3S36H

Structural basis for the function of two anti-vegf receptor antibodies
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
214
Chain Sequence
VQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVTDAFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1121B light chain
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system/transferase
total genus 39
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s36H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s36H01
4DKEH 5E00B 4ONGH 1I8MB 4QHUB 2A0LD 3FQXA 1L7IL 2JJWA 3VJ6B 4M6AA 4LVNC 3QRFM 2ITDA 3IXAA 4NQDE 3A67H 3OKDB 1DBBL 3O9WB 5F6IB 4MA1C 2HKFL 2Y7QB 4K94C 5DEFB 3V9FA 1RZJL 3JWNC 3O6KH 1O0VA 3BIAX 4FZ8L 3KDMB 2DLFH 3Q1SL 3E6HA 4ODWB 2QR0B 5B8CA 1BLNB 3L3KA 3QWRA 4RRPG 5KSAD 5E24E 4J4PC 4M1CD 3D85B 3LKNB 1OB1B 3DMMB 5I16A 1EX0A 3L9RB 3UTSB 1J1XH 3KLSA 3KXFA 4AIZB 3MNZB 2CRYA 3MROA 4LIQH 3RTQA 1QZ1A 3RU8H 5MEQB 3SDDD 1BREA 3KNBB 1EZVY 5CEZH 1FFOB 5F97E 4NKIH 4M5ZL 2X09A 3EFDL 3MUGB 4H25B 4U1SA 2CMRH 4GW4A 4X9IA 3UJJH 2E7HA 5IEHA 3BRFA 3O41A 5C0AE 2F53E 1G7LA 4OBRA 3V0AC 4LARH 4ETQA 3BZEA 5C6TL 1N5AB 2Q87A 5FCUH 1S9YA 3H7BA 1T2QH 4XCFL 3ZTNL 3GRWL 4FXKB 3SKMA 2PYFB 2I9LB 3V7AE 3LPGA 1U92B 3HFMH 3QJFA 4IMLB 2NX5A 4XPBL 1DLFH 1P4LA 3NZ8A 2R0KH 4F57L 1R5VB 5MEOA 1QFWL 4HKJB 5GZOC 4WFEE 3QIWB 2FJFA 1KPUB 1AR1C 4PJEA 4BZYA 5BZDA 2IC2A 4NGHH 3D85D 4UIMB 3U82B 3T2NL 2X9WA 3IDYC 4BSVA 3WS6C 5GGSA 5C0BB 4MX7A 3PWJA 1XF3B 3G5YA 1KEML 4Z7NE 1IM3A 4DCQA 2CUMA 4NRXA 5CP3A 1N4XH 1OAYL 2EYSB 5TE6L 2BHUA 1IM9D 4OB5L 2GAZA 1KLGB 4ZSOE 5JNYA 4LNRB 2BVPB 4HD9A 4WUKH 4PGEB 1X5HA 3B6SA 5MENE 3KPRE 1KJMA 3QUYA 1UB6A 1FSKB 3HI1B 4GKNA 3VFOB 3RPIB 1MFBL 5IBTH 5L0QC 4Q9BA 3ZE0F 2WWKT 4G43B 2IAMC 5J11C 1FO0B 2EDNA 3LZFH 3A6CH 4N1EA 4PJHE 2F5AH 3RIFF 4QRQB 35C8L 5F7YC 5LWYH 2PYEA 3DTXA 4NIKB 4MQ7A 3GIZH 2Z35B 5E9DE 5HYEA 1F3JB 1J8HE 4QRSB 2RHEA 3ESUF 3SBWA 2K7QA 3CVHH 3LRSB 4WW2B 3MRRA 3RWIA 3OR6A 5E5UB 1FYTB 4YC2C 3SDYL 5FKPB 1S9XB 4Z78B 3C8DA 4KKCD 4O02H 1H5BB 2OP4L 3TNMA 4LCYB 3BEWA 4FABH 5D2NE 5CP7A 1Q9KA 5IB3A 3L3HA 2EDJA 3KYAA 3CFEB 2ADJA 2IANB 5EU3B 3IDGB 3QSKB 4Y2DC 5DA0B 1NL0L 1ZLWH 4P23C 4I3RL 3VGDA 1MCJA 4ZUTA 1QG3A 2W60A 2F54D 2WP3O 2XNAB 3NFNB 1U93A 4NQDB 4YHPB 1G7MB 1MCKA 1JWSA 1JWMA 2EIBA 5D96B 1YDPB 1VACB 4K8RC 3GMNA 1P4IH 1Z9MA 2X4RA 2VXTH 1I1YB 5FYJH 4XH2A 3MRHB 5MERA 1OCWL 1IL1B 4WTZA 5HHVH 2AP2A 1CICC 2FIKA 3U7WL 5C0IA 1KIPA 3ECBB 2AVGA 2GITA 3C2AH 1AGCB 2FX7L 4J3WA 4EKXA 1QBMH 1BJ1H 5I17B 3H8NA 3T4AA 3T4YB 2RAMA 3FQRA 2AXGB 2H9GA 4TRPH 5IBUB 2B4CH 3SDAB 1QEWA 1FH5H 1VADB 4UT9H 4XB8A 3T2OA 3AXLB 3SKNA 3WLWD 1AD9A 4TUOB 1F58L 4Y4FB 5I8OL 4RFNC 5ANMA 1FNGA 3BD3A 2IPUK 2VIRA 3V8CA 3TA3A 3G5ZA 5IFJB 1XF5A 1NLDL 3ZKNC 3HNTH 4ZAKC 3WNOA 3W11D 4AENA 1MF2H 3A67L 4JFDD 4N8VG 3VXMD 4XTRD 2EDWA 3TZVB 3WDHA 2F53B 3V6BR 4DK3A 5KS9A 1WQVT 1B4JH 3WKML 5FEBA 1T21A 5CJOL 1Z6JT 1LILA 5D7JB 4MQXD 5IB2B 3GSVA 3RKDC 4OFYD 2KZWA 4WI4A 3MLTA 4ODHH 1QBAA 4HPYH 1INQA 2BXYA 4OUUA 4LF3B 3NN8B 1OAQH 4KK9D 1DQTA 4CADA 5KJRL 1ZWIA 4NDMA 3EFFA 3L3DA 2A9NH 1JF1B 1L9MA 5B39B 4Z7UE 3RNKA 4H26B 5ICZB 3DETC 1R3IL 1OW0A 3BIKA 1QKZH 5GGSY 3O8XA 3SGDI 2XWTA 1FHGA 4RZCB 4NKIL 1WISA 4QF1B 3DX8A 1EFXA 3ETBF 1FBIL 2Q86B 3IDXH 5I6XB 4FTVE 3T0DA 3P2TA 3MRNA 4Y1AA 2YK1H 3STBA 2G2RA 3V6OC 1DQJA 5F1NA 3DVGB 4HAFA 4KDTA 1HHKB 4CVUA 1RIUL 4ZSOB 1MCWW 4DGIL 1I75A 4KJYB 3GMPA 5AWNL 4CN4A 5MENB 3KPRB 5DQDH 4ZOAA 5E8PA 1GJIA 3RVUC 1HKFA 5JHDD 3BD4A 3U0TA 1PKOA 2XY1A 4NQED 4RGMB 3UO1L 4JAMB 4PJHB 1I1RA 1BVZA 4EUPH 2VLJD 3DMMC 5F1KC 3ULUE 4PJ8D 1HHHA 1DQDH 5D7JD 3PJSB 3QAZC 5E9DB 1J8HB 2X1XR 3QFDA 4UUJA 3VMOA 5BCAA 4X98A 4TNVK 3H9YA 4IOIB 1IAOA 2R9HC 2GJZA 4RFEB 3GBNH 3QQ9C 1SBBA 2C5DC 5D2NB 4WUKL 2WK2A 3S7GA 5LAXB 3HI5H 2QQQA 1R5WB 3LS5L 4OZ4A 3HS0A 5IBTL 3FO1B 5JMOC 4LOUD 5JPNB 1I85A 2X1OA 1GIGL 2NY7H 4LSSH 2HVJB 2YA1A 3EYFB 2XZQL 3H0TA 4U1LA 4G6AD 3MUY1 4NN5B 3A6CL 3BT2L 4HBCL 2DI9A 3QQ3A 4GKZB 3WJLC 5LWYL 4NHCL 3SGKA 1GGIH 4PRNB 4X99B 2UUDH 5ID0A 1N5YH 1CR9H 1PJ9A 1HINH 3VWKB 4OLWL 4ZD3H 3I02B 1FPTH 3TFKC 5ESAA 2YMXH 1E6OL 4YBLC 1A7QH 2LAAA 4I1NB 1HYSD 1YEJH 5D1QA 4ZPTB 3D3VD 4LAJH 1TLKA 2OTWA 3V5HB 3VCLB 3BHBB 2D0HA 3OB8A 2PXYB 1A6ZB 1BBJB 2IWGA 3KXFE 4M93C 3O3DA 5KVFL 2A6DB 4ZMAT 4LP4A 3RWEB 2YUWA 1ZMYA 4D0BA 2AEPL 3QXAA 1FSKC 3HZYA 3MBXL 4PREA 4P2OA 4QRUA 3L7EA 1CDCA 3MJ6A 4HLZG 2DKUA 4M1GL 4OCXL 5K59E 3SOBH 3IJYA 3QDJE 3UJIH 3CX5J 4X6FA 1UADC 2VXTL 5FYJL 3MLXH 1CXLA 5DEGA 5HHVL 1CFTA 5DURD 4MWFA 3T65A 5DJCB 4NQXA 1ZHKA 3KPNA 3MRLA 2IMNA 3UTOA 4JN2B 2GCYB 2ICEA 2Z8SA 2F58L 4NQUA 5A16A 5C9KA 1UQSA 4XPFH 1A7BA 2B4CL 4QGTA 1FH5L 4UT9L 3MJ9A 2VR4A 2BRRH 5HDBF 4G3YH 1KCRH 4CGTA 1H5BC 3QEQA 3FAWA 1OLLA 4QLRA 4L8DB 4PJEE 4JCLA 3EYOB 3LH2H 3T8XB 3GKZA 3SKOB 1FV1B 1U6AH 3HNTL 4FTVB 4DGYL 1U2CA 3BWUC 4KK5D 4OZGB 1KTKE 3CVIL 4ODVH 3WNMA 3T77B 1UXSA 1WF5A 3VWJB 1NGWB 1XGTB 3DRQA 4WI7A 1IGMH 4LGSB 3WXVL 1PX4A 5D96C 4TULH 1EUTA 1NMCC 5SWQB 5KZCD 2JK5A 4P2YA 1CXFA 4J3SA 4ODHL 5EPMB 3RL1B 1NCDH 4LQ1A 1UVQA 5H94A 2ZOLA 