA 2E4VA 5NLLA 3D4LA 4P86A 3KEMA 4EW2A 4B3IA 3NUZA 4LV8B 4F84A 5JY6A 3WWOA 3PC8A 2CCGA 3D6UA 2D8MA 4J7AA 5E7JA 2XB8A 2EVWX 2UVPA 2VF7A 2QZ4A 1GKIA 5CXQA 5AW2A 2FN9A 4G1UC 2I9KA 4YC7A 2XQFA 1CUDA 2FSGA 1I2CA 3AOGA 4HDKB 2B8EA 3GFRA 4KLAA 5PGMA 3ETCA 3MPUA 4IUCS 3RVRA 3OPYI 1CC1S 1SBTA 1E2QA 1RM4A 1YZNA 2ISQA 2QAGB 1XZPA 3Q12A 1DBIA 4G25A 1B6SA 2G80A 2HRBA 3MGCA 4WBNF 1IZ8A 2OZPA 3GL9A 2XTJA 2CE7A 4D56A 4ENPA 3LLCA 8ATCA 2OV1A 2RBKA 1LF5A 4MJ7A 4Z3OA 3LA8A 1H0SA 1MVLA 4GXNA 2GBFA 3SGLA 1U2GC 4B79A 3OZVA 1D6JA 3MWLA 4PZPA 3WE7A 4GICA 4PC7A 2Q5CA 4RKFA 4W4TA 1VCHA 5B1HA 3RM3A 4G5XA 3EWIA 1CE8B 4BL5A 3EDYA 3MC1A 5ECYA 1ARZA 5HILA 1KZGB 1MQSA 1P0IA 2P6OA 1DQZA 1V2GA 2JJYA 3OPQA 2Q2WA 4TTQA 2PUCA 5AIBA 1E1LA 1ZL0A 2NVBA 4ZTUB 1L5ZA 1QXSA 2VBCA 5I5GA 1C3XA 1E7YA 2IGTA 4QOFA 4RTKA 1ACMA 1GQSA 1KVRA 1Y98A 2AUNA 2Q5EA 1DRJA 2XA9A 3JQ9C 2PU5A 1D5WA 2VF8A 3PNLA 4FZVA 5IBRA 1KE1A 3WO0A 2X4IA 3FRHA 5E8JA 1OWPA 1Q0SA 3EDRA 3DLAA 1ADJA 1I6KA 1XL0A 2EARA 3DDZX 5L3RA 2Q41A 4IDAA 2SBTA 1Z5WA 2IV2X 2ST1A 1U31A 1KU6A 2AX4A 3R3XA 1ST3A 5D1HA 4X71A 1ZINA 4DBVO 2AE2A 4NDNE 1PJAA 2CBXA 2QD2A 2VA8A 1CPYA 1XRNA 1MO2A 3N59A 4QUJA 4L7VA 3T5GA 3CVUA 2FOIA 4MVJI 1VB5A 3I3SR 4NEGA 5CB0A 5IYZB 1C7FA 4BFLA 2F8SA 2EX4A 4YTEA 1JZSA 4BV3A 4N8DA 2BFMA 3HP1A 4FQ5A 4GEKA 1AVTA 1NLZA 4ON9A 1MB4A 3NANA 2WU8A 3AO0B 1JIJA 1SKYE 3HS3A 3PB3A 1E0JA 4NH4A 3ESXA 1HK7A 3WRYA 3LOUA 8MHTA 1Z4NA 2EFYA 4K6HA 5HR5A 1PT7A 4N18A 1LU9A 2QA5A 4RADA 3WNCA 4RDXA 4MGEA 1EI9A 1Z6GA 2QTVA 2ZSEA 3KVNA 4F46A 4KRFA 4NZZA 1OX4A 5EKXA 3BHMA 3PXAA 2ZJ7A 1VJTA 3DE5X 4JLBA 1P2GA 2O2XA 3QRWA 4P5PA 3G8AA 4QEKA 5EJMA 1PSDA 1K7FB 1HC7A 1Z0UA 1E4VA 2EZTA 2HRDA 2W90A 2CK3A 3QBEA 1DELA 3QU2A 4RS3A 5E6UB 1Y80A 3SYMA 4YAJA 3KKPA 1AO3A 3VHXA 3GWGA 5IBPA 1IN4A 1NY5A 3RHTA 2QNIA 3NVAA 1LW6E 4ALKA 4KGZA 5E6SA 4J91A 1LPOA 2XVZA 5GOTA 2C0CA 4ZJZA 5B1YA 3HM2A 1XMVA 3DMNA 4Q12A 5CVVA 1DKQA 3R23A 4G86A 1QTRA 4QHSA 4IV8A 4Y6SA 2VCHA 2Y1FA 3ZUGA 4BKQA 1HE5A 8ABPA 1P80A 1Z5ZA 3NTVA 1YRQA 3DO8A 2NO5A 1LLFA 2NMVA 4MYRA 1TYZA 1SBNE 1ZM2A 3OZSA 4QVGA 2J6CA 4XIYA 3VR5D 1U9IC 5ALOA 4KU4A 1XDWA 3JQ8A 1C3LA 1D6MA 2FYTA 3PHLA 1G4AE 4V0NA 5EWJA 3TJRA 4CL0A 4BLTA 5IFLA 1JHDA 3PDUA 3IAEA 3N2LA 1TJ5A 4LYFA 2CHGA 4YJ3A 3WGVA 1LLDA 3I4LA 4XD7D 1HA3A 4UAUA 3LCUA 1NPDA 2IUUA 4P54A 4EBBA 3WYCA 5F5LA 3KJGA 4I1PA 3K0AB 3DB1A 5JCOA 4OQFA 1OH5A 1M8GA 1NNSA 2ZATA 2VUSA 4OLFA 4EHAA 5JATA 5JSFA 4UUPA 5JYDA 3GV0A 4F11A 2ZCUA 3DVAA 4Q3CA 4GVLA 3UM9A 4EL0A 2JA2A 4LYDA 1YZUA 3JAWA 1T2NA 1PQPA 4GUAA 2BTEA 5JOQA 2H3HA 1XPUA 2PUDA 1WHTB 1CZUA 3K70D 3O3MB 4YAKA 4PR3A 1UBLS 3T34A 2ZI4A 4A6EA 2VJMB 3TBFA 2O3UA 2FFJA 5HDBB 5HF9A 