3S35H

Structural basis for the function of two anti-vegf receptor antibodies
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
211
Chain Sequence
KVQLQQSGTELVKPGASVKVSCKASGYIFTEYIIHWVKQRSGQGLEWIGWLYPESNIIKYNEKFKDKATLTADKSSSTVYMELSRLTSEDSAVYFCTRHDGTNFDYWGQGTTLTVSSAKTTPPSVYPLAPNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system/transferase
molecule keywords 6.64 Fab heavy chain
total genus 44
structure length 211
sequence length 217
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s35H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s35H02
2Z0BA 1UA6L 5DK3A 3TT1H 3Q0HA 4XX1E 2HTLD 1NKRA 4E41A 4N8CH 2HLFD 1MRCL 4AH2B 4HV8B 5L6YL 3BDXA 4P2RA 5C0BB 3VFNA 3QISA 2KPNA 5IMKA 4H1LH 4U33A 3TNMA 5ISZA 3RX8A 1DBBL 2H6PB 1UQSA 3MV7D 3P4MB 1LO2H 3EJZD 3GSQA 1MSPA 3KDMA 2Z8WC 1Q94A 4O5LL 2I07B 2JB5L 1HIML 3C9NB 5EZIL 1AFVH 2Y5TA 2AQ2A 5DGRA 3PGCB 5B39A 5EC2B 1GGIL 2VH5H 1HQRA 2C3WA 4L9LB 4H88H 2X41A 1FL3B 1PQZB 1DBAH 1JZ6A 2KQMA 1QHOA 3R06B 1N5AA 3MLXH 2IAMD 2HVJB 2P45B 3QUMH 4HCRA 2B2XH 5GGVH 4LSVL 2IADB 5LAXA 4LEOB 3OQ3B 4ZS6D 1IM3B 5D1ZC 1IGYB 3W9DB 5EN2B 5C07A 4WHTB 2IBZY 2P8LB 3D69B 2P8MA 3WD5H 2Y5EA 3IDMB 4OI8A 3BZFA 2FEEI 2K3TA 5IJVA 4Y5YC 3GBNL 2OXHA 1NFDB 1W72A 1BP3B 3NCMA 3MRCB 1JGEB 5TDPB 1T7XA 2IANB 3ARBA 3OBAA 3IJHB 1KYOK 5F96H 2HYMA 1VFMA 3MJ9H 5DJ0A 1QYGL 4WU5B 4P5KA 3VA6A 3LN4B 4LLYB 5CD3B 3I6GB 3NZHH 4PLOB 4ACPA 3MRQB 4TQEL 4L9DA 4TULH 1DQLL 2PYEE 4WEBH 1IAIL 5HYJB 4ODUB 1N2RA 2Y9RT 4LSPH 4D9RD 3UX9B 3D5OF 1OP3H 4X7TA 5HHVH 1ND0B 2FX9H 4XBPA 4GG6E 2EXYC 1RIHH 3CX5J 2XPGB 4NQCB 4AEHH 2CKNA 5CEZD 1CD9B 4FP8L 4PJ7A 4WTZA 3RWDB 3G6AB 1YMMD 3ARZA 3S35X 4IRJA 5F9OL 1K2DB 1B0WA 2Z4QB 3C5ZB 4RAVB 2FATL 4Y4KA 4MSWA 5TQ0L 2CIKB 5HYQB 1XGPB 3WUWA 3RVUD 4Z0BL 4PJ9A 4BK5A 4LCYB 1RU9H 5E56A 3OL2A 2EYRA 1H3VA 3A6OA 3GSOA 4HBCL 1A6ZA 2QADB 1T1ZB 2D9CA 2EDEA 4QT5B 4AIXA 2CXKA 1A3RL 4P2QA 2ICWI 2HJKB 1ZLWK 2G5RA 1HDMB 4E0RA 3HNTH 4OM1L 1K4CB 5DC0A 3HFML 3HUJF 3RTQB 2FL5A 4PJ5E 1T66D 3SE8L 4R7DA 4Y4HD 4FFVD 3ZL4L 4CGTA 4LAQH 5I15L 3LAFA 3U2SA 1U95B 4XWOD 5I2IA 3EOBB 4GUPA 5KJRL 1AGFB 3DO7A 3N1MC 2FD6H 3LB6D 1JRHI 2YD3A 4FN0A 3S37H 5C09D 3ARDC 4M4RA 3UTTE 1IEAA 3NCJH 4HWBL 1LWRA 5CEYA 1Z6JT 4GS7B 4EOWH 4CW1A 6FABH 1DZBA 3L3KA 4OM1H 4JDZA 2CLZB 1QSED 2VLJB 4CVZA 5ICYB 4LCCB 4KHXL 2UV3A 4R90H 3VFUA 4Y16B 2FO4B 5DT1L 1F3JB 5HI5C 1HHKA 4P2CG 5D72H 2X4OB 1DBMH 3BRGC 5H37G 3DARA 3MNWA 5FGBC 5ITFA 2CO6B 3MRBB 2IPUG 4U05A 4AEIH 1DUYA 4RA0C 1ITCA 3TWCH 2ADJA 5J13C 1TNMA 3WMSA 5E2UL 5E70A 5SWSD 2VXVH 3SCMB 1QSEB 1GAFH 4K2UH 1Z9MA 5I6XC 3S98A 4UILL 5M95B 1BVLB 5BO1L 1HH6B 3QCUH 4K8RC 2F5BH 3ZYOA 1HOCB 2VXSH 5C0CA 1WBYB 3UYOD 1OTSD 5I18L 1ED3A 4ODWA 1OTTC 4XCFL 5HYIA 2MOVA 1LD9A 3ARFA 1RZFH 1DQLH 2YUVA 5CEXB 1DR9A 1SEBB 5GZOC 3UYRL 4Y1AD 4ZFOL 3VFVB 5KVEH 1KT2B 5I15H 1H15A 1I9JL 4LNVA 5IJVB 2DBJA 1T20B 3IDMA 5DVMA 2JK5B 1U8MA 5KSAD 4Z95H 3UROR 4UINH 4IOFC 4FXKA 3PWUA 2LTQC 2F53E 3RVXD 2FX7H 4PJGF 1YY8A 2EYTA 4IRJC 4U6TA 4M62L 5I71C 3EYVB 5C2BH 5I1LB 1ACZA 3VFTA 5FUOH 4BFIA 4FQJH 5GS1C 2H2SC 2I9LB 4WI5A 2X4PB 5D2NC 4WDIA 1MFBH 1TPXC 4PBXA 2B1HL 2R2HB 5IB2B 4ERSL 3IETB 2XZAH 3MLSL 5IFHH 1E4JA 3LS5L 4W6XB 1YEHH 1RJCA 1JF1A 2AKRB 3GFUA 5GHWL 2R29H 4NO5B 4NQXA 5F71A 3OMZA 3RWCA 2P5ED 3SGKC 3CK0H 5E08L 3EJYD 1CIDA 2WLYA 1U8OA 1CG9A 5JQHC 2ZUWA 3HC3H 3BGAA 4PRDA 4UUJA 5IJKC 3MO1B 4LLWA 3ALXA 5EZIH 2D0HA 4EKXA 1S7UB 3BHBB 3SE3C 3UTTD 4I77H 4XRCB 4DQOL 2FECI 3P9WB 3GJFA 3RNQB 4KVNH 2VH5L 3IJSB 4EUPG 1AI1H 3QCUL 4XB8A 3VH8A 4YAQA 5I73C 1JE6A 3O0RH 5CJOL 5C0GB 1D6VH 4QOKE 4Z77A 3SKJL 1DVFC 3T09A 1VFBB 3LKSB 4OD2A 5E8NA 1NCCH 3QDMB 3IU4H 5GSVB 2CJUH 3MSPA 1EVUA 4Y5VC 5F7EL 5C08A 4U6HA 1G0DA 3GSNH 3I6KB 3HB3D 3TA3A 5M94B 5B21A 1KYOJ 4F9LC 4JZOB 5FYJE 1EGJH 1HEZA 5D2LB 1NCDH 4P2OA 2DLFL 4FFYL 4XP4L 1UH2A 4FQHA 1Q0YL 3X14A 2X4NB 3SDDB 1YEKL 3CFKB 1NGQH 1FG2B 2HKFL 5B38G 4NHCL 1NDGB 1EEYB 1TDQA 4Y4FD 3RY5A 3S6CA 3PXJA 4TNWK 1HQ4B 5ALCL 4HAGA 3NCFB 5GRZA 2EH8H 2X7LB 1YEIL 1M7DA 5GGSA 4GRLB 5FM5O 3BW9A 1A7QH 2ZCLL 4HUMB 3U36B 1OD7A 3MRJB 3UJIH 2ESVE 3QHFL 4XCEB 5FGCE 1F42A 1MCOL 3GSNB 5C0FA 4DN3L 2R1XB 2ZUYA 4WHYH 4DGIL 1TJGH 4YFLF 4YHZL 3NOIA 5EO9B 1OLLA 4KU1A 3RVUC 4R2GB 4IBLT 2ADIB 2VR4A 3MLZH 3ORJA 3FRUB 1K3IA 3HZVA 3C60B 1BVKA 1T0NA 4OD3H 4AL8L 3B9KC 5K59F 2QHRH 2E9WA 4ZUUB 3PWLA 3MGTB 1JTPA 4X80L 2NZ9D 3HNVL 5EO0B 3AUVA 4MZ2A 5ITBL 3RWGB 5EO9A 5ICXB 1XF3B 1RUAL 3MV7B 1LE5B 1IGIH 3DSFL 3MJ9A 5JXEA 3S3JA 4OLEA 1BZ7B 3GSNA 4NWTH 5IV2B 1L9NA 3VFMB 1LO4L 1RZJH 4R26H 1F8TL 1I85A 5JDJA 3QUZC 1ADQL 3B5HA 3V6ZA 1KN2L 4LCUB 2PCPB 5DTFA 3DVFA 3FQUA 1IGIL 1C5DA 3O2DA 1HK6A 4DOHB 2GCYB 1O5DT 5BJTA 5IMMB 1UH3A 5IEKA 1EEYA 2VKXA 2DL2A 2R4SH 2OSLA 1M6OA 3PIQB 4WJ5A 3QO0A 3L3IA 1ZLUH 3MBED 2NNAB 1CFBA 3PNWB 1FNFA 3O6KH 1UWEH 3ARGA 3LH2L 3ZYJA 3MCLL 2QKIB 2Z35A 1IEBA 4NO2A 4GW4B 4NJ9L 5TDNB 3I6KA 5AD0B 1G9NC 2C4XA 4JY4A 4NBXB 1CVSC 1FAIH 2ESVB 5D1QD 4TSBH 5E8NB 1JRHH 2IG2H 2QSQA 1UJ3A 3MLWH 1RZIB 1R5IB 3UZVB 4UDUA 1MCRA 4NO2B 3N1FC 1EPFA 2VQUA 4Y8DC 3PV6A 2APBA 4F9LA 