3S37H

Structural basis for the function of two anti-vegf receptor antibodies
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
209
Chain Sequence
VQLVQSGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVTDAFDIWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1121B Fab light chain
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system/transferase
total genus 37
structure length 209
sequence length 215
ec nomenclature
pdb deposition date 2011-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s37H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s37H01
4GW1A 4JFFB 4UB0L 4XPTH 3TJEH 4U6XA 4MAYC 1ZLUH 2KKQA 4LLWB 4KKAC 4CL7A 4HGKC 3HNSL 1OOAA 4PJIE 3GMQB 3O8XA 1UEYA 2DD8L 2GTWB 1NGYA 4AH2A 4JFZH 3SDAD 2EDEA 4OLUH 3WD5H 1TPXC 3RWCA 1FNGA 2EXYC 2PO6A 2EYSB 2CD0A 1BD2B 1I7UB 2VTFA 4OLVL 4XWOC 5CBEA 2IANA 4UIKL 1I7ZA 1I85C 5L8LB 1JYNA 3RY6A 3BKYH 2XT1B 2DLTA 1Z3GH 3QNYB 2NY3B 4KZDH 3D85D 3DECA 4LGSB 2DQEH 4Z77B 3EHBD 1U95B 1IEBA 4NKMA 2BVOA 4Y8AA 3HC3L 3TC9A 3BPNB 2R56L 1T1ZB 5CJXC 4HEPG 3TJHD 3ZTNH 4KI1A 4X7EC 3ARDA 1QNZH 4ODTH 1PKQE 3OZ9L 1BBDL 3PABA 3AM8A 4U1IB 1CGUA 2R0KH 1EIBA 1KFAH 3GSNB 3QQ9C 1AE6L 2D7QA 5HI3C 5SWZA 3MRIB 5L9DL 4MA7L 2GUOB 5DVMA 3A67L 2PCPB 4NRZB 2XA3A 4RA3A 4KU1A 4C56D 2CLRB 2WBWB 4BZ1H 3WE6B 4FQCL 1D5BA 3L3GA 3SO3B 3G5YA 3ARGA 1YMMB 1PZ5A 3A0OA 1FE8L 4XBPA 3RHWK 5F3HB 1DLHA 1A3RL 3BSZL 5D7KE 1CD1A 4HWBL 5EA0L 3FO1B 4HMEA 5DR5H 1FQ9C 2I07B 4UZGA 3OKYA 2WQ8A 4HK3J 4TVPE 4AEFA 3OKDB 1CN4A 2YPVH 3SDAA 5HI5D 4M4PA 4X7TA 3RKDD 3VFPA 1X5YA 4XPHL 2GK0A 3I6GA 1CDGA 5GSVB 2Z31B 3P30L 3T0AA 4MA1C 5ADPH 3JUZA 1DE4A 5F6IC 3N1MC 3ULVE 1A1OB 3VRLF 5GGUB 5JDSA 1F58H 4WVRA 1T5XA 4PGEB 5DMYA 2OBGA 4XPGH 5KZCD 5E08H 4RISL 4OTXH 1X3DA 5A2JH 3DTXA 3O2DA 5FV1L 1Z0MA 4NNXA 2OCFD 4ISVB 4ZPVB 1GGCL 