3DW3X 4B46A 4TMWA 3B3FA 5D84A 1DO2A 2JAOA 4K3UA 5D51S 4AP5A 4JT8A 1FXSA 5IUJC 1R66A 2ERYA 5KREA 5A0VA 4DREA 1D0VA 4XYMA 3RQSA 1JFFA 4WA7A 2JCBA 3DAOA 1Q3TA 4G1MB 3OJEA 4B4KA 3OUTA 3KKEA 3PJEA 4H3KB 1ZQ9A 2WABA 1E59A 2X19A 3H4IA 1H8ED 4M86A 4WZBE 1DO8A 2ZJ2A 1MJFA 2JD0A 4FQ8A 1MX5A 1ZCJA 2Q29A 4YRCA 3EYAA 1EVYA 2BEJA 4FCCA 4JCCA 2WYIA 5AK5A 5HIMA 1T2DA 1XTSA 3QOXA 5IAKA 3MSXA 2H1RA 3FVRA 2XBLA 3D8HA 1NKSA 3H6GA 3UKJA 3I6IA 4Q16A 1WXHA 2B82A 1WKBA 5BSGA 4V1CA 3F7OA 3DC7A 1K5HA 1QGUA 1P45A 4M2LA 5KYXA 5HOQA 3ND8A 2ONYA 3LYUA 4XIIA 1DC7A 3LTNC 2X1HA 3GFOA 3I1IA 1TT5B 2ES4A 2VVTA 5ARDA 3A9VA 3SJBA 4EPTA 5BNWA 4AY2A 1PLKA 4XIJA 1L8OA 3EQ2A 1GGEA 5ICFA 4DLLA 1N2HA 5BV0A 3B6JA 1D07A 5GJVC 1Q12A 3TFOA 3I0MA 4UQLA 3ELDA 3ZY3A 4HDKA 1VRCA 3UAWA 1EWQA 1UM9A 1C81A 2X41A 3O4IA 2V97A 2IHUA 1GA4A 1VHJA 3H2IA 4X41A 2V1UA 5JJIA 1M72A 1QO7A 3JATB 4QA9A 2GM3A 2M2IA 1Z2CA 2QAGA 3KZCA 2I6QA 3CUKA 3MRXA 4M99A 3E82A 5JS8A 4ML3A 1DLIA 1ICIA 2QTBA 4MGKR 3VAYA 1IY0A 3KOXA 1M5TA 2O52A 3PNOA 2B6HA 3P9RA 2OA0A 4YUAA 1XQ1A 2V7GA 4FHGA 2GEBA 3NUGA 3LDFA 2C2WA 1DZIA 1KDTA 3N53A 3JRNA 4WEOA 4Y2XA 4N8SA 5IF3A 4BKUA 2E4UA 5F33A 2QAJA 4AY3A 4I19A 5AM4A 4LWPA 1J1ZA 4OXYA 1UR5A 5U4QA 5CLJA 1CE8A 4KPYA 2O48X 2HQBA 4EHIA 4X9XA 3EJ6A 4V0MA 5CVJA 3AXSA 4XUDA 3HCEA 3KXLA 4GOKA 5D1NA 5JI2E 1H1DA 2JCSA 2CYCA 3LX6A 5BR8B 2GSDA 2OC9A 2R8EA 3GA5A 2XA1A 4KN5A 4ZO4A 4AS2A 4D46A 1LFAA 2XE4A 3V55A 3LQRA 5K0SA 2W6ZA 4Y1GA 4MROA 5H7XA 4CHTA 1IMJA 3ZOKA 4D3DA 4TN5A 2VUTA 4JBIA 4IAOA 3HRIA 1NR7A 1J8FA 1YR2A 2ZVPX 2HCBA 4JHLA 3K20A 2C2OA 1YR6A 4IJVA 1HR0B 3SD7A 1O94D 3G2MA 3WR5A 1XPRA 2QAIA 3PUVA 3A2NA 4JLSA 4RZ2A 1LW7A 4MQ6A 4YH1A 5BSMA 1G3QA 2ID4A 2JHAA 4F3TA 1H8HA 3EDOA 2P3QA 3GXBA 2AFIB 3NWBA 2OBBA 4R2KA 3GI1A 1U11A 2YW2A 4BC0A 1JKJB 3GG2A 1VBNA 4RXTA 4UOEA 4ZT5A 4FONA 5DSXA 4UU7A 1YZFA 2ZZMA 1M9NA 3O75A 4Y8VA 3B9PA 3NX4A 3WFJA 3WK8A 3T5DA 2CLOB 3R3SA 2D59A 4C4YA 1HFWA 1EX1A 5LZ4A 3RT7A 3UCEA 2G3YA 1I9CA 3GOQA 2GNAA 2JC3A 4FNAA 4DRXA 4BVBA 1HT1E 1NHGA 2EW8A 3ZOZA 1TEZA 4Y9RA 3O9VA 1J0AA 4AT1A 3NHZA 3LIIA 1WU8A 2F59A 1YQWA 4P4NA 5KHAA 1OY1A 4X61A 5AW1A 5TIIA 4ZXFA 4NATA 4DR1B 2XOEA 2FEOA 1YA8A 1XTIA 3R20A 1SOUA 2KSQA 1WHSA 3HYSA 4Q37A 1HI9A 2IBTA 1A88A 4L3WA 4DG5A 1KY5A 3L06A 3HXTA 3FGZA 2PUTA 4QYWA 3MN1A 3HKCB 3NBXX 3STHA 5E6UA 4D0SA 5MN4A 3F4KA 2P75A 1YB7A 1EVJA 3FGOA 4GKJB 5BNTA 4G0VA 3WIEA 4FW8A 1RAHA 4E4YA 3D4IA 4TTTS 2PUJA 3FYTA 2IVFA 2OGUA 3REOA 1NOIA 2GAJA 4R68A 4JJIA 3NV9A 1KOGA 1A9TA 3SZLA 1VYVA 4BGEA 3OZUA 5CFQA 2TMDA 3O92A 2VDUE 1IC6A 5B30A 1ABBA 5HPYB 3ZY4A 3A6GA 1AN0A 2J3IA 2HJWA 3M6XA 1RZRA 1KI4A 2WU0A 1C9YA 1KQPA 3QE2A 4BVGA 4E11A 1WM1A 