3S30A

Crystal structure of a putative glycoside hydrolase (bvu_0247) from bacteroides vulgatus atcc 8482 at 2.46 a resolution
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
254
structure length
254
Chain Sequence
TKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQGFALTGSGYTPNDFPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDALSATKFGTTFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQMLDGHIAKNNYEHENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVSIVLSASKDGDVFQGAPGSTLLIDDLELVCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical glycoside hydrolase (BVU_0247) from Bacteroides vulgatus ATCC 8482 at 2.46 A resolution
rcsb
source organism Bacteroides vulgatus
molecule tags Hydrolase
molecule keywords Hypothetical glycoside hydrolase
total genus 63
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13201 PCMD Putative carbohydrate metabolism domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.890 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3s30A00
4HETA 3S30A 4JRLA 3HBZA
chains in the Genus database with same CATH superfamily
3VBOB 1H2KA 1I3HA 4GIQA 3VBRC 1UO9A 2EALA 3PTYA 4FVVA 4FAHA 2GC0A 4AI1A 2QKDA 3JD71 5FMDA 2X09A 3PUAA 2UWCA 1JMUB 1O91A 2Q1ZB 1NOVA 1UAIA 3B02A 4Q4Y3 1PNFA 1QJX2 3Q8BA 1KITA 5CFCA 2PHXA 4ZS3A 3CNAA 4QPWA 1O8PA 4QB6A 4Y22B 5T5OA 5FQ0A 4NIHA 4PHZA 2E31A 5JUVA 2EXIA 3ABZA 2NP0A 2VQTA 1S2BA 2GH8A 1IPJA 2TBVA 3AP6A 3SH4A 4QMAA 1FNYA 1ZBE2 4ATFA 4MGYE 2PLV1 1W90A 2C6SA 4WM8B 4XETA 2BNOA 5AC93 2GNDA 2ZEZA 2RHPA 1GP5A 4LIUA 2DDUA 5FYHA 4LUMA 5A3WA 1H30A 2E6VA 5DDJ3 3VBFB 5JXIA 1HV1A 2JG9C 4XACA 3T4VA 2E9QA 4FAGA 3TYJA 4N53B 1RVF3 1Z0HA 4E4SA 3A4UA 1WMDA 4DEVA 3VBOA 5E8AA 2DBIA 2XG3A 3ZYBA 3LOIA 4CCEA 4D0QA 3EYPA 3U11A 2C1FA 2VMCA 1QJU3 2PHDA 2WZR2 3ECQA 1AX1A 3GZAA 3WQ1A 4AVSA 3VDDB 3NAPB 5IVJA 1CAVB 3HIFA 4A4AA 2ZX0A 3EBRA 5FY0A 1OC1A 5CBLA 4SLIA 4HVRA 1LESA 4E2SA 1JOJA 1JW6A 4YGBA 2XJRA 4J25A 1RUOA 1VP6A 1ND3B 1K5MC 3I59A 1XNKA 3CJIC 3V56A 5FPUA 1FOD3 3PUIA 1WLTA 1D2SA 1MEC2 2G9FA 2NZ9A 2J1TA 3IDCB 1GQGA 4HMZA 5FP3A 1RYYA 2RS33 2DUQA 5HBAA 2ZCWA 4DQAA 2ZTNA 4ASMB 4E2GA 1MVEA 5IT6A 2JDYA 2ID4A 4AFAA 2E51A 3U75A 3NJZA 1WA4A 4EWAA 2R49A 3MV01 5I8TA 4OUEA 2BOJA 2X5IB 1VB2A 3VLBB 1IG3A 1LOAA 3B69A 1SDDB 2FQPA 2XL7A 3LEGA 1W6PA 2XLAA 1ONAA 2XONA 4JX0A 3VV1A 1DHKB 3K4ZA 4JZRA 4DXSA 3UNPA 2W0XA 4XZPA 5GZGA 1F4HA 3K46A 5FZ3A 1N1TA 1S2EA 5EZWA 1ULOA 1WWYA 1Y7BA 4WM8A 5B4NA 4ATEA 2R061 4FPHA 4UF0A 4YSFA 3OTFA 3P6BA 4UF0B 4PJYA 1O3RA 1Y9GA 3I59B 2VXJA 2W3JA 5K4LA 1NE4A 2I07B 4Y20A 3WEZA 3U14A 2XJTA 4H55A 1VMHA 1GYKA 4P08A 4Z82A 3VD9A 5FWJA 4M3CB 1ASJ2 1OFNA 3AYDA 4HOOA 3ZR6A 5T3NA 3H9AA 3OY8B 3DPRA 2R0HA 3KF5A 3UKTA 1UIJA 5IVBA 2QVSB 1V9U2 2SLIA 3FC0A 1RJ8A 1XNTA 1ZZBA 4MG2A 1FYUA 5JR2A 1RMU2 4MX3A 1NCQC 4X6QB 4M3CF 3K51A 3VZLA 1W8HA 3E5XA 3Q8CA 1QNWA 5F3IA 1RUH1 1V6JA 4Q5OA 2W52A 4QHZA 1VRH1 2Q5TA 4N90A 3LFIA 3LSEA 4AEJA 1UN1A 4PLOA 5FP7A 2DCJA 5FZKA 5C3RA 2WQZC 3AVRA 4LKFA 4UBGA 2FDGA 5FCCA 4HKLA 1FV2A 1XE0A 1F15A 3OEBA 4QWNA 4XUTA 1L7QA 2JD4A 1B35C 2RM23 3QACA 5EPAA 5LWBA 2QQVA 4R4ZA 1GP6A 4XFCA 1T2XA 3GGLA 4Y3OA 4YVWC 3ZIXA 4BHPA 3RDIA 5FYUA 1AX0A 1J59A 5CADA 2R072 3ACFA 4BCUA 3HT2A 4XURA 3I49A 1SLIA 2JG8C 4YGDA 4N43B 4NIGA 1RXGA 3MF6A 1DZTA 1R64A 4CCNA 4D69A 2XKPA 2AUYA 1PVC1 4N53A 4P9WA 1BBT1 1ULDA 1RUJ2 3Q8AA 3MFCA 4NRMA 3EO6A 1VBE3 4LBOA 4JVAA 4S2FA 3UETA 3CU7A 5C4WB 1OF4A 1QMJA 2A6WA 3VBUB 1AF9A 4ITCA 2WO3A 4YM2A 1SPPA 5TSWA 1PGW1 1VBA1 1YIPA 1BMV2 2PAMA 1DG6A 4RHV2 2XWJB 2JIJA 4XEZA 3OBRA 2ZACA 4XW3A 3I2HA 5H9PA 1LULA 2G9GA 3LEIA 1O5UA 5C70A 3EJKA 2HKXA 2K9ZA 2HWE1 3N3HA 3WUDA 4DUVA 3LQCA 3BTXA 1H8VA 2DUPA 4I09A 2EIEA 2GH2A 4JKKA 2KXLA 5FY5A 2Q8DA 1FATA 4FOVA 5DABA 1BK0A 3ZN6B 2J1RA 3NNLA 5D8AA 4AAPA 3A0KA 5KR7A 2BGCA 5A7QA 4OI2A 4YW1A 2A7AA 4D6QA 2WLQA 4XXPA 3MLKA 4XUQA 4YARA 1H2NA 1X7NA 3AXDA 4UW3A 2W68A 2DF7A 4J1XA 4XIKA 3L2YA 4YGEA 3AMMA 3QOPA 5FREA 2HWC1 3THCA 1VB4A 5FZ1A 5I91A 4OFGA 1GZ9A 3S5QA 5KHIA 2A6ZA 1HB1A 2A6VA 4R9BA 3SHRA 3AJYA 2NPIA 3N7JA 1XBFA 3EMRA 4B7KA 2WJSA 1VJ2A 3NV2A 4Q4Y1 3CJIB 5LBBA 2FMDA 2WWSA 4CVUA 1RUD3 2XMLA 1U12A 3VD7A 2ET1A 2ORZA 4LO7A 1LHWA 4AI0A 2DCZA 4NWVA 1W03A 2VMFA 3R4SA 3JUUA 2HEYF 2CYFA 5LY1A 4BH9A 3QD6A 3I2JA 5DAVA 4HBNA 3MIDA 3ZSJA 4K1YA 5FO9B 1N1YA 2B45X 3PJQA 4GKXA 3K3NA 2OKXA 4LITA 3H0OA 1IGOA 4NHLA 1AR71 4HPKA 1PO22 4PLNA 2R6QA 4NIIA 2WC2A 4JDMA 5J48A 1YFWA 4XE9A 2TUNA 3JBG3 3JU9A 4RN5A 1DQ1A 1C1FA 4LKSA 2WSUA 3T3YA 1OXCA 3LDBA 2VAUA 1IPKA 2VG9A 5LRRA 4AI2A 1CQ9A 4BMBA 1UU5A 4LBLA 5CZKA 3R05A 1LHVA 1OUXA 1RJ7A 2R7EB 4AGGA 5IATA 3CJIA 4YNIA 3O1MA 4YM0A 5LBFA 1CAUB 1FV3A 1CPMA 4EZHA 1WGPA 2HWF1 2V5YA 2AEYA 5A7NA 1GSLA 1W0OA 4UXAA 5FY7A 1H8TA 3GZEA 4K6BA 1LAJA 4HXCA 3K4DA 2FDIA 5BNNB 5IVCA 5A3PA 2XWBB 3JBG2 2W92A 4AWDA 4QPIA 3ZPYA 2VOTA 4AFDA 5A70A 5FO8B 2R042 1RIRA 4AHXA 3VL8A 2VL4A 3GJAA 4CSWA 3N9QA 5K7PA 4CCLA 4EWEA 1DGWA 4HANA 1D0HA 1O3SA 2BBVA 1BEV3 3IIIA 1ZYBA 3ILNA 1FPN1 2ARBA 1JODA 3NNJA 4COZA 4W6YA 1GNZA 4ZPIA 4FTSA 4N9IA 1AR83 1JZ7A 1O5LA 3Q8FA 1C5IA 4PIYA 2VNGA 1XNBA 4IV3C 2VOWA 3IBMA 