3S37H

Structural basis for the function of two anti-vegf receptor antibodies
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
209
Chain Sequence
b'VQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVTDAFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1121B Fab light chain
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system/transferase
total genus 37
structure length 209
sequence length 215
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s37H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s37H01
3LEYH 3V4UL 3EO9H 4TULL 1KJ2A 3JTSB 2P48B 1KUMA 2Y5TB 1LNUB 2JKXA 1FAIH 2VLRE 3O81A 1EV2E 3SKMB 5E8NB 3WHE0 2G9HA 4DAGH 4ZFGL 3MRKA 5MEOA 4Q9QH 4LHUG 1D5MA 3AUVA 1JF6A 1QQDA 1SEBA 2CMRL 4WFGD 4BH7A 3D2UA 5HTSA 1T0NB 5H94B 3LPGA 4Y2DD 5E6ID 4KUZH 2CUIA 3G9VA 2UVEA 3HZYB 3VGDA 3A6OA 3TT1H 4ZSOE 2B5IC 5IVZB 4Q0XL 4XVSH 2R39A 1RUQH 4FQLL 2HJLB 2WIIA 3CFEA 4N1CA 3JWNC 3HE6A 5ITFB 2PTTA 3TCLA 5IHBA 1WQVT 1NH6A 2VKXA 5EZLA 1YEIL 5CIPH 3V6OA 1I1FB 4QT5B 1VFOA 1VERA 3MROA 3ZKMC 5E03A 4G6MH 1PBYA 3H8NA 1T03L 3MRIA 1MJ7L 4G8IA 1NFIA 1S8DA 3OKNA 4OM0L 1FYTA 4PJ9C 2P43B 4KV5E 1JFQL 1LEIA 1OP3H 5MEQA 4XCNA 4H88L 5E8DH 1N3NB 1YEDB 3TT3H 4TVPE 1QYGH 1KXVC 1T83A 4NRXB 1I3VA 1HKLL 4L4VA 5AWNL 2P5EB 2DDQH 5MP6L 5JMOC 3QXAA 3IDGB 1M4KA 2VSDA 3D6GA 4X7EC 1EEQA 5FO8B 4LHUB 2VLKD 2QSCH 1BREA 1VFBB 4ZUUA 3MA7B 5GJTH 2VE6A 3V4VH 3CC5B 3T3PE 4PLKD 1A02N 1WISA 5GRUL 3FRUB 5HI5D 2AEQL 2FDBP 5C70A 4OAWA 1YPZF 2XN9D 5D93C 2NPLX 2ZSWA 2X40A 1PSKH 5FM8A 3VGGA 3CGTA 1FG2A 4TSAL 5L0QB 3DV4B 2DQEH 5E1AB 3RDTC 5FYKD 5KSBF 2CDFB 2E9IA 5I8KL 5I1IH 3JUZA 4MD0A 2JB6A 1QOKA 1NPUA 3VWKB 5CD5D 4G3YL 2F53A 2Q3ZA 2X5PA 4ONHB 4OQTH 5KS9B 1MFEL 1URLA 3DUUB 1YNKL 4PGDB 1JVKA 2E8ZA 4KTEL 3H9SA 3RZCB 2BCKB 4PRPB 5GS0L 4K2UL 2J8HA 1SJEB 2KL6A 4P59H 4H26A 2NY1C 2IQAA 4IOFD 3IXAA 4WW2A 4QGYA 4X7TA 4LU5H 2XZAL 5HGHA 4U1KB 5D1ZB 4OV5B 3UEZA 4YWGL 4PJAB 4WCYL 4TSBH 1IGYA 5DQJB 4GRMB 4RMWA 1IQWL 4JZJC 4BZ1H 3C8HA 4ZUSB 4CN4A 3FFDB 4I13B 2H6PB 3ARFB 4NSKA 1FVDB 1QSEA 3GEWB 3NACH 5I66A 1CLOL 4I0PC 4HULB 4YX2H 3WJLA 4HUMB 3QRGL 4AL8L 1GYAA 1D6VL 3DSNA 3BRDA 5L7XH 5HVFB 3QUZC 3HCVA 3ULVD 3QHZL 5I1KH 4NJ9H 1CTNA 2VO5A 4U6VL 1K4DB 4QYOA 2XQYG 2LTQC 2HJKB 4PB0H 5FM5M 2UUDK 1P7QB 1DTUA 3O9WB 4YHKH 3VFTA 1T1WB 1NJ9B 4Y2OA 1BEYL 1WIUA 5CEXA 3LQZB 3C5SA 5GRYA 2DOCA 3HS0B 1MVUA 1ZMYA 3QQ3B 3GKWL 4YNYA 6FABH 3VW3L 3U7WH 5EOCL 3MNZA 4NQEB 3M17B 3RNQB 3DURB 4KK8D 4P5MB 4KHXL 4YC2B 1AR2A 2UV3A 3L3HB 4N0YH 1OF2B 3IJSA 1IGJA 5C7XL 4FXGA 4NJAL 4JDZA 3WNMA 4KZEL 2H1PL 2UYLA 4F7EA 2XTJC 4ZFFA 1PGRB 4WV1B 3EDDA 1AHWB 2BNQE 5J6GA 1CCZA 3PABA 4XT1C 2A2QT 1AD9A 5HYSB 2SEBA 3CDYA 3QT2A 4L9LC 4B5EA 5DVNA 3T8XA 1U8KB 3VD7A 5FK9B 2FBJL 4NGHH 5IVXA 3FAXA 4JM2F 3LPFA 2C26A 3FN9A 4X6EA 1GGBL 4J4PD 5E5RB 3BJLA 4QRQB 3HC0A 1P69B 4LKXB 1E0OB 4PJHB 2EYSB 2VIRB 5C0AE 3OXRB 2GJJA 3U0TA 4R7NA 4IRJA 2D31A 3BGFC 5C0BB 1ORQA 3MGTB 3EOTH 3BQUA 3MCG1 4UT9H 4FTVB 4PREB 4GBXA 4UDTA 4S1RH 1RUPL 5DJ6A 4QF1A 3QUKB 2ZUQC 1H3XA 5IOPA 4ZXBD 4R26H 1CFSA 4XP6L 5D7IE 5GZND 4OF3A 5JW4R 5L8LB 5L2JB 4K9EL 5CP3H 2QV2A 3CPLA 2FX7H 4FFVC 1A0QL 2AJZB 2JELH 2N56A 4F7CB 1A1OA 3IJYB 2AK4E 4O58L 5EUKA 2AXFA 5F71A 1CFVL 5C0GB 4R0LA 1XR8A 4WW1B 4LVEA 2BY3A 4PP1D 1H15A 1A9EB 1T80A 4QRRE 4C4KO 2CKBH 3ECBA 4OFKA 1QBLL 2V7HA 3WNOA 1T20A 1HQRB 1JNJA 3ARTA 3MLTA 1CDYA 3HFMH 1JK8A 1R5WB 4HG4K 2FHBA 1ZWIB 3PJSA 5EUOF 3VDCA 3RVVC 4XHJC 4YEFA 3KXFD 4DFIA 1CE6B 1C7SA 3FB5B 2WUCH 4PG2C 2OR7A 3FHAA 4S1SH 1TZHB 3FQWA 3SGDI 1UACH 2HTLC 5EZIL 1EO7A 1X5ZA 5EN2A 4ODWB 3IDYC 4LBEA 4FQQA 3K3QA 3DYMA 1I1RA 1U36A 4PY7A 1ZHBB 4KJPD 3LKOB 1QFWL 4HD9A 4M5ZH 5LAXA 1VADA 2BVQA 4KMTH 3T2NL 1BM3H 2GHWB 2OTWB 1OP9A 1MFCL 5JPMB 1H3TA 3ARBB 3GIZL 4QHKI 1LK2B 5DEGA 5CKGA 3ZTNL 3FQTA 5D1QD 3WFCH 3FB8B 1S7SB 2HMIC 2PETA 5IG7A 1U3HC 5BOZG 4HS3B 3VXSD 3LEXA 4XC3H 1MRCL 5D7JC 2C1OB 4NCC2 3WHXA 1OGAD 5FF6B 3SDCD 3GO1H 3INUH 1IAIL 1F4XL 2X4PA 3ILPA 1QNZL 2XNAA 4U0RB 5IB4A 1PZUB 3PL6D 4CUCA 5L88L 1S7XB 5DHXB 4UILH 5DK0A 1XMWA 3C6LB 3HPLA 1XIWA 2OXHA 4KV5F 2OR8A 4MA1B 4PJ5B 5HY9A 5KAQF 5KTEH 4LLAA 4E9LA 4D8PB 4DGYH 1IC4H 3C5ZD 4WTZA 4U2YA 2YR3A 3UPCA 1Q1JL 2BSRB 2BNRD 3QIUB 1JV5A 4X5XA 4U3HA 3BH9A 1W2KT 1X7QA 3BZEB 5GJSH 1MJJA 2FJHA 3W9DB 3LCYA 1AXSB 2D9QB 3H3BC 4QRPD 1TTFA 3LB6C 4IOIA 3C60A 5JHDE 4Q6IA 1AFVH 1P7KA 1V7MH 3MRLB 5ACZA 3KPLB 3G5YB 3HLAB 3T0EB 1BZ7B 1B2WL 4Z7UB 25C8H 4S0SD 1WK0A 4NPYB 3T3PF 4NKOB 4L4TE 4BFBD 3NN8A 2DIBA 1SBBA 5DJXB 5GHWL 4ZS6D 3C08L 5D5MB 1BAFL 1IFHL 3B9KA 5GGQH 3RVUD 1RPQA 1YEEH 4Y4KD 1PY4A 1VEMA 5JNYA 5IR1A 1I7UA 2Q8AL 3TJEH 3V6FB 1R3IH 2FATH 4I8DA 3HNVH 2W91A 4AQ1B 3NBNA 5I30L 2VMFA 4JG1H 2M2DA 1ZXQA 4S1DD 3QH3A 1O7SA 4OZHA 1MCBA 1E6JH 2WIMA 3OKKA 2PYFA 4KZDL 3V9FA 4R96B 4P48A 4M7ZC 4RBPH 1SYSA 4WEBH 2PYEA 4UTAH 4OFYA 4EOWH 2V2XA 4KRPB 4GRLC 3OMZA 1INEL 3SKJH 3P4NA 5HDLA 1JZ2A 1FN4B 1RULH 4MCYB 4X5WB 4JRYB 5CBAB 4HUNB 1XGQB 1M7DA 1CF8H 4HZLB 2XZQL 3STZA 1NBYB 1MFBH 3QDGD 3I3EA 3NABL 4LGPB 2B0SH 2EDYA 4LSRH 4ZOBA 3TO4D 3MRPB 4WU7B 