3DGGB 2NLJB 3CJJA 1OAQL 5IVZA 3I3EA 3VRIB 1AGDB 4K7FA 2GTWB 3S35X 3QPQC 1NC4A 2BNRA 3I75A 3O2VH 3TCLA 2FJGB 3N9GL 4X0KA 1DQML 1QKZL 3BOVA 3PDOA 1MNUL 5IWLA 1LO2L 4HBQA 1C5CL 2PYEE 1SY6H 3B43A 1IQDB 1DBMH 3IDXL 4Y4FC 3UP1A 3T0XA 3AM8A 5ITBH 1X4YA 3VFUB 1J11A 5HSFA 4OZHF 1DANT 4PJ9B 3BKYL 2KUTA 2YPLA 4XP9L 1IAII 4YXKL 3MRQA 4FFYH 3W9DA 1BIIB 4LLDB 2DRUA 1N6UA 1JV5B 1B90A 2YD3A 4HUUB 3TZVC 4BKLB 2UWEB 5GJTH 4BFGA 3VFPB 5C7XH 3FONB 4QXWA 3F7VB 3Q3GB 2HT2D 5HY9B 3EJZC 1ZVYA 4DZ8B 1TTGA 3ARDC 2PF6A 2MCPL 5JA9A 3ULVD 4PYGA 3FQXB 3C5ZD 3TYFA 4Q0XH 3IXAB 1TVDA 3ET9F 1OF2A 1U3HA 4WEBH 5HVFB 1CQKA 3WDJA 1UWXH 2WIMA 5GQBA 1AE6L 3JWDH 1ZS8A 1XGRA 2Z91A 4FOMA 4YFLI 3E6HB 1IT9L 4YJZL 5B8CB 4JM2C 3L3KB 4D2NA 1OHQA 3O4LD 4TVPH 3FZUD 1PD6A 3GBNL 3KYMA 4LGPB 3N1PC 2Z92A 3EYSH 1NAMH 2W0FA 1DR9A 4B41A 5J7CC 3HI5L 1M7IA 3MROB 3RTQB 2EDEA 1OGAD 3QG7H 1II4E 4PJ9D 2VR5A 3MLRH 5ANME 4FFWC 2Z31A 2DYPD 3MV11 4JPWH 4N68A 2DLEA 2EDOA 4AH2A 4DVRH 3ARPA 3DIFA 4DKDC 4U1SB 3TLRA 1U95A 2G60H 5DK0A 4GW4B 2PETA 5IEHB 1GGIL 2GEEA 3LQAH 4GUPA 5BVPH 2VYRE 2DB8A 5T33H 3GSNA 1OAKH 1P5UA 3CZFA 1N5YL 5KS9E 4ETQB 1RVFL 1J0ZA 4KJWD 4APQA 2YPKA 1MRDH 1KN2H 1S9YB 5H37G 5SX5H 4Q6IC 3ZKMD 1FRGL 2EIZA 4YHZH 1A7QL 5ALBH 3DXAA 3F7QA 4ZUSA 2YS4A 1YEJL 5EBLA 5MHSD 1CFQA 3GSQA 3QJFB 4LHUD 2C9AA 2P5WD 2NX5B 1MCCA 1P4LB 3NZ8B 4JY5H 1LO3H 2BVQA 3QR2A 5MEOB 1H3VA 5D2NC 2DWDA 2FJFB 4J8RA 4PJEB 5BZDB 1UM6H 2J5LC 1S3KH 4RMVA 2DQIH 4BSVB 5GGSB 4MX7B 3PWJB 4P4KD 1IM3B 4DCQB 4XVUD 3JTSA 4DN4H 4LRNL 1OTUC 4Y1AE 3V95A 4N0FA 4NRXB 4NN5C 2ED8A 4CVZA 3EOTL 3V52H 2GAZB 1DLHB 5JNYB 3BKML 4GW5A 1H8NA 4LVHB 3QXVA 4PS4H 1YYMH 3B6SB 3NACH 2YR3A 1KJMB 3QUYB 1GAFL 1UB6B 2IBZY 4GKNB 3DLQR 5IVNA 3OG4B 3QDGD 1V3MA 3GI8L 1MVFA 5HHXL 1PAMA 5J3HC 5AAWA 1RUAH 3E6FA 2J8UA 4HUMB 2D7QA 3ALXA 5L2KD 1WZLA 4PLNC 4K3EH 5T3XE 4G9FA 3K2UL 3H3PH 4MHHI 3QWOA 3R06A 3KHOA 4IRSC 2IQ9H 2WIIA 1BM3L 2PYEB 1I9JH 4K7PX 5B38A 3DTXB 2Y06L 4KHXL 4JRYE 5D9SA 1U6AL 4MQ7B 3ARFC 4MXWL 2DOCA 1FL3A 1P84K 2NX5D 3GNML 4JY6A 3OAZH 2Y5EA 1T7XA 3MJ8A 3AREA 4ODVL 3RWIB 3OR6B 4JFEA 4U31A 2Y6SC 4GAJH 5DEZA 1BQHG 3INUH 2ZNXA 4X4YA 4NN7B 3N85L 4EOWL 4X7DC 3TNMB 1IGML 5FGBA 5CP7B 1Q9KB 3R0MA 3L3HB 3HAEH 4TSBH 1M1SA 1ZGLM 3S4SB 2ADJB 3LQZA 1OD9A 1NCDL 4G6MH 5LBSL 1JHTA 4OQTH 4JQVC 5FKAB 3RP1A 4ZUTB 2W60B 2C4FT 4BH8A 1CVRA 3FOMA 2W0KA 1VA9A 1U93B 3O2VL 2H8PA 3KAAA 1JWSB 1JWMB 2P8LA 3RQ3A 4MDJA 3QUYD 5FYKU 4JFQA 4KPHH 4CDGC 5L7XH 1SY6L 3GMNB 4POZD 1CZ8L 1MI5A 2P5ED 1NBZA 2X4RB 3TN0A 4XH2B 1JPSL 5MERB 5ITBL 4LPWA 5CSZA 2FEDC 5DMGC 2EDHA 2FIKB 1F8TH 3QUXA 5FA4B 2HN7A 1KIPB 5C0IB 4HKBA 1DVFA 2E27H 2ITCA 2VXSH 4HH9A 4I0PD 4K9EH 3HLAB 3N50A 3TYGH 4OCLC 3FQRB 3MUHL 2H9GB 4MD0A 2VJXA 3B9KA 5DSCB 4NCC1 1QEWB 1QFWM 5DS8A 4R0LA 5AG9A 3SKNB 5CZKA 1AD9B 2R2HA 3IDIA 2IFFH 5FUZL 3QDHA 3MACL 4LCWE 2ATPB 5ANMB 3KPQA 3MZGB 3UZEA 2VIRB 3SKJL 2LQRA 4OF7A 4P5TA 3TA3B 1XF5B 3RDTA 3MV9D 4U1IA 4DK6A 4PPTA 3BMWA 1E27A 1FJ1A 4AENB 3E3QE 4WEBL 1LE9A 4JKWA 4HIXH 1IGJA 4U6TA 5IUSA 1X9QA 3LKPA 5KS9B 5BXFA 1CE6A 1FNHA 5EOTA 3UC0L 3VG0H 1ZEAH 1GPOL 3GSVB 43CAA 5HI4C 2ADFL 1OPGL 3BN9C 3MRJA 4TVPL 5IQ9A 3MLTB 3QXTA 3RA7L 1INQB 3SKUD 3UTQA 2DM4A 4OUUB 3SDXA 3NCBB 3EYSL 4UI2A 2VDLH 1DEEA 4CADB 1ZWIB 4NDMB 5CCKH 3BP4A 1T0NA 4Q9RH 3EFFB 3L3DB 1D6EA 2HKHH 3LCYA 5D1XA 1QLFA 3TH2T 3BIKB 2KKQA 3QEQE 4G6FB 3BH8B 3NFPA 2QHRH 1RHHB 2XWTB 4Y5VC 1EAJA 2W9EH 4DKFH 3EYUH 4DVRL 5F44A 1EFXB 4L3EB 4OGYH 1NUNB 2G60L 4RWYH 2ERJC 4Y1AB 3LQAL 2G2RB 1T89A 1DQJB 5EOCL 5F1NB 5HD8D 5BVPL 1N0LA 3SE3A 3MJGX 4GRWF 3SE9L 1T66C 3FMGL 2WBKA 4EIZC 3GMPB 3LAFA 4JZJC 4LLWA 1G84A 5IB5A 2DBLH 3TA3D 2X41A 4JB9H 5CINH 4LKXA 4TOYH 5E8PB 2YXFA 4NO2A 5ALBL 4H1LG 3IRZA 4TYUA 1H3TA 3U0TB 15C8H 3RX7A 3FB7B 4TSCL 3D39D 3V6FA 1CFSA 3FO9A 4JY5L 2J88H 2IFGA 4I0CC 3VDCA 5JORA 3O6FC 2Q8BL 3BDYH 2BNRE 4C59B 1HHHB 2FX8L 3ORJA 3WNKA 3K4AA 4DUVA 4U1KA 4U05A 4XRCA 5HYJA 1S3KL 1IAKA 4XNXL 5EO0B 2O93L 1YJDH 2V5RA 1QSFA 4UUJB 3O0RH 1T0MB 2XI9A 4X98B 4PJFF 3H3KA 1S7VA 3OAYK 3M8OH 1JL8A 1RZJC 3EYQD 4LU5L 5GZOD 4PG2A 1LNUA 3MLWL 4Q58C 1IAOB 3HG1A 2GJZB 2QQKH 5L6YL 3QXUA 2E9JA 2BFVH 1CK0L 1RFDH 3NACL 3NAAH 5ILTH 4YEFA 4OZ4B 3B4NA 3HS0B 4L3ED 1OAUL 3QPXH 1LWRA 3FFDA 5IBLC 1B0RA 5F9AC 1RUAL 1MUJA 3WHE1 4U1LB 2WWMC 3H0TB 5FYLE 1RUKL 2P47B 3T0BA 4CJ0A 1IKNC 3N0PB 4WI8A 3H2WA 5T1KA 1QVOA 3QQ3B 4RMQA 1LQSR 1HH9A 1UM4H 2IQ9L 4ZS6C 2EECA 3BSZL 2GUOA 2IAMD 3PDGA 5ID0B 2Y23A 4FZEH 1UB5A 5T3XD 4ZFGH 4PJDE 1YEHH 5DC4B 3UYRH 5DGQA 3INUL 1LP9A 4LSPH 2DI7A 5HGAA 1EZVX 2FBJH 4OCMC 5D1QB 4L4JA 5D7IF 5E2JA 1JI2A 2X1WL 4D8PA 4IDJL 4WWKB 3KPOA 5FFLA 2MKLC 4QRTA 1WVZA 4N0RA 4P5MA 3O3DB 1S9KC 1CGWA 3QRGL 4KJQC 2P1YA 2WLZA 5HPMA 4D0BB 3V4VH 4HJGA 3QXAB 5HGGS 4P2OB 2ZG2A 4QRUB 3L7EB 1OD7A 4YDLC 1T7YA 2FZ3A 4Y2DD 4P23D 3RIFK 3WDIA 1T7ZA 5L7XL 1KIQB 3IJYB 2WNGA 3M1BA 2QHLA 1A7PH 3MLUH 4P46C 1TDQA 4X6FB 4KJPC 4NQSA 4Z0BH 5DEGB 1B88A 1EO8L 1CFTB 2HTLC 4MWFB 3T65B 4XPHH 4NQXB 1ZHKB 4AEIL 3KPNB 3MRLB 4CL7A 5IFAL 2E27L 2VN4A 2ICEB 5DJAA 3SBWC 2VXSL 1ONQA 4K9EL 2N7AA 4NRYA 