1R3IL 4JPIA 3O3DA 1X5ZA 5LKNA 3ZE1F 4J2XA 1RD6A 3MV9A 3WN5A 5FOJA 5DJ2A 5DQDH 3QDAA 4J1UB 3C5SB 5E5MA 2QLVB 1A4KB 3X3FH 4PJAA 4CU6A 5D2NE 5IMMA 1IC5L 2F53A 4FQQB 4BSJA 2GCYA 5B39G 4V1DE 4GRWF 1T66C 3VWKA 2C5DC 1UM5H 2P8PB 4X5XA 2H26B 2D4FA 4X8JB 1FZJB 4PYHA 4FTVA 1MVUB 3MNZB 4UT9L 1ZHKA 4KV5E 4ZFFA 3S7GA 1HSBB 1N0LA 4PBVC 2YUWA 3OKEA 4LARH 5I8KL 3SKJH 4CNIB 1EV2E 1P2CB 4PJBB 2UYLA 1IMHC 1UWGL 2PW2B 1X3DA 4L1HA 4XCCH 3BP6A 3O6FD 5EBLA 5IFAL 2O26U 5DD3L 1I4FA 1JWUA 1FLRH 2DWDB 5CEZE 1LP9B 4PG9B 1U8MB 4XAWL 2V7NA 1T83A 4WI8A 5DMGC 2BSTB 3QHZH 1HKFA 4FS0A 2CK0L 2IGFL 2IH1A 3WNPA 3QULB 5FB8A 4NYLB 3UTSE 2YSSA 3RL1B 1F4XH 1T0MA 3RVVC 4P5TD 4O9HH 1IM9B 4RWYL 2HT2C 4PB9L 1R3LA 5BRZE 3MRIB 3NFPA 4QOKA 1ED3B 3MYJA 3K1KC 1DJSA 5BQ7B 4DGYL 3QCTH 3SGEH 1TZIA 4XXDA 5J1SC 3RDTB 2VDLL 3LZFH 3G9AB 3QUXA 4ZODA 5TPWH 1A3QA 3O6FB 3GBMH 5CGTA 5F7LB 2DQCH 4XP5H 3BQUC 4XVJL 5DRWB 2KH2B 1MRFH 1EJOH 1FZOA 3UP1A 2ADJB 3V7AE 2FBJH 1Q9LA 1U36A 2OJZL 2WBJC 3WFHB 5J11B 1FG2A 1WBXA 1MREH 3M17A 1IGMH 3DV6A 5C9KA 1OSPH 3MROA 5F7DB 5GJSH 4FQHB 4OSUL 4OFYA 2BNRD 5CP7A 1JZ3A 4OLVH 2VLKB 1V7MH 2GEEA 3T08A 5DC9B 1GGBH 3C8DA 1CTNA 3HE7A 4LPCA 2X70B 2YRLA 2VZTA 5DD0H 2VDKL 5BS0E 1WT5A 3IDJB 4PJGA 2YBRB 4PJBE 1AGBA 3FT3B 4M5ZH 5EUKB 4F80A 5ID1A 1AHWA 4HX1B 4O58L 2AJ3A 4GW1B 4MQXD 3HUJE 1ADQH 2PNDA 1P6FA 3MV7E 3WNNA 1Z0MA 2Z8RA 5D71H 1XH3B 3IF1A 3NAAH 4YDIH 1JHTB 5T1LD 3FB6B 3SJVE 5F3BB 1S7UA 5KW9H 4AG4L 3QPQC 2X4RB 3QQ3B 1J1XL 2GSGB 5HJ3A 5C7XH 4KC3B 3IKCB 3ARDA 5KSAB 4QRTB 3REWA 4M48H 1U91B 4L4TA 3S96B 1KPVA 5IG7B 3LEXB 3VXSE 1A6AB 3BPLC 2D7PA 3QDME 1NCWL 4PJEA 4ELME 2OXGA 3G08B 2H32H 4I2XE 2J8UF 2NQCA 4G43B 4JKWA 3O3EB 4JO1L 5E8EB 5JO5A 3ULUL 4H0GA 1KXQE 5FUCE 5GS1B 3BKCL 4MS8C 3GK8L 4OM0H 3W9EA 2FIKB 1YEKH 4EBQL 2V5SA 3BE1L 3MBEA 2LTQB 2ENYA 4XMPL 1RJYB 1SHMA 3TO4C 2DQFA 5IFHL 4J23A 4YWGH 3DMMB 1WZMA 3O3AB 5TE4H 2CPCA 1EX0A 1SEBA 3KVQA 1N2RB 4PLJC 1BZ9B 2CXGA 3P4NB 2OX5A 4WIQA 4GRWH 4C59B 1JGUL 3VRJB 1RUKL 1NCWH 2BJML 1JN6A 3VRJA 4Y4FC 3CZJA 4FABL 3ARRA 3M17B 1MFEH 2CKBL 1J10A 1ZTXH 4ZXBB 5D2LE 4BFBD 1OP3K 4MYWB 4HH9B 3VJ6B 3S4SA 1A7BA 5TF1L 1NFDA 3MV9D 4XHJD 2J4WL 1RFDL 2R2BB 2W60B 2FDBP 3D69A 3D2UD 4YUEH 5J13B 4NRYA 2YPKA 3C87A 4KMQA 3C6SB 2V2XB 2ZZUT 1AJ7H 1JWSA 2IADA 2A6DA 2ARJB 4I18C 1XF1A 1KJVB 3QUYB 4KDWA 4PLJD 3VFUB 4UILH 5JO5B 4UNUA 5MENE 4ONOA 4P3DB 4ZS7L 4UQ3B 2CKBA 4HC1A 2VDKH 4WO4C 2GQHA 2BOCA 2AEQL 3VFWA 4K7PY 3K80A 2NLJA 4Y0GA 1CT8A 1I1YA 3CDYA 1DSFH 3QIBA 4ODTL 5T5NG 4BFGA 1BD2E 1MF2L 5T1MA 5EUOB 3I02B 4E42A 3KPNA 1CK0L 1U8JA 4MDIB 1I1AA 4JM4H 1KXVC 2VR5A 3ARDB 1CL7L 4Z78A 5KSAA 4FXGA 4GUPB 4NGHH 1HH9B 1ODAA 1C5BL 3AY4A 3Q5OA 4OD3L 3O11A 4LOUC 4MWFA 1BMGA 5IVOA 5I1AB 3C60D 4FTVB 4N0UE 4XXCC 4PRIA 2IQAB 1PJ9A 4GAYA 1WQVT 4P4KC 4X6FB 1RV6X 3NCYP 3VXQA 3HAEB 3VWKB 2Q86A 1A1MA 3IXAB 3NCJL 5EWIL 2A83B 3LKPB 3G6JA 5CINL 2CUMA 2F53B 4FQQA 1XGRA 2LAAA 4ZUSA 4M1DL 4Q9RL 4J1UA 5E6ZA 4TSAL 1D5XA 1UM6H 3LIZL 4OFDA 3UYRH 2MWCA 4G6FD 1MEXL 4Y8AA 2X1QA 4LCYA 1TIUA 2PTVA 3H7BA 1F8TH 4ETYA 1UACH 2CDGA 1JHKL 4NKDA 1XGYL 5T3ZL 2ZUUA 1YNKH 1N64H 5JR1H 1PGRB 1CTOA 1CBVH 2E6QA 3B43A 4FQXB 4BKLA 1BFVL 5J57B 1WBXB 4GAYB 1FO0B 1OB1A 1RK0B 1CGSL 1J0IA 4YE4H 3MZGB 4WEUD 1FO0H 2AI0L 5JMOC 5C6WH 3L1OL 4QTHA 1W0YT 1DQQB 4GKNB 2H32B 2D31B 4J8RA 1BF8A 1EZVX 2FYYB 1X5AA 1A3LL 1WK0A 2FJFA 4O2FB 4GBXD 5TGBB 4HWBH 2ICEB 4DVBA 4PG2C 1RJZB 2QL1A 4MAYC 5BS0A 2BSED 3U0TA 1QR1A 1QRND 1I7TA 1IL1A 3C5JA 4LF3B 5DUPL 3MJ8B 4NO0A 3TVMA 5BZWA 3VXRE 1EBPA 3LQAC 4JR9H 5FYLH 4JPKL 4M03A 2BHUA 4UQ2B 5DJ6A 4X9FA 4P23C 3PGFH 1KIUA 2V7NB 2KUTA 1GXEA 4I2XB 3QPXL 5KZCB 4JRXB 4NQDD 3VFMA 2LU4A 1YPZA 1FYTA 1QSFB 2EDWA 1JWSB 4IOIA 5LAXB 3EO0B 1JNNH 5IW3A 4B7LA 2PW2A 5DZOA 4M1CD 1T4KB 1ZSDA 3RRQA 2IPTH 4L4TE 3MUY1 2RGSA 3D9AL 5EUOE 3QDJB 3A6BH 1J8HE 1QSVA 4WO4D 4NZTL 4I0PA 2AXGB 1FYTB 2R1YA 1ZVHA 4OGXL 3HS0A 4BQ8A 2F8XC 5A40E 2DQIL 5EH1A 3VXMA 5D1XB 1L0QA 3VXRD 3NIDF 4YHMH 4R97B 2KDGA 4WO4A 1FZJA 1CZ8L 3QWRD 1TETL 4FMFA 1MF2H 3H3PL 5DRZA 3RPKA 5F7EH 4OGZA 1CQYA 1S9YB 1AE6H 4PJ8B 4G9DB 1EEZB 3SPVA 3MMEB 4LHUD 2W9DH 4P0DA 2DBLL 4NQDA 1U8PA 2DS4A 4DUVA 2A6KB 4XP1L 4HBQA 5GRUL 1QSFD 2ICWJ 2L7UA 1OF2B 1WEJL 4XNQB 3OKNA 1FSKB 2EC8A 2FJFB 2XWTA 4HPOH 5IW6A 4RBPH 3SOBL 2GUOA 3O8XB 1ORQB 3AS0A 4LHUG 5DUPH 4ZFGH 2FEEL 4R96A 15C8H 1PAMA 4Z7UE 1KJ2A 3V6OA 1F6AA 1A7OH 3HC3L 1UJ3C 4TOYL 1S5IL 2CDFB 5CMAA 2ZUSA 1WZLA 4XCNB 5IT2L 1YDPA 1FZKB 4BELD 5SX5H 5I66A 3SDDA 2A74B 4BKLB 3T2PA 3MGOA 3FB5A 4LSPL 4XB7A 5TDNA 1CF8H 4XX1G 5DUML 4KMTH 4WENB 2AP2A 3ME0A 4P2OB 4S1RH 3BSZL 4GXUN 5D2LA 2VRAA 1AGCA 2WBWB 5ISZD 5IB3B 1BJ1H 3G5XA 1JGUH 2VLLB 3QIWA 5I75B 3CVHB 1NFDE 2DQEL 2ADGB 1BFVH 3QCVH 4WHDA 3AAZB 4LSVH 5EBMB 4JGJA 2CDFA 3RGVD 1YEFL 2R56L 2C7UB 3MACL 2BXZA 5HTSA 5EIIB 4JFXB 1KB5A 3RGVA 5DTFB 3ZHLA 1IGTB 4WI4A 4R8WH 3NZ8B 2GK0A 3HG1E 1KCRH 2NW2B 3F7PC 3HHRB 4LGRB 4RISL 3RA7H 3PGDA 4AK1A 3SDAD 5I1CH 1UZ8B 2FRGP 3FT3A 4ZQKA 5CZVL 1U8PB 2AV7B 3VXNA 5ACZB 4JM2B 1IE5A 3BI9X 4FXGB 4PRDB 2FEDD 5ICXA 4PUBL 3H9HB 4MAYA 3NFSL 1WIOA 5D1ZD 