5MEOA 3OGCA 5HHXL 3CH1B 1U3YA 2ZG3A 4Y5VA 5T3ZH 3TO2B 4GXVL 4H8WL 4I3GA 2H32H 1T22B 4JPIA 4BSJA 4GH7B 4MNHB 4MAUH 1NMBL 3NCFB 1CGSL 3O11B 4PRNA 4WJ5B 3VXRB 1UKTA 3TO4B 4XCCH 4HWEH 1CFTB 4G6JH 4NBYB 4QT5B 4WDIA 3PWPA 4C56A 1KN4L 1X5IA 3O8XC 3CK0H 4PJ5A 1A6AA 2VE6A 3VG9C 4HBCH 2UY7A 4IOIB 4XHQA 1EHAA 4JO3L 3K3QA 3UTOA 4GKSA 3VGGA 4WUKH 3ECBB 2PO6C 4P9MH 1FVDA 5IF0A 2WINA 5IKCA 2Z4QA 2HLFD 3FONB 3X11A 3QWRD 4MNQD 1OTSD 1MFDL 4OCMC 4Z7UF 3DURB 4B0MM 2B20A 1T0MA 2FWOA 5CHNA 1UM4L 3CVHL 4HJGB 4OKVA 4UUJA 1KF9B 2YD8A 1XF4A 1B3JA 3ARDC 3TCLA 5DJDB 4YEFA 1FNEB 1WCBA 3L95B 4BA8A 4LCUB 2XZCL 3I50L 4N8VG 4OZHF 3LPFA 2DI9A 3NA4A 3IJHA 3WIFA 3QQ4B 5E5MA 1T7XA 3D39D 4JRYE 4JPWL 3G04B 4LLDB 4QY8B 4X4XA 4E41D 1FBIH 1S7QA 5I8OL 3VD7A 2HT3D 1MF2H 3ARGC 5K9KB 2P8LB 5IP4A 1RIUL 2R1XA 5CUSL 1C1EL 3UO1H 2BNQA 2W0PA 3DV6A 3O6KH 5E6IB 2AV7A 1UA6L 3EYFB 3IU3A 3UJTH 3PV6A 5IIEB 4JHAL 2XPGB 2D7MA 5E99L 1VA9A 2WP3T 3O4LD 5JOFA 5EFIA 2ADJB 3C09C 2V5RA 4Q2ZB 5MENE 4BUHA 3ISWA 5IMKA 1P1ZA 3TIDB 3FJTA 3SDAC 3W81A 5ICXB 4P46B 1MJ8H 1S9WB 3FO9B 4MJ6A 2CLZA 4LIQE 1SEQH 2VUOA 4U31A 1BFSA 1CGVA 4YXHH 3LIZL 4MGXA 4MNQA 1NEZA 1UM5L 3MXVL 2EE6A 2V5SA 3UPRA 3QDGB 5DEGB 3TJHC 1ZVSA 5B3JF 4GRMB 5TE6L 3RZCB 2I9TA 2B5IC 4Y5VC 4JJ5A 3HA0A 2APVA 4TTDD 3T8XB 3RBSA 4PGBB 4GG6F 4YFLF 1CDIA 3ARBB 4QRTB 1S7UA 3LN4B 1RK0A 1LO5A 3B2UD 2XWJB 4HV8B 1HIMH 1DDHB 4YPJA 3AS0A 4YGVB 2DQDH 5C09B 2WM0A 4Z7UE 3MUGA 1TJIL 3FKUS 4AM0B 4LBEA 1CD9B 4RGNB 1H0DB 1XR9A 5FYJD 2EDDA 3GHBL 5AZEH 3RWGB 4BUGA 4LRNL 5HXMA 4Z78B 2MPAL 3V6FB 5GRYA 3VXQA 2YN5A 1JFQL 4QXGH 3OKNA 2HG5B 4ONFL 2ICWB 3T77A 4PP1C 3PGFH 1OTTD 4OZHE 3QEUB 1CQYA 2ED8A 4E42B 2PW1B 2X41A 3TBVA 1JJUA 2F8OA 4ODXA 1BJ1J 3GSQA 3H3PH 2OI9B 2CJUL 2VDLH 3OR6B 4TOYH 5DZOA 1OCWL 3QCVL 5ID0B 3DVGA 3PHOA 4HPYL 3QEGL 4WI4A 1MHCB 3QP3A 