5A16B 2BXZA 3TYGL 1XF2A 5K9KA 3Q48A 3CH8A 3C6LA 1A22B 4QNPE 4Z9KB 1OT2A 2QLVB 2XXCB 5CIPA 2V5SA 1CICD 4JVPA 3FJTA 4L4TD 5C6PB 3QEQB 4E42A 3QFJD 4Z7OE 5FUOH 5C2BH 3ZE2E 4HCRA 3EBAA 1G7HA 2HWZH 1JGLH 1PZ5A 3JVGA 4G7YH 4LSUH 1AH1A 1FFPA 3U4EA 3TH3T 4TNWF 4WWKD 3X14A 2NY4D 1UXSB 7CGTA 1F97A 5ELIA 2P44B 3DRQB 3IDNA 2Y07H 3HCVA 4XMLH 3ZKND 5JO5A 4ZAKD 4L5FL 4R2GB 3T04D 2JK5B 5H94B 2ZOLB 2A9MH 5IVZB 2LE9A 4XVSL 4JDTH 1F5WA 2J8UE 4DW2H 4Q9QH 2HKHL 4K7FB 2JB5H 1NC4B 2BNRB 3I75B 3VFTA 3RKDD 4G9FE 3TCLB 2AABH 3O3AA 2YN5A 3BZFA 3PDOB 4YXHL 3EYUL 2XKSA 5D8JH 1RUQL 2FX9L 3QO0A 4XI5D 2OCFD 1MIML 3MLSH 4G42A 4L8SA 1PG7W 4U7MA 5I1EH 5D71H 3DETD 5IQ7H 1AY1L 3GMOA 2OJZL 4JFEE 4QEGA 2YPLB 3S37X 3SCMA 4UNTA 5EU7E 1WIPA 5E5RB 1CXKA 1BJMA 3FO0H 3MRQB 3SQBA 3WJJA 3W9DB 4PRHD 2DQTH 4JB9L 5FOBA 5CINL 1BFOA 4TOYL 2YA0A 3CXHJ 4IRJA 3JV6A 1RUPH 1INDH 2RGSA 4GAYA 15C8L 4XBEL 1NGZA 1QOKA 1MJ8L 4GG6A 3TVMC 5GRVK 2J88L 1LO0H 3TYFB 1DL7H 3BDYL 1BQLH 1MCPH 4XVJL 3VD9A 1OF2B 3RVUD 1U3HB 5T5NG 3IJHA 4NC0B 4KVNH 2XA8L 4H0IA 4HPOH 1ZS8B 3GGWB 2EIEA 3UTZA 2WW8A 1XGRB 2Z91B 4CNIA 3M17A 5SWSA 3O0RL 1MI5E 1JYVA 4I4WA 2D31B 3O8XC 3BI9X 3M8OL 5GRUH 3VE0A 1M7XA 5TE7L 5B21A 7FABH 2QQKL 3KYMB 3T3MF 3PWPD 4NKOA 4POUB 1LVEA 2Z92B 2W0FB 5A2LH 3WFEL 3TJHC 4WW1A 5HGBA 1M7IB 2ICWA 1WZKA 5H37H 3VXSA 1U3YA 1X5JA 4XWOC 5GGVH 4F37F 2AJ3B 3FFCA 4Z8FL 4QHKI 3QPXL 2GSIA 4NSKA 4LCCA 1WUNT 1XCQA 2R9HD 4O2CA 4OCSL 3LOWA 2Z31B 3QQ9D 2YPLD 4AH2B 4PTUA 3Q6GH 4ZFOL 1F00I 3DIFB 4JREC 1U95B 5DK0B 4YDJA 5DD1H 5DD5H 2YPVH 2FO1A 3AGVA 4GUPB 5BOPA 1HHJA 5FM5M 3AROA 5ALCH 3GSNB 3HE7A 4JFOB 2GK2A 5IHBA 1Q1JH 4APQB 1YN6B 3MCLH 2YPKB 4F3FA 1F42A 4ZFGL 5HYFA 5JIIA 3QUZA 4HC1A 3BPCA 1BZ7A 2EIZB 3MRDB 3DXAB 4ZUSB 1NCAL 3WIHH 5F7KC 3MFFA 1U2HA 5EBLB 1CFQB 3GSQB 5D5MA 2CLVA 4OF3A 3SDXE 3M07A 4PD4J 4JFHE 3ZHKA 5JW4M 4HWEH 2BVQB 2B7DT 3TIDA 3TFKD 1W0WA 5ESVA 2DWDB 4J8RB 5TDOA 3CZJA 5HJ3A 4PV9A 3P4MB 2FH6A 2PTTB 4QXUH 2YUXA 4EIGB 1NFDF 2VWEC 2MSPA 2P45B 4LPUA 4BQBA 3P0GB 4N0UE 1ZLWK 3P77B 5J1SC 2FIRT 1T1WA 5DJ2A 3UEZA 3EDDA 1EEZA 3JTSB 2AW2A 3I6GA 4N0FB 4PLKC 5GS1A 3PGCA 4CVZB 2I26N 2EDKA 4GW5B 5FM5O 1RUMH 5DA4A 4XPHL 3QCUH 3NIFF 3MOAL 4QRRA 5HHPA 3ARBB 3D69B 3E6FB 1I7RA 1NFIA 1AC0A 4G9FB 5DJXA 3QI9C 2E7BA 5HGDA 43C9A 2B1HH 3QWOB 5JOFA 5D1QC 4GW1A 5FUOL 2WIIB 3P4LA 3BW9B 3DXAD 2X40A 5B38B 1OY3B 4XC3L 4X9FA 3DV4A 5HYJE 4AJ0A 1FL3B 2EIDA 4LSUL 1U91A 4M03A 2JJTC 1TTFA 4QTHA 3THML 3MJ8B 1REIA 3AREB 4LFHG 4Y5YC 4JFEB 4XP4H 3VA2C 3NMEA 1GRWA 4LRIC 4RFOH 1X5YA 4X4YB 3BUYA 4XNQB 3X3GL 3HG1E 4FFZH 3HRPA 2MCG1 1I3UA 3IGAA 1G6RL 3LQZB 4IIQA 3P9WB 3B83A 3DYMA 4L4VD 1D5MB 1PSKH 2QJDA 2A9ML 2AEIT 3S34H 3SHSA 5BJTB 4N0CC 5DVLA 2YUZA 4BFBD 4JDZB 3S3PA 1JZ3A 4XVTH 4ZOBA 4BH8B 3FOMB 2H8PB 1AD0A 1YNKH 5JOPE 4MDJB 4JFQB 4P3DB 4N90D 5HDOA 5D93C 1MI5B 4BSWA 1NBZB 2I5YL 3TN0B 5T1LA 3MLSL 4KQ4H 5I1LA 3ARBD 5EIIA 5CSZB 1GC1H 4PY7A 1V8HA 2FWOA 5D71L 4TVSa 3KPMB 2IG2L 1G6RA 3QUXB 4U1JB 4HKBB 4UDTA 3HZMB 1P7HL 1DVFB 2ENSA 2ITCB 2OK0H 5TDNA 3D87B 1KUMA 4HH9B 1TJIL 4KKLC 5C08D 2G5RA 4I77L 5JW5A 4MD0B 3B9KB 4KTDH 5FK9A 4BSJA 5DS8B 2YZ1A 4KKBD 4R6UA 4AY0A 4R0LB 3G08A 1J05A 3IDIB 4WUUE 4G80A 1ZANL 2B4CC 3V0WL 5IB4A 3RZCC 3KPQB 2EEBA 3NOIA 2OX5A 3BGMA 4P5TB 4EQ3A 3RDTB 2OSLA 3PWUA 3NA9H 4U1IB 3V4PH 5C0ND 1E27B 1DL7L 2E8ZA 1BQLL 4JPVH 1FJ1B 1MCPL 1T22A 3RVTD 1NCCL 1FG2A 1LE9B 1IGJB 5I30L 4YDKH 4HPOL 3LKPB 3ZYZA 2VE6B 5BXFB 2NTSP 1CE6B 2VUOA 5EOTB 2J8OA 3EZ8A 4WFGE 3PUCA 1S8DA 2IBBA 4UNUA 3OKYA 2W9DH 4LL9A 2E9WA 5IWLC 3U2SA 1K6QH 4GQ9H 4MYWB 5EN2A 3D1MC 3MRJB 4OD3H 5IQ9B 3OBAA 1WC7A 3UTQB 2JLLA 1RJLA 3SDXB 3AM8C 5DD6A 3FTGA 1DEEB 3B3IA 2AQ1A 3BP4B 1T0NB 5B3JF 1OQOA 1D6EB 1F3DJ 5D1XB 2DQDL 1QLFB 2DD8L 5BV7B 2IMMA 4H1LH 4GRMA 4HXAH 3ZT7A 3QUXD 4XPAL 4I48A 1DFBH 4P2RE 3W5MA 5JDSA 4FA8A 1TVHA 5EZIL 2X4UA 5DD1L 2XQYK 2VXVH 3B9KD 4HGWA 2YPVL 4M7KH 4H5SA 3X13A 3WNLA 3RRQA 5ALCL 1R0AH 1G6VK 3A6BL 1Q1JL 4UTAL 4LLWB 5IB5B 1U3HC 2H45A 4P5TD 2LFGA 4NJAL 4J6RH 4OLYH 4LKXB 4NO2B 3U6RA 4NT6B 1T3FA 2X89D 2UUDK 3F62A 3L3GA 4KMTL 1RD6A 2XPGA 5H35A 3V6FB 1CFSB 1EPFA 3FO9B 1KOAA 2DMBA 5JORB 3HC4H 3KWWA 1VFMA 3O6LH 3W0WE 1A64A 4KUCD 2ICWI 4QXUL 1PGRB 1D5XA 5HYJB 3NIDE 2LVCA 5I74B 1RU9L 3ARGC 3EAKA 4JZNB 5CGYD 3BRGC 1QSFB 2HRPH 5E6IC 2R29L 2YRZA 1C08B 4Q6YA 3LEYL 2D7TL 4X9BA 4N9OB 3IS1X 2Z31C 1S7VB 3EO9H 3C2SA 3CVHA 4CU7A 2GJ6A 5D1XD 4GMSL 3VD3A 2GTZA 4L1DA 4L9LA 1OAXH 1Q72H 5E6ZA 2CSPA 4Y16A 4M48H 5DO2D 4MNHA 1QACA 2ICES 3ZDXE 2AJYH 1W72L 3H9ZA 1MHPH 3BPOC 2W91A 1OWWA 1MCEA 3DX9A 1S78D 4CN6A 3JV4A 2B20A 5A3IC 5F1OB 2R4RH 4QOKA 1G9ML 3FFDB 2KPNA 1B0RB 2NYYD 4GSDL 4NO0B 3MV01 1MUJB 3VA6A 3C08H 1FIGL 3FRPG 4GJTB 4GG6E 5F93C 1ITCA 1OGTA 2VSDA 2HFGL 5T1KB 1QVOB 3X11A 1QA9A 1HH9B 3FN0H 4ZO8A 2WINA 5CBEB 4A6YA 5D1ZA 5M94B 1KB5L 5J3HD 2GUOB 2ARJQ 5C07A 3REWB 4Z7VF 5IBUG 2XACC 1UB5B 3OB0H 5DD0L 1DBJH 5SWSE 3WN5A 1W72A 4WO4D 3F58H 5TQ2H 3C5JB 3PP4H 5IJVA 5EC1A 4XP6H 1LP9B 5HGAB 1M7DA 2AEQH 1WWWX 4LMQI 1I1AA 1S7WA 3AY4A 4OUOA 2OZ4H 5IP4A 4X6DF 1WBXA 1SMAA 4K94H 2J3SA 