1LK2A 1XIWB 1M1SA 4R8WL 4U31A 4Y2DA 3TVMC 1X4YA 5MERB 2ZUTA 1DN2A 1J9CT 5MHSD 3ARTA 3ARSA 3R4DA 4XP4H 4FQ1H 1Y0LB 5EIVA 4MB5A 5DHYA 5IBLC 4S1DD 2C26A 1YN7A 2Z93B 1JJUA 3MTRA 1KBGH 3DURB 1RZKL 3S5LA 7FABH 4ORGA 3ULUE 2AK4B 2E9BA 3V5DB 2ARJA 5DJYA 3G6JE 5TQ0H 2V2XA 4FXKB 4XCEA 1AGDA 1I8MB 4YE4L 1W8NA 1CD8A 3X17A 1U8LB 2G75B 4PREB 4I0PC 1ZT7A 4YHKH 4KHXH 1RIUL 4KI5C 4RFOH 5D7LE 3GMOB 2G75A 5SWSE 2Z31D 4MLSA 3TBWA 4Z7NF 5CLWA 2FH6A 5CSZA 3JWOL 2QQLH 3CGTA 3KHOA 3MRIA 2DMCA 5DJYB 3V7AG 3GB7A 1WAAF 3J8F7 3LN5B 1SM3H 3JWDL 4LU5H 3F7YB 5H37H 1YN7B 4LDOB 4F7TA 4HPOL 1DQQA 3VGGA 2LU7A 1MPAH 5E0QA 1TZHA 4GAGL 5MERA 1HCFX 3BYTA 5KVGH 1WF5A 2W92A 1MCCA 3DUHA 5CZXD 4APQB 4P2YA 4GRWE 4LASH 3OAYK 4X7FC 1CFQA 1B9ZA 3I3BA 5DJZA 3SDXA 3BX7C 4KWUA 2Q76B 3CFBA 5GGUB 1G7MA 1QFUH 5FCUH 1JUFA 1NMCC 1KXTB 3PGDB 5T1LA 4YHML 1K9TA 4LHQB 2IALB 4S1RL 4Z95L 4XHQA 3GBNH 5T3ZD 2V5TA 2H26A 2BNRA 5T3XD 3B2VH 2F54A 2X4SA 2YEZB 1I3GL 3HB3C 2Q6WB 5LCVL 4Z5RB 1F4XL 4MD4A 1RULL 1AJ7L 4XPTL 3C5SA 5E5MB 4G6FB 3LEYH 4F15B 4LKXA 2NR6D 4C56D 4ZPTB 1BX2A 1CU4L 1PZ5A 2ZJSL 1S78D 3PHOB 2JCCA 3ARPA 2KL6A 1T5XA 4XPHL 1BJ8A 1QQDB 5E03A 2NY0C 3PL6C 1U6AH 5HJ3B 4MLIA 3UDWA 3KJ4B 3MUHL 4J3VA 3QSKB 3QXDA 5D7LB 1X44A 2HH0H 2FL5B 5EZLA 1XH3A 2QTEA 2O5ZL 1RMFH 2ZOLA 3MV8E 1G9NH 5C86A 3QT2A 3QAZB 1X5JA 1U3HA 1B90A 4ZAKA 1CL7I 1CT8B 1I1YB 4LVNC 1KB9J 4QT5A 1PG7H 4MJIA 1VPOL 4KJYA 1T20A 2Z35B 1WITA 3KPLB 3SKOA 1NBQA 3CFIC 1DBKH 3GSOB 2YPLD 3W5MA 4RNRA 3OKNB 5I76B 4ZD3L 3V0WH 4Y4HC 3G5ZB 1FNHA 3EIFA 4LPUA 5TQ2L 4OGYH 4PGCB 1P5UA 4HUVB 1WBZA 1WGOA 1MFAL 2YWYA 3VXRB 3KG5A 3MROB 5H35B 2XKSA 4OCYL 2GJ6A 5TH2A 3DV6B 4XP9L 4AEFA 5IB5A 5D6DA 4HC1L 4G8IA 4JEGB 5F7KC 3V6ZB 1WZ1L 5GPRA 2ZUQC 2UWEF 2UVFA 3O2DH 2NY6C 5SWZD 4X9HA 1H3PH 2DM3A 2CIIA 1T2XA 4A6YB 3HA0A 2DQTH 1J88A 1K6QH 2ZCKH 3RPIA 4OFKA 3P0GB 1FDLH 5HYSB 2M26A 5D7SH 3SEPA 1HXYA 1VGEH 3EO0A 3CPLA 4CU7A 1ZANL 1NLBH 2W65B 5DJ0B 2LE9A 1BZ9A 1QLFA 4JRXA 1XZ0B 3GSWA 1BFTA 3VGDA 5DQ9A 1WCQA 4YO0A 3QIBC 5MI0C 3ULVC 3WXWH 1OAYH 5EZOH 4JM2A 1OLZA 1IZJA 3I3EA 1H3GA 4DVRH 3MBXH 4HKBB 1QO3A 4M1GH 3BKML 4WI6A 2Q7NA 1AO7D 4YK4B 2AEQH 5SX4I 5EZLB 5DDHB 2NY4B 5I1KL 4ONGH 3KLAB 3TBTA 1A4JB 4XNZB 1NUNB 4ZPVA 1OY3B 2V17L 2X89D 4JRXD 1D5MB 4NZDA 4P5MB 5DVKA 5ANMB 3H9SD 5JXAL 4JB9L 2IBBA 3MRNB 1N0XH 3OKMB 2EZ0C 4R4ND 4YGAB 2H9GA 5CILL 1KCKA 4QF1A 4D0CA 1D5IL 4HD9A 5C08D 1OAXL 3MJ6A 5CBAA 3MCG1 4J4PA 4QNPE 2DQGH 2ICCA 5DMIL 4PIRF 2XQYG 5F1IB 3WIIL 3RU8H 1UQSB 3JV0A 1HEZB 3TIEB 1UCBL 2VJXA 3WHXA 2ZSWA 1MNUL 3IF1B 2HFGL 1G7LA 4GLRH 3MODH 4XVTH 5E8PA 2DQTL 1F13A 1G9ML 4YQXL 3WLBB 2R9HD 1MCOH 2E7BA 3LKSA 3P3YA 3OAYH 3O45A 4HX1A 3T65A 5F1NA 4PJXF 2E27H 4X6DB 5KSUA 3Q2CA 3ZKSD 4BSWB 4PJ5B 4X6FA 4KQ3H 4LFHD 1N6QL 5CJBA 3O81A 3VG0H 1YC8A 4OLUL 2FECL 3M8OL 2D0FA 3B4NA 4NQTA 2EIZB 4U1GC 4DTGH 1DANT 4RRPA 1ZLUK 1FVDB 3FN9A 1AKJB 1CG9B 1I1AB 1IAKA 4O02L 3RVTC 3DSNA 4MJ2A 1DQMH 3KPQB 4O4YH 3MRLA 4UT6H 3IDNB 3BPOB 2UY6A 1KCVL 4WV1B 5KG9B 1T2QL 3MRHA 1KG0A 3JVGC 4NQEB 2R4RH 1JGEA 2DIBA 3HI6H 2PTTB 4CL7A 4DFIA 5I1LA 1ZT7B 3FAWA 3T4YB 2VAJA 4MJ4A 2F54E 1HNGA 1IC5H 1YY8B 2EYTB 3EYFB 5IV2A 2A6DB 4LCWE 3MA9L 5DD5H 2Z92A 4JFYB 1S9VA 3ZTJH 4ORGB 4RQQA 4HG4K 5HYJE 3VXMD 4HGWA 3SQOL 1UM5L 5DJ6B 5H2BA 4M3KB 2JCCE 1T1YB 4U1HA 5T33H 5JLZB 1Y0LA 2Y07L 4C4KT 4ZXBA 2QQKH 4KXZI 2R29L 4BUHA 1EXUA 2C1OA 5J1TC 3DSFH 2ADIA 3MYZA 3OKKA 2NXYC 1JN6B 3L5WA 2XZAL 1Q0XL 1S9XB 3RIAF 1JYWA 3MUGB 43CAB 5MP6L 4MJ6B 5ACZA 1AXTL 4LLVB 2UYLB 1S7RA 4ZQKB 4Y89A 3LKRA 3CDGA 3LY6A 5T3XL 1S7RB 5GS2H 2ZOKB 4ODSH 2NY0D 2HWZH 1ZHKB 4ZFZA 3V52L 3RBSA 4QTIL 4WUKL 2DQFB 1OTTD 4PJ5A 3VI3E 2Z91B 3VGFA 5D7JA 3GRWH 1MUJB 1U3ZA 3FOLA 2NTFA 3CCHA 3IDYC 3JV6B 5DFWH 4ZXBD 4K8RH 1QNZL 3CVHL 3FT2B 4NKDB 3V52H 8CGTA 3WN5B 3NIDE 3N1QC 4P4RB 4I0KA 5DD6A 2ZSWB 4OZHA 5IOPA 1A8JH 5ICYA 3O3EA 5HHNB 1HHHB 4W68A 5CJQL 4PJEB 2OBGA 1PKQA 3RZWA 3DIFB 4KTEL 5FXCH 4PRBB 3PJSA 1P7QD 2DLIA 1NC2B 1BF2A 1NGQL 4R9HA 5HHOA 5HGBB 3H9YA 4LSRH 1N7MH 4ZO8A 2WBJA 1NBZA 3PWPB 1GAFL 3OKMA 5F6IC 3NFNA 1HE7A 1IARB 1MHPH 4IDLA 3W11C 4JHBA 3O2WH 5HSFA 4ONFL 1TCMA 4HIEB 5D7LD 1WFNA 1NC4A 3U4AA 4Y1AA 4GMSH 5F3BA 4PJHE 3FB6A 1MCPH 5DLML 1S9WA 2B0SH 3KLHD 5D9SA 5C0IB 5IF0A 3QI9B 2EYSA 4HUXA 1BWWA 4GT7A 5A3IC 5MEOA 5DZLA 1G9NL 4YXHL 3PIQA 1TLKA 1IKNA 3S88H 2V5MA 4Y2DD 5LJYH 4R90L 2VMFA 1E27A 4IRZH 5DD1H 1MCFA 1W0VA 3DI2B 5FEBA 2JKXA 2ARJQ 1RPQA 2E8ZA 4TUJA 4CVUA 1MWAL 1KEGL 3TH3T 3IXTA 2YHGA 1YECL 2BDNL 4U1KA 3NPZB 2P7TA 2DJ4A 4RGOH 5FKAB 1ZE3C 1YZZA 1EEUA 5EOQL 1NJ9B 4QXUH 3ZYZA 3IFLH 3QWQB 1MI5B 2ESVD 3ROOB 3VDAA 3ETBF 2X9XA 3T2QA 3MGAA 4HUWB 2C3GA 1C7SA 4B7IA 3QNZA 1KTRL 1CGUA 4PJIF 4NHCH 1A9EB 1CWVA 3F58L 4OT1L 4F58H 1I7ZA 3GUTB 2P24A 3P0YH 3RWEA 3O9WC 4WCYH 5IBUG 5ERWA 2ED8A 5GJTH 1R3LB 4ZG1A 3U0TB 1HSAA 3PABA 1JZ7A 3TFKC 2HTKC 1JV5A 4OZGF 3WFDH 3LS4H 3ARYA 1ZMYA 5ALBH 2XZQH 5DDHA 4PJCF 3R8QA 5FECB 3TO4A 2R0KH 4TUOA 2D31A 1J1XH 4Y5YA 3L5XL 1YC7A 2O5ZH 2ERJC 3WS3A 3IRPX 1QLRB 4Q6YA 5GRVL 3C8KA 3CU7A 4FZEH 1X9QA 2X42A 2G60L 5IESH 2FIKA 4FHBD 5FUZH 2FEDC 2GITA 