2B4CL 4G8FA 5D1ZA 4X4YB 4AZ8A 5ENWB 5EOQH 1WBXA 3B9KB 1I1FB 4FQQA 1MCLA 3AMLA 3CXHJ 1CLOH 1G0XA 4X6CE 5J6GA 1TMCB 4TVSa 1RURH 4U1KA 3WL9B 5C0EB 4BQ9A 1KTDA 5ITBL 2WWMD 1HE7A 3RPIA 3C08H 4XWGL 4XCFL 4IIQA 4OI9A 3EOTH 4WTZA 4Z7OF 2ZKHH 5I8CB 2HT4D 2BFVL 4LK4A 3PGDB 4U6TA 3CLEL 4NC1E 2X70A 3BI9X 3NA9L 3UTZB 2FYYB 5LCVH 15C8L 4UTBH 3VXOA 2CIKA 1DUYB 3QXDB 5IB3B 5J8OA 4N9GA 4HC1A 4YHKL 1FJ1B 4KKNA 4GG6E 3V52H 4PLJD 5IEKA 2N7BA 5DI8A 5EBWB 4XCNA 1FYTB 5I1DA 1OAQH 4U1MA 1MCEA 2AI0H 4WO4D 1CG9A 1IGCL 3BAEL 3IS1X 1A7PL 4GBXD 4J3VA 1KTLA 1QSED 2OL3B 5C0DA 4X9BA 1J1PH 3W9DA 3SCMD 3EYOB 4LKXB 4OCXL 2N7AA 2BJML 1KV3A 3O0RL 1MCOH 5L2KA 2Q7YA 3NFNA 3VMPA 5ANMA 1DLFH 3FQNB 1FSKB 3FT4B 2RFXA 4PJIB 4N5EC 1EUUA 5E95B 1V7NH 3UTTE 1F00I 4G5ZH 4HFUH 1AXTH 2WUCL 5E4EC 5KG9A 5JOPD 1CK0L 4OF3A 2AS5M 5E8EA 2A73B 1IM9B 5F7UA 3CSYA 4IDLA 1LD9B 1VADA 3RNKA 1MFEH 2NW3A 1BECA 1S9VB 5E2UL 3L3OA 5CZXD 5GJTH 1DQJB 1LWRA 3RWJA 1T66D 3VFGH 3SDDB 5DJAB 2DLEA 1MCKA 1P7QB 5D72L 5DJ6A 5IROA 3DETD 3IDUA 3OB8A 1TVHB 3BPLB 1KLUA 4ZNEA 3AGVA 3TWCH 4PLNC 4YUEL 5LGJB 5I17B 2LU3A 1ZGLP 3FQRB 5ALBH 2W65A 1PKQB 2OR7A 1L0YA 5E8OA 4BZ2H 2KL6A 1JWSB 4YHLH 2P7TA 5D1ZC 2NMSA 2DS4A 3ROOA 4GBXA 4M6OH 3H7BA 4FQLL 4FG6D 4K55A 1IM3B 4ZSOE 4Z7OE 1QSEA 2MQCA 4FTVE 4JREC 5FA3B 4NO5A 4XPFL 4YHNB 4P2QA 1NFDF 2NY2D 3LSOB 1Q72L 5FAAA 3K0WA 2N4IA 3MUY1 4X4MA 4JN2B 4TUJA 3SE9L 2W59A 2EDYA 4LP5A 3KXFD 2P24A 5F1NB 4PB0L 4KK5C 5EC2A 4UINL 1BQLL 2X4TA 2D2OA 4WWKB 5E5UB 1C5BL 3V6OE 1PG7W 4XP9L 4IIQC 3M45A 2ATPB 2AEQL 4E0RA 1FVCB 4I5BA 1YNKL 1IT9H 2JJTA 4UT7H 4DGVH 1EEZA 3QXVA 3NMEA 3V0AC 3VXTB 1XIWC 5I15H 4ZUVB 3WNNA 1LO2H 4EQ3A 4X0KA 1JNNH 5GISH 2V9QA 4UIMA 4PGJA 4QWWC 3QWQB 5CGMA 3RTQA 5FOBA 1FNFA 1OTTC 1JHLH 1MCQA 1UJ3A 3SKUD 3DUUB 1G7QB 3CFEB 3D6GA 2F53E 1F02I 1YMMD 2C26A 2X4RB 3HI5H 1BM3L 