2W0FA 3CCHB 2ARWA 1CFBA 4M62H 1FFNB 3QSKB 3MLYH 4OFIA 1QO3B 4ONGL 1VACB 1DR9A 2EEAA 1NC4D 3HUJE 2D03L 2XACC 4HPYH 4L3EE 2X10A 3D25A 1I4FA 4YDIL 1KN4H 3UTPD 4KDWA 2NY0D 2YD7A 1TJHH 1U8HB 4P3WA 4RDQG 2IBZY 3MRBB 1ACYH 5JXEA 3SO3C 3L5HA 4DGIL 3H7BA 4GXUN 1QSZA 4XNZB 2J12B 3OGCB 1Q0YL 4OFVA 5HI3C 3ULUL 4M6OL 3OF6A 3BWAA 2NY4B 3EW3B 4YHLL 4JFOB 4IRZL 3P11H 1EZVX 1EO8L 4EIGB 1ZE3C 3K8MA 2O5XH 2ORBH 1KTDA 2XICA 2WBJC 3GSOA 4WEUD 3RIAF 3O6LH 1RIVL 1DQDL 3LDBC 2FWOB 4X99A 2ARJA 5DLMH 4XCFH 1OLZA 5ISZA 4NZTH 4WUUB 1H8NA 4S1QL 1IAKA 1NKOA 3MLSH 4Y5YB 1T5XA 3O45A 1T5WB 1HCVA 2VXTH 4JFFB 4NNPL 2Q3AA 3Q5YA 6CGTA 4IRSD 5E08L 1I8LA 4F57L 5ID1A 3IGAA 5CJOL 2MMXA 3DUHA 2VZOA 1HHKA 3P3YA 3MCLL 4PRHD 3GKZA 4YHYC 1OQXA 1KNOB 1K85A 3AREA 1UJ3A 3KPSB 1A3LL 1K2DB 4WWKC 4OIIH 5EOTA 4IMKA 3LQAH 4Y7MA 1U0QA 4KC3B 3O6FA 4HLZH 4YH6A 3DRQB 4EDXB 4IS6A 5B8CC 1DBJH 5D7IF 1S7UB 3MJ8B 2ATKB 3MBXL 1T1XB 1ND0A 1M05B 3KYMB 4PJEA 5D9SB 1NAKH 1IC7L 1CLZH 2MQ0A 4PGEB 3GMLA 4G7VH 3CUPB 3GBNL 5C0DA 1HK6A 2P5EE 2PR4L 4EZMA 4N0FB 2X4RA 1DFBL 1EJOH 1N5AB 1FL6B 2FH6A 2BVPA 4V1DA 4KWUA 2ITDB 3CDFA 4NN7C 2NZIA 2NTSP 1S7VA 2LFGA 1TFHA 1S5IH 3QYCA 5KVGL 3X3FL 4MB4A 4WHTB 1UM4H 3MRFA 4ZAKB 3A6BL 5IQ7H 5EO9A 3L95A 1FNSL 5SWSB 2Q87A 3BDYH 4W6YB 1QSFD 5F1KC 4JY6B 4P4RB 1PG7W 4S2SB 3BPCB 1QA9A 2ZPKL 2H32B 2VNCA 5I19H 3IU3A 5IB1B 2EXWC 2Y6SD 3HAEG 5I0ZA 4LGSB 3MLZL 1KJ3H 4IMLA 3TVMD 3EDJA 2VITA 3G6AB 4P5TA 4OCYH 3T1WA 3D5OF 4OD1H 43C9B 1GGYA 1N0XH 3EIFA 5C0ND 1UGNA 5HHOB 5A3ID 1R0AH 2NY2D 2UZIL 2AJSH 4JHWL 1EA9C 1JHTB 1FFOA 3BX7C 2J88H 1P4BH 3WE6A 3E0GA 4L3CB 1VGKA 3GM0A 3IFLL 4DOHB 4XPGH 3RHWK 5C0FA 2HLAB 1UB5A 4XX1E 2YPLA 3OX8A 3UO1L 5DRXB 5B39G 1TXKA 3WFBL 1SVCP 4P2OA 4I5BB 1RURH 1HN1A 3MBEC 1EFXD 2HT2D 1P4LB 4J2XA 1NCAH 1BD2D 2P7TB 1PQZB 4U1NA 5CGTA 4N0UE 4OLYH 5SX4I 1OT2A 1QFUL 4G9FA 5T1LD 1HSAA 5EOQL 5DQ9A 5TGBA 5GRJH 3GM8A 1MAMH 1FQ9C 4KK5C 1ZGLP 1DBKH 1N64L 3CLEH 4JFXB 5I9QC 3OKEA 3REWB 4L9DA 3T1FA 5EPMB 3JV6B 4LHQB 5CIPB 4PTUB 3LHPH 1D9KC 3W0WE 1CZ8H 1TTGA 3EGSA 5DUMH 1JJUA 4XPHH 2OTUB 1KN2H 2HFFA 2W9EL 4FQ1L 3U30B 4OKVB 4XPAL 4ELMF 1B4JL 1JPFB 5FUZH 4EN3D 2V2TB 1UA6L 1WFOA 2RIKA 2F74B 1GSMA 1AE6H 1RJLB 4RAVA 4G6KL 3TJHD 4JEGB 4NQCB 1D5IH 5SX5H 1FNFA 1MCFA 2ZZUT 4CW1B 2Z93B 1SYVB 3NAAL 4URTB 1JPTL 4LCCA 1DE4A 5J13C 3Q6GH 3LRHA 5AZ2L 4EUPG 7FABH 4P3CH 2I24N 4HUWA 3ARUA 4HKXB 5D7IA 2RQ8A 5F9OH 1ROWA 3N1MC 4Z95H 3H0TB 3H9HA 5F1NA 3QA3A 4HK0A 1CXIA 3QXWA 4WY7H 4NQTA 2CPCA 5JQ6L 3OXSB 4XVUC 5CUSH 4M00A 3NTCH 4EKXA 2J5LB 1TCMA 1FL5A 3OAUH 5SWQA 1J86A 3D18B 2JTDA 2WSKA 3FT4A 3OKLB 2CLRA 5HI4C 1ETZB 4NM4H 3HMXA 2Z8WC 1YC8A 2ESVA 4F2MB 1QRNB 4XMKL 3MFGB 4PP2B 3SGJA 2YRZA 3U6RB 4FNLH 1MFNA 1RMFH 4U05A 3GFUA 4KY1L 1QBMH 3HRZB 1KYOK 4GW4B 2CIIA 1J11A 4FFYH 3B8SA 3OKDA 1S3KH 4NUGH 2VKWA 1FPTL 1GGCH 4LSQH 1RUAL 4AEHH 2BNRB 4MQTB 1E27B 5FECB 4UV4H 4N9OB 4FQ2L 3SDAA 3QEQE 3G6JA 1KTLB 4LSVL 4PBWD 4M7KL 3WIFA 4UV7L 5E00A 1ORSA 3UJIL 2Z31C 3QFJB 2PO6B 3NA4A 4I77H 4R8WH 3GSRA 3MMEA 5F6IB 1N7MH 1RZJH 3QNYB 2I07A 2P42B 2ADIA 3R0MA 1EAJA 3VD4A 5C08B 3RWEA 2W0KA 3ZE1E 4OZFH 2OBGA 5MEND 4HWNA 2PXYA 3VXMB 5DURB 3CH8A 3CK0L 1C1EH 4YXHL 4Z0XA 1LILA 3KS0J 4N90E 3L7EB 3FQRB 2QADC 5DSCB 3H9ZA 2GJ6D 3JZ7A 3VFRB 3RGVD 1F6FB 4KK9C 4PD4K 3IF1B 5HGGS 1YMME 2MJWA 4DKEH 5ICZA 4XVTH 4X4YA 4G8GE 4RGNC 2A73A 2CO6B 4ELMA 3O3DA 1BFTA 1YUHA 3QJHA 1NQBA 4O5LH 5HGDA 3VFUA 2ZSVB 5IMLB 1OM3L 4ALAL 1T0MA 4N5ED 4K7FA 3EYSH 3QIBB 1HILA 3QQ4B 1YEGL 4O4YL 4NHCL 3WLBA 5D8JH 2VXQL 4FQXA 4HHAB 4HGKC 5TE4H 2HT4C 3NFPA 1L7TL 5DMIH 4AT6A 1LO3L 4Y1AB 3NA9L 2A83A 5I76B 2CJUH 4G8EA 3GBMH 5IROA 3TO4B 1FNEB 5DYOB 4OB5L 5IESH 3BKJH 4XXCC 2IGFL 3UBXB 3M8OL 1OARL 2QSVA 2Q1EA 5FYKL 2VWEE 4X8JB 5EU5B 3RTQB 2GTZA 4QEGA 4MD4B 4P9HC 4OLXL 4GAGL 4LCWB 2HKFH 2NLJB 1F3JB 3DXAB 4G8FB 2NY0B 1MAJA 1KC5L 3WS6C 5I75C 3QAZC 2VDMH 3DVGB 1PG7H 1B6DA 1PLGH 4CRPA 1WBXB 1MLCA 3I75B 2V9RA 3LPWA 1Y18B 2C3GA 4TRPH 3QFDA 3O0RH 5I2IA 4C57C 4KMLB 1DBBH 3BPNC 4IDJH 1PZ5B 1RJZB 3WKML 3SJVB 1ZVYA 3UDWC 2B1HH 5C2BL 1BX2B 1FNGA 2X7LB 3GMRB 4WFGE 1VEPA 4ZPTB 4Y19D 4I2XB 1PX3A 4EQ2A 5LGHH 1NKRA 4R4ND 4M3KB 5IK3A 3QHFL 2Y06L 4O9HH 3VWJA 2CKBB 3RWGA 4G43A 1ZVSA 4BQCA 3TIDA 3VFOA 4LPUA 1KXTB 4XNYL 4CVXA 5TPWL 1ODAA 2YD1A 3WNKA 1JRHL 1MCLA 4LEOB 1F4WL 1DQQA 1MWAA 5D2NB 3BAEL 1N6QL 3KYOA 5IW1B 4GAFB 3UP1A 4XTRD 1A5FH 2O5YH 3WXVL 3VGEA 1I9JH 1RJYB 5HYEA 4Z7OE 4G6FD 2VZTA 4PRHB 4TUKL 1NANH 5EU6A 1GXEA 5I17A 5ENWA 2LVCA 3F8UB 4J3UA 1X4XA 2IAMD 4RMQA 5J57B 3RKDC 4L5FH 3G6DL 4MDIB 1EJ6A 3FO1A 2EYTB 1CGTA 1E4XI 3VRJB 1SEQL 4I3SL 5KVFH 4ZS7H 4Y5XB 1CR9L 3JTSA 4BYHA 2Y5TA 1LNUA 5CZKA 2R0WL 5GRVK 3SKMA 5T5NF 5E8NA 3BWUC 2APVA 3MA9L 4JR9L 4IOSD 1H9VA 2DBLL 3TESA 2FB4H 5KSVB 4OCRL 4YR6B 1T0NA 2E27H 1DUZB 2P5WB 35C8H 5H94A 2VLKE 1AY1H 2VXSH 1IT9H 3HZYA 1CL7L 1G9MC 5HYIA 5IVZA 3ZKMD 2LAGB 3RVXC 3ZO0A 2HJLA 2AXGB 1I3GL 2BVOB 5ITFA 3EO9L 3JWOH 1ZKAA 5B38G 4LMQI 5CEZH 1FAIL 4NM8H 2XN9E 3MXWH 12E8H 4PJ9D 4QT5A 5J3HD 4ODTH 2VR9A 3PWPB 4DAGL 4Q9QL 1F4YL 4CVUA 1FO0H 2I5YH 2EDHA 2DKMA 4XP9H 2OP4H 