4LBMA 1YEWA 2AENA 4DXZA 4P9YA 2P6HA 2D6KA 4UAPA 5LCWL 3MYXA 4MUVA 3HQRA 2PMWB 4Q0QA 2EICA 1LGNA 5FYMA 2WO7A 3N36A 4OMCA 1VAKA 2GAUA 1UY1A 1COV2 1ZRCA 3QBQA 3ZXAC 3VBSB 3WG4A 1U0AA 3J8F2 1CJPA 4GWIA 1FT9A 3HJRA 3J7MA 4Y1YA 4AEDC 3PUQA 1DQ0A 2ZS6B 2O8QA 4ISQA 3MPBA 4NIAA 1GU3A 2Z4FA 1RUC1 3IMMA 2YC4A 4YVWA 5CKQA 5JSOA 4XF3A 4AW7A 3PNAA 4CRQA 2XOMA 3WW4A 1PGL1 1W06A 3I2FA 2P2KA 3POIA 1AR72 3USUB 5FZ8A 3KGZA 3W20A 1D4M3 2RV9A 3IZOA 3OEAA 5D8AB 5FZFA 1PX3A 1QU0A 4N53C 4XCBA 5FPLA 5A6YA 1LU1A 2BFUL 4D7YA 1GQHA 3TAYA 1PGL2 1AL0G 4BM8A 1GFF2 1UXZA 2LUWA 4V2VA 5C8CC 3I4IA 3R4UA 2YPJA 4RL7A 1K12A 3ALQA 4BJ0A 1PIV3 1L7RA 3O1SA 4YPJA 1LOGA 5DN2A 4LT5A 1DGRA 4FFIA 5E6HA 1VE0A 2ZABA 4CCMA 1EAH2 3TN92 1WD3A 4AQ6A 5BNOB 3FJSA 5LB6A 3WNXA 1COV1 3K3OA 2ZGKA 3I3DA 2GMPA 4MXVA 2XGXA 2JIGA 3MIEA 5CNAA 3ZN5A 3PVBB 1UMZA 4AYUA 3VBFA 4XUNA 4ZKTB 1UD1A 2RDRA 4YM1A 2Q1FA 1S0EA 2R041 2JDMA 3DPRB 1J58A 2BOIA 2ZZJA 4RQPC 1HRV1 1V6LA 5ERLA 3BI3A 3VBRB 4LBQA 2Q8CA 1US3A 2ZXQA 4LJHA 2WS93 5EJZB 4YFZA 4P9LA 1VBA3 4NAMA 4QQLA 4E9KA 2V09A 1W9SA 1W8UA 1W8NA 3FE5A 3EXUA 4BQYA 1UPSA 1AR82 2LS6A 1HX6A 2WQ8A 1EP0A 1MS0A 2PELA 1WLCA 2RMU3 4QB1A 1HLCA 1YCIA 2ILMA 5CIRA 4C90A 4DS0A 5JMOA 3AL5A 5LW9A 2HWC2 3T1MA 1S0IA 3IAQA 2PQQA 3H7JA 3KGLA 1AL21 1FMD3 4B4RA 5DPNA 2JE9A 3OYWB 3O1RA 2ZEWA 1JBCA 5F9TA 1GOFA 1LR5A 1XB9A 3UYJA 5EV7A 5FIXA 1JYIA 2R0FA 2XLFA 3ACLA 1WZXA 1QQP1 2OQ7A 3ACGA 3MIBA 3WCSA 4EN0A 3AYCA 3WP3A 1F4AA 1ULPA 1YQ5A 4KL1A 3NKTA 3T0AA 1AZDA 1CWPA 3H1WA 5I0DA 1AYN3 3NNMA 1YQ2A 3HD8B 4OHVA 3ZN6A 2Y6HA 1YI9A 2Q30A 3ZFFA 2IC1A 3T2QA 2HYKA 5EXOA 1WCKA 4LO6B 1G9BA 2J7MA 2RR12 5T50A 1OKOA 3OBAA 1S0DA 1BYHA 2Y33A 1LGBA 2VUAA 5CFDA 2IXIA 3H3ZA 2FD8A 1HKDA 4P5YA 4CP9A 4PI0A 4TLFA 3JB4C 1O4TA 2W08A 2Z5WA 3SCFA 4AVBA 3Q9OA 2RDQA 3ZSMA 1RUD1 1OA4A 2ZGTA 1X50A 3N9LA 3LF7A 4GMP1 1DZRA 5HI0A 3ZM8A 5JPNB 1UYZA 3WF4A 3FLPA 5KXBA 2ZEYA 3MDPA 4OZXA 4ES9A 5A3LA 3WHTA 4EN6B 3VL9A 1HQLA 4V1PA 1O8SA 4QGMA 4CU7A 1HW5A 5L9RA 1FMD2 3ENRA 4CE8A 1RUH2 2WNVC 1LCLA 4K20A 2EAAA 1TMF3 4KQ7A 4BPZA 4CUAA 5FYTA 4FPFA 5C4WC 3LGRA 2DFCA 5BYNA 2TNFA 1FOD1 1Y3TA 5FZOB 5CB7A 3AKPA 5A3MA 4YW4A 2W46A 4CU6A 1IQDC 5FYBA 3RZMA 1NE6A 2VJXA 5CFDB 4IEUA 2A1XA 1YWKA 3ZXKA 3DXUA 1UY3A 3K2OA 1FXZA 2RS31 4R9CA 5CG8A 5GLVA 2VVDA 2W47A 4GJYA 5FPZA 3IDEA 2D6OX 1SFNA 1CIWA 1OUSA 1HDKA 3C7EA 4Y4RA 2YHJA 5F32A 3VZKA 4LTAA 1ZRDA 1U5YA 3VD4A 2BNMA 1PMIA 5JI9A 1SMVA 2DCYA 4OUSA 2VZTA 2GC2A 4UFJA 4LLFA 5I0SA 3NQHA 1D0GA 1REDA 2WT2A 2XVKA 3GNEA 2BVVA 1U5IA 3W59A 4ZY9A 2JKBA 1GANA 2R063 1A6CA 1I6XA 1QJX3 5DZGA 5DUXA 3WF1A 3H8UA 4XFFA 5HPOA 4DRVA 1SLTA 2ZX3A 2WDBA 1VALA 4QX5A 4CPBD 2DVGA 1PM4A 4M00A 5AVAA 2XLGA 4MVTA 4XJAA 4YVSA 3AMNA 4JGYB 2P34A 4KGGA 3ME2A 3PJYA 1DU3D 4YRDA 3M7AA 2Q8OA 1UKRA 3M3CA 3SXWA 4E8CA 1W9TA 1JZ3A 1VMFA 3KV5A 3CQOA 2ZAHA 3NKGA 1Q5OA 2Q1MA 1TQ5A 4DOUA 1CZVA 1W0PA 4FFGA 4XMIA 4YVWB 1JZ6A 3J7HA 2WQ4A 3EB7A 5GLUA 4RR3C 2HH9A 3MEPA 3J4UH 2DU0A 5SV5A 1JZ4A 3OGRA 4NN0A 1DYKA 4YZ4A 1YQCA 3DYPA 3HVDA 3M4FA 1KDKA 3T1LA 3LB9A 1E5HA 1XNCA 3AXEA 2B9UA 5JR7B 3ZYRA 3LIHA 2W2IA 1PK6A 4QPIB 1LOEA 5G05L 2CGNA 4QXKA 5FPBA 4XBLA 4CCOA 1OA3A 3AP4A 4CPBA 1DCSA 1ZZ8A 3LDRA 4ZXEA 1OKQA 4BQ1A 2CSGA 1GNHA 3RMYA 4DEQA 4IE6A 2W87A 4FSJA 3L2HA 2ZEXA 4NPRA 5EYYA 2WN2A 1KFXL 2ZHKA 4BB3A 4JDOA 4INDA 3WVJA 3WINE 1DQ6A 2AH2A 1RUG3 4FT8A 5IW0A 1AXKA 3R0RA 5J98B 3WHUA 1BVP1 1LKNA 4C1XA 3D8CA 4IV1C 4M0NA 1UU6A 3WQ0A 3AMQA 4UW4A 5LBCA 5FDBA 4A2UA 4PCRA 3VBFC 5J3UA 1EPWA 3E6DA 4A6SA 1OH4A 3OD0A 4Q1PA 5CEHA 2J1SA 1W6NA 5C8WA 1ND2C 2HWE3 3MICA 4HONA 3AZWA 1ND2A 1S0JA 4WVVA 4Y26A 3BTZA 2DYCA 2GP5A 4YLZA 3VBSA 5C8CB 4DY5A 2VZ1A 3I2IA 4ASKA 3PVOA 2PN5A 1C8M3 1CX1A 4WM7C 1YO8A 2VY0A 4CCDA 1LOFC 1XU1A 2DURA 1QJZA 2P3IA 5LK7B 4IEVA 5IAVA 3Q8EA 1HB2A 1C8NA 2YGLA 2PTMA 1RINA 4PDWA 1R1A2 5F3GA 4GWJA 1RHI2 2EXJA 2B8MA 2QZ2A 5FYSA 3NSTA 3FLTA 4YG6A 3NJYA 5FLHA 2Z69A 2BWCA 2QNKA 1TVGA 3AL6A 1IG0A 2B5HA 2JG9A 2PLV3 4RR3A 1SQ4A 4RHV1 5FZEA 2VMGA 3E5QA 4IGOA 4QX1A 4W50A 2ARXA 2ZGUA 4JHZA 3DECA 1Z7S2 5KHGA 4QGLA 1W6NB 5C3SA 2ZMKA 1YFXA 4JQTA 1VAVA 5EQUA 5FTTC 5E89A 1C57A 5GALA 3ZFFC 4B1LA 1RVF1 1QJU2 3C3VA 4UI9L 5IK8A 1MS3A 3LSDA 4AI3A 3AP5A 1CX4A 4FQZA 5FR3A 2WBKA 3UT0A 4DNYA 1UWWA 5G04L 2WZR1 3AJZA 3KV6A 3AK0A 4LIVA 2NM1A 4AF9A 4CZSA 4E4ZA 1W2AX 1RUD2 1A3KA 2PLV2 3AX4A 3MIGA 3MW4A 2RJ2A 3FFZA 5FKBA 1DGRN 5FMOS 3EQEA 1WCQA 3I3EA 3VZMA 3VDAA 3WCRA 4DUXA 2QQKA 3RGBA 3P1IA 4KG8A 5IK5A 2VPVA 1M06G 3IAPA 5ABJA 1AVBA 3NNFA 1G9DA 4Q27A 1K42A 2Y34A 3GHMA 5GZCA 2IVJA 1BZWA 5LA1A 1ZNPA 3NO8A 5EHDA 4Y1XA 3HQUA 1WCUA 1PVC2 1BQPA 4NOTA 4E4DX 1QJY3 4HSLA 1LGCA 1S0FA 4UOJA 3E5UA 1SEFA 2AACA 2DFBA 3ZOIA 1OPOA 2VCAA 3AYAA 2E7TA 4HSJA 4QX0A 2UYBA 3UJQA 1FX5A 5FOJB 1Y4WA 2D6NA 2LW8A 1POV3 1WW4A 1Z78A 2YXSA 4L2NA 4P9IA 5C9AC 1AX2A 5C9AB 1ZBE3 3AMHA 2ADEA 3BOPA 4CDUA 5JOWA 3TN91 4P9JA 4PIZA 4D8MA 3FUOA 2B39A 1RVF2 4N43A 4ZU4A 3AM2A 2PA7A 3AKRA 3I7DA 5DAWA 3O5SA 4NHMA 1WLDA 1K5JA 3MUZ1 3WX5A 4HN0A 3ZR5A 4CA9A 3ZSKA 2JENA 3VDCA 3E6BA 4EJRA 5FY1A 1IKPA 4QQPA 4RS5A 2GMMA 3RWKX 4IV3A 2XR4A 5KXEA 2CGOA 4LLOA 3IKWA 4CXWA 3LOBA 1HQWA 4LO5B 4W8JA 