5JXED 4D8PB 5C86A 1QSFD 3TH4T 32C2B 2MKWA 4P5MB 4QRTB 3VXSE 4N0YL 5GRZA 2Y6SD 5F6HI 5BRZA 3WL9A 4ONFL 5KN5A 3FFCE 2VABA 2WBJA 1KIRA 4ZUVA 5HPMB 3S34L 1MHCA 1KB5A 4HJGB 2YD5A 4XVTL 1RK0A 4Z77A 4PJBF 2HG5A 5EULV 4HWBH 1AGEA 1I9EA 1QHOA 4W4NA 2FATH 2FZ3B 4Y19D 1JFQH 4NO3A 4NQSB 4NO0D 3K81A 3K4ZA 4D9QD 1GC1L 4V1DA 2IALA 3IAGC 4ZXBC 2F5BH 1O7SA 4JFFB 1WV7T 3EDEA 5DJAB 1IJ9A 1ONQB 4ETYA 4NRYB 1XF2B 5K9KB 3AREC 5M95B 5D5ME 4KTDL 5CIPB 3MO1A 3QDMD 5EU7C 5DMGD 2JCCF 3SDCA 1E4WL 4LEXH 1XT5A 4E42B 3ARTA 3BPNB 5FGBC 1JK8B 3K4DA 1S9WA 3B8YA 1MOEA 3DNKA 1XR9A 1G7HB 1RMFL 3NA9L 1KJ2A 3V4PL 4GBXD 4JPVL 1WT5C 3OSKA 1IFHL 1FFPB 3EYVA 5L9DL 4NC2B 1G7PA 2IBZX 2H32A 4YDKL 3VFNA 3X14B 2EH7L 3UDWA 3TBVA 1FDLL 3CGTA 3IDNB 3LD8B 3HCVB 3MYZA 1UWXK 2W9DL 2N56A 2E9IA 4YHYB 2J1KA 4OD3L 5FO8A 4P0DA 2E7LA 4QRRE 4FFVC 4E0RA 1E4XH 4YFEA 3ZE0E 2K3TA 1RZ7H 3WFCL 5DMIH 4NM8L 4YHML 4LDLB 4ZO9A 3VFTB 3MV7D 2CLZA 5HI4D 2L7JA 2MPAL 3O3AB 3BZFB 3DX7A 2NMSA 4GKSA 3P4OB 4JFFD 4LSVH 4R8WH 5FUCE 3NZHH 2HJFA 5AAMA 1N6QL 3QO0B 2OR7A 3VFSA 2D3VA 4M7ZC 4G42B 4HIJB 1UZ8B 4L8SB 1VFAA 1ZTXL 3BQUC 4OZHA 1JHKL 3WHXA 3BP5B 2R0ZH 3GMOB 4RDQG 3TPUA 5DTFA 3SCMB 5I71B 5DFTA 3V0VA 1KF9B 4F9PC 1BFOB 1T5WA 2VQ1A 4HUKB 2EKSA 2WQ8A 4JJHA 2HT3C 3JV6B 3B5HA 1EVTC 3HNVL 3MFGB 4F58L 4GAYB 4CW1A 4C54A 1CLCA 2NY2B 1HEZA 4G7VL 5IV2A 5SX5K 2E7MA 2DM7A 1T66D 3UXFA 1NGZB 4LHQB 3PXJA 4GG6B 1CE1L 4HHAA 3I6KA 4JKPH 4MGXA 4QGYA 3QDAA 5IROA 4JPKH 3O6LL 4JR9H 1PDKA 4PJ7F 4KI5F 3IJHB 3CLEL 1X5GA 4OM0L 4GFTB 3DBXA 2EE9A 3FKUS 2HMID 3UTZB 4CNIB 5SWSB 1T5XA 3CU7A 5EUOA 1CF8H 1EXUA 2ZCKH 4I4WB 4ONHA 2CKBA 4OT1L 3TO2A 2D4DA 3O6FD 3B2UD 3AAZA 4P57A 5JDJA 3EO9L 4J23A 3VE0B 1NJ9A 4PB0H 1Q72L 2WM0A 1GOGA 5KVDL 4M48L 5BO1H 2BK8A 5HGBB 4K8RH 2ICWB 3VXSB 5C09E 1YY8A 3DVIA 4V2BA 1U8LA 3FFCB 4NRZA 4WI6A 5J6GA 2GSIB 1Q9WB 4NSKB 1HHIA 3QQ4A 3GB7B 1XCQB 2NY3C 1YQVL 4NP4L 4PLJC 5AEAA 1FNAA 3C08L 5FHAL 4PTUB 2BOCA 4XCEA 1EHXA 3VW3H 3VDAA 2BZDA 3CFBB 1VCAA 4WFFD 4YDJB 1I9IH 5KVEH 1YMHA 4KRNA 1HSBA 1V05A 3U1SH 1HHJB 2WLYA 3T0VA 1RURL 2N4IA 4HT1L 2CR6A 4WHCA 3NCYS 3LQAC 4F3FB 3O3BA 1A47A 3F58L 1HE7A 5TQ2L 2MQ0A 3BPCB 2EDFA 4OCRH 1BZ7B 3PP4L 1PVHA 3GSOA 1F4WH 4XP6L 4GXVL 1R3LB 2VZ1A 5J57B 1WEJL 3MFFB 5CD5D 2R2EA 2J7LA 1MJUH 2OZ4L 3OAZK 2CLVB 3EOYG 4NKMA 4UV4H 4OI7A 1OTTD 2ZCHH 2M1KA 4E41A 5DJ6B 3TIDB 4FQ2H 2ED9A 3VI3E 1W0WB 5DF0A 5TDOB 5GS0L 4U1NA 1UC6A 5HJ3B 4HK3N 4PV9B 4EN3C 4KRLB 4F8TA 2AJXL 3BH9A 5F72S 4MD4A 2Y36H 1T1WB 1VFBA 3L3JA 5DJ2B 4PP2A 3B5GA 2FATL 3QHTC 2OI9B 3I6GB 5KAQG 5GS1B 3PGCB 2YC1A 3NPSC 4X7TA 4S11A 4O2EA 4OLEA 2HH0L 5FHBH 1I8LC 3MREB 1BZQK 1LK3L 6FABL 5F9WB 2XWJA 2XQBH 2F5BL 2X05A 4J12A 5JUEL 3SE8H 1FAKT 3F5WA 4QRRB 1U8QA 2BJML 2A38A 1Y0LA 5HHPB 3CFKA 2R15A 4P46D 3BAEH 1JPFA 2R0WH 2IH3A 3PF2A 3PV6B 1K2DA 3LN5A 3KLAA 4OF5A 1I7RB 1I4FA 5I1KH 1TQCB 1NFIB 2RBLA 4M1DH 2HTLD 2K1MA 5DJXB 5EO9B 3GSXA 5T3ZH 3S8WA 5HGDB 5IG7A 43C9B 5JOFB 3BPLB 4GW1B 4I9WD 4WHYG 1CLOH 5INCA 3VI4F 4RAUA 1OAZL 1N59B 5GSRA 1GCFA 1U91B 4QTHB 3B8SA 3HR5A 4O51A 3C60A 3VMNA 1E4KC 1UCBH 1R3JA 2GJ6E 4IM8A 1OP5K 2FGZA 3ARRA 3IFOA 4ORGA 3FQUA 4X4MA 1YEFL 4OZFH 3IGAB 5DRNA 1T1ZB 2WUBL 1E4XL 1XIWA 4QOKE 1RZ7L 4GH7B 2JELH 4GAGL 5I1GH 4OCWH 3K0WA 3I2CH 4FXLA 1KELH 1SJHA 2H6PB 5GJSH 1FVDA 2G75A 1AD0B 5HHME 3C6LC 1Y6NR 4R8WL 3CSBA 2VKWA 1BD2D 3NZHL 2YD8A 5ERWA 4BSWB 2OL3H 5C07E 5T1LB 5TGBB 5I1LB 3BPNC 3KS0J 2EC8A 4PY7B 3GHEL 2FWOB 3UTPD 4OKVA 3OV6A 4UDTB 5LGJA 4YR6A 4TNWK 5TDNB 2ORBH 5LG1A 1IBGH 3VXUA 3G5VB 2BSRA 5JW5B 2ZUSA 1NAMA 3G08B 1B0GA 1J05B 1A3RH 2IF7A 2PN5A 3P4NA 4K9EC 5I18H 3GBMH 3VFGH 4G80B 5BRZE 5IB4B 5IVXF 3BGMB 3DYOA 1EHNA 4AEHL 1HK6A 4MLSA 3PWUB 4MS8D 1UXWB 1T22B 4JR9L 1FG2B 3SN6N 1F4XL 1F4YL 4AZ8A 3OWEA 5DYOA 3RUGF 1VFOA 2EDQA 3TVMD 5J6HA 1S8DB 1U8PA 1A1MA 2ZCKL 4HJ0C 5FYKE 4G8GA 2VZOA 4V1DE 3U2SB 1CGSH 4LVOC 4PB0L 5EN2B 4BH7A 1WC7B 4JRXD 2PO6A 5I1AA 5BO1L 1RJLB 4KU1A 4L8SC 5DD6B 3FTGB 3B3IB 4XX1E 2AQ2A 1SEBA 2OYPA 1FO0H 5GRJL 1UFUA 3K1DA 3UAJC 1ED3B 2APTA 1DBAH 2DMKA 3SCMC 5I71C 5KW9L 1CFVH 2ZUQB 3WJJC 3S36X 4GRMB 3N1FC 5EU4A 5SX4I 4I48B 1TZGH 2XTJC 5DC9B 4Y4HB 4IRJC 3QIBA 3VW3L 5D7SH 3TJHD 4PRBA 1TVHB 5D2LA 1I8IB 3BYYA 3QULB 1GZQB 4QHLA 3UJTL 2NY2C 2X4UB 4O9HL 1HKLL 1I9IL 2VDMH 1N8ZA 4XWOD 4H5SB 1Z9SA 3X13B 5ISZD 4WY7H 2R23A 1MY7A 2D2OA 5J9PA 3ZKQD 1JGUL 3MODL 1AGBA 1AHWB 4NQCD 1MQKH 5DJZA 1Q8MA 4OCRL 2FECL 1F4WL 5CEZD 4LK4A 5JHLH 3D2UA 3U6RB 4XCCH 1BQSA 1A4JA 4KQ3H 3L3GB 4MNQA 4NQTA 2LTQC 1LD9A 2XPGB 3MV8A 4RA0C 2ZCHL 2EXWC 3KR3H 3F6LA 3IJSA 3KPSA 2VDRL 4OF0A 4KWUA 4XCYB 1WICA 1JI1A 2ZCLH 4U1GC 3KWWB 4R90L 4MXQC 3RVVC 5MEPA 2DJSA 5EWIL 1D5XB 3BUTA 1X4ZA 2BDNH 4ZQKB 3AB0B 1TQBC 1RIVL 1FLRL 4NC1E 3O6MH 4UOW1 3EUUA 1NCBH 2JJVA 3FN9A 1I3VA 3S4SG 2NXZB 4YFDB 4LCCC 1UWEL 3LIZH 4PJFA 3RI5F 2HTKC 5GISL 1C5DA 3CVHB 3HNSH 3S35L 1Q38A 2GJ6B 3LKRA 4OZHE 4QHKJ 2GTZB 4L9LB 1YMMD 5CJBA 2VLME 1D3CA 3QEGH 4XWGL 4Y16B 5FHBL 1VFUA 3MR9B 4MNHB 5KSAA 4N1CA 1CL7L 2DTSA 2XQBL 4QRPA 4Y4HD 2R69H 1R3HA 1J8KA 3HE7C 3DX9B 1Z5LA 3JV4B 4XMPH 4QOKB 3BP7A 