5FYKE 1LP9E 4KUZL 5IF0B 4QCIB 4JJ5B 4X7SH 1F11B 4F33B 4G6AC 1RUQL 1N3NA 3FT3B 4X7FC 1J87A 1YEDA 4NRXA 1LWRA 2DLFH 5HVHC 1DVFC 4LCUB 1EEZB 1FRGH 1M71B 2VZVA 3IDGA 4Q9BA 4XCYB 3N1QC 4G6ML 3UTSB 5FO8A 4LHUA 1VFBA 4Z7VB 3ZE2E 4C54A 5C07D 5BJTB 1I75A 4ZD3H 2Q20A 2UVFA 3MA7A 5EZOL 4DN4L 5GGRB 3CC5A 3KGRA 3WKNA 3FRUA 5E8DL 3QQNA 4XWGH 5INCB 1F02I 1QYGL 2R69H 3KPSE 4FP8H 5HJ3B 3DVNB 1AGEB 2DDQL 1AGDB 1MQKH 2BVTA 1FNLA 1G7IB 3ULVE 5D7KD 3DV4A 4FQCH 4EBQL 2VLLB 5E1AA 2D7OA 5GGVH 5DGQA 3RWCB 2CDFA 4FS0A 4P2CG 3KVQA 2QSCL 3VWKA 1V3MA 1RZKC 4N8VG 3SGKC 4ETQB 4ONHA 2NY1D 3V4VL 5KS9A 2AEWA 3DUUA 1IAMA 4PGDA 1LE9B 3L9RB 1EX0A 4GKNB 4MLIA 3RZCA 2BCKA 4PRPA 3MV01 1PDKA 5F1IB 3U1SH 4DQOL 1AKJD 2DWDB 3HR5B 3CLFH 4X4MA 5JZ7C 3P2TA 2YZ1A 5I1IL 4U1KA 1TPXB 4OV5A 2Z92B 2NX5B 3ZE1F 4I0PD 3RL1B 4PJAA 1ULVA 4OGXH 1JNLH 3QUZD 3MV9B 4QLRA 5DQJA 5IHUH 3P0VH 3EJYC 4GRMA 4DUXA 2QQLL 1OQOA 1S7TB 4ZUSA 3FFDA 4OQTL 2H6PA 3ARFA 2XWJB 3DNKA 1IEBB 1FVDA 3SDDC 4EQ3A 2RB8A 3WJJC 1IM9B 5EWIH 2BVEA 1J8HB 2X4QB 1TVHB 2XKNB 4P59L 2VB5A 3QDAA 2H26B 1CD9B 3EZJB 2IJ0C 3LZFH 1K4DA 5MHSD 2HJKA 3GSVB 3BFOA 1P7QA 4J3XA 1NCCH 3P9MB 3WFDH 3O9WA 1IVLA 2GSGB 2XWBB 1T1WA 3QCVL 1NJ9A 1NCUA 3QUYC 4BZ2H 9CGTA 3LQZA 1UCBH 4M6ML 3CU1A 3J8F7 3AY4C 2XTJD 3HS0A 3ARYA 3QQ3A 5I71B 4PS4L 3NACL 5E2UH 1BIHA 2KPNA 4NQEA 3M17A 3RNQA 3DURA 5CINH 4YX2L 4P5MA 2EIBA 4R97B 5L7XL 3KAAA 3L3HA 5I1KL 4NJ9L 1OF2A 3BXNB 2YD8A 2EDJA 4ERSH 4WV1A 3FO0L 2A6JB 5ADOH 5T1KB 4XPFH 1AHWA 1WBZB 2YA0A 3NCJL 4LP4A 3G04B 4YHKL 5JW4N 5HYSA 4XP5H 1XZ0B 2J4WH 1QEWB 3RGHA 5JIIA 3BYYA 4K94H 1U8KA 5FK9A 5HHXH 3U7WL 4U1GB 1NUDA 2W9LA 2Y1VA 4XNMB 5MENB 1OTUC 3GRWL 4QRQA 3UJTL 2NW2B 4LKXA 1TETH 1QR4A 4PJHA 2EYSA 2VIRA 3DMMB 3OXRA 1N6UA 5FYJU 4MNQB 3QDJD 5C0BA 3MGTA 1X5HA 4FTVA 4PREA 4YE4L 5GS2H 3QUKA 4HBCH 1A2YB 4GMSH 4FFVD 1KCSH 3GGWB 3LN5B 1WFNA 4U1SB 4NGHL 4L1DA 3LSOB 4HX1B 5L2JA 2AQ1A 1BLNB 4MQSB 3GHEH 4NQSB 4XBGB 2R0ZH 2AJZA 3B6SB 4NN5C 4F7CA 3IJYA 3P30H 4HG4J 1DN2A 5C0GA 4PY8J 4WW1A 4RWHA 3EOTL 3VXSE 4UT9L 5C6PB 4TVSa 5FDWB 2VJXA 1CLYH 1A9EA 2BSED 1OGAE 2D7TH 3RVVD 3BI9X 4XHJD 3B3IB 2YXFA 4M4PA 2R9HD 1C12B 3C87A 5DS8B 2A6IB 1ZTXH 4GT7A 5JW5B 1UXSB 1HQRA 2F19H 2HTLD 5HBBA 1XFPA 5BO1H 1IZJA 3AMLA 4KROC 4D3CH 1R5WA 2WNGA 1ZWIA 3VXTB 3D0LB 4NKDB 1CE6A 5GSVB 2JELL 1OWWA 3FB5A 4LNRB 4ZFZB 4MDJB 5HYQA 2MQ3A 3W9EB 2BERA 2BNRE 3JSSA 4YDJB 1TZHA 4Y8AA 2EDBA 2N4IA 3HTLX 5KVDL 1DP0A 1JGVH 4ODWA 4FRWA 4A6YL 3LQMA 4NKMB 5GGUB 5SX4H 1VFAB 4JJHA 4QRPE 2CKBL 3V5DB 1ZHBA 2HMID 4WGWB 3L3GB 3LKOA 4YQXL 4LCYB 4FFWC 1X5XA 2OTWA 1TMCB 1C5DB 5JPMA 3ARBA 1LK2A 1P5VA 4LRNH 2WQ8A 4WTXA 4HUVB 1MNUH 1S7SA 2WUCL 2W0PA 5D6DA 4HS3A 3S88H 4NQDD 3VE0B 2C1OA 4S1SL 1UACL 2OM5A 1BFOB 4MJID 3S35X 4GOSA 4UTBH 3MUHL 3MNVB 1J1OH 4NO3B 1A1NB 1PKQB 2V5SA 4XPTH 1S7XA 3QG7H 1QKZH 4KMTL 4G80B 2GFBB 1FL3B 1Z9LA 1BM3L 3C6LA 4QTHA 4JO2H 4PJ5A 3PGDB 2BFVH 4TTDC 4D8PA 1J0JA 3LB6D 4DN3H 3WFCL 4LK4A 3QEUB 2BSRA 3QIUA 4Z8FH 3N9GL 5GIRB 2WWKT 4XC3L 1WFTA 5IJKC 3BZEA 5F9AC 1MIEH 3IDMB 3C8DA 1AXSA 4JFZH 3ZKNC 3QUMH 3GI8H 3INUL 3MLUH 1QFWI 1J1PH 3TN0C 5KANG 1G0YR 3MRLA 1G9NL 3KPLA 4JVPA 3HLAA 3ZE2F 3T0EA 1JGUH 4UILL 1BZ7A 5EIQA 4Z7UA 1PX4A 4UI2A 5KTEL 4NPYA 3QDGE 1IC4L 3D3VA 4NKOA 4OZFG 4WI6A 1KCVH 4Z18A 4YPJA 3F58H 4WVRA 5DJXA 1ZSDB 5D5MA 3O8XC 1MHHB 3GJEB 4G9DB 4JQXA 4QHMB 5GJSL 1IAII 4I3RH 2B8OT 3ULVF 3NGBC 3N50A 3V6FA 3EFDH 2DYPD 3SN6N 3S34H 1AFVL 3P40A 3UTPE 3VI3E 1B4RA 4O02L 4PJ9B 3Q48A 4GRLD 25C8L 2BXYA 2R8SH 2CR6A 3CFCL 4HQQL 4APQD 4BSWB 1KIUA 3B5HA 1U8JB 3NPSC 1JWUB 5JIKA 4NZJA 4UT6H 3T3ME 1X9QA 2KDGA 4PUBL 5AZEH 4R96A 4M93C 5DJYB 5GGQL 4LLUB 1L9MA 3LVEA 1JYWA 1XGTB 3BKMH 4DCQB 4K3JL 1P7HL 3TJEL 3MTRA 1ZANH 1FN4A 4MCYA 3JV5A 5C86A 2GUOB 4X5WA 4OI7A 2FATL 4JRYA 3HE6C 4BSVB 5CBAA 2AW2A 3TFKC 4DK6A 3B43A 3HNVL 1YQVH 1XGQA 5T3XD 2LAAA 1M6OB 5EB9A 4JG1L 3V6OC 1NBYA 2H2SC 5C0JB 3REVB 2W9DH 3EOBB 2H9GA 1E6JL 1XR9B 3MRPA 1YC7A 2AJUH 3QUXB 4OZFB 4W6WB 1WGOA 4WU7A 5F7EH 3OG6B 1KIQB 1QHPA 1KF9B 1FFNA 4WEBL 3U83A 1QO3A 4XP1H 4UTAL 4EOWL 1VACA 2MFNA 2D9CA 3QPQC 4F7PA 5JORB 5HI3D 1RULL 3RDTB 5F89B 1U8HA 3BESR 4PRHE 1RAMA 3MRBA 3LN4A 3QDMB 3RIFK 1Q94B 1T83C 5GS2D 3VMOA 1F8TH 1CF8L 3PXJA 4H0GA 3OB0K 1MF2H 4WI4A 5LBSH 3MX0A 3QWRD 3ZT6A 1EVUA 2OI9C 2B0SL 4LSRL 3OGCA 1U6AH 2APXA 2WBJD 5I1LB 2CLZB 4CAGA 4Z0BH 4JFOA 1IGTB 3E8UH 4FABH 3O2DH 1HI6B 4XP4H 3MLYL 3CSYB 4NT6B 1AQDB 4XMLH 3ARRA 1CGXA 4GAJH 2L7UA 1SY6H 3AU1B 4JVWA 4C56B 1KN4L 3OJ2C 1UWXK 1TJHL 2FWOA 3IAQA 2IWGA 1ACYL 2EIEA 3VI4E 1KXQE 4KVNH 3PHQB 1N2RB 4WUUA 1X5YA 4Y5YA 1YYLH 4YBLB 3E2HC 1T5WA 4J3OC 1VCAA 7CGTA 5CLWA 1C5CH 4JFFA 4LCIH 5EBWB 4PR5B 4RFOH 4WWKD 4UINH 1QSFE 2N1KA 2IH3B 3KR3H 4YGAB 5D7SH 4WI9A 1CICD 3BKCH 2O5XL 2ORBL 2OMNA 3O6KH 4X6CE 3EYOA 3U2SB 1UYWH 5DZNA 3O6LL 1KNOA 2AEPH 4MAYC 3KPSA 1K2DA 5DLML 5ICYB 4KUCD 4NZTL 3MLSL 5KW9H 3DRQA 4JREC 4WW2C 1FFRA 2VXTL 1IKNA 4EDXA 3MR9B 3V7AE 5HDBE 1S7UA 2ATKA 3MJ8A 1T1XA 3KYMA 1BMGA 1M05A 5C0CB 4ESKA 2E7LA 5DDHB 3WDIA 4HIHB 4PGEA 1I7RA 3CUPA 2JIXB 3MUY1 3TC9A 4HFWB 4FQJL 2EE2A 