4GZ9A 5ACA2 5DZEA 1LJ7A 1ZZ9A 1LEDA 1BBT2 3F95A 3KQRA 2E26A 2W1UA 3MUY1 2GNBA 1VBC2 2ZGNA 4JKMA 1W6OB 4QQOA 4Y4YA 5FPXA 1QJY2 3RZHA 2LROA 2CAVA 4QX8A 3LKJA 5CKMA 2WUHA 3SMHA 4BYYA 2HJIA 2YU2A 4OLLA 4OVEA 5DQ0A 1RUH3 1BEV2 1S2KA 1YUDA 3WDTA 1UY2A 2AZ5A 2ZPXA 4AOCA 3ZYIB 5A3TA 3VN4A 4FBFA 4Z92B 1DGWX 4OUMA 4FOYA 1TG7A 1GR3A 2BNNA 2Z79A 1CR7A 2DU1A 5GLWA 1MZFA 1ZM1A 3ASIA 5FOBB 2VMDA 3M2MA 2WFPA 2Y6JA 2V72A 3SEPA 2Y38A 2BVBA 3V0AB 4XPVA 2FBEA 3E97A 2ATFA 4IETA 4QD2A 4JQRA 3UJOA 1VBC3 4Q1RA 1OH3A 1EV13 5F5CA 3GZTB 4IGPA 1ACCA 3JXSA 5C8CA 5FAXA 2VW0A 4NROA 2GMEA 3DF0A 4P5HA 3PMSA 1QDCA 4A7KA 2IZWA 2KR2A 2A6XA 3CBNA 4P14A 4QQ2A 1BBT3 4W6WA 2EVXA 1NQJA 5FWEA 1VBE1 1RB8G 1L7LA 4FPJA 5I0UA 2YDEA 3LPFA 3RQ0A 3FBMA 2HEVF 4IE4A 1AYN2 2FCUA 2FDHA 1LOBA 3J7NA 4Y33A 1DLLA 2RE9A 4UFLA 5A3NA 2YMZA 3HNBM 2HYXA 4XAEA 2HWD1 1CAXB 4QPGB 1G86A 1NCRB 5HCBA 4A7YA 2DVFA 1UMIA 3AKQA 3CJXA 2E32A 2IXKA 1N1VA 2VNVA 1N3PA 5EWSA 3VZNA 5JCTA 3BTYA 3SEEA 3W58A 3NAPA 5GJ6A 1V6IA 3ACHA 1SFPA 4PQQA 2VTXJ 4FPLA 1JYWA 1MQTB 5JXHA 2OT7A 4WVMB 5IK7A 3BN6A 3HN1A 3LDKA 4K8RB 4LO4B 1SLAA 1VBA2 3DN7A 4XF9A 1MZ5A 1R093 2DUOA 3ORJA 1NLRA 4IDZA 4PF5A 1IPSA 4Q4X1 5A3UA 3K75B 3RNSA 2CY6A 2ZHMA 4A3ZA 4XFHA 3SCGA 3LA7A 2WZ8A 1GZTA 4WV8A 1OURA 5AC91 1RUJ1 2GC1A 2JG8A 4CUGA 2ZHNA 4Y1ZA 4DZGA 3OBZA 1ZRIA 2ORXA 5KHKA 5GZDA 3ZSLA 3B5LB 2WFF1 1GKBA 4LHSA 1LEMA 3VKFC 1B35B 2WT0A 2P6CA 2OQ6A 1RUG2 2VTFA 4HPKB 1ULCA 4RGAA 3VD5A 4B7EA 1SPPB 4M01A 1CAWA 2VO5A 4KMQA 3ETPA 1Q3EA 3HNYM 5EJ3A 1S0GA 1V6MA 1ZBA3 1KD7A 1QJU1 2O1QA 4DY3A 2YC2A 2J1VA 1VPHA 1OOPC 2QQPA 4RHV3 4I30A 3C7FA 4U2AA 3JD72 4XXAA 5ACA1 1IQAA 1AR73 1PIV2 2CV6A 1JHNA 1SCRA 1ZX5A 5FMCA 3KT7A 5IVEA 4YW7A 4L92A 4Y1VA 5HXVA 4IV1A 3BYWA 4C0HA 5F1RA 3M3IA 5A33B 2JE8A 3GALA 2YG0A 2I2SA 5JZGC 4RA0A 2W5FA 1AR62 1FI2A 5FZAA 4JTNA 1D4M2 1WA6X 1W2TA 3KCXA 3H42B 1POQA 2VOXA 4LK7A 3VBUC 5CFCB 1ASJ1 1DBNA 2VUJA 1JXNA 3TBDA 3MLJA 2G9ZA 1OVSA 2D3PA 5JZGB 2MEV3 1C8M2 3JQWA 4COVA 1HN0A 2HWF3 5FYCA 2P17A 1OLMA 4AI8A 5C3PA 4EWDA 1UZWA 4H14A 4WVWA 3KMHA 3OCPA 5FP8A 2E63A 3WT3A 4AVTA 5JOYA 1JUHA 4XFGA 3W5MA 2JE7A 3H3LA 2C26A 1WMEA 4KWUA 4AQSA 3B01A 1C4RA 3WF3A 4PQ9A 1QJY1 4JHTA 4AK3A 3OD4A 4Q29A 2A70A 4ARYA 1QGLA 3S57A 1BVVA 5FJKA 1LENA 5F3CA 4MXWA 4H7MA 4FPYA 2HBTA 4IUGA 3VDDC 4BE3A 5FZOA 3ILRA 3SNMA 2VVEA 4XDOA 4AXOA 2JB8A 1IS4A 4CTEA 2FHRA 2YROA 3B00A 3RRDA 3GJBA 4I3PA 2WWUA 1W3XA 5D2AA 2Y60A 4L11A 3POYA 4AEDA 4IL7A 5J09A 5C3QA 1OHFA 1NKGA 4NWWA 4Q4W2 3TEXA 4AFCA 4BMEA 3TEZA 1Y9QA 2WNUA 1MR5A 3LEKA 1UYYA 4ZU5A 1ENSA 3DCQA 2VCCA 2GP3A 3J9SA 4MGIE 3J8F1 1ZA7A 4AQ2A 5FO7B 3CZJA 4JV4A 1AUYA 4IEOA 1Z7S1 1UL9A 4R9AA 3U0ZA 1O7FA 2BWAA 1QQP2 2B9VA 2YYOA 4GXLA 2WO1A 4KNCA 1UMHA 2F17A 4AQTA 3JB8A 1IS3A 4QPIC 1J83A 4MV2A 1WKYA 5JMCA 3VKMA 5A7WA 4Y22A 5FQ0B 3ZFEC 1F9KA 3WNLA 3NJVA 4YFWA 3POBA 4CUCA 3BPSA 2AR6A 4TLGA 2OVUA 2XUMA 1E57A 1UY4A 4EE2A 1PX4A 2ZGMA 4Q0PA 3KQ4B 2XJPA 4DXRA 4H3WA 4QXBA 2CWSA 3MI8A 1H9PA 1RUE1 5FP9A 1XC6A 2ZGSA 1UXXX 2JECA 4GH4B 1HXS1 4UFIA 5F2SA 4AHWA 4B29A 5J7MA 3MPPG 5E1RA 1XE7A 4CDQA 3ZYFA 3POJA 1PIV1 3TWIA 1V9U1 1U5ZA 2XHNA 4MYEA 4XHXA 4C91A 5DMYA 3B93A 3UESA 5FYIA 2DTWA 1D2QA 2OZ6A 3U78A 4XC9A 4COYA 3ZMNA 2HWB3 1AR93 1OBNA 3K48A 1EV11 1CPNA 2QUOA 2BEOA 2VM9A 5D8AC 4P00B 4HLTA 3B9CA 3FHIB 1JS9A 1COV3 1VRH2 2OW4A 4IEZA 4WBBA 2BU9A 1CGPA 1VAMA 5L9BA 2E7AA 5FPAA 3P3NA 3W21A 4HVOA 2RMU2 2VBBA 2QQMA 3QH6A 5FPVA 3N7MA 1H4HA 3ZO0B 3ZPOA 1KDMA 4CDWA 3ES1A 3WDYA 1EPZA 1JYCA 2VZOA 1S4CA 4B1MA 5BNOC 1RUC2 2R30A 2QJVA 3BIEA 2VH9A 1F5JA 2WS92 5BY5A 5ANQA 3T08A 1A34A 3ZXLA 2E33A 1QJEA 4IE0A 4MHRA 4NAOA 1PM7A 1ZVFA 2HWC3 4RGKA 4DPNA 2VXRA 3ROUA 3USUA 4L97A 4DRRA 4FOQA 2PHFA 1JH5A 2QFEA 1RUE2 3H8OA 2BERA 4GD4A 3I54A 5HCFA 1C8M1 4LOSA 1JU3A 4K1ZA 3CZUA 2D6PA 1V6NA 1QF3A 1MZ6A 4R8HA 2PHUA 4NUBA 5IVFA 3V0AA 1PK6C 1RL3A 4AFMA 2CL2A 3URFA 5BNNA 2WINB 2ETEA 4EN9B 2BTVC 3CMGA 3NV3A 4L8QA 2P1BA 2JD9A 3I97A 1NUKA 3WP5A 3JQXA 5BNPA 4N8MA 1CAVA 1AYM1 3DKWA 2QCSB 2O8OA 4GULA 1A78A 3JCIA 4Q4W3 2MNGA 5JSPA 3IM0A 4HFSA 4D7TA 4XTMA 2E7QA 4BQ3A 2C0ZA 3KV4A 3OUHA 2I74A 4META 4JGZA 4A45A 1EAH3 2D44A 5EFUA 3RYKA 5B4XA 1WCSA 1SG3A 2R1DA 2W91A 3KVAA 1Q8OA 1VBE2 1RHI3 2GALA 1CJDA 5J1XA 1Y43B 2B7YA 2WSVA 1A8MA 3I2KA 3D0SA 4EROA 4DUWA 1H8TB 1WCDJ 1UOFA 2UY8A 3KD4A 5FBZA 5EYXA 3VBUA 3T30A 4HK8A 5C4WA 2PAKA 4CDUC 3DYMA 4FXKB 5A7OA 1PO12 3FWEA 4DINB 4CEWA 2PFWA 4E27A 3VHNA 1HJGA 3RG0A 1H8TC 4XJWA 4FTEA 1AL22 5ACA3 4BIOA 4XILA 4CDXA 1I1EA 4CEYB 3ST7A 4LORA 3HAGA 5IAXA 3LA3A 1F35A 1SFYA 4HN1A 4CDUB 1JOBA 2WZEA 4XDQA 4IEWA 3KV9A 2Q8EA 3HMYA 2HWF2 4LQRA 3WF0A 4A7ZA 3KT4A 2MEV2 5F5IA 5T5PA 2JDZA 3USSA 1DQ4A 3VHRA 1OA2A 4QX3A 1BEV1 2ZJCA 3RZJA 4IE5A 4IEXA 2WLPA 4AL9A 1FPN3 1ASJ3 4RQPB 3OGGA 4QGNA 1DZQA 1POV1 2ZX4A 5L19A 2XB6C 5ISLA 3UV9A 5A80A 4OQ8A 5D21A 5GZFA 3VDBA 1DF0A 1Q8SA 2VR4A 4QX7A 3TN93 2IFRA 5GKAC 3IDBB 2A6YA 1OSGA 4NRPA 1IZ3A 1RMU3 4KBZA 4O61A 4XTPA 3ZFEB 4ORFA 1OQEA 3HR9A 5L73A 3UK9A 2RS13 3N4MA 4XHBA 3M3OA 1NG0A 3RS6A 3SCHA 1K3IA 2P5BA 1HV0A 1G9AA 4JAAA 2UY9A 4KI5M 3WV6A 4PLMA 1CONA 4AEMA 5M0TA 4QAWA 4Q2FA 4Z07A 4CDXB 4FP2A 