2MOKA 3C1UA 4QUKA 5GONF 3V8QA 2K6GA 1RWKA 2O1XA 3DR3A 4C3UA 3C1OA 3LKVA 1ZVKA 4LGYA 1WWKA 2A2ZA 2UYQA 4OAOA 2ZANA 5F35A 1F8YA 2ZEJA 2BUCA 2HNBA 2C0PA 1MD9A 5I9SA 4PHGA 1SIBE 2BI4A 3FDZA 1XQVA 4HDNB 1VLLA 4XUEA 5LQDA 4NCBA 1QONA 4ARVA 1JH8A 4KQKA 5C80A 1U2ZA 4GI2A 1XA0A 5AJXA 1RYNA 1T6BY 2MYPA 3E7DA 3GUZA 4BLSA 4EM6A 1U80A 1VE7A 3UA4A 3K0AA 4PHHA 2PNJA 4M3NA 2IE8A 5F7OA 3VSEA 1TTHA 3HHPA 4QNNA 4C05A 4PICA 3FYHA 4H6PA 1NE7A 1ADGA 2CXSA 2QPTA 1LV7A 3NHRA 4YQZA 3PK0A 3CINA 5ICEA 1RWBA 2BFFB 2IWRA 1ABEA 4TT3A 2YJZA 3FXAA 5JS6A 1IM8A 2EJBA 1SVLA 4KWIA 1VL6A 4NEHB 1IZ7A 3ZDZB 1ISMA 2R1VB 2YXEA 3UBTA 3IVAA 3GJ0A 4MPPA 4PANA 3ZE0B 2VJMA 1KMMA 3LF1A 3ETGA 4NC9A 5IULC 1Y3IA 4YONB 4HAIA 1VDMA 4HGRA 3WTCA 1MX3A 2G9ZA 5DK6A 1H5QA 1QAMA 4D0NA 1GTSA 2C3UA 4YJGB 5AXCA 3QBDA 1XMOB 2FFBA 2H17A 3VZSA 3A36A 1JBQA 2WILA 4REOA 5AD1A 4MHOA 1TJYA 1AKWA 3AX6A 3D8TA 4HNVA 5JHHB 1XUOA 2R00A 5BSWA 3CB2A 2RHOA 2PA3A 4KFRA 3C4VA 4HH3C 3R6GA 5J2UB 2R6FA 4ZODA 1S6YA 2OOSA 5HJ5A 2ALJA 1MOZA 2NZ2A 4MVJD 1NT4A 5CTJA 4KQ9A 5C18A 3P2JA 2Q0QA 4QYXA 4A0FA 2V59A 1DQNA 3I6QA 4M98A 3EX7C 2OCAA 3B6MA 4TXHA 4KXWA 3MWFA 2BL4A 4RMGA 1WZCA 2WG0A 1SUIA 4PY2A 5JPDA 4NAVA 4GZ5A 1LVHA 5GWXA 3PRYA 5DHPA 2O4CA 2X9LA 4L6IA 4HNRA 3WHPA 1KQOA 4CCSA 1CR2A 1ZI6A 3HZOA 4FDMA 3ZI4A 3VPFA 3GEBA 2WAXA 1L5RA 5JE8A 4LS3A 1H3FA 5EXSA 3M3DA 4LE0A 3L7DA 3IPLA 3E9EA 4R1MA 2XUQA 2ZTSA 4YXFA 3NCHA 5B5SA 1DEXA 2I1LA 3BB3A 1SD2A 2QZJA 1NQAO 3D6NB 3HR7A 1P1FA 2POQX 4QXQA 4W7IA 5JYCA 4O02B 4Y6PA 3F6CA 2WKPA 4EFLA 2BV3A 1RXSA 1TJ4A 1XQYA 1CR1A 3EQ9A 4FGWA 1EPUA 3IIJA 2ZI6A 4LX8A 2GOYA 3H5VA 5JYEA 3JATA 4HXEB 1L7OA 2IDJA 3PUZA 4DANA 1JAXA 3FWNA 2FNAA 3LSTA 3WV5A 1A97A 1YJCA 5C34B 1PN3A 4AYXA 4CIXA 5IM4A 2J7PD 2X0IA 4DR2B 1U2TA 1YVRA 2NZVG 5AI9A 3RLFA 3RABA 2EWMA 2JI9A 4KXXA 3RRZA 4AD8A 5HKKA 2W0SA 1URPA 2DBYA 1X15A 2PT9A 3KDPA 1T4CB 2X4GA 1FQKA 3EXEA 1Q84A 3LUPA 4N1AA 5G1OA 1GNVA 2YIJA 1UZMA 3FZEA 4QPDA 5CB6A 2BI8A 2V6BA 4IIVA 1JQKA 1ORDA 1QGAA 5CYFA 2DHEA 1FFXB 1T6YA 4G0PA 1L7XA 3VSCA 2PIAA 2QIPA 2I80A 3K94A 3LUFA 4KQIA 3BRWD 3TBHA 1GTVA 3N86A 1IDOA 4XD2A 1H4QA 1R0BA 1QP4A 3OOEA 3QVMA 3L0DA 3VTAA 3D0RA 3TUJC 4I2NA 4GYJA 4CIAA 1JHAA 1U63A 2RMKA 4MW1A 4FNMA 1E2KA 1QLHA 3BL8A 4K6KA 3T38A 4CMBA 5FEUA 1WZIA 5EUQB 3L0YA 5FFMA 3PI7A 4UM7A 2Q46A 2CHFA 2R5NA 3CO0S 4GVPA 5B3JC 1L8LA 4P4LA 1OPRA 1IY8A 2G9VA 1PKXA 1DT3A 2PHZA 4M9XA 5I9LA 1IXZA 4LYGA 5BR1A 1Y8CA 1TD1A 2AFIA 3L1VA 3OZRA 1QRTA 2H4XA 3NNSA 3TLAA 5GGYA 2A33A 1C9DB 1KETA 1M1UA 3SE0A 3ER8A 4IGKA 2P4QA 2XMQA 2O8CB 2IIQA 4CDRA 5L53A 1PBNA 2PZMA 3NU1A 3PICA 1OZAA 1X1RA 1Y82A 3HU3A 3HTXA 4NCIA 1XDGA 4B33A 1DX9A 5DNUA 1P8JA 2EF1A 