1YJDL 3GI9H 4N0FA 1NFDB 2XTJB 3BZ4B 3ZYJA 1QUNA 1N5AA 1FL6A 2EXYC 4BELD 1BD2E 1ES0B 1NCNA 2ITDA 3WJLC 4OIIL 4XC1H 3LQAL 4B0MM 2EXWD 4WHTA 3VU2A 4GQ9H 4ZAKA 3WFHA 1I1AB 2GQHA 3WXWH 5SWSA 1A6WH 4OZGB 3QEGH 1DBJL 2E7MA 5F7HA 4JY6A 4P4RA 4PRAB 1NAKL 1WSST 1BGXL 4S2SA 3BPCA 3MRNA 5HHMD 5BXFB 4RQQB 3SKUD 4G7VL 1T4KB 5IB1A 4TVPH 1CIDA 1T22B 5A43C 2DQCH 3QG6B 5F7NC 1NLBH 4Z7WA 1EJOL 5EBLB 3ORJA 2BRQA 1E4XH 3G6AA 4FHBD 3T2PA 5DI8B 5DHYB 43C9A 2PN5A 3FQXB 1S5IL 3W39B 5HHOA 4OFDA 5IQ7L 4WWID 1A47A 1JHTA 3TZVB 4L3CA 5ANMB 5DF0A 1Z3GH 4HKBB 3BDYL 4HMCA 5IFAH 2HLAA 1W0VB 2GEEA 5DRXA 1VB9A 5FGCE 2X1XR 1SQ2N 4DKFH 4KK5D 5I19L 3ILQC 3N0PB 4JN1H 4I5BA 3TCXA 2OTPA 4JANB 3Q1SH 1KJ3L 1S9YB 2P7TA 2E5EA 1PQZA 1D9KD 5FYJD 2BY1A 5F7YC 2AV7B 3WFZA 4H8WC 2BSTB 4OCYL 1U8IA 4OD1L 1N0XL 5ALBH 3RY6A 1B3JA 1U2HA 1YZZA 3H7LA 3E6HB 1XGUB 4OUUB 4JFXA 1R0AL 1VSCA 1Q9OB 3VXNB 1FVEB 3JV6A 5EPMA 2I25N 4N8PA 3WNPA 4PTUA 2ICES 4IRJC 4P2RB 5M94B 1G7HB 2OJZL 2Z8RA 3ZMRA 2YS4A 4OCLC 1YDPB 1DEDA 4GBXC 4PV8B 1FO0B 1UKTA 2OTUA 5EBGA 3B2VH 1BOGA 5D1XB 3SQOH 1RURL 4OKVA 4U1IB 5LCVH 1U41A 2F8XC 1JPFA 2X1OA 4LARH 5BS0A 4ORZC 1DBAH 4OLYL 1N5YH 4GG6A 5E2JA 2WZPD 2F74A 5GRJL 1MAML 3X3GH 1RJLA 1DBKL 5IFHH 3CLEL 3GNMH 4ZFGH 2F54D 3T65B 4JO4H 1ZVHA 2R4RH 4NQCA 2R2EB 5E7BA 3CVHH 3LHPL 2NXZC 4CW1A 4PGBA 2Z93A 4R0LC 1SYVA 5E7FA 1IZKA 2ZUUA 4OF7A 5AYQA 5DUML 3VGAC 4XPHL 3PWJB 1MSPA 1ZEAH 1WZ1H 1TLKA 4XVUD 4FQLH 4PJFE 2DQUL 4HKXA 1WZLA 1U3HB 5T1MB 5D7JB 4ZUWB 5FUZL 4ORGB 3EAKA 3H0TA 3HE7C 1IRAY 2BNUB 1IGCH 1DQLH 4E41B 5IWLA 3OXSA 3TM6A 4JQIL 4AM0A 1D5IL 1KYOJ 3VI3F 1T03H 1MJ7H 4Z78B 3D18A 2E9BA 4U6TA 4OLWH 4OM0H 4ENEC 2CIKB 1BVZA 3OKLA 2OR9L 3Q6GL 5DFVC 5MENE 4JO1H 3GHBL 5CHNB 1KCUL 4F2MA 2VERN 7FABL 3PQYD 5DZLA 1FZKB 1QRNA 2XYCA 3T3MF 4H88H 1X4ZA 4PP2A 5F9OL 3U6RA 2MSPA 4Z95L 4OLZL 1D6EB 4OQTA 5E6IC 2GJ6E 3HRZA 4KRLB 2ZCHH 4GW4A 1DCLA 1YMHA 1GPOH 4WY7L 3VXPB 1LO0L 2J3SA 4XPBH 2AJVL 3UCRA 2Z31D 5JIPA 1E27A 2X89A 5IIEA 5DEFB 3S3SA 3TBYB 4P23B 3SKOB 4N0RA 4L8BB 5JW4Q 1KTLA 5ICXB 3DRTB 4NM4L 4HWEH 1VFMA 4W68A 3KG5A 2E7CA 1UG9A 4KKBC 2AEQH 1DDHB 1I9IH 2PO6A 3QFJA 3RWHB 4FNLL 1OP5K 1RMFL 3F7QA 3AROA 1XIWC 5L8KB 1QBML 2J6EH 1Z9MA 4PBXA 3CU7A 3HI1B 4FFYL 4FMFA 3QNYA 1S3KL 4NUGL 4TSAH 1GGCL 4HIIB 5FAAA 4LSQL 4GKSB 3S8WA 4PJ8B 4PD4J 4LLQB 5C08A 4XGZB 3BUTA 1F58L 2QADD 4UV4L 3VFGH 3I3BA 1EFQA 3U46B 1A14H 3VXMA 3C60C 1VEOA 3M1BB 2XA8H 4Q6IC 4RGND 3IDUA 3GUTA 3L7EA 4X6BB 4GH7B 3FQRA 5DSCA 4R8WL 4WFED 4Y4FB 3VFRA 3LOWA 1FP5A 4K2UH 3IF1A 4MZ3A 1N7ML 5A2LH 5DJDB 2HT4D 4PLKC 5EC2B 5DRWB 3B9KC 2V6HA 3VI4F 2ZSVA 4WI3A 5IMLA 5F7WC 3N1FC 4YWGH 4LSPL 3MRQB 5GGTH 3QIBA 3QQ4A 5D7LD 1CXKA 4ODXB 1LMKA 4MJ5B 4HHAA 3MYJA 1C1EL 1KT2B 4MA8H 2IADB 4Z7QF 1ERNA 1R5VB 1G6RH 4KXZH 4JFYB 2VLJD 4PRID 3MV11 4Q7DA 4BQBA 2DICA 4PJBB 1CLOH 4MVBC 4Y1AA 4Y19E 5E9DD 5I76A 1T7YA 4JY5L 4G7YH 5HYJB 4X6CF 3TO4A 4HJ0C 5KG9B 4XVTL 2ARJQ 2YHGA 5DYOA 1U3ZA 3UBXA 4O5LL 1XGPB 4O2CB 4BQ8A 1A6VH 3SO3B 1XAUA 4X8JA 3EYSL 5EU5A 3RTQA 4LVHC 1QRKA 4MD4A 2ZJSH 2EC8A 3GB7B 1QG3A 1TIUA 4JFDB 3P77B 4LCWA 4M03A 2NLJA 5D8JL 4K8RH 1F3JA 3DXAA 1BEYH 2LVEA 5HDBF 3UTTB 1H5BB 1HHHB 5EDXA 5TE4L 3GKWH 4P99A 3DVGA 5DMIL 5EOCH 1WBXA 2QQNH 3GSQB 5D96B 4YFEA 4DW2L 3GBML 5E2TH 1JPSH 3I75A 4Z9KB 1A64A 2YK1H 4NJAH 1Y18A 4KZEH 4DGVH 4DZ8B 4F37K 3BKJL 5CP3A 1PZ5A 1UZ6E 1RJZA 1MHCB 4Z7VF 3SJVA 2VDKL 1BX2A 2X7LA 2IAND 3V8OA 1EZVY 4I48B 2HKFL 4PJIE 3ULVC 3GMRA 43CAB 4ZPTA 2EDTA 1BVKB 4I2XA 1KFAH 2FBJH 2VDML 5JXEC 1PG7L 5F1SA 4CMHC 2CKBA 1PLGL 3O41B 1I7TB 1GGBH 3K1DA 4AEEA 3ZTJH 1RZIB 4I1NB 2H2PC 3MRDB 3MLXH 2CDEB 2F58H 4TRPL 3LAFA 3O0RL 5FUOH 3TGXA 1CGSL 3BW9B 4IJ3C 4LEOA 5HHNB 5D2NA 1DBBL 4IDJL 4HK3N 3RKDD 5IW1A 2B1HL 1NGPH 1I9EA 5CD3B 1RJYA 1AIFB 3BP7B 4S0TD 5B8CB 3RVWC 1A7BA 3ETBF 4XP6H 3VXUB 5LGHL 2DLEA 3PUCA 4O9HL 4BH8A 1IC1A 1INQB 4MDIA 1E28B 1R5IB 1WTGT 5GRWA 3VRJA 1J5OL 1MCQA 5I74C 4Y5XA 1B0WA 3MLPA 1I8LC 1YPZB 4KQ3H 2VYRE 1F4HA 4NN7B 4LSDA 1A5FL 3CXDL 3EDKA 1IQDB 3RVXD 4AIZB 1I9JL 2VUOA 5KSVA 1OAKH 2VDLH 3OV6A 4YR6A 5BVPH 2P5WA 1DUZA 5I1CH 1QBLH 5KSBB 3AREC 1UJ3C 2ICWJ 3D87B 4L5FL 3FB7B 4IMKC 4HIJB 5L2KD 4MJ4A 5C07E 5C09B 3MC0A 3O6FC 3RWFB 4YXLH 3ARDB 1JRHI 4QTIH 5KVFL 2AXGA 4ZS7L 2BVOA 3MXVL 2C5DC 2WMPA 4P0DA 1Y6NR 2KKQA 2K3TA 4AEFA 1B9ZA 5DZOA 5EZIH 5F1OB 4GW5B 1BQHB 3PWPA 3KJ4B 1NCTA 4V2CB 5D7KE 2E27L 5ECJE 35C8L 4HCRL 1QFWH 4R7DA 3WUWG 1U3YA 3QUMB 1AY1L 4KK6C 5IF0A 2EH7H 2VXSL 4QCIA 1DVFD 1IT9L 4JJ5A 2DM4A 4F33A 3S37L 5HD8C 3VFMB 4PJFF 3MBEB 3UX9B 5F9WB 3TA3B 3FT3A 2A6DB 5I16B 3EO0B 5CEZL 3D85B 5JDSB 2FSEB 3ARVA 4NM8L 4LCUA 4ODTL 3V8CA 3VXOB 3FMGH 5I9QB 1EXUB 1M71A 1I8KB 2CK2A 3LD8B 4XCYA 3VFSB 1IAIH 3UTSA 1FO0L 4XP9L 2OP4L 3BN9D 3UMTA 1MPAH 4WGVB 1CL7I 1NC2B 4Z7VA 5AG9A 2FGWL 3AAZB 1EGJL 3OAYH 1W72L 4OGAC 5I73B 1BZ9B 2R29H 4MA3B 3L3DB 5INCA 5ADPH 4ZUVB 1OCWH 4PJGE 2ZUVA 2DLFL 5HJ3A 3K74B 4P2OC 1AGEA 4MYWB 1AGDA 3QIWB 1G7IA 2EDRA 2VLLA 3RWCA 3L7FB 2WANA 3MZTA 5MHSE 2CRIA 2DQTH 3O4OB 3WUWB 1DQMH 2R23B 5J13B 4ZD3L 4ETQA 4JRXB 1VPOH 3AXLB 5DFWH 2A9NH 2WLZA 