4OGAC 3QUZC 2VL4A 3TBSB 4K07A 4HXBH 2UZIH 1KENH 4ZNCD 1PLGH 4DFHA 3SDDA 3X11B 1QA9B 5HHMB 4HWUA 2WINB 4I3SL 4ODXA 4A6YB 1MCQA 5D1ZB 1K4DA 4MA3A 4TQEL 4NWTH 2CIIA 5C07B 5ENWA 1A9BB 5KSBF 1FL5A 1A7RH 1MWAH 3WN5B 5KVMC 5EUOE 3QI9D 5EA0H 4PJ5D 5IJVB 3IU3B 5EC1B 1JCKA 1NSNL 2Q8AL 3MGAA 1C5BH 1SEQL 3IFPA 1M7DB 1S9VB 3BD5A 1I1AB 4M3KB 4OFPA 1WBXB 5D7IA 4MJ2A 2HFEA 3TIEB 1JUFA 5KN5B 1JF6A 3WL9B 5BRZB 5I1HH 1DDHA 2VABB 1IKFL 2WBJB 4LSTH 1KIRB 5F1IA 4ZUVB 3A0OA 4YPJA 5EU5A 4QTIH 4Z6AT 1MHCB 1KB5B 2JELL 1NEZA 5I1GL 1E0OB 5EC2A 5HYSA 2YOCA 3I2CL 4P59H 1OQXA 2HG5B 5BZWB 1A6AA 2X4TB 3WKNA 3ULSA 1EGJH 4YLQT 3GMMA 3QCTH 5M7QA 5JW4R 4NO3B 4PGDA 2UV3A 4OJFH 5IMOA 5E0QA 4N0CD 4NWUH 2AV1A 3VH8A 4OKDA 2IALB 1Z0NA 3PQYE 1A7NH 5FUCC 1BFSA 1IM9A 2VXQH 4NNPH 2ADIA 2ORBL 5D72H 3TV3L 1CLYL 1IBGL 1C1EH 3G6AA 3EZJB 3FO2A 4H25A 4WCYH 3STLA 4K23H 4P9ML 2F8OA 3MO1B 5J0BA 5E2TH 3ROLA 2B2XL 1A3RL 4WDIA 4OAWA 5I18L 1P84J 3HB3C 3GBML 4E41E 1NANH 5FYJD 2H1PH 1S9WB 4DAGL 1BWMA 1N5AA 1XR9B 2QADD 1KJ2B 2DDQH 4IIQC 2V7NA 3OF6D 4C4KT 5IW6A 4JQIH 3EYVB 1JIBA 3ZL4H 1G7PB 2H32B 4PRID 4ZODA 1IVLA 3VFNB 4LSQL 3RZCD 3TBVB 4OLZH 3PXHA 3QUMH 5E8EA 1HNFA 1CQYA 4LAQL 4ORZC 3DUUA 2WUCH 4JKMA 4XNYL 4X5WA 1N64L 4FRWA 2DQUH 1LDSA 5FO8B 4E0RB 1Q9LA 3R8QA 4XNZC 1QYGH 1IGCH 1FO0L 2VDNH 1FYHB 2DQGH 1BQUA 1DBAL 1UJ3A 1J0JA 4KKNA 1RULL 5E2WH 1K8DA 4KMLB 2O61A 2CLZB 5ICXA 3OPZH 3QJHA 5CJQH 2VLRE 4RBPK 2AK1H 3DX7B 4WFHD 1TZGL 4O5LH 1KLGA 1C12B 2F54A 3T09A 4KRPB 3X12A 1F13A 2XRAH 4BZ1H 3VFSB 2VDML 4HS8H 1VFAB 5CJXA 4OCYH 3F12A 12E8H 4OZHB 3WHXB 1FC1A 1OTSC 3TPUB 5DTFB 4AM0A 1WBZA 4M6NL 3E8UH 3EKCA 1MFAH 5DFVC 3CXDH 1CU4H 4K7PL 4S1SH 2K9UA 4K3DL 5JHLL 1ZKAA 4FMFA 1T5WB 3WFBH 2VQ1B 2BVOB 2EKSB 4X4ME 3VXRB 2NY6C 4NN6B 2AJUL 4S0SD 1NC2D 4CW1B 4F33A 2Y5TA 1HEZB 2BNQD 1EV2E 2D4FA 1HWGB 2COQA 2AEWA 4HHAB 3I6KB 1KJVA 2ZCLL 4CBPA 5C2UB 3PL6D 3HHRB 1VDGA 3GO1H 4KXZH 4MHHG 3UYOD 3O6ML 2WAHA 3S98A 4LCIL 1T5XB 2GT9A 4JFDA 3VXMA 1DE4A 1QPPA 4ONHB 2CKBB 4AL8H 4S1DC 3AAZB 5GRWA 1WFTA 1NJ9B 2BVTA 3WYRA 5D70L 3QH3A 1K3ZA 5AG8A 4DUXA 4X4ZA 3ARGD 1AKJD 4KRMB 4L8BB 4D9RE 3P0YH 2QSTA 3CK0L 3VXUE 3OJ2C 1D7FA 5F7EL 5E6ID 2R69L 2Q20A 3P0VL 1YY8B 1A1NA 4BUHA 6CGTA 1U8LB 4NRZB 5SWZD 5J6GB 2ZUTA 2OR9L 3O2DL 1CGVA 1HHIB 3QQ4B 4NBXB 1RK1A 5CUSH 5IT2L 1P4BH 5EB9A 3MLVH 5J13B 2UZIL 4JM2F 1TENA 1IL1A 4HJJH 4I13B 4XCEB 5INDA 1EBPA 1PLGL 5DR5H 4X83A 2FDBP 5IFHL 3ECBA 1YMHB 1CTOA 2I24N 1HSBB 1ETZB 2PR4H 1AGCA 2GJJA 3VXRD 3ZYOA 5A3ID 4ALAL 4NWTL 3OJMB 4Z0XA 3PGDA 2NY1B 3MLYH 5D7LD 3R0NA 3U9UA 1H15A 3GSOB 4G8GE 3AB0C 1KCVH 1C5BL 1X6LA 3O2DA 3EJYD 5DJDA 2ICWJ 2NXZC 2R2EB 3H6JA 4EI5C 4UTBH 4XPGH 3RAJL 4NKMB 3I3BA 5JHDA 4LPXA 1NKOA 2NTFA 4E41B 3ULUH 1GGCH 4Y16C 3B9DA 4CRPA 1XF4B 4NQEA 1DN2A 4QTIL 4U1NB 3RGVD 4U3XA 3VFVA 5B3NA 3WHE0 4QWWC 4P59L 1HH6A 2VLJA 3BH9B 4ZO7A 4MD4B 3NABL 4PJ8A 3RVWC 4ONOA 3QG6A 5ACZA 1N0XH 3L3JB 3KJ6L 2IPUG 4PP2B 5D2LE 4G6JL 2VC2H 5LJYH 1J0HA 1KCUH 2YC1B 4OJFL 3BE1L 3NH7H 4WHYH 2ZZUT 2VZ3A 4O2EB 1CT8B 4NWUL 1VESA 4GRWE 1RIHH 2ZSVA 2O5YH 4JHBA 5CFHA 1EO5A 5F1SA 4NNXA 2XWJB 5ICZA 3OL2A 4NNPL 3E1F1 3F5WB 1FVEB 4G6KL 1KN4L 5IHUL 1U8QB 3WFZA 5E08L 1WIOA 1Y0LB 1VSCA 4MNQE 1JPFB 4D3CH 4WCYL 2IH3B 4K23L 1A0QH 1K2DB 3LN5B 5DWUH 3KLAB 4ZTPH 1I4FB 3S37H 3MV8E 1MJ7H 3TT3L 1FNEA 3MJ7A 1G9MC 3GSXB 1NLBH 3BESR 3DVGA 3KPSE 4ZXBD 3HMXH 1CN4A 1HHKA 4NZUH 2R1WA 2XZAL 2GIYA 5F96H 4MVBC 3OKKA 5INCB 3KG5A 4RAUB 3I9GH 1FGVL 5GSRB 4ZFFA 2CO7B 3CFDA 1KBGH 2R1YA 1BFTA 3KVQA 1VHPA 4JQIL 2WBJC 5C8JA 3TJEH 3FCTA 5J1TC 5IJKA 1B6DA 3HR5B 1WITA 4PJFE 1I1FA 4O51B 3C60B 1X5ZA 4LDEB 5F6HJ 1BEYH 4OLZL 1R3JB 4TUJB 2NXYC 1Q94A 3RHWF 1E6JH 1H8SA 4U2ZA 4BQ8A 3IFOB 2WUCL 4ORGB 3FQUB 5BS0B 1FAIL 4ERSL 2DQUL 3DURA 5DRNB 3CMOH 5CWSA 3VXQA 1PZUB 1MJJA 4TSAH 1DBBH 3D3VA 4JVWA 2HKFH 1Z9OA 4KTEH 3VDBA 1XIWB 1QYGL 5I1JH 1IGCL 1JGDA 5I76B 1RZJH 2VDNL 4OGXL 3VGFA 4FZ8H 3O4OB 5C70A 1RZIA 2BY3A 4HZAA 3ARYA 5E2WL 1SJHB 4YO0B 1FVDB 1IGIL 4IOIA 4GS7C 4GXUM 4O5LL 1MREL 2YZ8A 3SDCC 2XRAL 5ERWB 1AIFB 4CVXA 5GGUA 4HS8L 4PBWD 12E8L 5HI3C 3FO1A 4OKVB 1QSED 2V7HA 4LHJB 4Z7WF 1XCTA 1WBYA 5LGJB 1KSRA 4YR6B 4UAOB 3ARSA 4XXCC 1GC1C 4JHWH 1F2XK 3VXUB 3CXDL 1CU4L 3HI6H 3WFDH 4M5ZH 3RWDA 3EFDH 5D7IE 1NAMB 4PV8A 5KSUB 4GKZA 1B0GB 3BQUD 5I8KL 2V17H 4Z7UF 4NZTH 3GHBL 5DUPL 1ZA3A 3E0GA 5CJ5A 5C6TH 4MB4A 4UV7L 3I02A 4FG6C 4JHAH 5BS0D 4XCFH 3BJLA 3TO4C 3GO1L 3MA9L 3HPLA 5DYOB 5JQ6L 3MBEC 4F9LA 4PBXA 2CLRA 5J6HB 1U8PB 4NZDA 4F57H 5DVOA 4NOFA 2D0FA 4G8GB 4TUKL 1N7ML 4NC1C 4BH7B 2N1KA 4YE4L 2PO6B 3DX6A 5I1AB 2I25N 1UT9A 1DCLA 3BZDA 1P9MA 3QUKA 4PRPB 3T2NH 3ZDYE 1SEBB 1U3JA 3ZSTA 2CGRH 1LGVA 3D18A 3UBXA 4Y8AA 1OAYH 2AK4A 5CUSL 1P4BL 2D7PA 1G0YR 4KK8D 5EU4B 1PY9A 4GOSA 4OB5H 1CWVA 1MEXL 4HUXA 1MCSA 4FHBD 3G6JF 4PRBB 5D2LB 1KPVA 4QHLB 4TVPD 5DR5L 5DVMA 1N8ZB 1LE5A 2DKMA 2PR4L 5F7NC 3T0ED 2A6JA 2R23B 3ULVL 5J9PB 2NY3D 4M00A 4GRWB 4CN1A 5IROC 3MLYL 5F7UA 5DJZB 5CKGA 3OX8A 2XFXA 4FQJL 2HLAA 4ESKA 3STZA 3WE6A 1Q0YH 1A4JB 3V4UH 1T83A 35C8H 4L8DA 3VGGA 5B38G 2BP3A 5GRYA 1U8HA 2KZ1B 4MNQB 