4TZDA 2WIIB 3KCYA 5CVRA 2BQPA 4YG3A 1R1A1 4OULA 4CP9B 3N9MA 4QB2A 4XFBA 3ZN4A 1W6QA 3R4DB 4ZU7A 2GNMA 3IT8A 1I9RA 3EHKA 1MS9A 4W65A 2N7GA 2YBKA 1W8WA 3SH5A 4OYUA 3PLQA 4TTGA 1ND2B 3PL0A 3WDVA 4QKBA 3PIJA 4TN7A 1F5FA 5FXXA 4C1WA 4HVQA 1DDLA 1Q56A 3QLQA 1MS5A 1ND3C 1QXPA 3LEMA 1DYOA 2X10A 4WZFA 4E8DA 3J8F3 4RSUA 4PF1A 4TSVA 1X33A 1WLWA 1VMJA 2ZKLA 4FPKA 3UKVA 5K9YA 2W39A 1FNZA 3FBYA 1Z7S3 5KHHA 4LE4A 4N43C 4UWDA 5JXGA 1ZZ7A 5F3EA 5JLVA 2CAUA 3WOGA 3DPRC 2JXAA 4RD7A 1WD4A 2FDKA 1HXS2 3A7QA 2EA7A 5KC6A 3AC0A 2DCTA 2UYAA 2F4PA 3E6CC 3LAGA 1KJRA 1SLLA 3NV1A 4IESA 4LA2A 5JVVA 4AVCA 4BLJA 4RS5C 2BPA2 1WBFA 5FXZA 2WWJA 1AXZA 1DIWA 2ZX1A 4XQWA 3I3QA 1AHSA 2VZPA 4IW3A 5HV4A 2IXCA 1OI6A 4LNVA 4GB31 4XZUG 2QE3A 3OUJA 4D3WA 3U4XA 1J1TA 3O0VA 4FPGA 5DZFA 1QXJA 5FYZA 5EIYB 4BWOA 1AJKA 1RITA 3ZX7A 1PO11 2GU9A 2R043 1RUG1 1QJFA 1E5IA 1WW7A 2VMIA 4XCAA 4BXFA 4XVHA 4QKDA 3ITQA 4XF0A 5JSRA 1V9U3 3I2DA 4MGSA 1CN1A 2B4KA 2HWD2 4GH4A 1UIKA 2P37A 2Y6LA 4LUKA 5DG1A 3S7IA 1JZ8A 2ET7A 3OYWA 1QHDA 4BQ2A 4UYBA 1S0CA 2D6LX 1AR63 4PDWB 5LEKA 4PDWC 3IN9A 3KZ4C 4MGQA 4MSVA 1G6NA 4A6OA 1O3QA 1NCQB 4BK5A 4DXTA 3KHBA 2RS32 1JU4A 1BXHA 3RYRA 1CAXA 1MEC3 2PHLA 2R071 2VBPA 1UY0A 3H8XA 2UWBA 2VZQA 3SITA 3FUQA 2QTWB 2W94A 1N1SA 4DB5A 4UW5A 1QQP3 2XUEA 3V64A 4KWLA 4BLIA 1R091 1XNAA 1XE8A 2W1SA 3OGSA 1W6PB 4Q4X3 3WNPA 1AYN1 4R4XA 1UQXA 4F7ZA 3AZZA 1TME3 1OPMA 5F39A 2QQLA 1PO23 1NXMA 1SZBA 1NXD1 3I3BA 5KWRA 4Z8BA 1RUJ3 1GWMA 4HL0A 1UYPA 1QH7A 2ZMLA 1KQRA 1RUF1 1FAYA 2FDFA 1W8OA 2ZHLA 3CIHA 4JGZC 1ST8A 3WNKA 5APAA 4RFT0 3C2UA 4ZXKA 5DDJ2 1GZWB 4FQ4A 1UKGA 2K2SA 2WNVB 2X8KA 3AP7A 1NA1A 1JN2P 2WL1A 3AZXA 4GMP3 4X8PA 5FZMA 2JG8B 2XBO1 1NA1C 1R083 5CAZA 1GP4A 2WT1A 4XUOA 1Q8VA 2WZR3 1DGLA 2EIBA 1AYM3 2IWGB 3UGHA 4Q26A 4NHYA 3DGTA 1PGSA 3AFGA 3AYEA 3H50A 5FRAA 5CFCC 3O1PA 3D3AA 2EIDA 2DTYA 4K21A 4NRQA 4NHXA 1YFYA 3NNGA 5FXWA 3NW4A 5A7SA 5F5QA 3POGA 4BQXA 1HIXA 1TMF1 2OUJA 2VE1A 2WKKA 2G1MA 3B3QE 4GH4C 4WM7A 3RFRA 3O1VA 2WNUB 3G6JB 3CO2A 4YW5A 4BU2A 1KFUL 3CHXA 1RHI1 5KHJA 1XYNA 2EXHA 2KD7A 2NMOA 3RZGA 5JOXA 5FUPA 3VHOA 4OHXA 2XJQA 2O0OA 3C7OA 1V70A 3M3EA 3ZDSA 2YBPA 1YYNA 2VW2A 4CDXC 5CA6A 2GN7A 4LPLA 1UOBA 2CDPA 3DUIA 2FZ2A 2P4EA 1I5PA 4LHKA 1HRI1 1ULFA 2MEV1 2A73B 2IUWA 1RUF2 3WDXA 2W95A 3KWVA 1ZBE1 3ZKYA 5C5TA 2C4XA 1QDOA 4EN8B 2CNAA 2BGPA 3BIWE 4GWMA 5DUWA 5LASA 4URAA 1AYM2 4MXWB 3AMPA 3OOXA 3B7MA 4JC1A 2PYTA 3H1MA 3MF9A 2RDNA 1UNBA 4YW3A 5DAQA 4CP2A 2G19A 4ES8A 1VR3A 1V0AA 3VDDA 1HN1A 5F8PA 4K8FA 1O59A 4WM7B 2VUDA 1O6UA 5FFOC 3VHPA 2ZBJA 3PTRB 4GALA 4Q0SA 2PHRA 3E1F1 2NMNA 3NWKA 4OI4A 4FOWA 5KC5A 2Y6KA 3U1XA 2Y6FA 1Q43A 2YB7A 1LECA 2RS53 4F83A 3AKSA 3IB3A 3H8RA 4NMIA 2BRTA 1MPXA 2JEMA 3AKTA 3GXUA 3VBHA 2A3WA 3ZYJB 5C33A 1I5ZA 1LHUA 2OX0A 4IQPA 3SC7X 5FK8A 1POV0 1GICA 1W9YA 3ATGA 1NA1B 5A7WB 5J37A 1OD5A 3GCWA 3LPGA 4UFHA 3BKZA 4CP0A 2V5DA 1UU4A 3H3UA 3OGJA 1ZBA2 5BUVA 4TWTA 4CUBA 2QQUA 5F6LB 2ZKNA 2OYZA 2UURA 3AVSA 4Z1VA 2QDNA 3AP9A 3P5BA 1MS1A 4QXCA 3AZVA 4I3GA 1QH6A 4JTOA 1LHOA 3KB5A 1PHMA 1KRIA 1G7YA 4W6XA 5L7OC 2BYVE 5FZHA 1UX6A 3TEWA 2NQYA 1S55A 1R1A3 2BUKA 4WM8C 2XPJA 4Y5TA 4O9EA 3ZXEA 5B2GB 4WZCA 5H9SA 3OY8A 5FP4A 4QT6A 3M70A 2EIGA 2H6CA 2ZGLA 3J7LA 2FDJA 5A1AA 2A3XA 2HBUA 2ZX2A 3WNNA 3HBKA 5T55A 4LBNA 3D5OA 2JG9B 4KBBA 3WSOA 4EN7B 3UGGA 2ES3A 2H0VA 1XQNA 4IV1B 2W9XA 5GLTA 5BXXA 2XH6A 3KLSA 4LO8A 1J84A 4OHYA 1VBD2 4CXYA 4R9DA 5EJ1B 4GQ7A 4Q8KA 5CG9A 3MW3A 1W3VA 3KT1A 2KM2A 4Y5SA 4BQ5A 1XU2A 1SBDA 2EAKA 1W6MB 5A1LA 3VKOA 2FMYA 4IGQA 2HWD3 2EXKA 1N3QA 2BFUS 2D98A 2QQWA 1AR91 2HWB1 4CEYC 1KS5A 1RGSA 3BOWA 4Y1UA 5FZBA 5A6XA 2AGSA 1OLRA 1C5HA 4XOGA 1YQ8A 2BGOA 1RUI2 2H6BA 2XXZA 4KGQA 3POWA 1GMMA 1PMJX 4NVPA 3TNQA 3ZXGA 5K0UB 2B42B 2QDRA 3MIFA 3N7LA 3WLUA 1YXWA 4JRAA 4LEJA 3BODA 4MHUA 4CCCA 1RTVA 2OA2A 1K5MB 4KWJA 2HWE2 5E16A 3VBOC 3HBZA 3POSA 2C5DA 4LXLA 3OB8A 4F8AA 1XNDA 5LATA 3KS7A 1OQ1A 4RS5B 1E5SA 4CXXA 3ZFFB 4YM3A 2A75A 1XPWA 2BZDA 3ZKUA 1YLLA 3RYPA 1ENXA 4OCTA 2EF6A 5A6QA 3V0BA 2R16A 3V65A 1AJOA 1QY4A 3CL1A 3BU7A 5FZ9A 2QQIA 1EV12 3BVCA 2XQXA 4D6RA 5LA9A 2JWPA 4AEKA 1UF2C 5I0RA 1REEA 3ZYGA 5GM0A 1H2MA 4Y24A 2VECA 2YZ4A 4Q4V3 4CP1A 5JPMB 2QBXA 1GBGA 2RVAA 1DP0A 1H6XA 2WA4A 4GAZA 5HCAA 1UOJA 1IS5A 5FZ4A 1LB2A 2BBAA 3U10A 4NJ4A 3WG3A 2GN3A 1JZ5A 1PGW2 5CISA 5F2WA 4A44A 2WRAA 3A22A 3NVCA 1NZIA 1UW8A 3MBWA 2Y8KA 1ZBA1 4MH0E 2LALA 4FI9A 1X82A 2YU1A 3NAPC 4XQDA 4C0BA 3C8XA 1Q8PA 1T6BX 2R32A 1MS8A 4XF4A 5T52A 4XIOA 3CDZB 4MADA 1ZREA 3POFA 4LHNA 3M1HA 3O0XA 4MGZE 3ZXJA 3NV4A 1OQDA 1V6OA 3WQBA 3ZFGB 4BQ4A 3A21A 2LTNA 5CU1A 5BPXA 5C9AA 3GM8A 1LOFA 1TEIA 4AAXA 4YVSB 4PI2A 5DG2A 2R062 1VBB1 3DYOA 1CIYA 2OZJA 3TB0A 1W2OA 4LMFA 5JAXA 2D43A 2JDAA 2JDUA 1QIQA 4GKYA 1TNFA 4EQVA 4H2AA 3U07A 1YJKA 4XBNA 4GB32 4LE3A 2X5IC 3B9IA 3ZXDA 4I02A 1W6QB 4QKNA 1TE1B 5FKCA 2B46X 1N3OA 4Q0UA 5DXDA 1HJFA 1UZYA 4Q4V2 5IUQA 2BDRA 1NLSA 2FCTA 4R52A 4XFAA 3ZIWA 4BQWA 2PXJA 1A8DA 2FZ1A 1SBEA 3ZLIA 4K3UA 2YC0A 1RC6A 5FXVA 4BK4A 4YZ3A 5T5JA 3I2GA 3ACIA 2HWB2 1AR92 4RGGA 2XVLA 1PZ7A 1TME2 3IWZA 1DLCA 4XF1A 2P3KA 5FZDA 4DFSA 4BXSV 1JTZX 3H1YA 2WABA 3PMEA 5LA2A 1YC61 2V4AA 