1I9RL 3SDCC 2DB8A 3LS4H 4HDIB 5JZ7D 3C08H 5JTWA 4XWGL 1NFDE 2XTJE 3L9RA 3DROB 4GKNA 2R69L 4FP8L 3EJYD 5F1IA 3DVIA 3PWUB 1VDGA 1MQKL 2DWDA 3HR5A 4DVBB 4OF6A 4JKPH 1ZHNB 2ENYA 4FQCL 2HLFC 4HXAH 3SDDD 5J06A 5GGVL 3T0XA 4NC0B 5D72H 3KPOB 2Z92A 2NX5A 3RL1A 1PG7X 3SE3A 1YY8B 2IFFH 3FFCD 5IJVA 3MV9A 4QXUH 1LK3H 4QRTB 5CSBA 3MYZA 1S7TA 2QSQA 4U6YB 1K3ZA 4UDUB 1Q9WB 2X4TB 3WO4B 2XWJA 1IEBA 2Q8BH 2FCBA 4MAUH 3QI9A 1IM9A 4LCCC 1UADC 1J8HA 2X4QA 1TVHA 2NY3C 3BDXA 2C4FT 2XKNA 2H26A 3CLFL 2Y72A 4RAUA 2X6MA 2YA1A 2Q76B 2FH8A 1AO7B 5C9JB 4NO0D 3GSVA 5CCKH 2Z91B 1UH3A 3RVUC 3QDJE 1NBQA 3MRRB 4ZO7A 4OGXL 1KIRB 3X12B 3P9MA 3QQ9C 5IHUL 2GSGA 3P0VL 2XWBA 3MUGB 1NMCB 1HOCB 2D0HA 4NC1C 4HWBA 3ZT5A 4QHNB 1JN6B 5FB8B 5HGBB 5A2IH 5DD6B 5EWIL 5KAQG 3PXHA 1BPVA 3F5WB 5A40E 1FDLH 5EUOB 3BXNA 3T0AA 4F7TB 1BIIB 5E70A 2IG2H 3BH8A 3LZFL 3SGJC 4K3DL 2A6JA 5T1KA 4CN1A 2VLRB 1WBZA 4FXKB 1OTUD 1NCCL 3G04A 3WFDL 2RAMA 3ZKXC 1CG9B 2LE9A 1XZ0A 1B6UA 3HKFA 4WU5B 3WS3B 1T1YB 1UCBL 4J3WA 3S5LG 4M6OH 5GPRA 4YHLH 1P2CB 5E2UL 4PJ7A 3MLRL 1BJ1J 3SDAC 5IT2H 5CINL 2BDNL 4XNMA 3L5XL 2FJGB 4ZSOB 3EOYG 2NW2A 1HSBA 1U8LB 1OOAA 3DMMA 4MNQA 4ERSL 3C09B 5ADOL 1C7TA 3V0VB 1HHJB 3I84A 3TYFA 5ABDE 3TPUB 2YD6A 1ZLWH 4RIRB 5T3XL 4PJIF 3S9DB 1A2YA 4XP5L 3GGWA 2J4WL 3I6GB 3LN5A 1D5ZB 2M8XA 4MSWB 1OTSC 4M7LT 5HPMB 1T7ZA 2ADGB 4K94L 5HHXL 5E08H 3LSOA 4HX1A 5LJYH 1J0YA 5D7LB 4ODHL 1BLNA 1RUKL 3MREB 3RP1A 1YYMH 4NQSA 4XBGA 3WIIL 1TETL 3BPOB 2B7DT 3B6SA 3R8BB 4XNUH 2GITB 5EZJB 1HKFA 4AJ0A 2J2ZA 2DLIA 5E9DB 3MACH 1CXLA 4NQDE 3KPPB 5FDWA 4PPTA 4TNWF 1KCRH 3C5JB 4HBCL 4UOW1 4MJIE 3B3IA 2YUVA 1KCSL 1QFPA 1C12A 5DS8A 2A6IA 5I75B 1VA9A 5JW5A 1UXSA 3MBXH 3S5LB 4LVNC 3UAJD 2HVJB 1IC7H 5IMMA 4MMXC 4F9PA 5JMRA 3VXTA 3D0LA 4FQXC 2WBKA 4KI5C 2R0ZL 4NKDA 5GSVA 2GCYB 5HVGB 1RQ5A 4LNRA 4ZFZA 4FFWD 4MDJA 4FA8A 3BPNB 3P9WB 2MTPA 4YDJA 3G5VB 4OSUH 5I6XB 2D2OA 1PD6A 4P9MH 5DMGC 1L0QA 3AB0C 4NKMA 5GGUA 1CLYL 5IROC 3X3FH 1VFAA 3UJJH 2ILLA 2D7TL 3VFVA 3V5DA 2GY5A 1FNSH 1BQLL 3L3GA 4LCYA 1QFWM 1EAPB 3QCTH 1PYWB 5TE7L 3UBXI 1ZHKB 2F19L 2OL3H 2WLYA 3O3EB 4OZ4B 3DV6B 1C5DA 4HS8H 5BO1L 2ZPKH 4D3CL 4PRNB 3BGAA 3WV0A 1REIA 2DJUA 1L0XA 3T4AA 3O4LD 4JFED 3VE0A 1EO5A 3G5ZB 4TTDD 3MV8A 1JGVL 1CYGA 1BFOA 4MB3A 2VUYA 2WINB 1TJIL 1MHPL 3MNVA 2UZIH 1A7PL 4UQ3B 2IMNA 5DC9B 1IAIM 4FQIH 4LLVB 1U8QB 4HKZB 3T0BA 4NO3A 2RCSH 1A1NA 1PKQA 2R2CA 4DFHA 4G80A 2GFBA 1FL3A 4KGLA 5C8JA 4CL7A 2A38A 4Y4HD 3PGDA 5F7DB 5AUMB 2YRLA 3CVHB 1IMHC 1PJ9A 2A1WH 2DMBA 4AENB 3QEUA 5GGSY 1A3QA 5GIRA 3VMPA 3S88L 2OZ4L 3VWJC 1UZ8A 1XGYH 4U2ZA 1QFUH 3MV7D 1MCRA 1FIEA 4J3SA 5LKNA 3IDMA 4P2QD 3KPRB 3QDHA 4UTBL 1K3IA 4QHUB 5FYLH 5IB5B 1J1OL 3RVTC 3O8XD 2QL1A 2CO7B 3ARZA 5EORH 1Q9LB 3P4MB 1QKZL 1MI5D 5T3XE 4JHBA 4PJBE 4JO2L 1HIMH 1OTTC 5A3IC 5GISH 3VXRD 2HVKB 1ZSDA 3O11B 4UOW0 3S36H 4PJGF 4K71C 4Z8FL 1MHHA 3GJEA 1U95A 1PFCA 4G9DA 3WIHH 4QHMA 4N8CH 4NBXB 1UA6H 1QFHA 3F7VB 5L2KB 1MIEL 2JJTA 4JFZL 1MY7A 4Z77A 3GI8L 3MLUL 3D2UD 2DRUA 2AVGA 1J1PL 3K8KA 1F42A 3HMWL 2HTKC 1JGUL 2BNQB 3N1PC 5I8CB 2CD0A 1JUFA 2YSSB 4CJ0A 2APFA 4BSWA 5K9JL 1U8JA 1JWUA 3HE6D 1NFDF 3TFKD 1CD8A 5DEZA 5DJYA 4OF0A 4LLUA 1Z6JT 2H2SD 1AQKL 2F9BT 1XGTA 5HVHB 4I3RL 3KHQA 4DCQA 3QPXH 4R2GB 3OJVC 5DUPH 4WRLA 1BBJB 4Q74A 1U8OB 2GUOA 3EFDL 5C0AB 5E5UB 1UWXH 3EDFA 5IVOA 3S34L 5T1DL 3C2AH 1IGMH 1M6OA 1KEGL 1FYTD 4GW1A 3REVA 4EN3C 5C0JA 2VAAB 3QPQD 2R8SL 3EOBA 1Q9KB 1ZLVH 3V0WH 1XR9A 3QUXA 1IAOB 4OZFA 4UT6L 5TH2B 4XMKH 5AZEL 1J0KA 1KIQA 1NBZB 3KWWB 4OQ1A 1FIGH 4PLOB 1ZA3B 4L4VD 1YY9C 3BKML 4M6NH 5JORA 1ZANL 3RDTA 5F89A 5E1HB 3QDMA 2CDGB 4X4XB 3MJ9H 1Q94A 1YQVL 4D9QD 4QXTB 4UIKH 4FQ2H 3JWDH 5AEAA 2RFXB 4QRRB 1TQBC 5M95B 4JDTH 3BKYH 2AJUL 4UV7H 5I1LA 5K9QI 5D71H 1YN6B 3BD4A 5F7EL 1IGTA 1RV6X 2GY7B 3FCTB 4KKCC 1HI6A 3CSYA 4NT6A 1AQDA 1QLEH 4KKLC 1G6RB 4N9GA 4E0RB 2FEDC 1DSFL 3AU1A 4C56A 1AP2B 4ZG1A 5IW6B 1BVLB 1GZPB 1TVBB 2F15A 2DAVA 1F8TL 1RHHB 3PHQA 4Q6YA 1MF2L 2F53D 1N2RA 5E4EC 2BZDA 3OR6B 3PP4H 1S7WB 4R4BB 5L0QC 1U6AL 4AK1A 1CQYA 3OAZH 5EBWA 4Z0BL 4PR5A 4MAYD 3O3AB 3O3UN 4J6RL 3W2DH 3E8UL 3VWKC 2FIRT 4FABL 3O2DL 2DJSA 2IH3A 5HHME 1EIBA 1RU9H 4XMLL 5D4QA 4GAJL 1U93B 2Y7QB 3U2SA 3WBDA 3QZWB 5H37G 4TNVK 1OM3H 5ICYA 3RZCC 2I9LA 3IETB 3HC3L 1F2QA 4O4YH 3QUYB 4OCSH 1YYLL 3ROOB 2EC9U 1WZMA 4MJ6B 2VXQH 1C5CL 3BIAX 1HQ4B 3MR9A 4LCIL 5HSFA 1YEHL 3IFPB 2EXYD 5C0CA 2IF7A 4RFOL 5DDHA 3FTGB 4HIHA 4K7PX 4YBQC 1AGFB 3KR3L 5D7SL 3WL9B 2ICEB 2HH0H 2JIXA 3BKCL 3CDCA 4HWUA 4HFWA 3LKSB 5IBUG 3WFEH 3O6KL 1V7NL 3ARFC 2DBJA 3BZ4A 3RUGA 2IBGA 5DJZB 3M8OH 1OARH 1ES0A 4KPHH 3NIGE 5FYJE 4OJFH 5FYKH 3ZKQD 3PGFH 5KW9L 5JHDB 1I1AA 4OZGA 2NXYB 4OZIE 3ZHKA 1KC5H 4X9BA 4X6DB 5HDOA 4I3GA 4PRAA 2DLHA 4TUOB 1H8OA 3MRGB 5BXFA 3O9WC 4RQQA 1BF8A 1T4KA 1FG9C 1T22A 4L4TB 1WV7T 3MO1B 4P46A 2A6KA 4OCMC 3GI9L 4YDKH 5E0QA 3MRCB 5EBLA 1EUTA 5DI8A 4POYA 5DHYA 1MCJA 3FQXA 5FYLD 3ILQD 4YC2C 3W39A 5C2BH 3GMQB 4ZFOB 4GQ9L 1NFKA 3F7YB 3TZVA 2F54E 5ANMA 3UPAA 4BQ9A 4HKBA 4WV1C 1P4IH 1AHWC 1W0VA 4PGCB 3B8YA 4ZTOH 3QHFH 4DEPB 5IUSA 4KU1A 2XV6B 4TVPL 2I9TB 32C2A 