4LJ5A 3TAHA 4XEUA 1EVEA 3UOWA 3U7QB 1U6IA 3WIBA 5CA1B 2IZ7A 3HLTA 1OROA 2DCUA 2G06A 3DHEA 3UJPA 5C8ZA 5KKNB 1NLYA 1E9VA 3E0QA 1KDZA 2HXGA 3RIEA 4EJ0A 5D3QA 4R51A 5AI8A 1HQCA 3H7AA 3QTTA 4IFEA 2DHRA 4Q3AA 2LCQA 3CYFA 1UXOA 2HXSA 3CC8A 3VNRA 1T6ZA 3G79A 1A2BA 5CHYA 1D7OA 4M7OA 2EC5A 1RJ9B 1UJNA 3C14C 1LBIA 4Z0NA 3RK1A 1GHTA 2FVYA 2RK6A 4N40A 4EUKA 1RFGE 1VPLA 2V7TA 3O2SB 2HLDA 1T5TA 3FVQA 4IYJA 1QFJA 4K88A 2BELA 1KZYC 4UDNA 5CT8A 1KYVA 4ZOLA 3N8DA 3FCYA 1SOWA 3OJWA 4FBLA 1CIVA 2V6JA 3QXSA 4TKLA 2JIZD 1Z9BA 3K30A 3IAAA 2ZT5A 4QYMA 1KK0A 2PX6A 4KHZA 5C8DA 1LI4A 3S8YA 1Q0TA 4K9LA 1I7LA 1YC2A 2ZJ1A 1USUA 1P0CA 4BZXA 1MQAA 2JJ1A 2LNDA 1MRNA 3HA2A 3ECCA 4G63A 3H5OA 3PPIA 4EELA 1U7HA 4FYYA 4X24A 1KYWA 4NCJA 4IVNA 4KNYA 1NQUA 1DDIA 3OCWA 4KWTA 3CKMA 3GNSA 2R0QC 3VDRA 1KR2A 3CM0A 1BNCA 2PKRA 3F6EX 2PL3A 1ZONA 1BS1A 3G2JA 3HVHA 1ZCBA 1GLVA 4JB8A 2G9QA 3KU1A 1IBLB 1NLUA 3FYDA 4WIAA 1TUEA 2WFMA 1V8OA 1F2VA 2HCJB 1V6CA 2OORA 4X63A 4M87A 5KX5B 1Z4LA 3C0KA 2O7QA 3KSMA 4O4HA 3VYSB 1SUBA 1UQUA 2FZ4A 3Q7SA 4HDSA 5K4AA 4MQLA 2ONZA 2EKPA 1Y33E 1KAHA 1UPAA 1XRMA 5K3DA 3U7IA 8AT1A 3T4UA 1MN6A 2ZRFA 3UGJA 2XODA 3BTUA 3RGGA 4PAOA 4DWVA 5B3KA 3BE4A 1TKBA 3E58A 2C3PA 4AF7A 2K2WA 3ZCQA 4B87A 1P0QA 4PEVA 1QNFA 2OYRA 2R1VA 4TKVB 1TYEB 1KRHA 3U44B 4ZI2A 1N6LA 1G5PA 3UYLA 4IGIA 4JI7B 1RKXA 1YBMA 4X66B 3D3KA 3H13A 2HREA 3S3TA 5KOJA 2CB0A 2AEFA 4XE5A 4NICA 1O2DA 4O2AB 4F5EA 4KO3S 1ELOA 3FAKA 4MAFA 2D1FA 5IJXA 4TL8A 1KO7A 4LXXA 5EJ2A 4ZHQF 1QPZA 3MWKA 2Q5OA 2P9FA 3BXZA 4U9HS 3E8MA 2GAFA 4Y0AA 3F97A 4ZEWA 4DTIA 2GRJA 2XUZA 2HRZA 4OEHA 2DFVA 4PG7A 2GK3A 3FETA 4D9GA 1C4KA 3GELA 2G71A 1HV8A 4BNDB 3QBJA 4UCXA 1O58A 3FR7A 5J2UA 1OLSB 3OCCA 2DR2A 3ILYA 2CFCA 2IUEA 5C31A 2FY8A 1VKRA 4LG1A 4NZNA 3AUYA 1EZ4A 2YMMA 4M9SA 4JSRA 4UMDA 5K8TA 4E5MA 2NQTA 1W8DA 2XYPA 1JR3A 5E4FA 4ZV9A 1MIOB 2QU8A 4QUEA 5D7BA 1KIFA 3JARB 4ZTZB 5IVKA 1PEAA 1MB3A 5ALIA 3CA8A 3N28A 4BX3A 4CHGA 3FFBA 2QP9X 3MJHA 2ZRKA 4K5QA 2BT4A 2P9QA 2HSWA 4B75A 2QY9A 3U31A 1YR8A 4N0QA 1ZJWA 2HF8A 2VK1A 5EKDA 3RYFB 4B3HA 1ECGA 4PGHA 4BKOA 3RTGA 4DJJA 4LTDA 1QIKA 3ENZA 4LJRA 4H35A 2FUG6 1PI3A 4O4LF 3WRVA 2PMKA 1SNYA 1B41A 4A91A 4FMBB 3A6PC 1GILA 4ZO8A 2WWGA 2NYVA 1N6RA 4RUKA 4XB1A 4MS4B 1Q1QA 3R5XA 4OLJA 1C7IA 1M2VB 2O20A 3MLEA 2NYUA 1ZNYA 2TYSB 2VAPA 2CXNA 1CUSA 2X6RA 2Y99A 1JSCA 3C6KA 2ZUSA 4LGVA 5AJYA 3FB4A 4PYKA 5LZ8A 3RROA 1D2MA 5ICCA 3MRVA 1GUFA 2VTBB 3P0EA 2G70A 4FJ0A 4G8CA 1UP6A 1TW2A 2RGEA 3H1AA 4L4ZA 2WMYA 4NBRA 4RTJA 4IQGA 4RGYA 1IUOA 1MPXA 4G36A 2XTMA 3RC1A 3SICE 4CJXA 1V9SA 4L78A 2FP3A 3G7SA 5CLFA 3SZOA 1Z3IX 3WLIA 4C4ZA 5L4LA 2PSJA 2QTLA 1UINA 5G53C 3DEIA 4D74A 3KOMA 3ABIA 