3HN3A 2JB4A 4FFFA 1MQTC 3FHAA 3OPZA 3WQ7A 3TEYA 4QHOA 4URTA 1HRI3 2JDHA 1S0BA 2C24A 5A32A 5IFTA 4KG0A 1J1LA 1H4GA 5SV8A 1NY71 3GBGA 1YRZA 5T54A 2C9AA 1SBFA 1RMU1 3WW3A 5FZ0A 3AB0A 1BHGA 1W9FA 4N7UA 2WN3A 2VGDA 2RS11 3K4AA 1GNYA 2DCKA 3O12A 3WR0A 1KEXA 3ZFGC 4Z2WA 3PU3A 3VGIA 1OVPA 1D7PM 1UOGA 2D97A 1JYVA 3MO4A 3LA2A 2ZOEB 4CEWB 2XL9A 2ZMNA 3HQXA 3QCWA 4K40A 5KXCA 1GV9A 1ENRA 2X29A 3M8LA 2Z42A 4QHBA 1ND3A 2JICA 5T5LA 1HRI2 2DWRA 3IPVA 4I0AA 2VU9A 4YZ5A 4QPYA 4Z2AA 2RJKA 3DKQA 2VQ0A 3N9NA 2XDVA 3VKNA 4XQ4A 4CDQC 2WNOA 5AFEA 4KWKA 3VZJA 3O1TA 1GUIA 2ZGPA 3HOBA 4G3YC 2Y26A 1ULGA 1PNGA 4O9GA 1O3TA 1Y9MA 3FMGA 4RQPA 3TOJA 3THDA 3FLRA 1JI6A 2JJ6A 3KM5A 3POEA 2ERFA 2D5FA 3RJRA 1VBB2 2GDFA 2DV9A 2ZGQA 1QEXA 5J96B 1W2UA 4FFHA 1U5XA 4IV3B 1EUUA 2AREA 3LFMA 1QKQA 4JKLA 4YYOA 2RM21 2PAEA 3IIAA 1LODA 3UL2A 4OZOA 1H1IA 3CEWA 2UU8A 1RUC3 4NO4A 2O14A 4AR2A 5L36A 3T2TA 1BK1A 2H0BA 4AEDB 4YW2A 4CEYA 2MHFA 3WP4A 2VNRA 3F2ZA 3U4SA 4CU8A 2ZZQA 1WW5A 3D4KA 2D3SA 1BLZA 1EY2A 1DQ5A 1PVC3 4QM8A 4Y20B 2VOVA 1D4M1 4C8DA 4D94A 2AEZA 1TMF2 5I8SA 3KF3A 3ZXFA 5LY2A 3GBWA 1NQDA 1MACA 1PO13 3KSCA 3OG2A 4YGCA 1P8JA 1M4WA 5A7PA 5FYVA 2DBNA 1OLQA 3X29B 5C3OA 1W2NA 3FFQA 4PBPA 4A42A 3VUOA 1LU2A 4IE7A 4O7XA 2I45A 1LTEA 2RJLA 2W1WA 5LK5A 3LCPA 3HPNA 2NN8A 3LZZA 4LK6A 5BNNC 1HB3A 1TZOA 3C7HA 1AR61 2VZRA 4L0PA 4LBQD 5L9VA 4HT1T 2XVGA 1DFQA 2V73A 4JCKA 4BA6A 2GSYA 2VZUA 4I01A 4D6SA 3GDBA 4I2OA 1CZSA 1W99A 3N35A 1ZZ6A 3WDWA 3WNOA 2HEWF 4NR1A 4GWNA 2D40A 2WFF3 4JGYC 3OJBA 4LR4A 4FP3A 1ULEA 3BTAA 4IEPA 4JGYA 3ZDVA 3T0DA 5K8SA 3PHMA 1HRV3 2IVIB 4YG0A 2P3YA 1UCXA 2A71A 2VVFA 4M4PA 4MLOA 2WS91 3VD3A 1OF3A 3GCXA 3PDQA 4BIFA 1OOPB 1K5MA 3G7DA 1W0NA 2YBSA 2QQJA 3H7YA 2YFZA 5H9RA 1IHMA 2RS12 3MV11 3W9AA 1TME1 1SHWB 3S5AA 1EYBA 5FY4A 3O0WA 2DVBA 3TNPB 1EUTA 4YZ2A 2RMU1 5IHRA 3FZ3A 3U37A 1Q8QA 2P3JA 1RUF3 2K46A 1EAH1 2PHWA 1AL23 1FMD1 4E4HA 1JUIA 3K77A 1APNA 3GHNA 2A3YA 1LNSA 1SLCA 5E88A 4Q4V1 1QWRA 4QX2A 5JZGA 4RFRB 4DMIA 1N47A 5FZCA 3TRSB 5C6CA 2XBO2 2OPWA 4DIQA 1CAWB 4LOTA 1ZRRA 4CDWC 4QXHA 1R081 4CDWB 4AFBA 3PVNA 5JOZA 4B8EA 4NPLA 4A3XA 3OSDA 2RM22 4Q8LA 5I93A 5FLJA 1FPN2 1GOGA 5BV6A 5F37A 2QZ3A 2L9LA 2Y64A 2KA3A 4TYSA 3A0NA 2DVDA 3ON7A 2CGPA 3FL7A 4M3CE 5LZ6A 3RJ2X 2IXJA 1PMHX 2ADDA 2VQUA 4BISA 2ZGOA 2JDKA 3RZLA 3ZVXA 4BZ4A 3JBG1 3MIHA 2D5HA 2WYSA 1OFSA 2X5IA 5BNPC 1VLNA 3I3MA 2R1BA 3INAA 3SKJE 2YUEA 2X05A 4YWAA 1VRBA 2G4IA 1C28A 1VBB3 2IXHA 3JZVA 4JDNA 2OXBA 5FZLA 4HETA 1O4YA 4QDQA 3DV8A 1RUI1 2Q0AA 3LE0A 1D4VB 3FX3A 1OD3A 4N7IA 2PHTA 1ALYA 3D0JA 4G9SB 3O1OA 2YGMA 4BOWA 2W1QA 3SQOA 5LBEA 1XSRA 1OOPA 5GZEA 4M3CA 3ILFA 4MZUA 2OPKA 3VZOA 2D93A 2WNVA 5DAPA 1UYXA 3RPQA 1NCRA 3VBHB 4PT6A 1QOTA 4GJZA 4Q4X2 4COWA 1O4ZA 4XMAA 5I8YA 5F5AA 4FCAA 4ZZ8A 4ZHNA 2JDPA 2WNEA 3W5NA 4P9GA 1X36A 3SLIA 4NHKA 2SBAA 3THPA 2VOKA 1YHFA 1H0BA 1IKQA 3MW2A 1DYPA 2ARCA 2RS51 2Z2SB 3QH7A 4J1WA 4V2WA 4XJ8A 3O1UA 2WYFA 3GYDA 1JOPA 5FYYA 3PUHA 3HEIA 4QQHA 1VBD1 2RR13 4CU9A 1NYWA 1US2A 3C7GA 1W8FA 1J3QA 5FV3A 4RYDA 1NAEA 5L7OA 4KH9A 1QOOA 5FLIA 1KS4A 1QNYA 2LM3A 3SISA 5KBFA 1W04A 5A32B 4ZONA 4AGRA 4UBHA 4XYXA 4ZZ5A 3IDAA 2ENRA 1RUE3 4AVVA 1NLQA 4M0HA 1NCQA 3APBA 1HXS3 3OF1A 3NMBA 3T2OA 3HNMA 4ASLA 3WG2A 4KU7A 1GLHA 3VBRA 4B3NA 5F6KA 2IXLA 1ODMA 3S0MA 4AHZA 4AE2A 5HXMA 4H7LA 3WW1A 3BUCA 2RG4A 4OQ9A 5EP9A 2CWMA 1XOYA 3N7KA 2Q4SA 1C1LA 5GLZA 1E5RA 1W9WA 1GQPA 3FN9A 4HZFA 4LA3A 1REFA 1B35A 3BCWA 4YVSC 1MQTA 4GMP0 4XUPA 4P9XA 2UWAA 3WF2A 3VBHC 1DQ2A 2GZWA 3RI8A 1X9PA 1YFUA 3UGFA 3WDUA 2Y0IA 4DO0A 4HKOA 3WXPA 5JXJA 5JWPA 4J6GA 3OGVA 1GZWA 2WO2A 4KU8A 1F31A 4LHLA 3RSJA 3SKVA 3WUCA 3RZZA 5LRSA 1KGYA 4Y5Z0 3MHZA 4QPGA 2ZA9A 1NCRC 5FY8A 2WZPP 1BJQA 4QPGC 4E2QA 3ETQA 1C3HA 2WA3A 2XKOA 1X9TA 3WW2A 3OUIA 1ZA4A 1J3PA 4MO3M 4XABA 5FK7A 1WMFA 1ZZCA 3CKHA 4XJ9A 4F3JA 2X53S 5FUNA 1QXRA 3JD73 1JYTA 1J3RA 3A23A 2JDNA 1B09A 5C71A 2R073 1MVQA 3WD5A 3ZSEA 4MGTA 2D6MA 1CD3G 4AI9A 2VQAA 5D1IA 1XJAA 4O65A 4CCKA 3GF6A 3PUSA 4XAAA 4LKDA 2VMHA 4UFMA 3IPVB 5CFDC 1YQ6A 3THTA 3LIGA 5CYYA 3OPWA 1H9WA 2XHKA 2WFF2 4ET7A 3KHCA 4EYUA 5IWFA 1JHJA 2RDSA 3AZYA 3ZMOA 1STMA 1W8TA 1PZ8A 4QU1A 4AGVA 5AVPA 1JZ2A 4Q4W1 4I0WB 2JKXA 5ABJC 5C5UA 4LBQB 1LRHA 4NE9A 2VUCA 5IK4A 2DVAA 1JYNA 1UZ0A 4S2GA 1PZ9A 5FZIA 1BMV1 5DDJ1 3FHQA 1XSQA 4K9SA 2Y6GA 1G9FA 5BNPB 1GOHA 2XJSA 2V4VA 4L99A 3I8TA 4LKEA 4B4PA 4ZS2A 2XBO3 4HKWA 4QDSA 3ZYPA 5BNOA 5FY9A 5F7UA 1ENQA 1W8ZA 1W39A 2VC9A 1H1MA 1WMXA 5FUIA 3PU8A 1SDWA 5FJHA 2OUHA 4AZZA 3DEMA 4CEWC 1HB4A 3T4HB 3WG1A 1SACA 3OBTA 4EV0A 1LHNA 2GNTA 2VZ3A 2XQRA 3MLLA 2IFWA 4Q0VA 4CYDA 5IFPA 3BGAA 1V6KA 3O14A 1BKZA 4K7JA 2FCVA 3ZYHA 1XXNA 1X8MA 2OIIA 3ELNA 2J1AA 3BPZA 5JIAA 5A33A 1NY72 5A6ZA 1GWLA 5FZGA 1GZCA 1UZVA 4FXGB 4MOAA 1HRV2 3RVHA 3SH3A 3WY6A 3WNMA 2VCMA 1F2NA 5JDBA 3PVEA 4LULA 2WR9A 1H1AA 2NLRA 1NX9A 1NZCA 1T6GC 1IOAA 1W05A 2QQOA 4BDVB 3O7OA 5JIUA 2D3RA 1ODNA 1GWKA 3CF6E 1YNAA 3UKNA 1TNRA 2VZVA 3HT1A 2VNOA 5A1FA 1JYXA 5L7OB 1AXYA 3D6EA 1H6YA 1G8WA 1OT5A 2D7FA 3RI9A 4EZ4A 1OLME 1IS6A 3MZHA 3WZ1A 1WUVA 4XDPA 2F6BA 4QDRA 2WNUC 2BW8A 3DXTA 3VKLA 4TXWA 2YY1A 4YW6A 4FTBA 1UX7A 4IXLA 4OI0A 4HK9A 