1U2CA 2HVJA 2CO7B 2CMRL 4XNXL 4KVNL 2AS5M 3CH1B 2XFXA 3WFBH 4PV9B 2BVUA 4LNRA 3LS5H 1T89A 1RIUH 2DAVA 4YHNB 2OL3A 1YNTB 2MQ3A 3HNVH 2CDGB 2MCPH 5JORA 5JW3L 1D5ZA 3WE6B 1QVOB 1IAOB 1IRAY 2D0GA 2HKHL 4PLKC 4APQD 4C56A 3H6JA 4X6EB 3V8OA 4GOSA 5F7NC 3QNZB 3EBAA 5D7SL 2A6IA 1NGPH 3V5HB 3W39A 4L8SC 3AMKA 5FHAH 3QWOA 4L5FH 2UWEE 3TZVD 2R15A 1OGTB 3WFZA 1X5KA 5A2JH 3F6IA 5KSBB 4KAQH 4ZSOA 1TCRA 3GGWB 4NOBA 2DIJA 4HKXA 4R7DB 4TUJB 4M93B 5FDWB 5BV7B 3DRQA 5F93C 3QNXB 4ZAKC 1EO8H 1HXMB 5HPMA 1IGJB 4K07A 2PYED 1GGCH 3OAUH 1Q9WB 1IKNC 2EO9A 2MJWA 3RZCA 5KJRH 3VU2A 4L3EA 3TNNA 3MRKB 4JZJC 5B38A 1A5FH 2UZXB 1CFTB 4Y5XA 1FBIH 2DLFH 4NQUA 1A6WL 1A14L 1LE9B 2W0KA 3B6SB 4F7TB 3BWUC 3HPJB 3LKNB 3MLUH 4IJ3B 4TRPL 2NNAA 4TUKL 5LGHL 2ZOLB 1WAAE 4OCWL 1KTLA 3QCVL 4TNVF 3NH7L 4YPGA 3ZDXF 4HKXB 3Q1SH 5J1AB 3GB7B 3W5NA 3VWJA 4EDWL 1DFBL 1MWAB 1DBKL 4RAHA 1EGJL 3FQTA 4BM7A 2PCPA 1CE1L 1GOHA 3A0OA 3G9VA 4OZHE 2GY5A 1AGDB 3TPUB 3FQRA 1MLBA 4XBPB 3VCLA 1KIPB 4YZFF 1NAMA 4MD4B 4LCWB 3P9MA 2F15A 4OCXH 1U8QB 2HT3D 4HKZA 1HHHA 4P49A 5GZND 1M05A 4JKMA 2X4SB 5CSBA 3RIAK 4UTAH 2JJSA 4RFNB 2ED7A 2AJSL 4LLQB 4X7EC 2DIAA 4RX4A 5BZDB 4XWOC 3PDDA 4AT6B 1HH6A 5LCVH 3K4DA 5IHZA 4L8DA 3FN3A 3QR2A 3FOLB 3SDXB 4KGLA 4PJHA 1AIFA 3LKOB 5IB1B 1P1ZB 4XP6L 4KJWD 3OXRB 1FGVH 4M5YL 4UIMB 2IH3B 2NY7H 3O2VH 1XF2B 2XWBA 1FORL 1OGAB 3I2CH 4JRWA 1WFTA 5C71A 2AW2A 3BJLA 3KWWB 4U1LA 1Q9OA 5EORL 2JJTA 1CQKA 3BDYL 3BPNC 4GRLA 3L5WB 5D93B 3KYKH 5I1GH 4HJ0D 1DSFL 4OIIL 1EXUB 3UBXA 3EDDA 3MREA 1A4KA 5EBMA 1FGVL 4I5BA 1MLBB 3VCLB 1RUQL 4E41E 3CX2A 4K7PH 3RY4A 3GSQB 4JPIB 2B4CC 5AWNL 2ZUXA 2EDQA 2FR4A 1S7SA 2FLBT 5D2NA 5I16B 2WIIB 4V1DA 3BJ91 4KKBC 4HXBL 3L3OA 4LHUB 1SM3L 1BQHG 1IC4L 4JHWH 1I3UA 2Z8VC 3QUMB 4XCNA 3HPJA 2HJKA 4OB5L 3RHWF 3RTQD 4BQCA 1DBBH 2JB6B 1PG7X 4GW4A 4QWWC 1MJ8L 4NQVA 5E6IB 1DLHB 2BSSB 2HAZA 2ITCB 1P6AB 1CI5A 1T1XB 3QJHB 2J8UB 3HE7D 2HVKB 1NUGA 2CDEA 4X9GA 5KS9F 4BSVB 1FH5H 3EYSH 3DO3A 1QD0A 4XNYL 5C07E 4KQ4H 5TE4L 4JDTH 1QP1A 4XWGL 1XGTB 4N8VG 1JZ4A 4IMKC 3RWDA 4NC0B 4NRXB 1CLOH 1TVBB 4JFXA 2WW8A 4HLZG 5E9DD 1P4LA 4DN4H 5BOZG 1KCRL 3U6RA 5BRZA 4CU8A 1DBJH 4JVPA 2DLTA 1ND0A 2F54D 1CR9H 2B2XL 5GGVL 4WW2C 2BDNH 4WFFE 3QDJA 4Z8FH 3MRDB 5BRZD 1KEGH 2NYYC 5IMOA 3QIWC 1D5ZB 4WHCA 4PTUB 3SDCC 4NDMB 4C56E 1PKQB 4KQ4L 5GS3A 1DBJL 3NIFE 4XHJC 3RWHA 4IOSD 4Z7VA 5FB8B 4GH7B 2JB5H 2BSTA 3RGVC 4JANB 4PJ7E 4G7YH 2DKSA 1JCKA 4F9PA 1JF6A 1LK3L 3CU1A 5HD8C 1ITBB 4AEIL 3HNTL 2GJZA 3FKUS 2A9NL 1D9KC 3ARFB 4D8PB 3HMXA 4NHUB 3WS3B 1FCGA 2XNAA 1YQVL 3RP1A 5MEQB 2GUOB 3E8UL 1U92B 4G42B 3U1SH 1FVEA 3KPMB 2XWTB 1L6XA 1OF2A 1P2CA 4PJBA 3UPAA 5E6ID 2ZPKL 5HDQH 1UZ6E 1NCBL 4Y2DC 1GHFH 3VI4E 3K81A 3OKEB 4EI5C 5IFJA 3EO1A 12E8H 1Y18B 3T4AA 3MMEA 3BIKB 1YEJH 4PJXE 4G9DA 4GSDH 3MV8B 1A7PH 3BMVA 2NW3B 4YDVA 5JTWA 3TN0D 5T3XE 1AXSA 3KJ6L 1V7ML 1XZ0A 1ZHBA 4NKMA 1QYGH 4R7NA 3MV9B 3NGBC 1MI5A 4HDIB 4R4FL 1P7KA 1WWWX 5C0BA 4KJPC 3VFSB 3GRWL 5BCAA 2Z31B 1YEFH 3QDMA 4CMMA 1F2XK 2CIIB 4K7FB 4U1KB 4XPFH 3UTTA 1W0WB 2P5WB 3O4OB 3FQRB 1QFUL 5FCUL 4HUNB 3O2VL 3UTSB 1S8DA 3T4YA 5TPWL 2PO6D 1AQKL 1UB5A 2EE9A 4X99A 2V9TA 2IAMB 5I0ZA 2VQ1B 4QRUB 4X4ZA 3IJSA 3JUZA 2K1MA 3JSSA 2ZCHL 3KLDA 4I4WA 1E27B 3K7UA 5ETUA 1UKSA 3BP5A 5JHDD 1MPAL 1HKLH 3N9GL 3SHSA 2VN4A 3D85A 1JGDB 2FATH 1IAKB 5C07D 4O2FA 4S1SH 3MOAL 4XVSL 3RIFF 1PD6A 3BXNB 4M6ML 2IFGA 1I7UA 4FFZL 2DL9A 2EDFA 3GSUB 3I75A 3QYCA 1RHHA 5GQBA 2VXSL 3VXUD 3B3IB 1WEJH 2AK1H 2VQ1A 4QRUA 4BFIB 3ZDYE 1HXMA 2O5XH 4MMZC 5HPMB 3DRQB 2XTJE 1F90L 5DJCA 1R5VB 2OTUA 3EZ8A 3MC0A 1T5WB 3MV8D 5JPMA 3TA3D 3ULVF 3PWUB 3BRFA 4UT9H 2BVYA 2YPKB 3ILQC 2Y4SA 4M7LH 2YC1B 2ADFH 3QXAB 3WFDL 1QRKA 5I30H 5IOPB 4GBXA 3RWGA 3O4LB 3EYOB 1G7JB 1A02N 4OD1H 3V5HA 4HUUB 5FOBB 3ZE0E 1JPSL 2FGWH 5HGAA 2YMXH 1ZV5A 5ENWB 3HI5L 3Q48A 4XH2B 4Y88A 1K4DB 5D5MB 1RI8A 2D7TH 3GI8H 4MQXC 4PB0L 3F5WB 3GMRA 4G8EA 5IM7A 2VDQH 4H25B 5L0QC 4OLUH 1MLCB 3HG1D 2A77H 5EBWB 4MA7L 2OQJA 5HPOA 3KWWA 1U3HC 3CDGB 5CIPA 1MIEH 2ZSVA 1BD2A 2BHZA 4PJDE 1O7VA 2QQQA 3CH1A 5HGGS 4MA8L 3BW9B 3GIVA 1AD0B 3WXVH 3KPNB 4MDIA 4RGNB 1PYWA 5IK3B 1UB6B 5HVFB 4MXWL 3D39D 1VACB 4DEPB 1WSST 2DQJL 2C4FT 3RL2B 5BZDA 4R0LB 3R06A 2CKBB 3EO9L 5T3XH 1N4XH 4NN6B 1G1YA 4XZUB 4MQSB 3QP3A 4MXVF 4LVHB 3LPFA 3KPSB 1UG9A 4M48L 3JTTA 4JGUA 3QB7C 5C09A 4WI2A 4LDLB 1JHLL 4PJEF 1N3NA 1A6AA 1N7ML 2F19H 1ETZB 1LHZA 1BIHA 4OCRL 1YY9C 4IHOB 3P0VH 4P5TB 2PXYC 3E3QC 3CLFL 1WZKA 4HIXH 5AZ2H 1T2JA 1GIGH 1TZGL 4QRPE 3V5DA 1SEQL 1TVBA 3OR6A 2MHAB 4M5ZL 1E4XH 1PVHA 2OZ4L 5ESVB 4P9HC 4XCYB 3RNQA 4UTBH 5LBSH 3MA9H 4Q9RH 4HUVA 2APXA 4OGAD 4OF3A 2QHRL 5DEGB 4L3ED 3QJHA 1LNUA 3BPCB 3GIZL 1HCVA 4JREB 4RNRB 1LK2B 3HI1A 2VXTH 5JXED 4YPJA 4X6CB 4Y5XC 3LB6C 3BPCA 5ALBL 4EEEA 5IUSA 2C1PB 2X44D 1LILA 4HXAL 5IQ7L 1CDJA 5DEGA 3T0EC 5JNYA 3CC5B 3OKLB 3RHWK 4HWEH 2R2HA 3UC0L 4TVPE 3VWKD 1H3PL 3V4PL 3D25A 2GTZB 2CK2A 4Q7DA 3X11B 5C0IA 1JK8B 1WZ1H 1NGZB 3BE1H 4GO6B 4NT6A 4U2ZA 2JIXB 4JFED 3UJJL 5E8EA 4EUPH 1Q9LB 1RVFL 4QHNA 4PJCA 2CK0H 3HRZA 1YUHA 4JY5H 4X0KB 3D3VB 3GRWA 3QH3B 3ULUC 3CDFA 1MIMH 