3OB0K 4R9HA 4MCZA 4XPGL 1LD9B 3BGFB 3MV8B 4YUEH 3ULUL 3IJSB 3KPSB 2Z8RA 3P3YA 4Y5XA 4LVEA 2NR6C 1KYOK 4OLXH 3DO7A 5MEPB 1L9NA 3C6SA 3U7YL 3SDYH 1XGTA 3C5ZA 2F54E 5TQ0L 2OTPA 2X9XA 4PRPD 1N0XL 4ELMF 4PJFB 5EPMA 1NL0H 3VXNA 4I3RH 3LKRB 4S10A 2BSTA 2WSKA 1PG7X 4WGWB 4JZOA 1X7QA 2DM2A 3C9NB 4EN3D 3U30B 5FV1L 2ZP0T 4QRPB 3VG9C 2BVUA 3O4LA 1R3HB 5MP6L 1FNSL 3HAEB 1Z5LB 1F90L 2NNAA 2NY1C 3BP7B 3HZKA 1F3DH 5EIVA 5DMKA 1ZAGA 4YAQA 5DWUL 4ZTPL 3C09B 3S37L 5FV2A 1MJ7L 2C1OA 4WI5A 1OCWH 1FFQA 1T0PB 2VOTA 4X7EC 4FQLL 5DMYA 1OGAA 2R56L 4MAYC 1NLBL 3SDDB 1VB9A 5F96L 2DYPA 4OQ1A 2HVKA 4ODXB 2FX7H 2H3NA 1BIIA 2CIIB 4Z7VA 4NM4L 5ENWB 3LV3A 1ZE3C 2UWEA 4R4ND 1FL5B 5C0FB 2GHWB 2VLKD 4JFDE 4XNUL 3VXME 5JW4N 3Q3GA 5F89B 1R3KA 2PW2A 1F58H 1YQ2A 3L1OH 1BEYL 2YWZA 3W2DH 3QEHB 3IFPB 3WNPA 3GUTA 3GSWA 1E6JL 4OTXH 1HOCA 3GI9L 1M05B 3DSFH 1NLDH 5D7IB 3S88H 5DDHA 3BKJH 1H3PL 5GGVY 2HFEB 3TT1L 1JUFB 3CMOL 4KHTH 1LEKB 4LHUA 4TSAL 5CILH 1DDHB 2P5WA 2B8OT 4KTEL 5F1IB 2C3GA 3SJVD 5I1JL 5EU5B 5CJ8A 1NEZB 4R97C 1EO7A 5EC2B 5L88L 3WKMH 5HYSB 4LLAA 4PJBA 5E94A 5CJOH 1A6AB 3RWJA 1JNHB 5GS0C 1F4HA 3ULSB 1HHGA 4L9DA 4QRPD 3GMMB 2O5ZL 4NJ9L 4PGDB 5IMOB 2NW2A 4P4KA 5KJRH 4W68A 2AV1B 3VH8B 4LP5A 5CEXA 4M7LT 4YIQA 5JIHA 3U9PH 1IGYB 3IFNH 4CUCA 1IM9B 1MIEL 1R3IH 5CLWA 1BJ1J 2ADIB 4JHWL 1UG9A 3PG2A 3G6AB 3HI6L 3WFDL 4BK5A 1E28A 2NZ9C 2FHFA 3FO2B 1FBIH 1LDPL 3STLB 1HDMB 1NBYA 3OKMA 3VXTB 2JCCA 2V5TA 3ROLB 3QDGA 4WDIB 5JHDE 4OAWB 4JN1L 2V17L 4A2LA 4NZTL 2DJ4A 5T1MA 3AMLA 1RIUH 5L2KA 4RGNC 4NQEE 4DGIH 3DSNA 1Z9LA 2YD4A 5AWNH 3ZLQC 1NEUA 2V7NB 4JHAL 2VLJE 4NCDA 5IW6B 1X5XA 1JJUA 5E2VH 4NUJA 3GJFA 3QEUA 1XIWC 5IMLA 3FT2A 3L5WA 5IR1A 1MCOL 3O4OC 5I75C 1HILA 2BNUB 3N1MC 2H2PD 4HLJA 3K46A 3QIUC 5E8EB 1PQZA 2X9YA 3UO1H 3DUUB 4Y4KC 5AD0A 2WV3A 4XAWL 4X5WB 3NFSH 3AU1A 3I3DA 1D9KD 4EZMA 3DJ9A 1Q9LB 5FECA 2CGRL 5J06A 2VNCA 4UT6H 1UJ3B 4HJ0D 1K8DB 4HSQA 2O61B 5ICXB 3QJHB 4PFEA 2XKUA 1DLHA 2F54B 2MWCA 1JE6A 1VGKA 1OOAA 1FE8H 3X12B 4IJ3B 1MLCB 3OMZA 1M6OA 2EICA 3LS5H 3L6FA 3ZHDA 5E8DH 3F12B 5DK2A 4PUBH 1J5OL 3MA7B 2P5EA 4AM0B 1WBZB 1RZFL 2VR9A 4PJXF 1GIGH 2XTJD 2XZQH 2MTPA 5MI0B 4X7SL 2WWKO 3QNZA 4L3CA 3BT2H 4U0RB 1PKQA 2ILLA 1DUYA 4HBCH 1KTLA 2LVEA 4IRZL 5I9QB 1Q0YL 4I0PA 2HT4D 3V4UL 4NHCH 2OLDA 4F33B 2Y5TB 4RGOL 5E5MA 1GHFL 3D3VE 1UH4A 1KXTB 2YD7A 4WEUD 4YUEL 4IS6A 2ZSWB 4BFIA 1ADQL 4RMTA 1CDIA 4OLWH 1KJVB 1M4KA 1RHFA 4OLXL 2JIXD 1KV3A 1E6OH 3IETA 5TPWL 3V5KB 2J6EL 3MV9A 4WI9A 1AFVH 3UBXI 2CUHA 4X6EA 5LVEA 1ZV5A 2EXWD 4WV1A 1GOFA 2GT9B 4JFDB 3VXMB 5KS9F 3IB4A 4M7JL 1DE4B 3S4SA 4MXQD 5KVFH 1Q0XH 2YD1A 3QIBC 1X5AA 5FKAA 5E99L 3ARWA 3QH3B 2AEPH 3HE6B 2R2CA 1ZT4A 2DQEL 3MBXH 1JMXA 3RJQB 1ADQA 4JVUA 4XBGA 5LKNA 3MJ9H 1A1NB 4EVNA 5DJYA 4M1GH 4OCXH 5CKAA 4BK4A 1RK1B 2RJMA 3B2VL 2J6EA 5F8QC 1B2WL 4PBVC 3D25A 4YK4B 5INDB 3MC0A 1WAAA 4PJCF 1IAIL 4PJAF 5E8OA 4N9GA 5FA4A 3SO3B 4I5BA 1SBSH 4HWBA 3BGFC 1S5IH 2F58H 1I9RL 2YN3A 4OGAD 3HLAA 1R24B 4Z0XB 3PGDB 5DSCA 3T2PA 2XZZA 1O5DT 4N5UA 1G7JB 3U9UB 2A0LC 1H15B 3L1OL 4JO2L 3W2DL 5JLZA 2ATPA 2APWA 3BEVA 5DJDB 3RI5K 4OTXL 3BWAA 1MAJA 2OMNA 3DSFL 1MCIA 3CU1A 2ICCA 5TJWK 3S88L 4DGYH 2VH5L 3BKJL 4DTGH 5JHDB 2NTFB 5B3JE 3CVIH 4KHTL 4GKOA 5CILL 1S5HB 1U8OA 1OWRM 2C3WA 3D39A 4GRLC 4NQEB 2AJZB 4PTTB 5KSAC 3KLHD 3K3QA 3K8MA 3VFVB 1JZ6A 1HH6B 1NFDB 3WO4C 2VLJB 4PGJA 3WXVH 3L3IA 4PJ8B 3HE6D 3QG6B 5ACZB 4G5ZH 4HEPG 1GH7A 4EJ1C 3RWFA 3C09C 3SGEH 4ZOCA 5F3BA 3NGBB 1X4XA 1DZBA 1BBDH 1EHLL 1DN0B 3EOBA 1YECH 2ZSVB 2C4FU 3U9PL 5LQBH 3IFNL 4NNXB 5FB8A 4XPTL 3N9GH 2O5XH 1DQMH 3BH8A 1RHHA 1MNUH 3TWCL 2XZCH 1I7TA 5FYLH 1LO2H 3WS6A 1C5CH 2VAAA 5T3XL 4L3EA 1MVUB 1FNEB 4OZGE 2YEZA 1TTUA 3MJ7B 3VRLE 5I73C 4V2CB 3IKKA 5CHNA 3BKYH 2R1WB 3TBWA 3MOBL 3OKKB 1DSFL 4XP9H 1X5IA 2FD6L 3ULVE 4GG8A 4YXKH 3U0PA 4ZFFB 3IT8D 3CFDB 3ZDZE 4KGJA 1JNJA 2R1YB 3O9WC 5E2VL 5F6IC 4YBHA 5C8JB 4KY1L 3FCTB 4FXGA 3MQIA 1I1FB 2IAMA 2SEBA 3VFRA 1CXEA 3FB7A 2MCPH 4JO3H 1Q94B 3FOLA 5FF6A 1T03H 4XP1H 3O4LE 4NPYB 3DURB 3NFSL 4XAKD 1NCTA 5CWSB 3VXQB 1MJJB 1AE6H 1ZGLP 1SM3H 3D3VB 1J1PH 4KFZC 2OMBA 5EO0A 1JGDB 4LPYA 4DQOH 1JHLH 2L7UA 3WEXA 1T0MA 4UT6L 1RZIB 1J0KA 2JJSC 1IT9H 3WMSA 4KROB 1EMTH 4H88H 5IMMA 1OGAE 4S1QL 2DL2A 2R4SH 2DS4A 3GSNH 3FT4A 1A4KA 1FE8L 4CVXB 5IK3A 4Z7VE 5GGUB 3ILPA 5E70A 5E1AA 4Y2DA 4P23A 2UWEE 4JG1H 5E8DL 4UBDC 4PUBL 5J4MA 2V7HB 1MCNA 1A6UL 1XCTB 2HAZA 1WBYB 5F71A 1WWAX 3LDBB 3KJ4B 3FB5A 1DJSA 4KC3B 4YHLL 5HVHB 4XXDA 5DURB 5A40E 3RWDB 1QLRA 1ERNA 4PV8B 5KANI 2X10A 1P6FA 4PJIF 5MHSE 2P5WE 3EHBD 3JBG7 5I1DA 1ZA3B 1RVFH 3MXWL 1CICA 1R5IB 2NY0B 3F65A 4KKCC 4ZNEA 3QIWC 4L4TA 4YXLH 5BQ7A 5I2IA 5E4EB 5LXGL 1B4RA 1FRGH 3QFJA 1FZMA 4DEPB 5K9JL 1B9ZA 2MOVA 1WFOA 3HPLB 1AFVL 1A7OH 1KULA 1JZ4A 1P7QD 4R4FH 2CLRB 4JO1L 4WWKA 1C16A 1TITA 1Q0XL 4KROD 2WZPD 4F15B 1D5ZA 3MXVL 4PY8J 3DX6B 4KKAD 3H42H 4YHKH 4ZAKA 1ZK9A 3S3SA 3QUKB 3P11L 4PP1C 1H3XA 4CMHB 3MJ9L 5KZCB 1TZHA 3D18B 5HHOD 2JCCE 3QDGE 4JFZL 4LRNH 3UBXB 4QKXB 5MI0C 1KIQA 2AK4B 5KOMC 3EOTH 1V3LA 5HI5C 5L2KE 3GIVA 3BKMH 4HUXB 2AAVA 5I9QC 4WHDA 