1MZEA 2YPDA 2YV8A 2CU5A 3GZUC 2XJUA 4QU2A 1K45A 2J1EA 1UPIA 5HV0A 4L9BA 1XYPA 2AYHA 2A5ZA 4UT5A 5DAXA 2BV4A 1RUI3 3S7EA 5ABJB 2VZSA 4HG6B 4ARXA 3L9JT 4LBKA 4OHZA 4NPMA 2VD7A 3V0BB 4OI1A 4FO9A 4ISRA 1AR81 4S2HA 3DL3A 1HQNA 4OHWA 3ZFGA 4AG4A 4IEQA 4XJUA 3RMXA 5KXDA 3ZFEA 5IVYA 5ANNA 2HLEA 4AVAA 1W28A 3NJXA 4U36A 3CLPA 4LBJA 1LOCA 4WVMA 3T0BA 1G9CA 1YJLA 5HCHA 2F4LA 1W6OA 2JX9A 1VRH3 4COUA 1YI7A 1KJLA 5AC92 1QJX1 2BJSA 1R092 3KVBA 5IJRA 2CTVA 3GBFA 3N9OA 4GA9A 4JGZB 3AFKA 1OMIA 1RUNA 3PIGA 4AHYA 4S2DA 3RZKA 3BALA 2XJVA 3OPTA 4RR3B 1H2LA 1CAUA 4X6RB 2CDOA 5H9QA 4JRLA 5AFBA 4FPOB 1VBD3 2BP6A 2RR11 2VBDA 2NYYA 4QKFA 4UFKA 4W4ZA 2VTXA 4OMDA 1YIFA 3VB9A 1V00A 3IMNA 1VIWB 3MFAA 2ZAAA 1CVNA 3I2OA 5DUVA 5DUUA 4GB33 5LA0A 1PK6B 5FBJA 4B4QA 5IVVA 3S30A 5IYYA 1QOSA 3PURA 2E53A 2VW1A 2PQSA 2K0GA 2VULA 2TEPA 3NL1A 1CESA 3HWJA 3J26N 4NIDA 4XBQA 3VBSC 5CKNA 3T2PA 1XYOA 4UW6A 2GC3A 2WAOA 1R082 3MGUA 5I0TA 1MS4A 3B94A 1XRUA 2ARAA 3N9PA 4YZ1A 3ES4A 1KXGA 1VBC1 3WP6A 2CHHA 1SCSA 4MGKE 1ZRFA 4P02B 2RS52 4X8NA 2ZGRA 3RWNA 5BNQA 1BCXA 2J22A 1URXA 4Q4Y2 3P3PA 4FPEA 5JI7A 4ONUA 1FOD2 3BU0A 2C9KA 2OS2A 1SLBA 4G4FA 2WAAA 4XJZA 5FMOL 3R6SA 1CZTA 4D7SA 5J36A 5LEJA 1MEC1 1WBLA 4A41A 1PVXA 1W6MA 3D82A 4FPCA 5C7GA 4CCJA 4IEYA 1S1AA 2MPFA 2QQNA 1L3JA 4I0BA 4WVZA 4XFIA 3LWCA 2J42A 4IERA 3BB6A 4PIXA 2VMEA 4SBVA 1R1ZA 2LRPA 1RXFA 3KCCA 5A3OA 1F8VA 1UZZA 3LD8A 2J1UA 4M4RA 1NT0A 4N9HA 3NRUA 5K0UC 2AC1A 4PBOA 5FMBA 3S6PA 5K0UA 5FZ7A 1PO21 2VCBA 4QM9A 1WW6A 2YFUA 3M3QA 4CDQB 1X8EA 3T09A 5FZ6A 2Y0OA
chains in the Genus database with same CATH topology
3VBOB 1H2KA 1I3HA 4GIQA 3VBRC 2EALA 3PTYA 4FVVA 4FAHA 2GC0A 4AI1A 2QKDA 3JD71 2UWCA 1O91A 2Q1ZB 1NOVA 1UAIA 3B02A 4Q4Y3 1PNFA 1QJX2 1KITA 5CFCA 2PHXA 3CNAA 4Y22B 5T5OA 5FQ0A 2EXIA 4AE2A 1S2BA 2GH8A 1IPJA 2TBVA 3AP6A 3SH4A 4QMAA 1FNYA 1ZBE2 4ATFA 4MGYE 2PLV1 4WM8B 4XETA 2BNOA 5AC93 2GNDA 2RHPA 4LUMA 1H30A 2E6VA 5DDJ3 3VBFB 1HV1A 2JG9C 4FAGA 2E9QA 3TYJA 4N53B 1RVF3 1Z0HA 4E4SA 3A4UA 1WMDA 3VBOA 5E8AA 2XG3A 3LOIA 3U11A 2C1FA 3ECQA 1QJU3 2PHDA 2WZR2 3WQ1A 1AX1A 3GZAA 4AVSA 3VDDB 3NAPB 1CAVB 3HIFA 2ZX0A 3EBRA 4SLIA 4HVRA 1LESA 4E2SA 1JOJA 1JW6A 4YGBA 2XJRA 1RUOA 1VP6A 1ND3B 1K5MC 3I59A 1XNKA 3CJIC 3V56A 1FOD3 1WLTA 1D2SA 1MEC2 2G9FA 2NZ9A 3IDCB 4HMZA 1GQGA 2RS33 2DUQA 5HBAA 2ZCWA 4DQAA 2ZTNA 4ASMB 4E2GA 1MVEA 5IT6A 4AFAA 2E51A 3NJZA 1WA4A 4EWAA 2R49A 5I8TA 2X5IB 1VB2A 3VLBB 1LOAA 3B69A 2FQPA 3VV1A 2XL7A 1W6PA 2XLAA 1ONAA 1DHKB 2W0XA 4XZPA 5GZGA 1N1TA 5EZWA 1Y7BA 4WM8A 4ATEA 2R061 4FPHA 4YSFA 3OTFA 4PJYA 1O3RA 3I59B 1NE4A 2I07B 4Y20A 2XJTA 4H55A 1GYKA 4Z82A 4M3CB 1ASJ2 1OFNA 3AYDA 5T3NA 3H9AA 3OY8B 3DPRA 2R0HA 3UKTA 1UIJA 2QVSB 1V9U2 2SLIA 3FC0A 1RJ8A 1ZZBA 1FYUA 1RMU2 4MX3A 1NCQC 4X6QB 4M3CF 3K51A 3VZLA 3E5XA 1QNWA 1RUH1 1V6JA 2W52A 1VRH1 2Q5TA 4N90A 3LSEA 4AEJA 1UN1A 4PLOA 2DCJA 2WQZC 4UBGA 5FCCA 4HKLA 1FV2A 2JD4A 1B35C 2RM23 3QACA 4R4ZA 4XFCA 3ZIXA 4YVWC 4BHPA 3RDIA 1AX0A 1J59A 5CADA 2R072 4BCUA 3HT2A 1SLIA 2JG8C 4YGDA 4N43B 3MF6A 4D69A 1DZTA 2XKPA 2AUYA 1PVC1 4N53A 4P9WA 1BBT1 1ULDA 1RUJ2 3MFCA 3EO6A 1VBE3 4LBOA 4JVAA 4S2FA 3CU7A 5C4WB 1QMJA 2A6WA 3VBUB 1AF9A 4ITCA 4YM2A 5TSWA 1PGW1 1VBA1 1YIPA 1BMV2 2PAMA 1DG6A 4RHV2 2XWJB 4XEZA 3OBRA 2ZACA 4XW3A 5H9PA 1LULA 2G9GA 1O5UA 3EJKA 2HKXA 2K9ZA 2HWE1 3N3HA 3WUDA 1H8VA 2DUPA 4I09A 2GH2A 2KXLA 1FATA 4FOVA 3ZN6B 5D8AA 3A0KA 2BGCA 4OI2A 4YW1A 2A7AA 2WLQA 4XXPA 3MLKA 4YARA 1H2NA 3AXDA 1X7NA 4UW3A 2W68A 2DF7A 4J1XA 4XIKA 3L2YA 4YGEA 3AMMA 3QOPA 5FREA 2HWC1 1VB4A 5I91A 4OFGA 1GZ9A 5KHIA 2A6ZA 2A6VA 4R9BA 3SHRA 3AJYA 2NPIA 3N7JA 4B7KA 2WJSA 1VJ2A 3NV2A 4Q4Y1 3CJIB 2FMDA 2WWSA 1RUD3 1U12A 4AI0A 2ET1A 4LO7A 1LHWA 2DCZA 4NWVA 3R4SA 3JUUA 2HEYF 2CYFA 4BH9A 3QD6A 4HBNA 3MIDA 3ZSJA 4K1YA 5FO9B 1N1YA 2B45X 3PJQA 4GKXA 3H0OA 1IGOA 4NHLA 1AR71 4HPKA 1PO22 4PLNA 2R6QA 2WC2A 4JDMA 5J48A 1YFWA 4XE9A 2TUNA 3JBG3 3JU9A 1DQ1A 1C1FA 2WSUA 1IPKA 2VG9A 5LRRA 4AI2A 1CQ9A 4BMBA 1UU5A 4LBLA 3R05A 1LHVA 1RJ7A 4AGGA 3CJIA 4YNIA 4YM0A 1CAUB 1FV3A 1CPMA 1WGPA 2HWF1 2V5YA 1GSLA 1W0OA 4UXAA 1H8TA 4K6BA 5BNNB 2XWBB 3JBG2 4AWDA 4QPIA 3ZPYA 4AFDA 5FO8B 2R042 1RIRA 4AHXA 3VL8A 5K7PA 4EWEA 1DGWA 4HANA 1D0HA 1O3SA 2BBVA 1BEV3 1ZYBA 3ILNA 1FPN1 2ARBA 4COZA 4W6YA 1GNZA 4FTSA 4N9IA 1AR83 1O5LA 1C5IA 4PIYA 2VNGA 1XNBA 4IV3C 2VOWA 3IBMA 4LBMA 2AENA 4DXZA 4P9YA 2D6KA 3MYXA 4MUVA 4Q0QA 1LGNA 3N36A 1VAKA 2GAUA 1COV2 1ZRCA 3QBQA 3ZXAC 3VBSB 3WG4A 1U0AA 3J8F2 1CJPA 1FT9A 4Y1YA 4AEDC 1DQ0A 2ZS6B 2O8QA 4ISQA 3MPBA 1RUC1 4YVWA 5JSOA 4XF3A 4AW7A 3PNAA 4CRQA 3WW4A 1PGL1 2P2KA 1AR72 3USUB 3KGZA 5CBLA 1D4M3 5D8AB 1QU0A 4N53C 1LU1A 2BFUL 4D7YA 1GQHA 3TAYA 1PGL2 1AL0G 4BM8A 1GFF2 2LUWA 5C8CC 3I4IA 3R4UA 2YPJA 4RL7A 3ALQA 1PIV3 1LOGA 4LT5A 1DGRA 2ZABA 1EAH2 3TN92 1WD3A 4AQ6A 5BNOB 3FJSA 3WNXA 1COV1 2ZGKA 3ZN5A 2GMPA 4MXVA 2XGXA 3MIEA 5CNAA 3PVBB 1UMZA 4AYUA 3VBFA 4ZKTB 1UD1A 4YM1A 1S0EA 2R041 3DPRB 1J58A 2ZZJA 4RQPC 1HRV1 1V6LA 3VBRB 4LBQA 4YFZA 2WS93 4P9LA 1VBA3 4QQLA 4E9KA 2V09A 3FE5A 3EXUA 1UPSA 1AR82 1HX6A 1EP0A 1MS0A 2PELA 1WLCA 2RMU3 5CIRA 1HLCA 1YCIA 2ILMA 4C90A 4DS0A 2HWC2 3T1MA 1S0IA 3KGLA 2PQQA 