2QHLA 3VGAB 2AERT 5F88A 3F7RA 4ODSH 4QXUH 2XACC 2FX7L 4L3ED 5DHYA 3JWOC 1VEPA 3S4SG 3BO8B 4ZS6C 4FXLA 4WY7L 4YQXH 2BNRD 4NUJA 4MB5A 4X98A 4NKOB 5AZ2L 3OXRB 2JCCA 5DK2A 4ERSL 1T5WA 1C7SA 1VACB 3HE6B 4PJHF 4OCYH 3JV6B 1KELH 4FN0A 2Q3AA 3IKCA 3VWKA 3HMXA 4YR6A 2B2XL 2NYYD 1WEJH 1ZTXL 4QYOA 2PR4H 2WWMC 2FB4L 3KYMB 5C0BE 5DRWB 1QSZA 5IVZB 4G8EA 4NZJA 4OF7A 2LU4A 1GRWA 5IROC 2IPTH 3QWOB 1FFOA 3MJGX 1KEML 5KSUA 5EC1B 5EZLB 5DJZB 2IALA 4F37F 1UACL 2FJHA 1NFDE 1BBJB 1JPSL 2Q76A 1YY9D 2AEPH 1GZPA 1YPZF 1FRGL 1T21A 1HSBB 3SO5A 43C9A 5LGHH 3C8KA 4N0RA 4P5KA 4JE4B 1VKXA 2MKLC 4GBXC 3E6HB 4H88H 4JRYB 3OQ3B 5HGAA 3B9EA 4H26A 4KTYA 1F4XL 4MS8D 4OGAD 4JDZB 4F33B 4RX4D 4U3CA 3WDJA 5I8KH 5EO9A 3MFFA 5E7BA 1YEFL 3MXWH 1Q9KA 2O61A 2BNRA 3S34H 1XGQA 5AAWA 3GMMA 1I3VA 3WNKA 4YC2C 1I3GH 5C0AD 1MLBA 4NP4H 5I71C 3V0WH 5EIIB 1W72A 3UTSD 4XCYB 5MENB 2JJTC 4ZYKB 4OM1L 2FCBA 4TYUA 3U9PL 1ORQA 1HCVA 3RQ3A 5DMKA 1HHHB 1QACA 3MRNB 3RU8H 3H7LA 5FKPB 3RTQC 1HILB 3JV4B 1T66C 4L4VA 2J8UF 1UJ3C 2X4SA 1QO3A 4AIZB 5C6PB 5B8CB 3ZT7A 3B6SB 3C5SA 4FQXD 5EU5A 5HHPB 4ZFOB 4PJHE 3BXNB 4YHIA 4M7KH 2BY1A 4PY7A 5DYOA 3VD3A 4O2CA 4HUXB 1W0YT 4XNQA 4UQ3B 5LAXB 1N64H 3MJ7A 4QXTA 3G6AB 1P4BL 4P46D 4PJ7A 4U7SA 3IXAB 2VZ3A 3MRCA 4RX4A 4OLWH 2V7HB 1P7KA 3GMOA 4NO2B 4Z7UB 4DTGH 1NAKL 3L6FA 3IJSB 3VWKC 3HNVH 1EBPA 4WU5B 3LEVL 3RJQB 4NWUL 1CXEA 1WGOA 5C0AA 1LNUA 1ZLUK 1YPZE 32C2B 4ZO7A 2FNBA 5ACMA 1IFHL 2J8HA 4OZHB 1GAFH 3CX5J 1NCDL 4D0DA 4OLXL 4NN6B 4DVBB 3TPKA 1H8SA 1V7MH 1P5VA 4PGZA 1N6VA 4ODWB 4YX2H 1B0GA 2YD7A 4Q9QL 3NTCL 4QRRA 4LDLB 1JTOA 2YK1L 3H42L 5B21A 3RWIA 1S7VB 3FHQA 1G7JB 4GRLB 1XGYL 4MCZA 4U1JA 2C3VA 3QIUD 4YDVA 3ARWA 4G6MH 1EO8H 5E00B 1XF5B 4FQXA 3FQXB 1T20B 2BSSA 4Z9KB 3MLVH 1G7PA 5J1AA 3RHWF 1NL0L 5HPMB 4O2EA 4KTEL 3SKMB 5F3BB 1CLZL 4UV7H 1HWHB 5DVKA 3IDXL 