3FHQA 2DQCL 5CP7A 4XXDB 3TIEB 4JANA 4P9HL 1NLBL 3EFFB 1S9YA 4IRJD 3ULVH 1A4JB 3T77B 4CDGC 1E4XL 5SV4A 2AV7A 3MQIA 1F4WH 3BQUD 1LDPH 2DTSA 5KBNC 2BSTA 3BAEH 4GBXD 2YN5A 3DX6B 3E6HA 1XGUA 1Q9OA 1MLBB 3VXNA 1FVEA 4XBEH 2HP4A 2DKUA 1OAQH 4P2RA 2RBLA 4PG9B 3F12B 5IFAL 3UTQA 5DC4B 1YDPA 4PV8A 1JNNH 4KROB 3ZT7A 1FO0A 4DKFL 1CT8B 4JN1L 3ZSTA 4LRIA 5D1XA 3IB4A 1PVHA 1W0WB 4U1IA 4I3SH 3PQYE 1JWMB 3Q1SL 2NXZD 4PG2A 2A74B 1J1XH 5DGRA 2V7NB 3LMJH 2FZ3B 3HUJB 5LWYH 2AJ3A 4UBDD 3LKQB 3DX7B 1WEJH 5DD5L 3SY0B 2DBLH 3T65A 3DUSB 2R2EA 2V2WB 4WFFD 4XAKE 4FFZH 2HJFB 4W4NA 1VGEH 4W70A 1SBSH 3VG0L 4JKMA 4LPYA 4PJBF 4MNGE 3DHMA 1KPVB 3PWJA 1T04B 1UENA 4C58B 3PGCB 3RY4A 3SQOL 1XCQB 2UZXB 1EK3A 5LCVL 1U3HA 5T1MA 1U3JA 5D7JA 4ZUWA 4LARL 2X2YA 4ORGA 3BO8B 2GJZB 1DBAL 1JP5A 4ENED 3BHBB 1N5YL 2IAMC 1FORH 4NN6C 2BNUA 5DFVD 4NOBA 3X3GL 4OUOA 2OMBA 4V2BA 4E41A 3GNML 5IFHL 4U1LB 4M48H 5D70H 5DO2C 1F4YH 4JO4L 2R4RL 3FRPG 2ZKHH 2NY6B 1RZ7H 3CVHL 4M5YH 2JCCE 4Z78A 1JMXA 5FHBL 2IC2A 2CIKA 1ZEAL 4JLRB 1WZ1L 2NW3B 3KNBB 5CHNA 1FZKA 1NCBL 4RGNE 4S11A 2BOCB 1WCQA 2EDNA 4JVUA 1D6EA 4DZBB 1L7IL 1MCSA 4WFEE 3ARBC 1IGCL 1DQLL 2QLVB 3S3PA 2FIKB 5DJAB 3VXPA 4NBZB 5H8DA 4Y16B 3TN0B 4DWHA 1G9ML 4KKBD 3HZVB 3DYOA 2NCMA 3RWDB 1WFUA 1MIML 5DEFA 3TBYA 3ULSA 3U9PL 4P23A 4IDLA 1XIWD 3SKOA 4L8BA 4OLWL 5IEKB 3MV7B 2BVUA 1CFQB 1GGUA 2EEBA 5ICXA 3DRTA 5EZOH 3KPQB 5D7LE 4JO1L 2IPKB 5J3HC 4DN4H 3UTZB 5DT1H 4RX4A 2VQUA 4XX1G 2QR0B 3RWHA 4QOKD 4GXVH 2VLJE 3BEVB 4PRIE 1KCKA 1A6ZB 4MA1C 5E9DE 5J11B 2ZCHL 3HI1A 2ZUSA 3C60D 1GPOL 3R0NA 3S6CA 4UAOB 1D5XB 4HIIA 5SWZB 1NGWB 4GKSA 4EBQH 4XPBL 2BY0A 4PJ8A 4LLQA 1MUJB 2FHFA 1T7WA 3QIUC 4ODUB 4XGZA 2P8PB 5MI0B 2K7PA 3GSNA 3X11B 4KUCF 5T5FL 3U46A 4ZYKB 4HWEL 5JA9A 3OB8A 1D5MB 3M1BA 1RZFL 2K9UA 3B9KD 4M93B 4X6BA 1I9IL 4HC1H 4Y4FA 3AFLA 5IHZB 4WDIB 2J6EL 5IKCB 4WHYH 2X70B 4DQOH 3DBXB 2C4XA 5DJDA 2BHZA 3CFEB 1MRDL 3RWIB 2IQ9L 5EC2A 5DRWA 3GIVB 1QACA 4JB9H 4JQXC 4MVBD 3VFGL 5KZCD 3MRQA 3MNWB 2R1XB 3MROB 4ODXA 2QQLH 1A14L 3E6FB 4NO5B 4HJ0D 2IANE 2DLGA 2YPKB 2XA8L 1KT2A 4YHOH 2IADA 4JFPA 4XHQA 1R5VA 4GFTB 4G8IB 4JFYA 3WDJA 5GZOC 2B4CC 3NZ8B 3BVNB 2CRYA 4LFHD 2PYED 2X4NB 4OFYD 4Y8DC 2Y07H 2YRPA 3U7YL 4DK3A 3VD9A 4XCNB 3RJQB 5HYJA 4Z76B 1RZKL 5KG9A 1OAZH 5TF0A 2DF3A 1Y6MR 2DTMH 1XGPA 4N0UB 3P4OB 4O2CA 4OBRA 5GGTL 4L4VB 4KRPC 1JHKH 5HYSG 3GB7A 2GT9B 3QCVH 4JFDA 3P77A 5AD0B 2C7UB 2N7AA 4M6MH 4MA8L 3UTTA 1HHHA 1H5BA 1G6RL 3ABZA 3W0WB 2YPVH 1AI1L 1U2CA 4PS4H 5CILL 3D48R 4AG4L 2IBZX 4MXQC 4W81A 5FKAB 3GSQA 4EIZC 4G7YL 3KPRE 4OIAA 1J0HA 4RRPA 3HG1A 4WO4B 4DZ8A 5EA0L 3HC4H 5JXED 3NIGF 3FO0H 1XF3B 4P4KB 3RWJB 1MHCA 1A6VL 2VH5H 3NCJH 1UH4A 3D39A 3SE4A 3NCMA 3SCMB 2ZJSL 5ACMA 3U4EB 4B53A 2H2PD 4K8RL 3OF6D 2GW5A 1TZIB 3GBLA 1HWHB 3VFNB 4OZIF 4HMDA 43CAA 1Z2KA 1BVKA 4PTTB 3DGCR 4CVWA 1A22B 1HHGB 3THMH 3O41A 4EVNB 1I7TA 4HSQA 3GRWH 1NMAH 5KOVC 2Q7YB 2QQNL 4JE4B 5L2KE 4XNZC 1LDSA 5E2TL 1JPSL 3UJTH 1RZIA 3MRDA 2CDEA 2YK1L 3RVWD 5JUEH 1CDCA 3K46A 4DGVL 2XA3A 4MAYB 3BW9A 5HHNA 5GRVL 3L5WB 3JV0A 5ISZD 2ED9A 2XY2A 2EDEA 4YE4H 5TJWK 5CD3A 3RRQA 4HGWB 3LIZL 1AIFA 1RHFA 4X7TB 3BP7A 4X7CC 4WTWA 5B8CA 3WEXB 5LQBL 4KDTA 3VXUA 1KFAL 2FO1A 1UFUA 4OGZA 4L1HA 5GS1A 1INQA 2AV1B 1N4XH 4Y5YC 1E28A 3MJGX 1R5IA 1GC1H 3ESUF 2X1QA 5LGJB 3MLXL 2F58L 2OL3B 1Z9SA 1OL0A 4TPRL 3ARED 1V3KA 5FUOL 3VRIB 1YPZA 1B0GB 5BRZA 2QKIB 3MODL 1NGPL 2APBA 2PKDA 3O6FD 1IQDA 4AIZA 1BZQK 1AR1C 4HV8A 5T33H 5D2LE 8CGTA 1SJHB 1JGDB 5KSBA 4U49A 3K1KC 4IHOB 3QEQB 4K3GA 5DK2B 3FB7A 2E6PA 4HIJA 4O2FB 5C09A 1OPGH 2J8OA 2ZUWA 3DVFA 3PWNB 3RWFA 3TNNB 3ARDA 4P49A 1IKNC 5L6YH 1XF5B 3EKCA 3PP3H 4U6XB 4V1DD 4ZFOL 1A21A 2E7LC 3JTTB 3NCYS 4KQ3L 4GRWE 4KK6D 1U8PB 3IAPA 2FJFA 2XZZA 5KVDH 1GL4B 4GW5A 5HD8D 4A6YH 4A2LA 1VENA 4DUVA 1OVZA 1ACZA 1OAKL 2VDLL 1XEDA 4H1LH 5BVPL 3GMOB 5I1CL 3IS1X 4YQXH 3QUMA 5HHVH 2P24B 1NEZG 1AD9B 2Z35B 3O6ML 4ZAKC 3VFMA 3CFKA 1UM6H 4YXLL 3MBEA 4QTIL 3TA3A 1GGTA 5IMKB 2A6DA 4JZOB 2R9HC 4K55A 1MAKA 1FLTX 5IBTH 5I16A 4YO0B 3DECA 3EO0A 4P5TD 3D85A 5JDSA 2QQKH 5ACLA 15C8H 1Z0MA 1YMMB 1NANI 3D0VA 1EXUA 4OGAD 4LSSH 4G8GB 4OFPA 3VFSA 1DLHB 1LHZA 2EDLA 4WNQB 2JCCF 2XZCL 4CADB 2W92A 2YPLD 1NC2A 2FL5B 2PNDA 3X13B 3IDNA 3AAZA 3GJFH 2EH7L 4P2OD 3PDGA 3FFCE 1IJ9A 3ARGC 1QSVA 1BZ9A 3RHWF 2EH8H 4I9WD 4MA3A 5DHVH 1T2XA 4GLRH 5J6HB 4ZUVA 4UZGA 1G7PA 3N9GH 3VGBA 4G9FD 1ZLUH 4YHPB 2VN7A 2X4OB 3I50L 4WJ5B 3QIWA 3FMGL 4LDLB 1CLCA 3L7FA 2YD9A 4R0LB 1G9NH 1MPAL 3WUWA 2YWYA 2R23A 3I6LD 3K2UH 4TQEH 5FIEA 3S4SG 5EFIB 1NEZB 4JRXA 2AABH 3AXLA 4GQPH 4LLYB 2L4OA 2HLFD 4HDIA 2NY5H 1JZ6A 2R29L 2V7HB 4WI8A 3P4LA 2EC9T 5ADPL 1OCWL 3DROA 2ICCA 3HE7B 4JM2A 3BE1L 4JO3H 2GYSA 3VG9B 4DVBA 4YDVB 2A77L 1NUFA 2J8UE 3U30C 1ZHNA 2VDOH 2R1YB 3D9AL 4X9IA 1AH1A 4FZ8H 4Z7NE 4J8RA 2DM7A 3KPOA 3RA7H 1AGCB 4O02H 4PJCE 4X6DE 2DQTL 2NY3D 5JLZB 1YY8A 1DQML 1RFDH 4QRTA 4LBEB 4FQQB 1VPOL 3EOAB 3CFCH 4HQQH 2A9NL 4U6YA 4PJXE 1X5LA 1Q9WA 2X4TA 4RSVA 4UDUA 1QR1B 3LS4L 3U36B 2BVQB 4PUBH 1FHGA 3RL2B 3NCYP 3PHOB 4Y2DB 4D9LH 5E6IB 3QQ9D 2H3NB 4D0CB 3BEWA 4K3JH 3LH2H 