3H7JA 1AL21 1FMD3 4B4RA 2JE9A 3OYWB 1JBCA 5F9TA 1LR5A 5EV7A 1JYIA 2R0FA 2XLFA 3ACLA 1QQP1 3MIBA 3WCSA 4EN0A 3AYCA 3WP3A 4KL1A 3NKTA 1AZDA 3H1WA 1AYN3 3HD8B 4OHVA 3ZN6A 1YI9A 2Q30A 3ZFFA 2IC1A 2HYKA 5EXOA 1WCKA 4LO6B 1G9BA 2RR12 5T50A 1S0DA 1BYHA 1LGBA 2VUAA 5CFDA 2IXIA 3H3ZA 1HKDA 4TLFA 3JB4C 1O4TA 2W08A 2Z5WA 3SCFA 4AVBA 3Q9OA 3ZSMA 1RUD1 1OA4A 2ZGTA 1X50A 5HI0A 4GMP1 1DZRA 5JPNB 3FLPA 5KXBA 3MDPA 4OZXA 4ES9A 5A3LA 3WHTA 4EN6B 3VL9A 1HQLA 4V1PA 4QGMA 1HW5A 1FMD2 3ENRA 1RUH2 2WNVC 1LCLA 4K20A 2EAAA 1TMF3 4KQ7A 4BPZA 5C4WC 4FPFA 3LGRA 2DFCA 5BYNA 2TNFA 1FOD1 1Y3TA 5CB7A 5A3MA 3AKPA 4YW4A 1NE6A 5CFDB 4IEUA 1YWKA 3ZXKA 1FXZA 2RS31 4R9CA 5CG8A 5GLVA 2VVDA 5FPZA 3IDEA 2D6OX 1SFNA 1CIWA 3VZKA 1HDKA 2YHJA 4LTAA 1ZRDA 1U5YA 2BNMA 1PMIA 5JI9A 1SMVA 2DCYA 4OUSA 2GC2A 4LLFA 5I0SA 1D0GA 1REDA 2WT2A 2XVKA 3GNEA 2BVVA 1U5IA 3W59A 2JKBA 1GANA 2R063 1A6CA 1I6XA 1QJX3 5DZGA 5DUXA 3H8UA 4XFFA 4DRVA 1SLTA 2ZX3A 1VALA 4QX5A 2DVGA 4M00A 5AVAA 2XLGA 4MVTA 4XJAA 4YVSA 3AMNA 4JGYB 2P34A 4KGGA 3ME2A 3PJYA 1DU3D 4YRDA 3M7AA 2Q8OA 1UKRA 3M3CA 3SXWA 3NKGA 2ZAHA 1Q5OA 2Q1MA 1TQ5A 4DOUA 1W0PA 4XMIA 4YVWB 2WQ4A 5GLUA 4RR3C 3MEPA 3J4UH 2DU0A 5SV5A 4NN0A 4YZ4A 1DYKA 3M4FA 1KDKA 3T1LA 3LB9A 1XNCA 3AXEA 2B9UA 5JR7B 3ZYRA 1PK6A 4QPIB 1LOEA 2CGNA 4QXKA 4XBLA 1OA3A 3AP4A 1ZZ8A 1OKQA 4BQ1A 1GNHA 3RMYA 4FSJA 3L2HA 4NPRA 5EYYA 1KFXL 2ZHKA 4JDOA 4INDA 3WVJA 3WINE 1DQ6A 2AH2A 1RUG3 4FT8A 1AXKA 3R0RA 5J98B 3WHUA 1BVP1 1LKNA 4C1XA 3D8CA 4IV1C 4M0NA 1UU6A 3WQ0A 3AMQA 4UW4A 5FDBA 4A2UA 4PCRA 3VBFC 5J3UA 1EPWA 3E6DA 3OD0A 4Q1PA 1W6NA 5C8WA 1ND2C 2HWE3 3MICA 3AZWA 1ND2A 1S0JA 4WVVA 4Y26A 2DYCA 4YLZA 3VBSA 5C8CB 4DY5A 3PVOA 2PN5A 1C8M3 4WM7C 1YO8A 2VY0A 1LOFC 1XU1A 2DURA 1QJZA 2P3IA 5LK7B 4IEVA 2YGLA 1C8NA 2PTMA 1RINA 4PDWA 1R1A2 1RHI2 2EXJA 2B8MA 2QZ2A 3NSTA 3FLTA 4YG6A 5FLHA 2Z69A 2BWCA 2QNKA 2B5HA 2JG9A 2PLV3 4RR3A 1SQ4A 4RHV1 2VMGA 3E5QA 2ARXA 2ZGUA 1Z7S2 5KHGA 4QGLA 1W6NB 2ZMKA 1YFXA 1VAVA 5FTTC 5E89A 1C57A 5GALA 3ZFFC 1RVF1 1QJU2 3C3VA 5IK8A 1MS3A 3LSDA 4AI3A 3AP5A 1CX4A 4FQZA 4DNYA 2WZR1 3AJZA 4AF9A 3AK0A 4CZSA 2NM1A 4E4ZA 1RUD2 1A3KA 2PLV2 3AX4A 3MIGA 3MW4A 3FFZA 1DGRN 5FMOS 3EQEA 3VZMA 3WCRA 5IK5A 4KG8A 2VPVA 1M06G 5ABJA 1AVBA 1G9DA 4Q27A 3GHMA 5GZCA 1BZWA 1ZNPA 3NO8A 4Y1XA 4NOTA 4E4DX 1PVC2 1BQPA 1QJY3 4HSLA 1LGCA 1S0FA 3E5UA 1SEFA 2DFBA 1OPOA 3AYAA 2E7TA 4HSJA 2UYBA 3UJQA 1FX5A 5FOJB 2D6NA 1POV3 1WW4A 1Z78A 2YXSA 4L2NA 4P9IA 5C9AC 1AX2A 5C9AB 1ZBE3 3AMHA 3BOPA 4CDUA 5JOWA 3TN91 4P9JA 4PIZA 3FUOA 2B39A 1RVF2 4N43A 4ZU4A 3AM2A 2PA7A 3AKRA 3I7DA 3O5SA 4NHMA 1WLDA 3WX5A 4HN0A 3ZSKA 2JENA 3E6BA 4EJRA 1IKPA 4QQPA 4RS5A 2GMMA 4IV3A 5KXEA 2CGOA 4LLOA 3IKWA 3LOBA 1HQWA 4LO5B 5ACA2 5DZEA 1LJ7A 1ZZ9A 1LEDA 1BBT2 3KQRA 2GNBA 1VBC2 2ZGNA 4QQOA 1W6OB 4Y4YA 5FPXA 1QJY2 2CAVA 3LKJA 3SMHA 4BYYA 2HJIA 4OLLA 4OVEA 1RUH3 1BEV2 1S2KA 1YUDA 3WDTA 2ZPXA 2AZ5A 3ZYIB 3VN4A 4FBFA 4Z92B 1DGWX 4OUMA 4FOYA 1GR3A 2BNNA 2Z79A 1CR7A 2DU1A 5GLWA 1MZFA 1ZM1A 3ASIA 5FOBB 3M2MA 2WFPA 2Y38A 2BVBA 3V0AB 4XPVA 2FBEA 3E97A 2ATFA 4IETA 4QD2A 4JQRA 3UJOA 1VBC3 4Q1RA 1EV13 3GZTB 5C8CA 5FAXA 2VW0A 2GMEA 3DF0A 4P5HA 3PMSA 1QDCA 4A7KA 2IZWA 4P14A 2A6XA 4QQ2A 4W6WA 1BBT3 2EVXA 1NQJA 1RB8G 1VBE1 4FPJA 5I0UA 2YDEA 3RQ0A 3FBMA 2HEVF 1AYN2 1LOBA 1DLLA 2RE9A 2YMZA 2HWD1 1CAXB 4QPGB 1G86A 1NCRB 5HCBA 4A7YA 2DVFA 3AKQA 3CJXA 2IXKA 1N1VA 3VZNA 1N3PA 5EWSA 5JCTA 3W58A 3NAPA 5GJ6A 1V6IA 4FPLA 1MQTB 4WVMB 5IK7A 3HN1A 4LO4B 1SLAA 1VBA2 3DN7A 4XF9A 1MZ5A 1R093 2DUOA 4PF5A 1NLRA 4Q4X1 3RNSA 2CY6A 2ZHMA 4XFHA 3SCGA 3LA7A 4WV8A 5AC91 1RUJ1 2GC1A 2JG8A 2ZHNA 4Y1ZA 4DZGA 5KHKA 5GZDA 3ZSLA 3B5LB 2WFF1 1GKBA 1LEMA 3VKFC 1B35B 2WT0A 1RUG2 4HPKB 4RGAA 1ULCA 4B7EA 4M01A 1CAWA 1Q3EA 5EJ3A 1S0GA 1V6MA 1ZBA3 1KD7A 1QJU1 2O1QA 4DY3A 1OOPC 2QQPA 4RHV3 4I30A 4U2AA 3JD72 4XXAA 5ACA1 1IQAA 1AR73 1PIV2 2CV6A 1JHNA 1SCRA 1ZX5A 3KT7A 4L92A 4Y1VA 5HXVA 4IV1A 4C0HA 5F1RA 3M3IA 5A33B 3GALA 2I2SA 5JZGC 4RA0A 1AR62 1FI2A 4JTNA 1D4M2 3KCXA 2VOXA 3VBUC 5CFCB 1ASJ1 1DBNA 2VUJA 1JXNA 3TBDA 3MLJA 2D3PA 5JZGB 2MEV3 1C8M2 3JQWA 4COVA 2HWF3 2P17A 4AI8A 4EWDA 4H14A 4WVWA 3KMHA 3OCPA 2E63A 3WT3A 4AVTA 5JOYA 1JUHA 4XFGA 2JE7A 1WMEA 4AQSA 3B01A 1C4RA 4PQ9A 1QJY1 4AK3A 3OD4A 4Q29A 2A70A 1QGLA 1BVVA 1LENA 4MXWA 4H7MA 4FPYA 3VDDC 4BE3A 3ILRA 3SNMA 2VVEA 4AXOA 1IS4A 4CTEA 2FHRA 2YROA 3B00A 3RRDA 4I3PA 4AEDA 4L11A 3POYA 4IL7A 5J09A 1OHFA 4AFCA 4NWWA 4Q4W2 4BMEA 1Y9QA 2WNUA 1MR5A 4ZU5A 1ENSA 4MGIE 3J9SA 3J8F1 4AQ2A 5FO7B 4JV4A 1AUYA 4IEOA 1Z7S1 1UL9A 4R9AA 3U0ZA 1O7FA 2BWAA 1QQP2 2YYOA 4GXLA 4KNCA 4AQTA 3JB8A 1IS3A 4QPIC 4MV2A 5JMCA 3VKMA 4Y22A 5FQ0B 3ZFEC 1F9KA 4YFWA 2AR6A 2OVUA 2XUMA 1E57A 2ZGMA 4Q0PA 2XJPA 4H3WA 2CWSA 3MI8A 1H9PA 1RUE1 4B29A 2ZGSA 4GH4B 2JECA 5J7MA 1HXS1 4AHWA 3MPPG 5E1RA 1XE7A 4CDQA 1PIV1 3TWIA 1V9U1 1U5ZA 4MYEA 4C91A 4XHXA 3B93A 2DTWA 1D2QA 2OZ6A 4COYA 3ZMNA 1AR93 2HWB3 3K48A 1EV11 1CPNA 2QUOA 2BEOA 5D8AC 4HLTA 3B9CA 3FHIB 1VRH2 1COV3 4WBBA 2OW4A 4IEZA 1CGPA 1VAMA 2E7AA 3P3NA 4HVOA 2RMU2 3QH6A 3N7MA 1H4HA 3ZO0B 1KDMA 4CDWA 3ES1A 3WDYA 1EPZA 1JYCA 5BNOC 1RUC2 2R30A 2QJVA 2VH9A 1F5JA 2WS92 5BY5A 3ZXLA 1PM7A 1ZVFA 