2BCKA 2HRPH 1T1WB 4K94C 3IAQA 3JTSA 3OKDB 2OR8A 3PHOA 1IAOA 3BZDA 3WE6A 2A0LC 4LAJH 1TQBB 4QF1B 4D0CB 3KGRA 1FAKT 3LHPL 4AZ8A 3V4PH 3VD7A 4NM8H 5IMLB 4ELKA 3K74B 4Z18A 1S7TA 4LOUD 2YD7A 1GH7A 4MQ7A 3LV3A 5GRVK 1NC4D 1SVZA 2D9QB 5E99H 1UJTA 1A9BA 2CGRL 2MMXA 3BUTA 3Q6FA 4OUUA 2NXZD 4N5ED 3C8KB 1Z3GH 1I4FB 3FONA 1R3JB 4GRMA 1WJ3A 5CILH 4MCYB 1MCSA 3TYFA 1MRDL 1KLGA 5SX4H 1KCVH 1PEZA 3U4EB 4EIGB 1P7KB 5DLMH 3ARBD 4OUOA 1AR2A 1E6JL 4Z7UA 3WKML 5T3ZH 1HSAB 32C2A 3PABB 3MCKA 4TNWF 1MVUA 3BESR 1UC6A 3VMNA 1FL6A 5KTEH 2FO4A 4F8QA 4X8JA 4S1DC 3U0PB 4M3JA 3KXFB 4R2GD 2F19L 1U58B 3A67L 3L3KB 3T4AB 3NTCL 5HDOA 4WFGD 3LDBC 1Y18A 3VXMB 4KKCD 4J4PD 3HS0B 4WI9A 3EKCA 1MREL 2YS4A 2IFFL 4YHLH 2FBJL 1FC1A 3B5GA 3EOBA 4AH2A 3O9WD 3MV9E 5MEQA 3GMMB 2BVTA 3DBXA 5JQ6L 4K71C 3G04B 5DJDA 3EYFA 1ZHNA 2A6JA 4JRYD 2GI7A 1OSZA 1P7HL 3KPRD 5D2LF 2YSSB 3RL1A 3UTZA 4G6JL 4NYLA 4TVPD 4U6XB 2NY1B 2VDRL 3B6SA 2W0FB 2XWJB 1RHHB 2HWZL 3MXVH 5TE7L 3RVWC 4MJIB 5MEND 5L88H 5J3HD 4HSQA 2N7BA 4ZO9A 3TO4D 2ID5A 2DWDA 4MHHI 4YDKH 1NAKL 3ZLQC 4F7CB 2ICEA 4DVBB 1NCAL 5D71L 3T0EA 3BP6B 2OTWB 1ZA3B 4O51B 1DE4A 12E8L 1PY9A 1NMAL 4YHPB 4XC3H 2ZKHL 5EZOL 2EE3A 4MDJA 4NC1C 5AZ2L 5ETUB 3SGDH 4JN2B 1CD1B 3DXAD 4JRYA 3O6MH 4TTDD 1TTUA 3P77A 3E2HB 1A6TB 4KI5F 4AL8H 1P9MC 3DROA 1F58H 1IFHL 1A6TA 3L5XH 3UTSA 4QRPB 2XG5A 4WW2A 3TN0C 7FABL 4WY7H 3O45B 5DD5L 3FRPG 3UTTB 3PWVA 2VISA 1MJUL 3WLBA 4OV6F 4C56B 4U1JB 2EC9T 4L8BA 4L3CB 4B0MM 5SWSA 5JORB 1KB5H 4LCIH 4JKKA 5DRNB 2BNQE 2CLRA 2VWEE 3GKZA 4NKMB 4ODSL 5DQDL 4ENED 1IC7L 3IDGA 3QA3A 4NFDA 4UDUB 5I1JH 4NQED 3G6JB 2W0FA 2XWJA 2RCSH 5DK2A 1H5BB 4OZ4B 5IW1A 4Q9BA 4S1SL 2C4FU 3QUMA 2IQ9H 2HKFH 4HCRH 4HT1L 4K71B 4OCLC 3UJJH 5IP4A 2D7TL 1F4YL 5E2VH 5C07B 3QPQD 1QLRA 1UXSB 1YMHB 3RVWD 1KF9B 2VC2H 3PHQB 1ORQA 1R3IH 1HH9A 5T33L 2GSIA 3ULVL 2VL4A 2VKWA 5HGDB 3OTTA 5C6PB 4N9OB 3I02A 4PJ5D 5BXFA 4DWHA 1HQRB 4L9LA 2H2SD 2E27L 5JOFA 5CD5D 3SO3B 5HHQA 4LCIL 2FX7L 3BAEH 3K8MA 3R1GH 2Y5TB 4C57C 2ZWLT 3HZKA 4U1HB 2DTML 4DAGH 2BNRE 3QIUD 3AB0C 1VPOH 3FQUB 1NAML 4GAGH 3BQUD 3GM8A 3SJVD 4KRPC 2CJUL 1QLFB 5BVJB 5C0AB 2GAZB 3L3GB 4Z7UB 1BZ7A 5IMKB 5D96B 5HYSG 4JFPA 1EGJA 4LSTL 2H2PC 1IC4H 2V6HA 2XWBB 3BN9D 2YPLA 2R0LL 3DURA 2W60A 4UIMA 2DLGA 2Z93A 4OZIB 3QNYB 4I3RL 2AJYL 4H20L 5DK2B 1MY7A 1JMXA 3C6LB 5J56B 1UADC 3V0VA 1OCWH 4PJEE 1HKLL 4M7KH 3LQZB 2ATKA 1EAPA 3GMPB 4KK9C 4I2XA 1MHEB 2Y6SD 1ZAGA 1OAYL 5F1KC 3M8OH 1MCNA 1YEDB 4NWUL 5ADPH 1EA9C 4LLQA 4KUCF 3TIDB 4XPTH 3SCMD 5F44A 5JHLL 1IL1B 1AE6L 1MAJA 4KRLB 5J12B 4MJIE 1O0VA 1C8PA 4UB0L 4YXKL 4OF6A 1K3ZA 1UZ8A 5C0AE 3HC0B 4PTTB 2J88L 2ITCA 2B5IB 3O3AA 4GRWB 3JZ7A 3DMMA 3SKOB 3F12B 3S36X 4NQVB 3VRLE 4WGVB 3CZFA 5DXWA 4D0BB 4Y1AB 3HPLA 4X6DA 1EJOL 4NO3B 1F4HA 4PJCB 4KRMB 2NY1D 3GBLA 2EH8L 3JWDH 5DUBA 5FCSH 4F7MB 3QDGA 1G7LB 4MGXA 4Y4KC 4X9IA 5E6YA 3PQYD 3D25B 4KROD 5A43C 2NY6D 4ODVL 4CAGA 4D9RE 2OYPA 3KJ6H 5KANI 4RFOL 5M7QA 2UZIL 3PF2A 5B38B 4YGVB 4JREC 5DJ8B 4QXGH 1AFVL 4OZHB 3PWNB 3CLFH 2N56A 2ARWA 2CR3A 2D3VA 3RUGE 4NZUL 4Q2ZA 3O3BB 2GT9B 4M1GL 1VFBA 1YYML 3FFCD 2X4RA 3QQ3A 4QGTA 2HFEB 3L3JA 2XOTA 4JFHD 3GMMA 5ITBH 4JY6B 4ZO7A 2O61A 1V3KA 2BVQB 4JQXA 3VE0B 2VAAA 4A6YH 2VE6A 5KOVC 5MENA 1SY6H 2OTPA 1DN0A 2NYYD 2O5XL 3LKRB 3GSXB 3RWFA 2JJUA 1I3RA 2EEAA 4NQDB 3LD8B 4V1DD 3GI9H 4MNQE 4PJGB 4PY8J 4YDJA 4TUKH 3O41B 3WNOA 2VLRA 2W9LA 3RKPA 2GK2A 4ISVB 3MRBA 1FDLL 3T0EE 4UOW0 3R0MA 2PR4H 1J0KA 4JPVH 3V5KA 4UMGA 1QG3A 2F74B 4QHKI 3P9LB 2J6EH 1ZT4A 3TZVC 4AT6A 3PL6D 2APFA 3WEXB 1DLFH 2W65A 2YOCA 4R0LC 2X4PA 4PUBH 1I3GH 3O8XD 2DQDH 4LLDB 4WU7B 1CE6A 5C0JB 2VL5A 1WWBX 1CCZA 4Q9QL 5EWIH 3TYFB 3FN0L 4OCSH 4DEPC 1BOGA 4POUB 4YLQT 4JDTL 1A1OB 4KQ3L 3WNKA 1FZOB 1FH5L 1M4KA 3EYSL 4B50A 5I1IL 5DRWA 4P3CL 2AJZB 3CSPA 3H3PH 4EXPX 1CFVL 2XY2A 5E9DB 2PTTA 5FV1L 3OKOA 1G0YR 3VW3H 5IB5B 4F2MB 1I8MA 3MRRB 3NIFF 3C5JB 4HXAH 5IQ7H 4MD5B 5F1SA 2WWKT 2E9JA 3VRLF 2XTJC 4P3CH 4NKIH 1KELL 5FUCC 1SYSA 3IU4L 3T77B 1T0MB 3TJHC 3DRTA 1E6OH 3MJ7A 4P4KD 3WIIH 4C83B 3HC4H 1JNHA 5DVNA 5EU4A 3WLWC 1OAXH 4YH6A 4I48B 3HNSL 3QO1A 3QEHB 4JAMB 3V4VL 4NCDA 1L7IL 1FN4B 1QSEA 1X5LA 2GJJA 1U41A 4XNUH 2P48B 4HK3J 1I9IH 2CSPA 3D1MC 3O4LA 3ZYIA 2FO1A 4JDVA 1A7OL 1AR1C 4KRNA 2VLMD 4TOYH 1CU4H 3HNSH 3EUUA 2Y23A 3T3PE 1Y6KR 4N9GB 2P7TB 5AYUH 3KPSE 1VADB 4Y4KB 4RAVA 1OM3L 5JPMB 1R5WB 1RZGA 4HFUL 4K94H 2C3XA 2IF7A 5I8EA 1MCKA 2YKLL 4OLXH 1CLYL 3WHXB 2J5LB 4UT7L 4F37F 2I60H 2JCCF 2APVA 3H9ZA 1VERA 5JIHA 4Q74A 2W9DL 2C7UA 4KJWC 3KPPA 5AUMA 1ZWIA 3E6FB 4NNPL 5GS0C 1QEWB 2YPLE 3FB7A 3CVHA 1LGVA 1ZOXA 1KACB 3I6GA 4M5YH 1A6VH 3DETC 3T1FA 5CWSA 1KJ2L 3DRTB 5DSCA 3IKCA 1AGCB 5FYJU 3SE3A 4M6NL 1JHKH 4YHNA 4OGAC 3KPSD 3WJJA 3QIUC 4GXVH 3H0TA 4AY0A 1JHTA 1IT9L 4G9FA 1XGUA 4QNPF 5GZOD 1CFQB 3PP4H 1MHCA 5I66B 4P5TA 4KZEH 5ADOL 3NFSH 1KJMB 3C6LC 1XR8B 3O4OC 4LU5L 4OAWB 5F6HJ 2P8LA 1AHWB 5IHBA 5J0BA 1AH1A 3EGSA 3W9DA 1HI6A 4JO1H 5C09B 2E7CA 3CMGA 1UEYA 4N8VB 5HVHB 4IIQB 4QRSA 3PP4L 4ETQB 1X4XA 3Q5TA 5F7MC 2PTUA 2PO6C 4KRPB 2BMKA 4R7NB 5JOPD 1HIMH 2BNQD 3LQMA 5FO8A 3STLB 3MACH 3PGCA 