1KMQA 3FPJA 4G41A 2G25A 4IDEA 3ZQKA 1B2LA 4UNQA 4HQOA 5JNVA 2P6MA 1VBMA 1E3QA 1Z26A 2HJ9A 3WIUA 4DSAA 3OTOB 1R8XA 3RHFA 2F1IA 1E3MA 4DJ5X 3QI2A 1AKMA 1GPMA 4UBLA 2DU8A 1OQAA 4EWLA 1O6ZA 1GG8A 2XDWA 2ZRQA 3GBPA 4KREA 5FOTA 1KPGA 1Z36A 3CF2A 2VDJA 3LQYA 3OH8A 4CKBA 3GWZA 1HLPA 5TF4A 3RSSA 1G7TA 1MHTA 3O1IC 3Q7PA 1YZHA 2W0MA 1FPQA 3CRMA 3JVVA 1DFHA 2Y77A 3LE8A 4FE7A 4BZQA 1E62A 1P75A 3AL3A 2CE2X 2IV3A 4Z0PA 3SFTA 1M54A 2OCIA 1ECPA 4EABA 4RPLA 1M34E 4EH1A 3VMFA 2J4CA 4CMIA 1X0XA 4MR8A 2X5KO 2XWSA 3CRZA 4E5KA 5CDSA 1TZBA 4ZT6A 1YFKA 1O77A 3DAPA 4MP6A 2WD7B 4DNXA 5TPZA 3EZ7A 4E3ZA 3EFEA 3Q72A 5CA1A 4ZWNA 4OP1A 1V35A 4D4HA 1S96A 4YIHA 5CIYA 2PSFA 3TNJA 1BJTA 4NBSA 1HYGA 4XGQA 2BF7A 2XNSA 3REQB 3EPRA 5EZYB 2Q6OA 4OI1A 2Z6QA 2WTEA 3E3NA 4MUFA 2H4FA 3MCTA 3JQAD 4UTRA 5BUZA 2OQIA 1U4OA 1QO0A 1X9IA 1DDGA 4IZ6A 3UJAA 1CUVA 3V4PB 4X20A 3UG6A 1P73A 1RJ9A 1DXHA 1RWQA 2QZPA 3LGSA 4A5SA 3FWPA 1DKMA 5JSUA 3FHTA 4D26A 3IO3A 2Q99A 4HNHA 3AFHA 4ERXA 2SKEA 3ND9A 4B6SA 4B3SB 2HO5A 3B5EA 4OHUA 2XXAB 4EMUA 3GQVA 3WGTA 4HF7A 4WHMA 4P3OA 4CEJB 3P26A 5EP3A 4MLDA 4KIWA 1JLSA 4UM5A 1C3OA 3FKQA 4G2NA 1SPBS 4MUHA 1GL3A 1IG0A 1WUYA 4CG2A 4B3FX 1J9GA 2DVMA 3VOAA 1GCUA 5JMPA 4BFCA 4LZAA 4DLXA 2XGJA 3AB8A 2G6BA 1PWYE 2V9PA 3HQ4O 2H8GA 4OSPA 4CTMA 1JFLA 5DYIA 1UBTS 3QVLA 3TRIA 4G0UA 1IFXA 1G60A 2V1XA 2O8FA 3CIOA 2XMPA 4D0GA 1MFZA 3DTVA 4UU1A 1C0LA 1W1UA 3DOEA 3UMMA 4JC5A 2ZYGA 4G67A 2ZREA 1YL7A 4V0RA 2W6IA 4JB2A 4YASA 3MB8A 1NBWB 5KX5A 2BHTA 5B3LA 1GAWA 4RNCA 5JFGA 4RTOA 2WSMA 5DRTA 1RAIA 4LI0A 1NY6A 1GVNB 3B78A 5EJAA 2XMSA 4DG8A 3X2FA 4UVHA 4CIYA 3N2YA 4HMQA 4EY4A 5C8YB 1DGQA 3WGJA 1ZUHA 1YKGA 3O1HB 2QF7A 3PITA 4X90A 3T3DA 3VNAA 3L7KA 3L43A 3GW8A 1RYYA 3VU0A 2J8ZA 3ELUA 3CX3A 4CDMA 2CY0A 2F17A 4TKVA 3CUEF 2J0EA 4O8ZA 3U44A 3TMAA 3JQDA 1DC3A 1HFEL 2GCPA 1J49A 1JVNA 4EG3A 1U0BB 4B35A 4BBPA 5DWDA 4PNHA 3U7GA 1ODFA 1GNQA 1AT1A 1PR0A 3KLMX 4O2AA 1Z73A 1K68A 2W6JA 3B2NA 3M9LA 4UJ3A 4QM6A 1R5NA 3TPZA 5TLSA 1RKUA 2VAXA 3C2QA 4REQB 4XLTA 4G4SO 3VM6A 3ZV5A 4D8XA 5K0GA 1UOQA 2ZPAA 1E8NA 4JIMA 5IBQA 4JCOA 2HFKA 2NLOA 1BTOA 2VNIA 2JGRA 3L7IA 1O8BA 4UEQA 1U90A 3ETHA 3GJ6A 3RUHA 5HRUA 2JEZA 1JQAA 2IPAB 4D80A 2Q4EA 4K8RB 3W8DA 4AN4A 4EB3A 4QJBA 3LHSA 3DEJA 3AL2A 1X3SA 3D0OA 3Q8XB 4KN6A 5JAMA 1N2GA 4TWZA 3GLGE 4QAJA 4O63O 4DLTA 1ZUNB 4RK6A 1MIOA 2XQVA 2CJYA 2BVNA 4TV8A 4YCAA 5TPWB 3JARA 2E6KA 3VO9A 3KYCA 1TRKA 3BWVA 1XPJA 2QSZA 1C29B 4Q7KA 1QBKC 3EEFA 2GETA 1H1TA 3NHLA 3MBOA 3FRJA 5IAJA 3WL8A 3QF4B 1J0CA 3OTWA 2JPDA 1I4WA 1OHHD 1UZNA 3L1JA 3F96A 3PKJA 4FVTA 2H9IA 4JNCA 4RFSB 2ZWPA 4LQCA 3RYFA 1T5DX 4MINA 5T4FA 4EHNA 2X7HA 1G7CA 3VKHA 3ACCA 1FZTA 3TW4A 