4JKPL 2Q76A 3H3KA 1AO7A 5GS0D 5C9JA 4HXAL 4RZCB 3RX5A 5D72L 2Z91A 3MRRA 3X12A 1KIRA 1SY6A 2IFFL 4QXUL 1LK3L 2ESVD 3CXHK 3MUGA 3S4SB 3AVEA 5IWLC 1HOCA 3A0OA 1J0ZA 2CXKA 3VDAA 4QHNA 1JN6A 5FB8A 3QNXB 5HGBA 5IQ9B 2J5LC 2Q8BL 3GMNB 4MAUL 5DD6A 3CFIC 4KFZC 5C3TA 1KJ2L 4AQOA 3WN5C 3F5WA 2OJEA 4RMUA 1P6AB 3CSBA 5EUOA 3HI5H 4APQC 4F7TA 1BIIA 4QOKB 2AGJH 5DJCB 2VLRA 3BH9B 3SDAD 5CCKL 5F7UA 5ILTH 4FXKA 3STLB 3PE9A 1CG9A 2ZCKH 3K7UA 4NKIH 4PBVC 4M1DH 4QRSA 3WS3A 1A4KB 4UQ2B 1T1YA 3BRFA 3IS0X 4L29B 5I1AB 2D7MA 4HT1H 4HS6B 2VLKB 1P2CA 3BJ91 3QULB 5TDNB 4OI9A 1Q72H 2NTFB 1ZLSH 2FJGA 1KV3A 4ZSOA 4KAQL 2Z0BA 1X44A 1FDLL 4H0IA 4ZTPH 1U8LA 1OTSD 2IG2L 1SJVA 2W38A 3B9KB 2PO6C 4PJDE 3V0VA 2XN9B 1HDMB 1HHJA 2CKNA 5F6IC 3TPUA 2PXYD 4RIRA 4HJGB 3RY5A 5TDPB 2P44B 1UJTA 3C8KB 4M43H 4OCXH 1D5ZA 4MSWA 3ARQA 2XY1A 1WUNT 5HPMA 2ADGA 1GZQA 1LP9B 1AD0B 1FC1A 2F8VA 1RIUH 5IT2L 1WZKA 1OSZB 4JFQB 2X4UB 4HFUL 3MREA 2GITA 5EZJA 3VFPA 3O4LE 5ESQB 3TBWB 4JFEE 2PW1B 3X14A 4LVHB 3KPPA 1ZHLB 1G1YA 3C5JA 5BVJB 4FQXD 2W59A 4GJTB 4KI5D 3Q2CA 2C1PB 1FGNH 3I02B 5DVKA 3WS6A 1M7DB 3S5LA 3VD3A 3ZYZA 2HVJA 5ELIA 2D7QA 4JGMA 3A6CH 5DMGD 2LABA 3L5IA 1UKQA 2VZ3A 1YYML 5JHLL 4FQJH 2VISB 2GCYA 1YJDH 3IDXH 4XNUL 5C0RH 3H6JA 2GAZB 5DVOA 1I8MB 2KZWA 1QTYT 3G5VA 3MACL 4DKAA 3MV7E 5IV2A 5D2LF 1CICC 1KCRL 4P2QE 5JOFB 2PCPB 4X83A 5CGYC 5E2WH 2XQBH 4ZO6A 1EAPA 5A16B 1PYWA 3JVGA 3H7BB 1WLHA 1ZHKA 1BGXH 1NMBH 2GIYA 1KB5H 1LO4H 3O3EA 4OZ4A 3DV6A 4PY8I 1MI5E 3RTQC 3U0PA 1A6PA 4PRNA 1WIPA 5SWZE 3VXRE 1IARB 2QJDA 3AS2A 4IJ3B 2ATPA 4GRWF 3V6ZB 1R3HA 4RBPK 4OSUL 3G5ZA 5J8OA 3B9VA 5KJRL 4P9ML 2WQRA 1JWSB 4NDMB 2XTLA 4XVJH 2IPTH 3UJJL 2WINA 4M1CC 4C83B 4UQ3A 3QCUL 4LLVA 4HKZA 4NNYB 5MEPB 3N06B 4X99B 2EDOA 1D5BB 3QCTL 3VWJD 5ISZB 2OL3L 3MRHB 1U58B 2O26U 4HS8L 2RJMA 2DD8H 5AUMA 1CGVA 2YA2A 5EO1B 4ZNCD 3CVHA 3JXAA 1I8IB 4AENA 5I74B 3RVTD 4O51B 2J7LA 5ID1B 3O3BB 3TH2T 3CFBB 5CS7A 1A6AB 3V6OE 4YXKL 5DMKB 3KPRA 1OTTD 4JCMA 3OJMB 1S7QB 3CZFB 4QHUA 5IB5A 1WF5A 5EU6D 4BJLA 4FQIL 5E94B 2RCSL 1Q9LA 3P4MA 5D2NC 2OJZH 5EOTB 1MREH 4PB9H 4XAWH 4M6AA 5A2JH 1FYTE 2ZUTA 5LXGH 1MH5B 2W07A 4O00A 2A1WL 1F6AB 2HVKA 2C3HA 3V5HB 3O11A 5KSUB 2HTKD 4ZXBB 2F8OA 1JZ4A 1TTUA 2VDNH 4E5XA 5DA0B 1X5IA 2ITCB 1XGYL 3IRZA 2UZYB 3F7VA 5C0DB 1ZA6B 3ALXA 4L4VE 2AJXL 1MCCA 4X9FA 4Y5XC 5FYLL 1AC0A 4OCNC 2DQJH 1EEYB 1P1ZB 2ZP0T 4LSUH 5EORL 2BNQA 3MLWH 5FKPB 1Z5LB 4D9QE 5HVWA 2YSSA 1HIML 2Z8SA 1EDQA 5H35A 4H8WL 1HYSD 1L0YA 4TTGA 5TFSH 5GISL 1NL0H 1Q8MA 2DQUH 3S36L 2X41A 3WIHL 4N8CL 3ALWA 2J8UF 3VH8B 1BBJA 1U8OA 5ITBH 5C0AA 3KXFB 4JQIH 4Z7NF 2J6EA 4PJCF 4X6DF 1YY9D 3OZ9L 4LF3B 1KGCD 1YEKH 2VAAA 2F53E 2OR9H 1Q9KA 4PJXF 3GHBH 1KCUH 4UIMB 3WE6B 5FO7B 1IAOA 3NFNB 5TH2A 1NGQL 3CFDB 2AQ2A 2WP3O 1NBZA 1VESA 3KWWA 2IH1B 1ZA3A 2LU4A 4OLZH 4NFBA 3QPXL 4NFCA 1H3WM 5DUPL 5KSAA 1FJ1B 1LO0H 4LHUD 2AK4A 5D1QB 4JPWH 2AJVH 4D9RD 2CDGA 4X4XA 4U7SA 1MCHA 3C2AL 1IGML 3T04D 3VXSB 3LS5L 4KKCD 1WC7B 2RFXA 4KKLD 1OGAB 2JF1A 3U9UB 3NIFE 4X0KB 4QRRA 2FEDD 4WIQA 3OKEB 3V0WL 3SDCB 4KDVA 4ODVL 1YN6A 4Z6AT 1NCWH 2Y4SA 3PL6B 1CS6A 5CJQH 1OAXL 3EGSB 3FCTA 4HLJA 1FIGL 2AQ3A 4ZDHA 2Q7NA 2FRGP 3RNKB 2R4SL 4E0RA 2XKUA 4M6NL 3C5ZB 4UU9B 4DTGH 4KH2A 3WO3B 1AP2A 3M07A 2GK0B 5IW6A 2BRRH 1BVLA 1GZPA 1TVBA 3UC0H 3MJ9L 3VWKD 5H2BB 1F58H 3P0YH 1RHHA 4UIKL 4F9LA 2E7HA 3JWDL 2O61B 1R3LA 3KS0H 3OR6A 4QRPB 1S7WA 4R4BA 4JDTL 3BKYL 3ALPA 1N6VA 1TNNA 4ZPVB 5D71L 1J12A 2NR6C 5DJ0B 4P57A 3RZCD 4PRPD 2FD6H 2YD3A 3ULUD 4MQXC 2EDXA 1QLEL 3HUJF 1LGVA 2R2HB 5F7MC 1U93A 2Y7QA 3IVKB 2ED8A 3QZWA 3UBXG 4L8SB 4PJDF 2F5BH 3TH3T 3I3DA 1EH9A 2E8YA 4Y4KB 2FGZA 4LSPH 1MCPH 4YBQD 4YHZH 4P5KB 3IETA 5FYLE 4PIRF 3PP4L 3QUYA 3ROOA 2R0KH 4MJ6A 3ARFD 3NZHH 2YC1B 1HQ4A 5F88B 2BY2A 3IFPA 3ZL4H 1TPXC 1QPXA 3FTGA 4ACPA 2PF6A 3W2DL 2W60B 5F93C 3SE3C 3FT4B 5IVXE 3FAWA 1AGFA 3WL9A 2ESVB 1RU9L 4JY5H 3LKSA 5C3LD 1GH7A 1NGYB 3OKYA 4OD2A 3QI9C 1J05B 5E6YA 1P7QD 5DJZA 3GMMB 2MCG1 4GG8B 3O9WD 2NMSA 3ZKXB 3UTOA 4OCSL 5JHDA 5ALCL 5I15H 2VDRH 4HZAA 5J1SC 5DK3A 4X6DA 4NQED 1OHQA 4B7LA 3G6JB 1CD0A 3QDGB 2HH0L 4L4TA 4DW2H 3MO1A 1HE7A 3WFEL 4JDVB 1JZ5A 5I71C 2YEZB 5FGSA 3MRCA 4JCLA 4KPHL 4R97C 4OJFL 1TZGH 2VDKH 3PGFL 1NC4B 3GMQA 4ZFOA 2HT3D 1T2QH 2CLVB 3UZVB 3F7YA 4LIQE 5JW3H 2GKIA 2BJMH 3L5JA 3RWEB 4ZUTB 3ME0A 4WFFE 4PGCA 3RX8A 1L6ZA 4JPIB 2I9TA 1F00I 1RZGB 4XXDA 3TIEA 3W11C 2VC2H 5J89A 3EFFA 4YDKL 3LQAC 5CZVL 1A4JA 5C0BD 3T77A 4BA8A 5BW7A 4U1GC 1CGSH 3FT2A 1HYRC 4FTVD 3L3IB 2AI0H 3DX6A 1H0DA 3W82A 5J56B 1MLBA 1A7OH 1HEZB 1R3JB 2EICA 4LVOC 4LLMB 5DWUH 4WUKH 3F12A 1ZT1B 5ESAB 1P4IL 4A6YB 4K7FB 2D0FA 2NQCA 4ZTOL 2HA1A 1MRFH 4H1LB 4OCWH 4W6XB 1CT8A 5EU3B 4JPKH 5D6CB 1W0WA 3FB6B 1J5OH 1JWMA 3JV4B 5DTFB 5E2VH 3EHBC 3ULVL 2XI9A 5HHQB 5AG8A 4IRSB 5F3HB 2V7NA 1A7NL 1LDPL 1A1MB 4MXWH 5J12B 4NZRH 2FZ3A 1ZAGA 3HUJA 4L3EA 3CX5K 1AXTH 3CXDH 3SEPA 1D3CA 3LKQA 3DX7A 3DUSA 3RU8H 4XBEL 4BSJA 2DL9A 1M1SA 2V2WA 1PKOA 1OAQL 2P8LB 1JIBA 2HJFA 4CVZB 2VDQL 1HHIB 1SMAA 3B9DA 5DA4A 1KOAA 5FA4A 5BMFH 2D7PA 1CVSC 2VR5A 1JNNL 1KPVA 1T04A 5JXAL 3MCKB 3PGCA 