5B39B 1J0ZA 1JWMA 2MPAL 3CPLB 3RVVD 2I60L 3RX7A 3D85D 1VACA 3OR7A 4Z76A 5BJTB 3RWEB 5DI8A 2AGJL 3T0AA 3GMOA 4R3SA 2JELH 2LQRA 5J06A 3KDMB 2R2BA 5HHME 3MV01 1S7XA 4PJIA 4G6KL 1FO0L 2AI0H 4BZ2L 5CCKL 4HQQH 1PKQE 4GQ9H 15C8L 1BD2B 4UIKL 1DP0A 1MJ8H 4ZFGL 3L7EB 3TBYB 4Z7QF 2AK4A 4KVCH 2RBLA 2EDXA 3IDXH 4NN5C 3MUGA 43CAA 4LLYA 4RAUB 2VDPL 3NFPB 2D7OA 4NQEE 1RHFA 1YPZB 1L7IH 4NUJB 1I1FB 4Y1AE 4L4VA 3MRGA 4LSSH 2EDRA 4MA3B 4U0QB 3IS0X 5CFHA 3AREB 5FIEA 5EO1A 4RIRA 1RFDH 3CFEA 1MOEA 5FHBH 5KOMC 35C8H 4N90E 2NY2D 4RA3A 5H2BB 4C55A 4URTB 1CDYA 2R2EA 4P46B 4AEEA 1EH9A 2R0WL 1X5FA 4L4TD 4Z7WF 3ZDXE 5EBGA 4X7CC 4EI5A 1T5WA 4PTUA 5MEOB 1S3KH 2EH7L 2NY5C 5JXEC 1AQKH 5L2KA 4JFFA 2FYYA 3CMOL 2VLRE 3E6HB 3GBML 2P43B 4M62H 3QXDB 3SE9L 3F58H 1C5BH 1W8OA 4JLRA 3DUUA 5GGVY 3EW3B 3U6RB 2BERA 3KPRA 1T5XB 4QGYA 3R8BB 1V3MA 4P2RE 1ZK9A 4FQIH 3GO1H 1Y6MR 2HFFA 4ETQA 2XRAH 2R1WB 4FQXA 5HI3D 4WFGE 4I3RH 2VSDA 3P4MA 1WV7T 5C6TH 1VSCA 4PJDB 4OV5B 4YR6B 2AAVA 3L3HA 2PXYD 2VABB 4M61B 2J2ZA 4J12A 5E6IC 1PX4A 2BNRB 2AJUH 2XI9A 5DD6B 1OCWL 1MELA 1C7TA 4TTGA 1A3LH 4F7PA 4XNUL 1JZ5A 1CXIA 4F7EA 2CRZA 5C0CD 5HGHB 4M43L 2WIMA 3GMPA 3TBVA 1XGRB 4WEBL 3HN3A 1QRNB 3IXAA 4PV8B 4X4XA 3E8UH 3U7YL 1R3HA 2D4DA 4KROC 3EFDH 3WFEH 3AS1A 4XPGH 1NGWB 3WUZA 4JFQA 4AG4H 4OT1H 4S10A 3O11B 3RGHA 4V1DB 4MQTB 1E4WH 5ESQA 3K2UL 4HEPG 4JVUA 5TDOA 3GJEA 1QSEE 3R1GL 4CMHC 2HT4C 2I24N 4N8CL 2AEPL 4G8GD 3OJ2C 3LDBB 3OPZL 3IVKA 2D2OA 4JHAL 4PJFE 2OI9B 1R5WA 1RZGB 3WFHA 4I5BB 4HJJL 4P57A 5LQBH 2ATPB 3LOWA 4N9GA 2ITDA 1VESA 4KDTA 3ULSB 4IM8A 5GSRB 4QHUA 5INDA 5CUSL 3MZTA 2DQDL 2NTSP 4XPAL 4ZAKD 4QHMA 1DQJB 5EFIA 2B8OT 4JFFB 5T1KA 1T04A 3S34L 1JFQH 3ZKMC 3B83A 3S88L 4RRPG 5EOTB 1N8ZA 3UTPD 2Y36H 5FYJL 1MJUH 1S5HB 2YD6A 2F53D 1B0GB 4UQ2A 5DHVB 5BV7H 4DCQA 4Q6IB 4WWID 4KPHH 4JANA 4S0TD 1G0XA 3LH2H 3BP4A 1T21B 5DD1L 4XVJH 1WUNT 1CE1H 3ZO0A 2X1XR 3BDBA 1SY6L 2NPLX 2VUOA 2HTLC 1A0QH 2O5YH 5D7KE 4G9FE 4LCWD 4L3EE 1UA6H 4ZS6C 2AJZA 1NMAH 1ZA6A 3L3DA 1EBAA 2VISB 1KN2H 2VNCA 1BOGB 1A6WH 3BWAB 1BIIB 4QCIB 4ALAH 5ADPL 1FFOB 2EE2A 5F9AC 3WS6A 4HG4J 2OJEA 5CGMA 5BMFL 5J9PA 5MEPA 1CE6B 2BRRL 4P2OD 3VXPA 5E2JA 3FHAA 1PEWA 2ZNXA 3U30C 3HTLX 2GJ6B 5TH2B 1RUMH 1I9IL 1UKQA 3BIAX 3AU1A 1GGCL 1Z2KA 2VITB 5SWQB 3VWJB 1A64A 1NDGA 3DX6A 5AWNH 3ZKMD 3V5KB 3AAZA 5FV2A 5GS1A 1DDHB 5IQ9A 1EFXB 4YPGB 3OJDB 1OQXA 2FJHA 5GGQL 4EN3C 1ZA3A 4O51A 1KULA 4KFZC 3LKNA 4GG8A 5IR1B 1RUKH 5I74C 3QG6B 4PJIE 2XZQL 4Y5XB 4UU9A 5F8QC 1UYWL 3IS1X 4GG6B 1IEHA 4G80A 3QFDB 3K1DA 4MAUL 3MRKA 3MGOB 2VQTA 3HE6D 1A1MB 4XPBH 1J0HA 1CL7H 3QIUB 2IMNA 4OD2B 3LRGA 3MRNA 2XZCL 1BJMA 4JE4B 3ARXA 1NUFA 4JQXC 2IFFH 2H1PL 5GGTL 1AC0A 3K4ZA 2DD8H 3KR3L 4NRZB 2NCMA 2WIIA 5L7XH 3GZKA 1FNEB 3WO3B 5KBNC 1OVZA 1W72H 1OGTA 1U42A 3UJTH 4RWYH 3PG2A 4OF5A 1ROWA 1AY1L 1P4BH 2CUHA 4FRWA 1BOYA 1H8NA 2XACC 1TQCC 1J1OL 1XR9A 1ORSA 4RGMB 3QHZL 4J3OC 1JPSH 2NXZB 3S9DB 3VGAC 2MKLC 3WIHA 5L2KE 3DX6B 4LCUA 4YXHH 1NMBL 1UCBH 1WCBA 5IIEB 4OLZH 2EKJA 4NO3A 1Q9OB 4U6VH 3W82A 1JPGA 3NCEB 2J8OA 4L29B 3UMTA 3V2AR 4ZTOL 3WO4C 1I8IA 2A1WH 2NY5L 4NRYB 4BZ1H 5HYSA 1XF3A 3U7WH 3HRPA 1WTGT 2V5YA 4JCMA 3O6ML 3I85A 1DFBH 1EFXD 1J1OH 1UWXH 3AGVA 1BM3H 3GM0A 4NQCA 2ERJB 4NZRL 4O2CB 3HZYA 4L8DB 5E4EC 1T0NB 1HZHH 1JPFA 4ODXA 5DK0B 1YN6B 2DDQL 5EU4B 1YEDA 3MRQA 2J7LA 1FBIL 4POYA 4Y19A 1B4RA 4M7ZB 5CKGA 5K9KA 3TH2T 1EAPB 5IMLA 5L2JA 3HLAB 4H1LA 3OJVC 4PRNA 1GGBL 5L0QB 3QFJE 5KSVB 2R1XA 4ODBD 5L2JB 1KEMH 2AABH 3K4AA 2LVEA 5CSZB 2IANA 3ARBB 5DD0L 1QKZH 1YN6A 5CAYB 5L7XL 4PR5A 3U9UB 3ZTNL 2C3VA 1T7WA 3SO5A 1U8LA 1MJ7L 2GAZA 3MBEB 3ZTJG 1LEKB 1IGYA 1RZ8A 1T3FA 1WCBB 4NPYB 4BUGA 4F3FB 5B3JE 1F6LL 1UM4H 1FIGL 4YBHA 2PYFB 1KTLB 1I8IB 3KLHC 3FFDA 1B2WL 3QEQA 5JUEL 1A7NL 3VGAB 4WW1B 3NTCH 5JOFB 1JPGB 1MH5A 4UNVA 1ZT4B 5DMYA 4FTVD 4JZOA 3LD8C 4QLRA 4GMSL 1JNLL 2BX5A 2NXZC 4ONHA 2MTPA 3BT2L 2R4SL 2GSIB 4I8DA 1R6VA 1TQCB 2EDKA 1FNEA 1D5XB 5E7FA 1YEJL 4DUXA 3MR9B 1N0XL 1IGJA 3VXSD 5J7CC 3RVXC 2XA8H 4HJJH 3GKWH 3GI8L 3OG4B 3FQWB 3VGBA 1MCHA 2YEZA 4Z7VE 1JF5A 1Q0YH 2NW2A 2XT1B 2VB5A 4X80H 5MENB 4CVWA 2Y25A 4PV8A 1D7FA 3PV6B 3P4LA 4PJFF 3IKKA 4X4ME 3WHE0 5JPNB 1PG7L 2XY1A 4DVRL 4KKLC 3FTGA 1LEGA 2E8YA 4KHTL 4F7PB 5E2TH 4U3HA 1VEOA 1FLTX 3C6LD 5A3ID 5I74B 5KSBF 3L7FA 2ESVA 2ZNWA 4MXWH 4LQFL 4U1JA 2RJMA 3DVGB 3WIFA 4KKAC 3JWDC 1JI1A 5KANG 1IGCH 2Z31C 3D3VE 1FFNA 4N0FB 3O2DL 2X4UA 4UAOC 3VWJC 4Y2OA 4F33B 3NGBB 6FABL 3WN5C 3QEQB 5FYKE 2OK0L 4F58L 3HKFA 4PV9A 3U30B 3DV4B 5IHUL 1M6OB 4QRPD 4MD0B 5GIRB 3DUUB 5FO9B 2CIKA 3DTXA 3CXHK 3IFLL 4OI9A 2WMPA 1MI5E 3CDCA 4KK9D 4MZ3A 4JO3H 3RDTA 1E4KC 5TJWK 1TZIB 3SE8H 1FAIL 2JJSC 4XVTL 3BWAA 1KB9K 4HWEL 2SEBA 1CD0A 2RIKA 4OJFL 2MQ0A 2IJ0C 4WWKA 1T21A 1FLRL 3CFJA 3DWTA 1I3VA 3S5LB 2NXYB 4FXLA 1BM3L 1N59A 1XF5A 1FPTL 3U7YH 1EEZA 5D5ME 4AM0A 5GGQH 4OZFH 1ERNA 4Q6IC 4S2SB 4KMTL 5FYKL 3UXFA 1BVLA 5EU3B 1SY6A 3B2UC 4NFBA 2X4QA 3IJHA 4IRSA 2PKDA 3X12A 4DJMA 4NN7B 3PP3H 2WUBH 2JJTC 1F58L 1R3KA 1S5HA 5GS0H 3BRDA 3NBNA 4HXBH 4LSSL 2J8HA 3FZUC 3IJYA 4IOIB 3EHBC 4X6DF 5FM5M 2G9HB 1NPUA 4FZ8L 