2V6FA 2JLWA 3PD0A 4LRTB 2JJ2D 2VDQB 3H9JA 3CX4A 4XH9B 4YRIA 1QZUA 2HJGA 4Q39A 3DTTA 2YV5A 4TV9A 1FS5A 4UNPA 1XMPA 2BSAA 4MPRA 4Z1MD 2ZITA 3DDWA 3GJRA 2FR8A 2Z09A 2ZUBA 3AESB 4PZLA 5TJ9A 4X64B 1GNSA 1M2VA 3UCXA 2H1SA 5KHOC 5LB2A 1MO4A 2WF9A 3HU1A 4ETIA 4JP8A 1C4XA 4EA7A 1CXZA 4C4OA 3IEVA 4AJLA 4HTAA 5ALWA 3P71T 2JCGA 4HZUA 3RG8A 1DC8A 2PJUA 1E3IA 2W2XA 1CY1A 1QORA 2GK7A 4URZR 2I91A 4YHHB 3CWCA 3PHCA 3KV3O 4GE0A 2AFHE 5BNZA 3L1IA 1J2TA 4PLCA 4RF2A 2I7XA 4OATA 4UM8B 3ST7A 3T7KA 4DSUA 5AUQA 2R7AA 4MIOA 3WISA 3UO8B 4BFZA 1FFSA 5ALFA 3RTAA 1TMGE 4NMHA 2O57A 3G2HA 4JLMA 4X45A 5BUSA 1ZY2A 1T1JA 4NECA 4WAUA 2WOOA 3S2IA 3M81A 3UJ3X 5F9MA 2PXAA 3H3JA 5JSKA 1G8PA 2FI1A 1PF7E 1XRRA 4H7HA 3M1YA 1U0JA 1THTA 1Y5RA 2CLEB 4MRMA 5BURA 3ZDQA 3BGIA 4EW3A 3D7NA 1EVQA 4EMBA 1XTKA 5IZCC 3S2UA 1W44A 1RBZA 1E6CA 4AFNA 3VR3A 1G8MA 1SXGA 2KJQA 2NIPA 4BB5A 4BMZA 3EK2A 3KE9A 2F8TA 1FMFA 2X4LA 4Z4EA 3CF6R 1FLAA 3I72A 2OCBA 3F8WA 5K6AC 4N5MA 2PYIA 3A6LA 2X7XA 3BERA 4TRRA 4TTRA 4A2CA 4EPXA 4A15A 3RRBA 2WSBA 4FEEA 2LD4A 5C1DA 1PR6A 2VC2B 3FYCA 4E5VA 2NXJA 2Z9BA 3TEMA 2NG1A 1TFRA 2A9VA 5C5DA 3SP1A 1Q1GA 2QGNA 4X8MA 2PV0A 3FUWA 4RY9A 4WCFB 2JL1A 1T2CA 1U8XX 4JC0A 4U6NA 5LP6B 4KSBA 3U80A 3PA8A 3A1VA 2WV7A 5EWLA 3F7TA 3STTA 2IEYA 2XCIA 4IIJF 4Z4GA 2GN9A 5BRAA 4G5OA 5KTNA 5L6LB 1JVBA 4PYNA 1UPFA 1H0HA 2ZTLA 3E23A 5EZYA 5G1PA 3REQA 4YRZA 2XLBA 1YCGA 1IIBA 4BECA 1J8MF 1LLUA 2Q49A 3G5AA 5EP2A 3VR5H 3VUEA 5LMZA 4MDFA 4RF4A 4I50F 1S2LA 4TMKA 1CX9B 1RP7A 5LXTF 1BE6A 4MP8A 3UHJA 5IC4A 1KA9H 1EUZA 2VWGA 2VDLB 2J3QA 3VNUA 1B73A 5ALDA 2ZI3A 3IP9A 2BF4A 3NVMB 2WG2A 3W6OA 4A92A 3MGBA 1K9SA 2XXAA 2XNCA 4ZI7A 3OOSA 3NP9A 4JNKA 4WXEA 1LWNA 4U8HA 4CF7A 5J3JA 4YX9A 3AB7A 4FGJA 3OZWA 3HR4A 3T5PA 1P81A 1XRSB 4NMLA 5JASA 2VCYA 3KSAC 4WT7A 2JIBA 2A1IA 1ZA2A 2Q1TA 1P4JA 3UUEA 2JRCA 2PTGA 3EXAA 3I8XA 1G9TA 3TSCA 4V0KA 1U5BB 2AN9A 3IKMB 1JUDA 3V3TA 4HRXA 4DQVA 1J5EB 1HE1C 3A4TA 4RX1A 3GLTA 4KLRA 3GLHB 4E6EA 1Z0AA 3DCIA 2C9DA 2H7YA 1ZD4A 2YDYA 2P0EA 5IN5A 4MI1A 2OZVA 4QYTA 2VF2A 4LMRA 1US8B 1J1IA 3DBIA 4C0HA 4K2AA 3ORFA 1SMKA 1Z29A 2A92A 3TRHA 4C2UA 5AK0A 2OK7A 3C3BA 4NMXB 4YQEA 2J4FA 1FVFA 2HWYA 2V7QD 4IFTA 2Y2VA 4IOJA 2NYAA 2XF2A 3TQFA 5HK9A 3ZGZA 5C8YA 3FOBA 2X58A 2JFUA 2GZRA 1QVRA 3BL5A 5T64A 4C0WA 4LPSA 5T41A 1RRVA 3ETNA 2XWQA 4IJUA 1Y37A 2XGSA 4BTVA 3IE2A 4E2WA 4D8VA 1JQ5A 3ZKAA 3ZXYA 3HKBB 2HQRA 2ZLBA 3EJWA 3A25A 1GNTA 2P9BA 1X1EA 1W25A 3TZHA 1FS4A 2JFWA 3A32A 3OZAA 1XEXB 3D64A 3X43A 5K4GA 4JHXA 5IF9A 3ASZA 3FPGA 4F4FA 3O4VA 4U6SA 4ZAZA 3AP3A 5IH3A 1T5IA 4ZYYA 1Q22A 4X3CA 3Q7EA 1F3OA 1X7YA 5DSTA 1QIMA 1O94A 4REQA 3NHJA 3CO5A 2HU5A 5HWSA 3K9FC 4G0MA 1T2UA 