2HWC3 4DPNA 2VXRA 3ROUA 3USUA 4L97A 4DRRA 4FOQA 2PHFA 1JH5A 2QFEA 1RUE2 3I54A 5HCFA 1C8M1 4K1ZA 2D6PA 1V6NA 1QF3A 1MZ6A 4R8HA 2PHUA 3V0AA 1PK6C 1RL3A 4AFMA 2CL2A 3URFA 5BNNA 2WINB 2ETEA 4EN9B 2BTVC 3NV3A 4L8QA 3WP5A 3JQXA 5BNPA 1CAVA 1AYM1 3DKWA 2QCSB 2O8OA 4GULA 1A78A 3JCIA 4Q4W3 2MNGA 5JSPA 3IM0A 4HFSA 4D7TA 4XTMA 2E7QA 2C0ZA 4META 2I74A 4JGZA 1EAH3 2D44A 5EFUA 3RYKA 1WCSA 2R1DA 1Q8OA 1VBE2 1RHI3 2GALA 1CJDA 1Y43B 2B7YA 2WSVA 1A8MA 3D0SA 4EROA 1H8TB 1WCDJ 2UY8A 5FBZA 3KD4A 5EYXA 3VBUA 4HK8A 5C4WA 2PAKA 4CDUC 4FXKB 1PO12 3FWEA 4DINB 4CEWA 2PFWA 4E27A 3VHNA 3RG0A 1H8TC 4XJWA 4FTEA 1AL22 5ACA3 4BIOA 4XILA 4CDXA 1I1EA 4CEYB 3ST7A 3HAGA 3LA3A 1SFYA 4HN1A 4CDUB 4XDQA 4IEWA 3HMYA 2HWF2 4A7ZA 3KT4A 2MEV2 5T5PA 2JDZA 3USSA 1DQ4A 3VHRA 1OA2A 1BEV1 2ZJCA 4IEXA 2WLPA 1FPN3 1ASJ3 4RQPB 3OGGA 4QGNA 1DZQA 1POV1 2ZX4A 5L19A 2XB6C 3UV9A 5GZFA 1DF0A 1Q8SA 3TN93 2IFRA 5GKAC 3IDBB 2A6YA 1OSGA 1IZ3A 1RMU3 4XTPA 3ZFEB 4ORFA 1OQEA 3HR9A 5L73A 3UK9A 2RS13 3N4MA 4XHBA 3M3OA 1NG0A 3RS6A 3SCHA 1HV0A 1G9AA 4JAAA 2UY9A 3WV6A 4PLMA 1CONA 4AEMA 4Q2FA 4Z07A 4CDXB 4FP2A 4TZDA 2WIIB 3KCYA 5CVRA 2BQPA 4YG3A 1R1A1 4OULA 4XFBA 3ZN4A 1W6QA 3R4DB 4ZU7A 2GNMA 3IT8A 1I9RA 3EHKA 1MS9A 4W65A 2N7GA 3SH5A 3PLQA 1ND2B 3WDVA 1F5FA 4C1WA 4HVQA 1DDLA 1Q56A 3QLQA 1MS5A 1ND3C 1QXPA 4WZFA 3J8F3 4RSUA 4TSVA 1X33A 1WLWA 2ZKLA 4FPKA 3UKVA 5K9YA 2W39A 1FNZA 3FBYA 1Z7S3 5KHHA 4LE4A 4N43C 1ZZ7A 5JLVA 2CAUA 3WOGA 3DPRC 2JXAA 4RD7A 1WD4A 1HXS2 2EA7A 5KC6A 2DCTA 2UYAA 2F4PA 3E6CC 3LAGA 1KJRA 1SLLA 3NV1A 4IESA 4LA2A 5JVVA 4AVCA 4BLJA 4RS5C 2BPA2 1WBFA 1AXZA 1DIWA 2ZX1A 4XQWA 1AHSA 2IXCA 1OI6A 4LNVA 4GB31 2QE3A 4D3WA 3U4XA 1J1TA 3O0VA 4FPGA 5DZFA 1QXJA 4BWOA 1AJKA 1RITA 3ZX7A 1PO11 2GU9A 2R043 1RUG1 2VMIA 1WW7A 4XF0A 5JSRA 1V9U3 3I2DA 1CN1A 4GH4A 2HWD2 1UIKA 2P37A 4LUKA 5DG1A 3S7IA 2ET7A 3OYWA 1QHDA 1S0CA 2D6LX 1AR63 4PDWB 5LEKA 4PDWC 3IN9A 3KZ4C 4MSVA 1O3QA 1G6NA 1O3TA 1NCQB 2RS32 1BXHA 3RYRA 1CAXA 1MEC3 2PHLA 2R071 2UWBA 3SITA 3FUQA 1N1SA 4DB5A 4UW5A 1QQP3 3V64A 4KWLA 4BLIA 1R091 4Q4X3 1XE8A 1W6PB 1AYN1 4R4XA 4F7ZA 3AZZA 1TME3 1OPMA 1PO23 1NXMA 1NXD1 5KWRA 4Z8BA 1RUJ3 4HL0A 1QH7A 2ZMLA 1KQRA 1RUF1 1FAYA 2ZHLA 4JGZC 4RFT0 3C2UA 4ZXKA 5DDJ2 1GZWB 4FQ4A 1UKGA 2K2SA 2WNVB 2X8KA 3AP7A 3AZXA 1NA1A 1JN2P 2WL1A 4GMP3 4X8PA 5CAZA 2JG8B 2XBO1 1NA1C 1R083 2WT1A 1Q8VA 2WZR3 1DGLA 1AYM3 2IWGB 4Q26A 3DGTA 1PGSA 3AFGA 3AYEA 3H50A 5FRAA 5CFCC 4K21A 2DTYA 1YFYA 3NW4A 5F5QA 1HIXA 1TMF1 2OUJA 2WKKA 3B3QE 4GH4C 4WM7A 2WNUB 3G6JB 3CO2A 4YW5A 1KFUL 1RHI1 5KHJA 1XYNA 2EXHA 2NMOA 5JOXA 3VHOA 4OHXA 2XJQA 2O0OA 1V70A 3M3EA 3ZDSA 1YYNA 2VW2A 4CDXC 5CA6A 2GN7A 2FZ2A 3DUIA 4LHKA 1HRI1 1ULFA 2MEV1 2A73B 1RUF2 3WDXA 1ZBE1 1QDOA 4EN8B 2CNAA 4GWMA 3BIWE 5DUWA 1AYM2 4MXWB 3AMPA 3B7MA 4JC1A 2PYTA 3H1MA 3MF9A 4CP2A 4YW3A 4ES8A 1VR3A 3VDDA 4K8FA 4WM7B 5FFOC 3VHPA 2ZBJA 4GALA 4Q0SA 2PHRA 2NMNA 3NWKA 4OI4A 4FOWA 5KC5A 1Q43A 1LECA 2RS53 4F83A 3AKSA 2JEMA 3AKTA 3VBHA 3ZYJB 2A3WA 5C33A 1I5ZA 1LHUA 4IQPA 1POV0 1GICA 3ATGA 1NA1B 5J37A 1OD5A 4CP0A 1UU4A 3H3UA 3OGJA 1ZBA2 5BUVA 4TWTA 5F6LB 2ZKNA 2OYZA 2UURA 4Z1VA 2QDNA 3AP9A 1MS1A 3AZVA 4I3GA 1QH6A 4JTOA 1LHOA 3KB5A 1PHMA 1KRIA 1G7YA 4W6XA 5L7OC 2BYVE 1UX6A 2NQYA 1S55A 1R1A3 2BUKA 4WM8C 2XPJA 4O9EA 3ZXEA 5B2GB 4WZCA 5H9SA 3OY8A 4QT6A 3M70A 2EIGA 2H6CA 2ZGLA 2A3XA 2ZX2A 5T55A 4LBNA 3D5OA 2JG9B 4KBBA 4EN7B 2ES3A 2H0VA 1XQNA 4IV1B 5GLTA 5BXXA 2XH6A 3KLSA 4LO8A 4OHYA 1VBD2 4R9DA 4GQ7A 4Q8KA 5CG9A 3MW3A 3KT1A 2KM2A 1XU2A 1SBDA 2EAKA 1W6MB 3VKOA 2FMYA 2HWD3 1N3QA 2EXKA 2BFUS 2D98A 1AR91 2HWB1 4CEYC 1KS5A 1RGSA 3BOWA 4Y1UA 2AGSA 1OLRA 1C5HA 4XOGA 1RUI2 2H6BA 4KGQA 3POWA 3ZXGA 4NVPA 3TNQA 5K0UB 2B42B 2QDRA 3MIFA 3N7LA 3WLUA 1YXWA 4JRAA 4LEJA 3BODA 1RTVA 2OA2A 1K5MB 4KWJA 2HWE2 5E16A 3VBOC 3HBZA 3POSA 2C5DA 4F8AA 1XNDA 3KS7A 1OQ1A 4RS5B 3ZFFB 4YM3A 2A75A 3V0BA 1YLLA 3RYPA 1ENXA 2EF6A 2R16A 3V65A 1AJOA 1QY4A 3CL1A 3BU7A 1EV12 4AEKA 1UF2C 5I0RA 1REEA 3ZYGA 5GM0A 1H2MA 4Y24A 2VECA 2YZ4A 4Q4V3 4CP1A 5JPMB 1GBGA 2WA4A 5HCAA 1IS5A 1LB2A 3U10A 3WG3A 2GN3A 1PGW2 3NVCA 1UW8A 1ZBA1 4MH0E 2LALA 1X82A 3NAPC 4XQDA 4C0BA 1Q8PA 2R32A 1MS8A 4XF4A 5T52A 4XIOA 1ZREA 4LHNA 3M1HA 3O0XA 4MGZE 3ZXJA 3NV4A 1OQDA 1V6OA 3ZFGB 2LTNA 5CU1A 5BPXA 5C9AA 1LOFA 1TEIA 4YVSB 5DG2A 2R062 1VBB1 3TB0A 2OZJA 5JAXA 2D43A 4GKYA 1TNFA 3U07A 1YJKA 4XBNA 4GB32 4LE3A 2X5IC 3B9IA 3ZXDA 4I02A 1W6QB 1TE1B 2B46X 1N3OA 4Q0UA 5DXDA 1UZYA 4Q4V2 5IUQA 4R52A 1NLSA 4XFAA 3ZIWA 1A8DA 2FZ1A 1SBEA 4K3UA 2YC0A 1RC6A 4YZ3A 5T5JA 1AR92 2HWB2 4RGGA 2XVLA 1PZ7A 1TME2 3IWZA 4XF1A 4DFSA 2P3KA 1JTZX 3H1YA 3PMEA 1MQTC 3OPZA 3WQ7A 4URTA 1HRI3 1S0BA 5A32A 4KG0A 1J1LA 1H4GA 5SV8A 1NY71 3GBGA 1YRZA 5T54A 2C9AA 1SBFA 1RMU1 3WW3A 3AB0A 4N7UA 2VGDA 2RS11 2DCKA 3O12A 3WR0A 3ZFGC 4Z2WA 3VGIA 2D97A 3LA2A 2ZOEB 4CEWB 2XL9A 2ZMNA 3HQXA 3QCWA 4K40A 5KXCA 1GV9A 1ENRA 2X29A 3M8LA 2Z42A 4QHBA 1ND3A 2JICA 5T5LA 1HRI2 2DWRA 3IPVA 4I0AA 2VU9A 4YZ5A 4QPYA 2RJKA 3VKNA 2VQ0A 4XQ4A 4CDQC 5AFEA 4KWKA 3VZJA 2ZGPA 4G3YC 2Y26A 1ULGA 1PNGA 4O9GA 3FMGA 4RQPA 3TOJA 3FLRA 2JJ6A 3KM5A 2ERFA 2D5FA 3RJRA 1VBB2 2GDFA 2DV9A 2ZGQA 5J96B 1W2UA 4IV3B 1U5XA