1F2QA 5C0RH 3ZT7A 1YEHL 2WINB 5I17A 1PQZA 1GHFL 5FA3B 2V2TB 1I9RL 4I13B 2BRRH 1FP5A 1IAIH 5MHSE 2ZCHH 1KLUA 3O3UN 1A6PA 3BGFC 4P59L 3UPRB 4WRLA 4WV1A 4XGZA 2FWOB 3MRLB 1T7YA 5E08H 5F9JA 1AO7B 3FO9B 5IG7A 3QXUA 1X5IA 3MXVL 1KLGB 2VZOA 4CMHB 1LEIA 1Q8MA 4OI7A 1U91A 4L4TB 1GVIA 1OAUH 1X5XA 3TT3L 1I8LA 4QRRA 3IRZA 1QRNA 3L5IA 5ICZA 1SBSL 4DGVL 1U8KA 4R4FH 1DQDL 4W81A 1IKFH 3TA3B 3MXWL 2X9WA 4OQTH 1NGWA 4GKOA 1BGXL 1LO3L 3KYOA 5C08B 2AQ1A 1YDPB 5CD5C 2OR9L 3HAEG 1K4CA 3IFOA 2VLJD 2EZ0D 4R4NC 4X99B 4K23H 4GW1A 1S8DB 4Y19E 1F6AB 4JQIL 1AQDA 1AXTH 3W0WA 3TV3L 1ZLSL 5IROA 4HF5H 2D7NA 5E94B 4NKQB 5E95B 5C0NC 3FB7B 3ROLA 2X70A 2CLRB 2OMBA 3TA3C 2HFFB 4GG8B 5IR1A 2IANE 1AC6A 2DM4A 1OW0A 3TN0B 3S35H 2D7MA 3EOTH 2OSLB 4LLWB 4GAFB 4X7DC 4NWTL 5D6CB 5IVXB 4PGEB 3VWJD 4XNYH 1OAQL 2WINA 3RWCB 2Y72A 5KVDH 3M1BA 4XPGL 1JF1B 2AKRA 2Z91A 3KYMB 1HYRC 3L1OH 2H9GB 4KDTC 4LSQH 5HDLA 3THML 1BBDH 2OJEB 3SDDD 1PZUB 2PW1B 3IETA 2VSCA 1BIIA 1F97A 5JNYB 1ZGLB 4JLRB 2NY4C 4S1QH 4KUCD 3D18A 3QUXB 1K5NB 2X09A 3KYAA 5KVDL 4K9EH 5IWLA 1LE5A 4KPHL 1S9XA 3EJZC 4HMDA 5INCA 3ZKXC 3TO2B 4UT6L 2NY1C 1NANI 4G6AC 3OKKB 3LEVH 4NUJA 1UCTA 4NN7C 3AREC 4K3JH 1FRGL 4JG1L 1ZKAA 3VMOA 5EB9A 1FV1B 4ODHL 1CXHA 4AMKH 4HGWB 3RJQB 4HS8L 4ZSOE 2P5WE 4X4MA 5EOTA 4K23L 4NN5B 1MFAH 4EQ2A 1MFBL 2E7LA 3MUJA 5CKAA 2BNUA 5I0DA 4NFCA 1MAMH 2QADD 1FL3A 3L7EA 3TBYA 4CNIA 1BEYH 2UUDH 2BXYA 2KKQA 4UINL 4CJ0A 2UVEA 1FE8H 3G5YB 3SKMA 3QUYD 1NGXB 4OFYD 3BD5A 3C08L 1KNOB 3KYMA 4ZUTB 4F33A 1J5OL 1JPTL 3T3ME 4LSUL 1UWEL 2EH7H 1WBZB 2N4IA 3M45A 5AYUL 1A7RH 4IDJL 1XCTA 5HVHC 4NBZB 4OIBA 4PGZA 4RMVA 4P3WA 2W0LA 3O0RL 4U3CA 5DJXA 3IGAA 3QQ4A 2OMNA 3VD3A 1OL0A 4EVNB 3FCTA 3ROLB 2IBGA 1J7VR 5CZKA 1R3HB 1E4XL 1Z5LB 5AZEL 1S5IH 2ZJSH 3DX9A 2CRMA 4OZIE 2VE6B 5C6TL 1SYVB 3P0VL 4PS4H 3V8CA 2VOTA 1RIHL 3L3JB 4N68A 4JY4B 4OFIA 5I1AA 2F5BL 3TVMD 5K9OB 5C3LD 3NA9L 4LLUA 2R0ZH 4J6RL 5FGRA 3X13B 3INUH 1CLCA 4OTXL 4H0HB 1GRWA 1UENA 4MHHG 2NY4D 1NLDH 1BEYL 3VFGL 4HKJA 3L3IB 1MFDL 5T1MB 2J5LC 3IAPA 3SBWA 1E28A 1RQ5A 1FJ1B 4WW1A 5JHDB 4Z7VF 43C9B 3NABH 1DBML 5IEKB 3BKYL 3MREB 5SV4A 2VN7A 4DKEH 25C8L 4H8WH 3TFKD 3RNKA 3PL6A 1B4JL 1NFKA 5FKPA 3E6HA 4PJ9B 3FHQA 5B4MC 5TE6H 1RZ8B 1T3FB 1LEKA 4GBXC 2YRPA 2GTZA 5DRXA 4KZDL 3CZFB 4OZFA 3CD4A 4QWWD 4H8WL 5GGSY 5ALCH 3ARDD 4OCYH 3DUSA 1MHHB 5K9QI 2FD6L 2HP4A 1FVCA 2YD5A 3OXRA 1KT2A 3HR6A 1FZMA 3VFRB 3ZZ1A 3ZDZE 1TTGA 3IU3B 4L5FL 4G7VL 3WSQL 4Z7WB 2XTJB 4KKBD 2O93L 3ZE2F 1LD9B 1BQLL 3GHEH 5EU7E 1NH6A 3BH9A 3HFMH 3U82B 3UTQA 2DICA 3CSGA 1NKOA 5D1XD 3RKDC 1D9KD 5IBLD 4XCYA 4KHTH 4P5TC 3S8WA 3LN9A 1SYSB 3T77A 4UB0H 4N0RA 4U7SA 3CFJB 3GNML 3KPOA 3TBSB 1Z9LA 2FHCA 4J3XA 1KIPA 4S1QL 4YDIL 3W0WE 2QJDA 5TDPA 4F2MA 4BZYA 5C0DB 3VFSA 1DQTA 5CJOH 2BOBB 2IPUK 4YFDB 4G8IB 4UT7H 4XC1L 5HDBF 4PJHF 2FX8L 1BFSA 2E6PA 1QFWL 3NH7H 1LO0H 1UM6L 3LIZH 3SDCD 1VGKA 3ZE2E 5C8JB 1F00I 4LRIC 1PX3A 4YZFE 5ILTL 3JWOC 3WCYA 4EUPA 2FGZA 4N5UA 3WIHL 4N0UA 3QG7H 3BISA 4PRHD 4YDVB 4C54A 2UWEB 4MD0A 5GIRA 3BT2H 1U3HD 3ZKNC 4RISH 3TZVB 4MCZB 4CADA 3B8SA 5AZEH 3WEXA 3FO0H 5BXFB 5CGYC 1EZVY 5IB4A 4M1CC 4CW1B 4LEXL 4GXVL 2BFVH 3QJFB 1KCSH 3HE6C 4FMKA 3DVNB 3VD9A 1IEAB 3V4VH 4O00A 1U8NB 1U92A 5CLTA 3OGOE 4X98A 1Q94B 3A6CL 3VE0A 5F7YC 5CZXC 4QRTA 3EZJB 5GGTA 2HFEA 3BZ4A 1FORH 1U95A 3T3PF 4XP5L 2DQEH 2GJZB 4NKOB 3RWFB 1DQDH 4MNHB 3T0WA 1BLNA 4OJFH 3Q6GL 2RQ8A 1H5BA 3BDYH 4NWUH 5HI5D 4HIIA 3VD4A 4H25A 3G6DH 1ZVSB 1T7ZA 3QWOB 3IDGB 3QA3B 1J8KA 2BFVL 5BOPA 4UU9B 1H3XA 1OWWA 3E6FA 4ZTPH 1YYLL 5ID1B 3LSOA 4PP1D 3OF6A 3U79A 2YA0A 1C08B 3PUCA 4KRPD 2NY7L 4G8FB 4KJQD 1ZS8A 4X6EA 2ZG3A 2YXMA 2IC2A 4HUUA 5K9JL 1S78C 2PR4L 4L8BB 3E0GA 4GKZB 1E6JH 3VFPB 2NR6C 4KI5D 4GBXB 3AMLA 1KGCD 2ORBH 4ODHH 3NN8B 3U46B 3OHXA 3ARUA 4FFVC 2LABA 5IESL 5JMRA 5J9PB 2DTMH 4DAGL 2WAHA 1RUQH 4YIQA 3U1SL 5CCKH 3OGCB 1KN4H 5CMAB 3THMH 3VGEA 1QFWM 1NC2D 1T2QH 3X3GH 4UNTA 1NMBH 1RZKH 2B0SL 3WUWG 4POZD 5C3TA 3H2WA 3RBGA 4ODUA 1J0YA 1YNKL 4PR5B 2ICWB 1R24B 4K7PX 4F7CA 5C0BE 1KGCE 1TJHH 4EDWH 5CHNB 3ES6A 3TT1L 4XC3L 1BQUA 1AQDB 3SY0B 4RZCB 4NUGH 4E9LA 2EDOA 4UOW1 3BP5B 1G7IA 3F7VA 5HHXL 4FQCH 4OZIA 1WC7B 1Z9SA 3VH8G 3EDKA 3TJEL 1C5DB 2EDYA 5D7IF 1EO7A 5A2LH 3C2AH 3I6LD 1A9EA 1MHEA 4O2CA 3TESA 3VXTA 5C0AA 4PP1C 1T04B 5D96C 4ESKA 4A2MA 1BBJB 3RDTD 1SJEB 4HLJA 3QI9D 4M6NH 2IWGA 4X6DE 3TP4A 1I85C 3TT3H 8FABB 2QSTA 3V6OE 4QTIH 3TH4T 1KENH 3AB0B 3DX7B 1IFHH 1CFSA 3U4BL 3IVKB 1CDBA 5ACLA 2W0PA 3L6FB 1EAJA 2P4AB 3U9PL 3VFGH 4WV1C 3BOVA 1CFSB 3HMWH 3VMPA 4LQFH 3T8XB 5JW5A 3HZKB 2R9HC 32C2B 5H94B 2OI9C 3H9HA 4LF3A 2J88H 4MAYB 3ZMRA 1OTUC 4G6MH 4U2YA 2WWMC 1CLYH 5CEYB 3H42L 2VZSA 1MFCH 4WUUA 4HWZA 4HK3N 1I1AC 2IH3A 1TENA 4DZ8B 3O3DB 2XIDA 1XGQA 3VFNB 2XV6B 1D6EB 1AIFB 3HZMA 3LKOA 4OBRA 5IB1A 5DVLA 2DQUH 2BVQA 5FA4B 1H5BC 4LSTH 2R2CA 4LRNH 5EU6B 1MCIA 4KROB 4YHOL 3PWPD 3PDGA 2HJLA 4HPYH 2XA8L 4MQ7B 3W0WD 4H1LG 1WC7A 4M1DH 1F11B 1N59B 1MY5A 1NBZB 3IFPA 3PWPA 4OZ4A 5ELIA 1HDMA 2Q3ZA 1S7WB 5FYKD 2VABA 3BKJL 3PWNA 3L3HB 3PJSB 3G5XB 3CNKA 5I8KH 4N1CA 2Q7YA 4MNQA 4GW5A 3D87B 4ZDHB 