4BYMA 2WJGA 1QIIA 3KD3A 1L4LA 3MVEA 2I0FA 4KE9A 2XZLA 2NM0A 3PGJA 5K0JA 3QELB 4LJLA 1GPWB 1UT8A 1W36C 4KHPB 3Q6NA 1HMYA 2R6CA 3G8CA 5CNJA 1GUDA 4OGLA 1K92A 2BFCA 5AUPB 1ETHA 3H42B 4YJHB 4FDUA 3ZGYA 2WJHA 1Z08A 2NACA 5IXYA 1LCIA 1AGNA 2QW0X 3GVPA 3MGGA 2R1ZA 4EPRA 1R1DA 5LDGA 1ZUNA 3JWGA 4LJ7A 1JR6A 1BU5A 1EFLA 1MXFA 1T9AA 3HEMA 5HOEA 5JZOA 4O5AA 4OLHA 1WDMA 3B3JA 4F91B 5CA0F 2P2YA 4JODA 3ZS8A 4V39A 3ZW9A 3MINB 4ASUA 4F72A 2J5XA 3QPDA 2LW7A 1VHLA 3RGWS 1ORVA 4DPLA 4ARSA 5EAIA 4DSOA 8GPBA 3WFIA 2B4QA 3GLIA 3BORA 3EUEA 5DH9A 5IKMA 1JQEA 1QE5A 3A28A 4TYNA 1IK6A 2OWDA 3D8NA 3TTYA 1N33B 2OXEA 1KAMA 2JATA 5GJWC 2D62A 1EIZA 2GUWA 4H0FA 1H0RA 2VDMB 4A10A 2FJUA 3PUWA 3RSCA 1SOAA 1Y8QB 1L5HB 1QH8B 3RRFA 4NCNA 2AIRA 3T5CA 5TARA 4YNBA 3HXQA 2Z9DA 3Q1KA 3OPMA 5LQSA 3ZLVA 5IJ0B 2B8JA 2C3MA 2KLHA 3OZ7A 5K0NA 1L4HA 3PEYA 4PRKA 1P0PA 1E1MA 2PFGA 1GZDA 4EY8A 1P4AA 1Y1SA 3NR2A 1HDRA 4PZAA 3ND5A 1YRAA 4BYGA 1OI2A 4W1QA 3PNQA 1E3WA 2HR1A 3R6DA 5JT1A 6LDHA 3RYIB 3SQXA 3GPIA 5BYKA 2PRJA 2FEKA 1G8JA 1VFPA 3QSYA 4D57A 2AOTB 3C7DB 3GEHA 4AJIA 1XFAA 2UAGA 2VQ6A 1CUGA 3QFFA 4Y6OA 3RS0A 1Z5VA 4FHCA 1G66A 3RSOA 1ZLXA 2BSXA 3BMXA 3WLSA 3HB4X 2ZCVA 5DXFA 4IX9A 1N6KA 2QSYA 4DMCA 3TUZC 1B0UA 5C7IO 1DT5A 1F14A 1L5YA 1OJLA 3GNQA 5EMKA 4MVYA 4AXXA 1Z5OA 1CDEA 1QPGA 4FZRA 4W8OA 1JFSA 1QKIA 3KWFA 4YREA 1CEQA 1NV8A 1I36A 2WPNA 3O95A 2A9KA 1W2GA 1A82A 1OCEA 1EK2A 3IESA 4R4JA 5AO9A 3BD9A 4RSRA 5E9JA 4H77A 3ZCRA 5IX8A 3UJ6A 2F43B 1F17A 2NV0A 1NNUA 4FYWA 4DGSA 4A6PA 2EEZA 5HKOA 5SZJA 1ZJJA 4R1LA 2Q3CA 1A8SA 4RVSA 2HYDA 2C5LA 3O7MA 5T6BA 5E7MA 3BSFA 3OWOA 4RKWA 1I0ZA 4WCFA 4YT2A 2DWPA 5LIRA 5LP6A 4HY3A 1J20A 2BCJQ 5KTPA 2RGAA 5FLYA 3WMWA 2VDNB 3WHIA 2WUGA 4E4TA 3ZGVA 3BM5A 3OIDA 3LKDA 3SEZA 3THOA 5IMBA 1CEXA 4MV3A 3FM9A 1N2ZA 3MXTA 3RSGA 4BMVA 2JIPA 5EJ7A 3OG9A 1ZUWA 4DIOA 3V7WA 3FGNA 1WL8A 1RQ7A 4N3AA 4UNIA 5AHKA 1K3TA 2BPOA 1RIFA 2L82A 3HDGA 4I3FA 4W1PA 5C0OE 3SDSA 2R6JA 3CNBA 4HB4A 3UMSA 1NI3A 2QLLA 2GAAA 1G20E 1X6VA 1GKKA 1G1AA 1X14A 3DXYA 3QPCA 4A03A 1JFTA 2Z1MA 2ZBDA 3COVA 4Z7OB 1I3KA 2LIPA 1WG8A 3AJRA 3D8BA 3HWX1 3H99A 3EFBA 3QYFA 3IHTA 4RIHA 1IWPB 3VSAA 1KRWA 4RIGA 4UNSA 2PKXA 2PZGA 5K0BA 3P2OA 4OV6B 3OIFA 2C7GA 2QRHA 4ABTA 2JZOA 4IF6A 2WNHA 4IHAA 4WGFA 3D8RA 1IB6A 4RDIA 1UWVA 4K0RA 1IUKA 3GLHA 3ZEIA 2FN8A 4GYYA 3RU3A 2OBXA 3LQ4A 4GGPA 1H4TA 3IHWA 3M9WA 4BZWA 4N0DA 4CF6A 1N6HA 4ND7A 2I3GA 5CX1A 5I4KA 3QHAA 1US8A 3QU7A 4MVCA 1YMQA 4UBKA 1R5BA 3CG0A 4CL3A 1XVUA 2C1XA 4IDPA 2WTUA 1X7ZB 4KR6A 2J7PA 2R8ZA 3GZNB 3NT2A 1ULBA 2AJDA 5JXWA 2XI4A 2ZRPA 3FDFA 4N5IX 4EARA 5G0TA 4PF1A 3W5BA 4KDRA 3JRXA 3BX1A 1D2CA 2NXCA 3O6VA 3SM3A 1N8NA 4Q4JA 2V9CA 