1KPVB 5GSVA 4MA7L 1GAFH 1SBSL 1LE5B 3TP4A 2A6JB 1S5IL 4B7LA 3KS0H 3QZWB 3GI8H 3V79C 5HHXH 4O58L 4WW2C 3NVQA 2NX5E 1UYWH 4PGBB 3OX8B 2NY0D 4OIIH 3K2UH 4MA8H 2XFXB 1AO7D 3KYOA 2HLAB 3STZB 3WE6B 2E5EA 3W11C 4M8QA 4PRHA 2XG5A 1ZLSH 1BM3H 1U8HB 4KHXH 2Y06H 2Y25A 4MCZB 4XTRC 5HGHA 4MXWH 4DTGL 4JCMA 3V6OA 3GNMH 1P7KA 4Y5XB 1UEYA 5D6CA 3DO7B 5KOVC 1KNOA 3C6SB 3N85H 4EOWH 4OV5A 3C5ZB 4EI5D 5F3HA 5HPOA 2NQCA 5EU6D 4G5ZL 5JMRA 4L29B 3BZ4B 5F9OL 3VXNB 4PJDF 5LBSH 1GGBL 3PHSA 1BBDL 2BSTB 2P5EE 1MCDA 2AK4D 5FGCE 1YECL 4JZOB 1X7QB 4HKXA 3UTTD 5LQBL 3RVWD 2QBWA 1H3UA 3O4LB 5FM4A 3V5DA 2D7OA 2IQAB 4Z95H 4U6YB 1PKQE 2E6QA 2O5XL 3SE4C 1KEGL 1NKRA 3PWPA 3D9AH 2XZCL 4IMKC 2NNAB 3SDAC 4OZFA 5FYLL 3HZKB 1MFEL 3K1KC 5DMKB 1LK2A 1ZHNA 1CZ8H 4LLYA 1ZSDA 4YAQB 5IW3A 1NH6A 2VQTA 1WTLA 5DLML 1JPSH 2C1OB 2R0LH 2R1XB 5ADPL 1OGAB 4F7TA 4OFVA 4OIAA 5FA3A 5CZVH 1EEQA 1U9KA 1ULVA 4Z7QF 5EORH 2DYPB 1MHEA 2HVKB 3B9EA 2H3NB 4Z7VB 4AMKL 3MV9E 3RPKA 5KSBA 3LV3B 2G5BB 4YDIL 5E2UL 2DI8A 4ISVA 1KGCE 2OL3A 1R3KB 2PW2B 5FUZH 3EO0A 3MACH 2CQVA 4P2QA 3VMPA 5DHXB 2JB6A 3GSWB 3GUTB 4JO3L 5D7JC 3SKJH 1T03L 3DPBA 1HOCB 4X6DB 4S0TD 1J18A 1JPGA 2EH8L 1ACYL 3LMJH 2OTUA 5DDHB 4X6CF 4XP1L 4EEEA 1ACZA 3D48R 2E3VA 4LHUB 2P5WB 4FQPA 5C0DA 1SM3L 1J1PL 1XAUA 3GGWA 1TJGL 4DQOL 3LEVL 1JHLL 2NXYD 4Z7OF 4AG4L 3MZTA 3UC0H 4PJBB 5E94B 1YPZF 2D31A 1EMTL 1G7QB 4H88L 3RWJB 1GPOH 1WAAE 4O2FA 1HHGB 2ADFH 4XHJD 1OPGH 1E4XI 5BOZG 2R4SL 4K71B 3N1GC 3GSNL 3RA7H 4P49A 3OXRA 5I6XC 4M5YH 4LOUC 2NW2B 4XP5H 4P4KB 4MJID 5CEXB 4YIQB 4JG1L 5LCVH 2AJ3A 2B1AL 1W2KT 5F7FA 4C56D 3UYPA 4QXGL 1E28B 5SV3A 2PCPA 2EDYA 1TMCB 3RHWK 1NBYB 3OKMB 3UCRA 2JCCB 9CGTA 3QDGB 2RQ8A 2J8UF 4FP8L 1V7ML 1G7IA 5TE4H 5D6DC 3CMGA 4RGMC 4N5ED 5EOCH 5T1MB 1XGQA 4I3GA 1JWUA 5L2KB 2VQUA 3D39E 4JFOA 3SE9H 3FMGH 1YN6A 4YXLL 1TNMA 2X44D 1EJOH 4NUJB 3GJFB 3GM8A 1H3GA 3MRDA 3QEUB 5IMLB 3FT2B 3L5WB 3LHPH 5IR1B 1HILB 3NCJL 5JA8B 1A7OL 4TSCH 4RX4D 4R4FL 1PQZB 4OI9A 5AD0B 2F15A 2PW1A 1NMAL 3MYJA 2Q8BH 2FX8H 3AU1B 3TO4D 4JANA 2PTTA 3P4MA 1YC7A 1NMBH 3H42L 4YHKL 1QFOA 3CPLA 4XNXH 5ADOL 1L7TH 5FECB 1J88A 3P77A 1G9NL 5FAAA 4L3EE 4L4VA 4CU8A 1ZLVK 4LU5H 3MLWH 5DD3L 5L6YH 5F7DA 2V2WA 1VGKB 1I3GL 3ELAT 1CK0H 4U1MA 2DJUA 4UB0L 3RWGB 1M6OB 3L6FB 2W07A 3DUSB 1OAUH 3F7RA 5DK2B 3ARZA 2P5EB 4E5XA 3VWKC 5FGCB 3X3FH 1P2CB 3ARBA 3D69A 5E4EC 1I3RA 3R1GH 2H2SD 1D5IL 1UYWL 3QNZB 2ZG1A 4L3CB 4DEPC 4XGZB 1RUKH 1PKQB 4OIIL 5FGRA 4MA8L 1DUYB 1KTLB 3U79A 4JFPA 3QP3A 4KGLA 1J10A 4I0PB 4F9LC 1IC4L 1ZLSL 3BW9A 5FYJU 5C08A 5E5MB 2PXYC 1SQ2N 3BSZH 5JQHC 3ZMRA 1J86A 2N7BA 4PRAB 1T20A 3LKQA 4IS6B 4R4BB 4BFIB 5ECJE 1KG0A 1W8NA 3CXHK 4U6VL 4PJ7B 1P9MC 1IAMA 5GS3A 2ZOKA 3IETB 4XNQA 1S7UA 3MV9B 2X1QA 1J7VR 5F88A 4X6EB 4WV1B 2J12B 1AXTL 2FHCA 4IDJH 3NCMA 3CX2A 2NR6D 3E2HB 5J56B 4NNYA 1WZMA 3ARDA 1D5MA 3QRGH 1AQKH 1IGFL 3AMKA 5BJTA 4JDZA 3ZHLA 4LVNB 2V2XA 3MRBA 4ZOEA 1ZT4B 1ZLUH 1WJ3A 5CIPH 4XBGB 2XV6B 4Z95L 1B0WA 4OIBA 1YY9D 4EVNB 5DJYB 4MA1B 4YBQC 4HDIA 4R3SA 5DXWA 3D9AL 4P3DA 1CBVL 4Q7DA 3PP3H 5FGSA 4HCRH 3D25B 2B5IB 5BMFH 2R0LL 1EO8H 2EC9T 4ZNEE 5TF0A 4L4TE 3KPMA 4U1JA 5E8OB 4N9GB 5EORL 1X3DA 5GGTL 5CZVL 4I5BB 3HZMA 3QFJE 2AJSH 4AEIH 5IFAH 4XX1G 1TFHA 4NQVA 4YHNA 1EA9C 1EGJA 5T1DL 2HT2C 5SV4A 2C26A 3S97C 3FT3A 5DRXA 5GZNC 1LEIB 4KTYA 3VWJC 3ULVC 4WU7A 1U58A 2X4SA 4EQ2A 1HIML 3ZTJG 5JLZB 4KI5D 3BEVB 3WSQH 4FQXD 3BWAB 2X5PA 1EEYA 5DC0A 1KXVC 3LMJL 4YHOL 5C0RL 1YN7A 2X89A 4HG4J 4G9DA 1KGCD 1NGQL 2W65A 5GGTA 5BV7L 1U8OB 3RVXC 4UNVA 3D39B 2UVFA 3EDFA 2VE6A 1WSST 4L8CA 3ULUC 3GK8H 3FZUC 5EZJA 3L3IB 2IGFH 3SQOL 4L5FH 5KG9A 5I8CA 3RWFB 4M5YL 5F3BB 1J9CT 4XP5L 3S36L 4ODTH 4P9HL 1G0XA 3EOBB 4RWHA 4XVSH 4PJ9C 5CSBA 5LCVL 1GGTA 2RCSH 3ZT5A 5FB8B 1RSFA 3MRGA 4J4PD 2BY2A 4EUPG 1E4JA 2HYMA 4YPGA 4O4YH 1JGEA 2DN7A 1I7TB 4YXHH 4PRHE 3IDYB 2VAAB 1U8NB 2W0LA 1RUQH 3T3PF 2FX9H 4ZG1A 1MIMH 4X5XA 3V6OE 5TE4L 2YEZB 4KK6C 5CHNB 1AY1H 5JW3H 2OJZH 3TBWB 3NIGF 4F7EA 4Q9CA 4GG8B 1I7UA 3U0PB 5IHLB 2M2DA 1NCWL 1EK3A 2PTVA 3SPVB 1EJOL 4WIQA 2AERT 4MDIA 3HMWL 5L0QB 1IQWH 4FXGB 3O45A 4NT6A 1XF1A 3LHPL 2ADGA 2IAMB 3DECA 2SEBB 3VFRB 1MAMH 4XBEH 4RGND 5B8CC 3MCKA 1ND0B 1ORSA 3MGOA 3FOLB 5FF6B 1MJ8H 2MQ3A 4WO4A 2HJLA 1KPRA 4K71C 5DUMH 4XVJH 2P4AB 5EUKA 1NMBL 3ARFA 3PWPE 2XA8H 4W81A 5DUBA 1L7TL 5JXEA 4JZNA 4RCAA 2ZPKH 3WEXB 3L95A 1IAIM 3QIUD 3RTQC 2UVEA 3OAYH 1C08A 2EKJA 4Y4KD 4AT6A 1A5FH 5IMMB 1AR1D 5TE7H 1QO3A 1SVCP 1BAFL 2YPLE 4N8CH 5FDYA 3FT4B 1A4KB 4OD2A 3GKWL 2VXUL 4R26H 5IK3B 4UT7L 3WFEH 3ILPB 5E1AB 5KSBE 2DLGA 4Y2DB 4Y19A 4P23B 4W70A 4M6OH 4Z7WA 1ZVSB 5AZEH 4Z8FH 2FYYA 3QB7C 4NO0A 3X3FL 1FIEA 4U3HA 4ZUWA 4RAHA 4OCSH 3FB5B 4JHZA 3R1GL 4XXDB 5KVGH 1BVKA 3O81A 4K3HA 2G9HA 2VITA 1QLRB 2FCBA 4PJGF 4Z7UA 5CBEA 4DZBA 1TETL 3HC0A 2AGJL 2E7CA 3REWA 5IVXB 5I1DB 3QDMA 1CICB 4L4TB 5BQ7B 5I2IB 2M8XA 5K9QI 3QFJB 3GFUA 3C5JA 3IDMA 1FZMB 2A77L 4HMDA 5TF1L 4HLZH 3K8KA 1NCAH 1RZKH 2PNDA 3RUGB 4GBXA 1FL6A 4KUZH 3DROA 4CDHA 4F7MA 2NY4B 32C2A 1C16B 4W4OA 1ROWA 1AQKL 4LVHC 1JNNL 3RFZC 1D5ZB 3QUYC 2MQCA 4ZAKB 1H0DA 4POZC 