1XF1A 4WHCA 5C6TL 5DO2D 4JKWA 1GHFH 1JTTA 1XCQA 2AKRB 3OG4B 5JR1H 1FCCA 3GJFB 3OPZH 3MXVH 5DJ8B 4X80H 2JK5B 1SMOA 1AXIB 4JAMB 3BO8A 1J1XL 2GJZA 5F9JB 4QOKE 3BHBA 5DD0H 1H3PL 3LMJL 1QBBA 5DHVB 4F9PC 5LWYL 5K9QG 4JGJA 1U8NB 1WEJL 3BUYB 4U1LA 3BYTA 1DL7H 3QFDB 1JHLH 2A9MH 4FFZL 3R1GH 3HZKB 3RZWA 1VGEL 4HCRH 1SBSL 3ARBD 3T2OA 2NW3A 2HG5B 3KNBA 5TE6H 3S37H 4BK5A 4RGOH 5E5MB 2L7JA 4NKQB 1MJ8L 2BOCA 1QSFB 4NCC1 1T0PB 4DZBA 1FORL 1I1FA 4R3SB 1QBAA 3VFOB 1AGBB 4LAQH 2WV3A 2FIKA 2WWMC 5DJAA 4X6CB 5D70L 4M48L 4OKDA 4Y16A 5F3BB 3TN0A 3NCBB 3HZVA 2ZKHL 3RWDA 2HYMA 1RZ7L 4M5YL 4Y5VC 1DQQB 3TWCH 3TVMB 2VR4A 4PJ5D 5IEKA 1MEXH 2FGWH 3MV7A 1CFQA 3STBA 4OZHE 1G9EA 3KPQA 1EGJH 5DRNB 2IPKA 1W72H 5FOBB 2NY2B 3UTZA 4RFNC 3QIUD 2ZCLH 3BEVA 3GSUB 4EI5C 3G5XB 1A6ZA 1WJ3A 5F97E 2PYEE 5B21A 2P5EA 4OM1H 4WW2F 1D5XA 4RA3A 3BP5B 5SWZA 1NGWA 1MUJA 1EFXB 3DLQR 4ODUA 3B5TA 3T0ED 2KH2B 3FRPA 1BD2B 2P8PA 4HJJH 4AIOA 4LAJH 3X11A 1ZGLM 4HW6A 5T1LB 2YKLH 3NIFF 4ZYKA 2BMKB 3D3VD 1I9RH 2PW2B 5DT1L 4FG6C 5FO9B 2X9XA 1EPFA 1NGXB 4S10A 1FSKB 4N68A 5DQDL 3CDGB 1CDIA 4GXVL 3BN9C 3IDJB 5IHZA 4U3CA 1ZT7B 4WDIA 1DEEB 5IKCA 2X70A 3B9EA 5TQ2H 1DBMH 3DBXA 1NSNL 3ZDXE 4AIXA 3RWIA 5A1AA 1CE1L 1CXEA 3GIVA 5GZOD 4L3AA 2UUDH 2VDPH 4EN3B 1DLFL 3ELAT 1DUYB 1S78D 3MNWA 2R1XA 2JJTC 3GMPB 3E6FA 4NO5A 1T21B 2YPKA 3BMWA 5FCUH 3BD5A 2Y9RT 4D0BB 1ITBB 5DRZB 3NZ8A 3BVNA 3HAEH 4HC1L 2X4NA 5FGCB 3MZGB 4KRPD 1T2JA 4XNQB 1KLGB 5E99H 1SJEA 1BOYA 4Z76A 2BK8A 1FGVH 4JRYD 4N0UA 3P4OA 4JB9L 1WT5A 5D1ZA 5DMJB 5BCAA 4MXQD 1BHGA 2MNUA 4GMTL 3U82B 4BZYA 4CKVX 1MJUL 5ISZE 3ARWA 3SE8H 2GT9A 1TQBB 1FZJB 5AD0A 4K23H 2C7UA 2CUMA 1TVDA 4YHOL 5GRXG 5F8RC 5CLTA 3W0WA 1RZJC 4HLZG 1A7RH 1G7JB 2C3XA 5IVXF 1WICA 2Y07L 3T0VA 5FKAA 3RAJH 1TJGH 1U91B 3QUXC 5BV7C 1OAZL 1A3RL 4WO4A 4HUUB 4K3DH 2DTML 1XF3A 4P4KA 3RWJA 3IXTB 2Z4QB 1A7QL 5E4EB 1JHKL 3B9AA 2FEEL 3SCMA 3E3QC 3U4EA 5JO5B 3RIFF 1KB9K 1TZIA 2NY4D 3VFNA 1UXWB 2YPVL 4LMQE 4JRWA 4PJEE 4PTTA 4Q2ZB 3MLRH 1HHGA 1G7MB 4EVNA 1FLRL 3V79C 2BDNH 3NCFB 3S35H 3L5XH 5C92A 5GXBB 2Q7YA 4M1GH 1BJMA 3QWOB 4PJFB 3FZUC 5I8EB 3FOLB 1ZS8B 3C6SB 1CIUA 4MAYA 3RPIB 3HC4L 4V1DE 3VXQB 3L5WA 2VH5L 4RWYH 4F15C 4WUUD 4IIQB 5JIHA 4Q9RH 4HGWA 4YK4B 5T3XH 4KXZI 4JFFD 4IM8A 3WEXA 3HMXL 3T08A 5EC1B 4EUPH 1F3DH 1MCIA 3THML 2AV1A 1NMAL 4ODHH 1AR1D 3NFSL 1Y0LB 4YBLC 1RUKH 4HBQA 2HFGL 1P84K 1HNFA 5LGJA 3WIIH 2EO1A 1LO2H 1ED3B 1DANU 2OL3A 5JUEL 1KB5B 3KXFE 4WI5A 3KPSD 3VRIA 5KANI 1B0GA 5CJ8A 5BQ7B 1PW3A 2QKIA 1J7VR 2GJ6B 2EZ0C 3BPLB 2CXGA 3RGVB 3BSZH 2BHYA 5IGXH 3L3JB 4TYUA 1SJHA 3MOBH 5GSRB 4K7PY 1JGDA 1B0RB 2CK0H 4IHOA 2JJSA 2Y36H 3QEQA 2YPLE 5DK2A 4G5ZH 4CNIB 4O2FA 3ZSSA 1C5BL 1N4XL 3PWNA 3TNNA 1GC1L 1F3DJ 5EU7C 1XF5A 4I9WE 3H2WA 4U6XA 1RUMH 4M3JA 3JTTA 3BGMB 5I18L 2DQGL 1U8PA 4G9FE 1H3GA 4PRBB 4ZAKD 3C9NB 1P53A 5T33L 4Z7OF 5SWSD 1WITA 3GMOA 1F6LL 1S5HB 1BQLH 4JQVA 2P24A 3WMSA 5TE7H 3DPBA 2Z35A 3I6LE 1OPGL 3BDBA 3KYNB 1I1AC 4EXPX 2AEIT 5BZDB 3GK8H 5L6YL 3U48A 5IMKA 4JZOA 1OAYH 4YO0A 5I1GH 1R3KB 3PV6B 4CMMB 2H41A 2FLBT 4E42B 3UAJC 5HHOD 2ICWI 1YMMA 3TNMB 3ARGD 2CRMA 4P46C 4G8GA 1TJIH 1MHPH 2KUTA 3WIHA 1A7PH 1JGEB 1DLHA 5L9DL 4WNQA 1CI5A 4CADA 3X17A 4KVCH 2FL5A 3X13A 3ZE0E 4NRYB 5HHVL 1PAMA 3LKNB 5K93A 4N1EA 1FH5H 1MCWW 1UM6L 3TZVC 4XCEB 2HKHH 3GSXB 3FB8A 5J6HA 3AGVA 5IBTL 1MCDA 4LLWB 4LKCB 4Y19B 3UYOD 2OZ4H 2QQKL 3CZJA 1NDMB 2G5BB 4YHPA 1FNHA 15C8L 3EYFB 2X4OA 4WJ5A 5FF6A 4LSSL 3TBSB 4NC1E 5F6HI 1LP9F 4ZQKB 1QPPA 4KI1A 5EULV 3WNLA 5DC0A 4OZHF 5EFIA 1NEZA 3JWOC 1G0DA 4HEME 1MHEB 4U0QB 5C0IB 2ESVE 4Y88A 1XCTB 2EH8L 4LLYA 1UWGH 3K8LA 4G6FB 4RGMC 5BS0D 4LQ1A 5CSZB 2E7BA 2UY6A 4MGXA 2IAMB 3HE7A 4JZNB 4NN6B 4Y4HC 2G5RA 4LRIC 3W9DA 4YDVA 5D1XC 2ZWLT 2VRAA 4NQCD 4AH2B 2ADJB 2R1YA 5HYQB 3F6LA 1I3RB 3HMWH 3AM8A 3G5YA 3OJDB 1AGCA 3RBGA 3SHSA 4D0DB 2CQVA 5JLZA 1FBIH 4R4FH 4TQEL 3K2UL 3G6JE 2IBBA 5CJBA 2B2XL 2W65B 4XI5D 2AAVA 2AABL 3EOAA 4PJIB 2B5IB 5CGMA 3DOSA 3MJ9A 3U79A 5FGBA 5K9JH 1QR1A 2NY5L 2ZG3A 3CXHJ 3U36A 2HWZH 3RL2A 4ONFH 4Y89A 3PHOA 4LLDB 4Y2DA 5E6IA 1AQKH 2H3NA 4JO3L 2QBWA 1MWAL 3V5KB 4D0CA 1O0VA 5FYJH 4I18C 3ZDXF 2X44D 2DIJA 4F8QA 1EVTC 1NAMH 2VDOL 1BWWA 4MA7H 4RZCA 4FZ8L 5T1DH 4EI6B 3RA7L 1TENA 5IP4A 1EMTH 1KEGH 1U42A 1RFDL 3V0AC 2YBRB 3CH1B 3S4SA 4BM7A 1QRND 1RJCA 2ZNWA 3QNXA 1T6VN 5IQ9A 3MPCA 1ZGLB 4X9HA 3GMNA 4UUJB 4M02A 4QTHB 1FFPB 1P9MA 2EE3A 4O2EB 4D9LL 5CZXC 2I26N 3KLSA 2YMXH 5FDYA 5EIIB 2QQQA 3EZ8A 5CBEB 3TBVB 3LH2L 1KENL 5GGSB 2MWCA 1FVCB 2X89D 4ELME 5I8OL 4QOKA 5FA3B 5DJCA 1I85A 3D69B 5C1MB 1JI1A 4HZLA 3STLA 4FQPA 5CSGA 4N5UA 2R2BB 2R1WB 4YUEL 4HWZB 4J3TA 1GOHA 1A4KA 4UQ2A 4KI5E 4TUJB 5FHAL 3QFJD 2PO6D 4L29A 1J88A 5I1AA 4HS6A 2VLKA 4P23C 3CCHA 3QULA 5TDNA 4OV6F 5D93B 2NTFA 3WNNA 5C07B 3D3VB 2E6JA 3HI5L 1DSFH 4NP4H 5C08D 4QY8B 3EYVB 3CVIH 2AGJL 2XN9A 1HDMA 5ILTL 2ZOLB 3RFZC 3VXMD 4HJGA 2ZCKL 4NKIL 5DURD 5TDPA 4M1DL 5ESVB 3C8KA 4PJ8C 1FZOB 3CD4A 1LP9A 1AD0A 4PJEF 2XG4A 4OF5A 4HT1L 3S7GA 1KTRL 1YEFH 4J6RH 3NH7L 4LDEB 1OSZA 1Q72L 1ZLSL 3SBWA 4JFQA 3MLVH 2X4UA 2R0LL 3U4BH 3G9AB 1LEKB 4LPXA 2NY1B