4YBLC 4FA8A 3B9DA 2B20A 5FO7B 3S36L 5IKCA 3KPRB 4WJ5B 3QH3A 4CN6A 5EOCJ 3IFNH 2NZIA 3DTXB 3CFDB 3E2HC 4PJBF 3VWKC 4HZAA 4MX7A 2JIXA 1J8HB 2F58L 5KS9B 3S3SA 5FO7A 7CGTA 3TJHD 2HRPL 5KTEL 1MCBA 3F12A 3BN3B 1FFOA 2IPKB 2PF6A 1N6QH 3NN8A 3BHBA 4X7TB 5CEZL 4D0DB 4YBLB 3WFBL 5EOQH 3OPZH 3KXFD 1GGIH 1UXWA 4H20H 4K3JL 4OCNC 1D5BA 3BEVB 1YJDL 1FC2D 3SPVB 5A16A 1BJ1J 2IGFH 5CD3A 4HHAB 4YX2H 2E7MA 1GC1C 1UVQB 3OX8A 4JPVL 3KS0H 4TTDC 3MGTA 2WUCH 1DL7L 3MRGB 4MA3A 4QYOA 1G6RL 5L9DH 5I30L 1REIA 4O5LH 3UBXG 2NLJB 3P11L 4X5LA 3NACL 5EC1B 1ZVSA 2M8XA 3MRMB 4BH8A 2AXGA 5JW4Q 4UQ3A 4PP2B 4KK8D 5LGKA 1BLNB 3S37X 3U7WL 2DJSA 5LWYH 4POZC 1OSZB 1XF4B 3UAJC 4HK0A 4I3GA 2OLDA 4A6YL 1LQSR 5D6DC 5LXGH 1U6AL 1RUPL 5C0ND 5GRYA 5T1KB 3U0PA 4QHMB 4J3SA 3P30L 3L6FA 5CEZH 4X7SL 5GSRA 1CIUA 5LVEA 3KPSA 1X5HA 1IAIM 4U3XA 4UDTB 1K8IA 3BPNB 4XMLH 4DTGL 4NQSA 2H3NA 4ZTPL 3JV4B 1QOKA 5EULV 5HI4D 1A22B 4QY8A 3BKCH 1WBYA 5FGBA 3N1GC 4JY5L 3MCKB 1GCFA 2WWMD 4MAYD 4MAUH 3KR3H 5DMKB 4GG6F 4IIQC 1NBYA 5C2BL 3TO4B 4JHZA 4U1NA 3H3BC 2LVCA 1WT5C 1KPUA 1NDMA 1S7VA 2XZCH 1FFPA 1JRHL 5I1DA 3OWEA 4K8RL 2ICES 1UGNA 4U1IA 2RFXB 3T65B 3SJVB 1MLCA 1A9BB 1YEGL 4U1SA 5EA0L 1I9JH 4V2CB 3RWIA 3QHFH 3F5WA 1T89C 3EHBD 2DMKA 1RK1A 5KVFH 4ODXB 1P84J 4TSCL 4KH2A 3BD4A 3CFCL 1RZJL 1TQBC 4BA8A 5L8LB 2AK4D 2J12B 5E8OA 3VFOA 5CBAB 1L7TH 3MLRL 4P48A 3QXAA 1D3CA 5B8CA 5C70A 3MRPA 3DO7B 2BY2A 4W6YB 3GHBH 3DETD 1UFUA 3REVA 2HT4D 1NCDL 1T80A 4JN2A 2WP3T 2A1WL 2NY5H 3QZWB 1RJLB 1I8KB 4BK4A 3MRFB 2CGRH 2GJ6E 1A4JA 5J1AA 5HY9B 2A9MH 2A0LD 3ZHKA 1HN1A 2G2RB 1II4E 5L2KB 2R4RL 5DURB 1IZKA 1GZPB 1CVRA 3T0EB 4G8FA 43C9A 1LE9A 3SGKA 5FYJH 5JZ7D 3OKLA 2C3HA 1CFTA 4U1MA 3QRGL 2AK4E 3IDJA 4HIHA 1T1ZA 4JGMA 4WUKH 3U4BH 2RAMA 4P9ML 2EXYD 5EZJB 2OZ4A 5JOEA 3ZE0F 5J6HB 2VIRA 4UV7H 4XVUD 4EZMA 1RJLA 1F5WA 4JRXE 1KJVA 4L8CB 1CXFA 4P9HH 3QCTL 1X6LA 1GOFA 4HH8A 4PRHA 3MLTB 4L8SB 3GGWA 1Q0XH 5HHXH 2PXYB 4PB0H 1SYVA 5LG1A 4GKSA 4PJ7B 3SGJA 2Y7QB 5E8OB 2YMXL 5E2WL 3RZCD 2F8OA 2EEDA 1MIML 4Q0XL 3VJ6A 3HE6B 3MNVB 5IHUH 3TZVA 5GZNC 3RI5F 4JFFE 2ZG2A 4LVHC 5JIKA 4JHAH 4R0LA 5DEFB 1HINH 2XXMB 5DD3H 2YRZA 1KN4L 2VITA 1YMMB 3KNBB 5F88B 1HWHB 3JTTB 4LHJB 1TVDA 4ELMB 3INUL 4OTXH 4HS3A 1J1PL 3BKJH 3P4OA 2BMKB 3FO2B 3GIVB 3MBEC 2OS7A 3SKNB 3G5YA 1S7VB 4LPVA 4Z0BH 5IFJB 3B9VA 5IT2H 2ZOKA 4IIQA 4QRSB 5FYJD 4ZFZB 1RAMA 2K7QA 1GIGL 3ARBC 3EGSB 5GISH 3LRHA 2XG4A 4GSDL 4M7LT 3BGMB 9CGTA 4LEOA 1UB6A 2UY7A 1AGEB 1FQ9C 2AK1L 1PSKL 1V7NL 3RX5A 4RSVA 5ILTH 4OCRH 4PRPB 1H3UA 1CFNA 4C4KO 2EIBA 1ZXQA 1XGUB 2ORBL 4H8WC 4PGBB 2ZSVB 4FFZH 1FV1A 2HRLA 2V7HB 2GW5A 4DKAA 1FZMB 5E4IA 3DOSA 5DHVA 1BQSA 2X4TA 5FUOL 4RQQB 1IQWH 2XRAL 3VRIB 3ZSSA 5HDBE 2WZPD 4FQLH 4WTZG 3ECBB 2JJVA 4WFED 2DLEA 4LPYA 3A6CH 1PLGL 3KXFE 4RMSA 5CP3A 2LAGB 3L5JA 4RMRA 1OSPL 4F37K 1K6QL 3MRDA 1U8HA 5HY9A 3WD5L 1FYHB 3D9AH 1BFOA 4PJFA 4NT6B 4PJ9C 4P2RB 5GGRY 2YC1A 4BH8B 4M6OH 4E41B 5DMIH 1OTSC 3LKQA 4JFDB 2VLKD 1RZJC 5JDSA 3UO1H 3CFBB 4QYOB 1K2DA 2Z4QA 1QFOA 5AAMA 4U6YB 1OP5H 3D39B 4D3CL 3WXVL 2F8VA 3I50H 1DLFL 5JXAH 4KZEL 3S34H 1LO0L 1SJXA 5IVZB 5ESQB 1TZHB 2XYCA 4X4YA 4WW2F 5I19L 2DQUL 2DI7A 5HYJA 4EI6B 3QO1B 2I26N 1Q1JH 3BEWB 4PG2A 3OG6B 3PNWA 2VDQL 2Q20A 5F7DA 3F7YA 2ATKB 1KTDB 4P23D 5BO1H 1WLHA 1KTKE 3DX9B 2XQBH 4G7YL 4P23A 1M7XA 4JFEE 4X83A 1G7PB 2HTKD 3QUZB 5D1XC 4YFLI 5IKCB 2YUXA 1WFOA 5TFSH 4ZYKA 1SVCP 5HHOB 2FR4B 1ZHBB 4EIZC 4GW5B 1NLBL 3MYJB 4ZNEA 4I77L 2MKWA 1F3DH 5F9DC 3NMEA 5DT1H 1NEZA 3K0WA 1GGYA 2BY3A 4PJ9D 4S11A 1QPXA 4P5MA 1KLUB 4QXTB 4FQIL 1AY1H 4GFTB 4PFEA 5EOCL 4F9PC 1F3RB 2B1HH 3NABL 3QDGE 5LQBL 1FL5B 1QLEH 2IMMA 4FNLL 2FCBA 2W91A 4NNPH 3FB8B 3EO1B 3LMJL 2EEBA 3OZ9H 3MXWH 5ISZB 2EECA 1Q72H 1TVHA 1TETH 1INDL 1CXEA 3QRFM 3ARFC 1HHJA 1FVEB 3FQNB 2NX5B 4P46D 4NJAL 3T0DA 1FNSL 2O61B 1D9KB 1T83C 3FO2A 1KB5B 5FK9A 3RGVB 5E24E 1R0AL 3RWHB 5AG8A 2IPTL 1K4DA 4Z6AT 3TO2A 3C8HA 4PRHE 3SDDC 4KV5F 3UCRA 4J4PC 4OBSA 1RY7B 1T1YA 4ZS7H 5FYKU 3ZKXB 4Q9QH 2X4NA 1DBAL 4BYHA 4RFEB 3UAJD 2YKLH 3QIWB 4OLXL 4LP5A 4NQCD 3D18B 4RDQG 3MV11 3SDCB 2OM5A 3UEZA 1K8DA 3QUXC 5BRZB 4HPYL 4JO4L 4YNYA 4WW2B 1OM3H 4NP4H 1I75A 4DOHE 2C9AA 3FB5B 2BVEA 4KMLB 4YHKL 4LSDA 3HCVA 4HW6A 4HIXL 5H35A 4DKDC 3BO8B 3SGDI 4OZIF 3QWRA 5C9JB 2HJFB 5I8OL 5ECJE 4CKVX 2X9YA 1ES0A 4RZCA 1A1NA 4G9FD 2JELL 4PD4J 4RGNE 2V2WA 1KTDA 2X05A 3WV0A 2FX8H 2P46B 5CHNA 2NX5E 2VXQL 3QIWD 2LFGA 1I7UB 4PJAF 1G6RA 3SDAA 5E6IA 2ICWA 3HC4L 4NQCE 3A6BL 1E6OL 1QBMH 1FFNB 4XRCA 4KI5E 5E94A 1FVDA 3EO9H 4E5XB 1KENL 4FNLH 1VFAB 3O4LD 3PDOA 4MVBC 4U6XA 1U8OB 3P2TA 4PJ8A 3V6OC 4U6YA 4YIQB 5J8OA 3CX5K 4G9FB 1KUMA 4Y5VA 1L4IA 5EU6A 4Z0XA 1S7SB 1J11A 2N1KA 5D2NB 3WKNA 5T1DH 5KSBA 4KGJA 4HZLA 5A1AA 4QRRB 2VDNH 2MQCA 1CLZL 3HZMB 5CWSB 3TYGH 3T1FB 5JIPA 5JZ7C 4ZOBA 5E8PB 2P5EA 1KIRA 3W39B 2JE8A 4OCXL 1NEZG 4H88L 1H0DB 1ZWIB 2QBWA 3KPPB 5AUMB 1C08A 5HHOD 4JFOA 3UPRA 4OGYL 5H94A 1SMAA 3GMNB 3KXFA 2FZ3A 2VZ3A 3BGFB 4UIKH 5FA3A 2V2TA 3C60A 1H15B 4FFYH 3QEQE 4QKXB 1MRCH 4LLMA 4OF0A 1JUFB 3FFDB 4NNYB 4Y4FB 4Z7OF 2Q76A 1XCQB 5D8JH 4FQLL 3BZ4B 3VA2C 5F3HB