1CDUA 1TZHB 2APVA 2VLLB 3U4BL 3OAUH 1M71A 1RPQA 4HCRL 3GIVB 5DJ8A 2EYRB 4OFDA 3NIDF 5F21B 1QRKA 3LKSA 2LV4A 3G6JA 5BMFL 3MV7A 1F11B 5GSVB 1CD9B 3CC5A 2AJSL 4JFFA 1INEL 4OSUL 1VGEL 3FB8A 3MOAH 2VDKL 3U7AA 4POYA 3DXAE 4K8RD 1IILE 4NFCA 4M6MH 4BZ2H 1RI8A 4ZFZA 1UA6H 4F8QA 3BX7C 4NN7C 3ZDXF 3KYOB 4Y5VA 2CRMA 1XH3A 3TC9A 3WSQL 1JK8A 4M8QB 4PRHB 4WV1C 2VZTA 4XC3H 5HGHB 5IESL 1EH9A 3Q5TA 5H8DA 3THMH 4EXKA 3QXDA 1P7KB 3W81A 1QRND 4GG6F 4QXTB 4L4VE 5D6CB 3H9HB 3PHQA 1KNOB 4JZJA 3MNWA 4HIIA 3WS3A 1K4CA 3GK8L 3HMXA 2VDOL 3X3GH 3RWCA 4OV5B 1H8OA 1JGVL 5F3HB 5IB1B 1KCSL 4RAVB 2IGFL 3MUZ1 1EJ6A 2ZWLT 5JZ7C 3FQWA 4ELMA 4NHUB 1G6RH 3K7UA 4N90E 2B5IC 4GRLD 3BVNB 2EZ0C 2P8PA 4NO5A 4ODTL 2M26A 2NW3A 2GY7B 4HKXB 3O6FA 4HFUH 2DLTA 5DHVH 2RCSL 3BO8B 1NCNA 1S7XA 5DZNA 3V5DB 4QHMA 3QAZB 4O4YL 2YHGA 3PWPB 4DWHA 3P4OA 2VZVA 4OZFB 4R7DA 1FZOA 3OHXA 3GJEA 5HD8C 5C08E 1LK2B 2FBOJ 1ZHNB 3PWNA 4LLYB 1ZSDB 4TPRL 2IADA 4JGUA 2I5YH 1CGTA 3RY5A 4HIJA 1UZ8A 5DRWA 1MFCL 4F7TB 2FEEL 3TA3C 2IG2H 5FA3B 3BP5A 5JW3L 2YD2A 3MSPA 1MHEB 2FSEA 3WIIH 3IS0X 3OXSA 1TJIH 3QDJA 5KSBB 4I77H 4LFHD 2Z8WC 4ISVB 1IQWL 1NANI 3CSGA 4HGMA 1QBLL 1BX2A 2OL3B 4WHTA 3EO0B 1MAML 4P3CL 5DHYA 4P2QB 5J89A 5EIQA 1ZANH 3V0WH 2FNBA 1NGPH 2JB6B 3MOQA 1ZGLA 2ARJA 5EBWA 1IKNA 2F74A 5T3ZD 1YA5A 1JPGB 3O9WD 2OTUB 5D5MF 3EGSA 1A6VL 5DUML 1NCCH 4UINL 4MCYA 5C71A 4OFIA 5I30H 3QA3A 5C0DB 4RMWA 2CIKA 5LGKA 3EYQC 3UX9B 2BRQA 2ZPKL 3F6IA 1YEKL 3BFOA 1OW0C 4RQQB 4UQ3A 5DQJA 3MRMA 1A5FL 3DMMD 4YBLB 4O2FB 3AS3A 3S3JA 2AQ3A 4UQ2A 3UTSD 5IVOA 4JGJA 4N8CL 3OXRB 1NUGA 1URLA 1SMOA 3BDXA 3GRWA 4YHIA 1T04A 4R26L 4YQXH 3PABB 4KDTC 4HC1L 4M93B 5IW1A 2EO1A 1I7ZA 3FN3A 4M6OL 1YEDA 2DQDH 5AZEL 1Q9WA 3CCHB 2DD8H 3GB7A 4JGMA 4FS0A 2IJ0C 4XPAH 5DVNA 1T7VA 5CEYA 5KVGL 2ZKHL 3L5XH 2PCPB 4IBLT 3CFBA 2CJUH 5EZIH 3T0AA 4KZEH 4PG9A 3C8HA 3EJJX 1G7IB 4UBDD 5FO7A 4P46A 3EOAA 1XGQB 1JWUB 5D7KD 4P2QD 3A6BH 4UTAH 1IZKA 4EBQH 2D03L 4NJAH 2JF1A 3S9DB 4WNQA 1R3LA 3I50L 3PE9A 4HULB 1RZKL 4FQ1H 4KUZL 4HH8A 4KMTH 5J12B 1VERA 3FB6A 5ABDE 3QIWD 4CU6A 1SJVA 1QLEH 3LS4H 5ESQA 2PW1B 5DJ6A 3L7FA 3ME0A 3MYJB 1VPOH 2BHYA 4KXZI 4JANB 5C0BD 2F19L 5C0GA 4GXUN 2YKLL 3CPLB 1RU9H 5GIRA 2WP3T 3PHOB 1I85C 2QSCL 1P6AB 1PG7H 2R29H 4L4VB 1PX3A 3LEYH 2D7TH 3ES6A 3QHFL 3OAUL 1CDHA 1U0QA 4OCNC 1BMGA 4GMSH 4A6YH 2Y1VA 2DF3A 2Z8VC 1FZKB 1SHMA 5F7DB 2V2WB 3Q5OA 3MREA 1NMCB 4PP1D 2VUYA 3SGKC 5C3LD 3LPWA 1BJ8A 4U1MB 2A1WL 3IDJA 1W72H 5IIEA 3HAEG 1BD2A 4LKCB 3TGXA 4E5XB 3WXWH 1G9MH 3IAPA 4GSDH 4PJXA 4M6ML 4BZ2L 4NBYB 2IPTH 5HI5D 2ZJSH 3PV6A 3O11B 1I3RB 1UA6L 1FIGH 1HZHL 5EO9A 2EE3A 1TJHL 2HFGH 3D0LA 4D9LL 4JFPB 1XGYL 4PIRF 2NY5H 5C08B 2DLIA 4K2UL 1KB5H 4WWKC 1N59A 2OXGA 2NY4C 4NFBA 1T20B 1FYTD 3LKQB 2VDPL 1QSFE 2YUVA 1YNTA 4DKEL 5DD0H 3FL7A 3I6LD 4ONGL 1KG0B 2DWEA 2P48B 3GMRA 4URTB 5IM7A 4DVBA 5J1AA 4Z5RA 4P2OC 5C0AB 3E3QC 2ZOKB 1S7UB 2IAND 1GL4B 5F88B 3T0WA 5FYKH 3O6KL 3JWOC 4YGVA 2DLFL 1T1ZA 4Y19E 4NNYB 4N0YH 3ARDB 2C4XA 4HAGA 4ONFH 1MWAB 4Z7WE 4MXVE 1NEZG 4LLMA 4UIKH 3TVMA 4NQDD 5HYSG 4D9QE 2FHBA 4HFUL 2V2XB 3MRBB 3P30H 5FOJA 2H6PA 4WRLA 1FN4A 4XI5C 5IKCA 4JRXA 1J1XL 4HDIB 4R3SB 3ZTJH 4LIQL 3VI3F 3RU8L 1Y18A 5E6YA 3VH8G 4NFDA 5TGBA 5CEZL 3QDME 1KJ2H 4JM2B 4PJCA 4R7NA 4ZDHA 3QPQD 4PJAA 4F2MA 1EEUA 1PEWA 2H32H 2CMRL 3DI2B 3UJJL 4B50A 4P48A 3TPKA 1LP9E 3SDAD 3WIIL 1CIUA 4NQVB 4YHNB 1P1ZA 3WV0A 3G5VA 2O26U 3DO3A 1UCTA 4H0GA 4LARL 1GVIA 3FT3B 4Y4FD 5DRXB 3WLBA 4A2MA 5ISZA 2QQLH 5AYUH 2Q3AA 4WU7B 5FCUL 1E4WH 1SYVB 1U58B 5A43C 2X4SB 3M45A 2NZIA 1T2QL 2YRLA 3LY6A 5A2JH 5JXAH 3W9EA 1KYOJ 1NGPL 4NQCA 5GRVL 5FDWA 1KCLA 4KAQH 1Y6KR 4NYLA 4R2GC 5C0AD 1EEYB 1RMFH 2W59A 3HFML 1UXWA 3TZVD 2F53D 1YN7B 1HQRA 1IFHH 4G9DB 3DOSA 2WQRA 3S96B 1DLFL 1NGXA 2W65B 5L9DH 1MCWM 2R0KL 3EJZD 5F7LB 1MELA 3WUWB 2EH7H 5B4MC 3ARDD 4L8CB 4M3JA 1FDLH 4Q6IB 4OI8A 4NGHL 5EZJB 4JRYA 1N26A 1L6XA 2C1PA 3G6JE 3MV7E 5KG9B 2Z93A 3PIQA 4XNMA 5I8CB 5IEKA 3MX0A 4JFFE 5HBBA 3JUZA 1N4XL 4YQXL 2X4NA 2Z0BA 3GSUA 4WFED 1LMKA 1ED3A 3ZYIA 3PNWA 3WFCH 2BCKA 4LQFH 5SX4H 4JM2D 4NM8H 3QUMB 4YHMH 1YMMA 1AJ7H 2P8MA 3MRGB 2J5LB 4JO4H 4BFEA 2MPAH 4YPGB 5H2BA 1JGEB 4HWZA 2BY1A 3FHQA 4Y4HA 3L5XL 1N6QH 1I8IA 2CJUL 3QULA 1GZQA 4KZEL 4X5XB 2FR4A 1RJCA 3LZFL 1A14H 1ZTXH 1JHKH 2F5AL 5MEND 3KPRD 4F7EB 4FFWD 1AHWA 4EBQL 1I7UB 2VISA 1CD8A 2EE2A 3GIZL 4MDIB 2CKBH 1RQ5A 4UILH 3O45B 4ELME 3CVHL 3HNVH 4F58H 2ADGB 4S2SA 4FQ1L 1JZ5A 3RIAF 2XYCA 4G7VH 1RZ8A 1GXEA 3MCKB 1ORSB 3MGOB 4O02L 1UGNA 4WO4B 1CE1H 1YC8A 3QI9A 1QLEL 2HJLB 1KPRB 1AP2A 3LS4L 4PJ5A 4XCYA 2HJKB 5CAYB 5BW7A 4FABL 4IRSB 2APBA 3WIFA 3ZZ1A 5E9DD 1VPOL 5TDPA 1J8HD 1ODAA 3OJDA 1JZ2A 3CLEH 5EUKB 4CJ1A 3ARFB 4OM0H 4ZQKA 5DUBB 4LCWA 2JJTA 4UOJA 3KYNA 1FLTX 3L95B 1WIUA 4Y5YA 3PV7A 1QFWI 1PG7L 3D6GA 4AT6B 4LRIA 4OT1H 1V3KA 5E95B 4A6YL 1QO3B 4YDVA 4WEMB 1FVCA 3HKFA 5KVDH 1OSZA 5DFWH 3RNQA 4OD2B 1F6AA 3MR9A 2K7PA 1SVZA 3DARA 5BVJA 1P4IL 1QFPA 2BY0A 2CK0H 4WFFE 2AXJA 3OG6B 4Y19B 3U36A 1OTUD 4Z7WB 2Q76A 5EO1A 4APQC 3TBYB 3WXWL 2FYYB 5E03A 2IPTL 4HQQH 1YQVH 4NP4H 2ZJSL 3Q6FB 4ZUWB 4UZGA