4URVR 1QWOA 3FCCA 3SHVA 1AJEA 1TYCA 1PL0A 5DGIA 4RF5A 1ID1A 1Z5UA 2OKCA 4PSKA 2E0IA 3OM0A 1JZQA 2YX1A 3S81A 2RGXA 1SVUA 3DZDA 4INZA 3TQIA 3WDLA 4AP6A 1W0KD 3T5TA 3T7EA 5FYQA 1P7ZA 1KMCA 4LW8A 1U9YA 4PYOA 1ZUIA 4P4GA 2QRJA 3DNFA 3LXXA 3INYA 1C1DB 4URWR 3F5SA 3KBBA 1QZXA 3K9CA 1Q3KA 2P2ZA 4MV5A 3UHAA 2ZR7A 4UATA 3ROFA 2IBSA 1AURA 2R62A 4QQ8A 4CM4B 2OKGA 5I7RA 4I8IA 2XZOA 1T4MA 4HB2A 3ONEA 4ND2A 5NULA 2XE7A 2QORA 3PC4A 2HNAA 4QOSA 2CSXA 3OQNA 3TR5A 1X8JA 2PRSA 2JGIA 2Q5FA 4FS3A 4G81A 3QELA 5CLQA 1ADFA 2CMKA 4I6JA 1Q15A 3RU9A 4DLSA 4NCAA 2J0SA 4RO0A 3VJRA 4PLZA 5GGXA 3JX9A 5HS6A 1JNYA 1JLKA 2GR9A 2JJQA 3RJZA 4W5RA 1DXOA 3TINA 1FTGA 1H0KA 4OOFA 5DNAA 5A05A 4QATA 5C1IA 2G4VA 1YRLA 4G0YA 1RXWA 3L93A 1EZ1A 4F1KA 3QUAA 3X1ZA 4IS2A 2J9XB 1DKLA 3UHFA 1W581 1XXHA 2V45A 2C5FA 3KZKA 4PPGA 5TV2A 1U6JA 3MINA 2GFHA 1RWOA 2FETA 3GGDA 2GF2A 4I6GA 3KKOA 3OAAA 4B8WA 4RK1A 4AG3A 2EJVA 2BGGA 1PVOA 4NTZA 2CVPA 1T8TA 1SKMA 3EGEA 1MRSA 4ZCRA 3PBKA 1VLJA 1DWPA 3NFRA 4BAZA 1Z3CA 2ORIA 1KO5A 2BEWB 2D2XA 4J94A 5A7GA 4WLEA 4KE6A 1E5LA 3AR6A 1VM6A 2H85A 1WD7A 1ZW1A 2WTBA 4D42A 5C52B 1QRUA 5EINA 3OQJA 1T0UA 2QN3A 2PQMA 3ZHVA 1LXCA 2H59A 4BAUA 3CUVA 3K9GA 2JIZA 4GRIA 1DOZA 3VZCA 5CW2A 1G21B 5CXSA 5A4JA 1Z28A 3BILA 4CN8A 2KE5A 1ZJ6A 3U4QB 5IJ0A 4ACBA 4PFKA 5JXGA 1SUDA 3JU3A 1ECJA 1HTTA 3I64A 3IC5A 5EJ4A 1BHSA 1J56A 4KJZA 3ANYB 1EP3B 1UKVY 4WUVA 5MGNA 2PGOA 4V2UA 2PV7A 3AIOA 1J97A 4TLLB 1KZ1A 3W3AA 3HUUA 3FNEA 5AICA 3ADDA 4O4JA 3TX2A 4OQYA 1JHQA 4RLHA 3GFSA 1W36D 1SWVA 2D5AA 1VYTA 2NNWB 2AOTA 2X4DA 3A2MA 5BQOA 1QIGA 2CNDA 3HUEA 3MIZA 5TEWA 2RG7A 3AHGA 3ZQ4A 2V6GA 4MV7A 2ZUUA 3BE5A 2QQEA 1NUPA 1LKZA 2QX4A 1I2ZA 1IZ0A 3AW8A 1K6IA 2WB4A 3GMSA 3VU8A 5L3QB 1XG5A 3L4SO 4US0R 1QJ4A 4DR5B 5FQNA 3Q1LA 4C0JA 3DOUA 2AI1A 1KNQA 3AHEA 4W8HA 1AV7A 3IA2A 3MCUA 2IF0A 4GECA 4RW0A 2NQ2C 1A04A 2EIHA 2Y71A 3U09A 3EH2A 5KNDD 1SHLA 3LS2A 3WRWA 2DWQA 2R11A 1Y3FE 4D9FA 1WZ2A 3DAFA 3MYYA 2J1LA 1OJ7A 1IWBB 2F43A 2HLNA 1LSJA 3FTFA 1NBOA 3AKDA 4EHFA 1UK8A 2SCUA 1JQDA 3FE2A 3M7IA 4HGOA 4MVJE 4BGIA 2DERA 2GPWA 2W6CX 3GY0A 1JT9A 1U4NA 4BO8A 4FHFA 4L9SA 3HZZA 4GFDA 1E2IA 5JAPA 4B4VA 4NAUA 1BDIA 2GVZC 3PGXA 3T5BA 1V8PA 3T3HA 3W05A 5JALA 1L7AA 3JZMA 3ZHOA 2D00A 3PT9A 1VMEA 4PPQA 1XKLA 3AUJB 4X94A 3CNLA 2J9FA 1FE8A 3INGA 1F7VA 1E6MA 3RIHA 3V00A 3AR5A 1DAIA 3C3CA 5FPYA 4ALIA 3W3AH 2I67A 1EVKA 1Z12A 2YHIB 1CFZA 1UODA 4H9GA 3K53A 1YWGO 2VAWA 3EB9A 4ZALA 1P0MA 5DIZA 3L6DA 4D81A 3DAGA 2HCTA 1NYTA 4ARUA 1XTVA 4G1EB 1G8AA 2C8KA 4CKWB 1LZLA 3INNA 3K0EA 1W36B 5KI6A 1IULA 3V4LA 1P5ZB 4JGIA 1NNLA 2OG1A 5DN6A 5IEJA 2OFPA 2I4IA 3B7PA 4KMMA 2AI2A 2G63A 3F5MA 1LS6A 1E69A 2FZGA 4UTOA