3QNZB 4F7PB 1QFWM 4AT6A 4LHUG 5DJCA 2J8UE 1Z6JT 3UC0H 1NANH 1T1YA 5DLML 3MGTA 5D8JH 2X6MA 1VESA 2R0LL 1CFNA 4Y8DC 4UBDC 2NYYC 4M7JH 3T65A 4AK1A 4ZO6A 3EFFA 3L3KB 2VDRH 3SKNB 1JNHB 3Q0HA 4KMLB 3ARFC 2ZSVB 4LLMB 5CSZA 4BQCA 4GG6B 4J3WA 5HD8C 3U1SH 3TYFB 2G5RA 4FS0A 4NM8L 4S1QL 4GQ9L 4J3OC 4RFEA 4UT6L 4FZ8L 4XZUB 3UP1A 5F7NC 5H35A 1NAMB 1GYAA 4PS4L 4DGIH 4HKXA 3OX8B 5E70A 1XF2B 3QIUA 5EG6C 3GHEL 4L8SA 5FOJA 1MNUL 1B2WH 3C9NA 4FFVC 5IR1A 4Y5XB 3W0WD 2PXYB 2XZZA 2Q8BH 4MS8C 1X7QA 4OGAC 4NNPH 3BGMB 2GT9B 5ICYB 3TM6A 4HF5L 4RFOL 3LY6A 2ORBL 3UTTB 4J3XA 4D0BA 5L7XH 3RX8A 2O5XH 4HH8A 4O02H 4WHCA 2IWGA 1AKJA 2W9EH 4ONHB 4TULL 3U0WL 4OBSA 4Y16B 1H9VA 1PY9A 2QQKL 1I4FA 2EDWA 4QOKD 3EYQD 3NCJL 1RUKH 1E4WL 1FLRL 4P49A 4JLRA 5E8DH 5SX4H 1H8OA 2W91A 1RFDH 4PG2A 1QA9A 3K2UH 3RIAK 1UZ8A 3QCUL 4QRSB 1KN2H 4ORGA 5EBLA 1FO0L 3HAEB 3VD4A 5H2BB 3UJIL 4PJAF 1HXYA 3HC4L 2HWZL 4PV9B 5CBAA 4OI7A 1WV7T 5JPNA 1YNLL 3BMWA 1IKFL 4XPBH 3P4MB 4F2MA 1J1XH 4J4PA 3JWDC 5BV7B 3HC0A 1EAPB 3HZVB 4FQXC 1HK6A 1G7MB 1Q9WA 5JA8B 4WI5A 4ZXBB 4QO1A 2P8PB 4EN3C 4NSKA 5LXGH 4ZSOB 4FTVB 5IQ7L 4N0FB 1J5OL 4D9LL 1IQWH 1F3RB 2VH5L 4XAKE 2YKLH 1WAAF 4WUUD 5HGBA 5DD1H 4LSQH 2XI9A 5FCSH 4L29B 5JO5B 2ZUWA 1S3KL 1JZ5A 4F8QA 2PW2A 1EK3A 1NLBH 3A6BH 4WHTA 4S1SH 2Z93A 3TLRA 3GMNA 2NY0B 1EUTA 1W0VB 3B5GA 5JR1L 5F93C 2ZNXA 4G8GE 4X7SH 1J86A 1KIRA 1S7XB 3MRRB 4X6EB 2AABH 4RZCA 4KK9C 1JF1B 3PP3H 4ONGH 4QOKA 2HVKB 1YEIH 4MD5B 3S6CA 3EO0B 1LDPL 2YRLA 3X14B 5F70A 4UILL 1BZ7A 5GGSY 3TA3B 5T3XD 2GTZB 3V9FA 3C87A 4U05A 1K5NA 1NC4D 5IB5A 4MHHG 1DQDL 2NTSP 3GB7A 1QQDB 2BY0A 5JW4M 1F4WH 4NOBA 5IESH 2VLLB 5D7KD 2H9GB 1RJYB 3CFBB 1BQSA 4U6YB 3QIUC 3IKKA 4R6UA 1W72L 4I77H 4L8SC 3RKPA 3V6ZB 5E5RB 4RIRA 3VDBA 4F7CB 3GZKA 5TQ0L 4X80H 3CDFA 3LKQB 3VXSE 4I48A 5AYQA 4C58B 12E8H 4NWTL 2ZCKL 1RIVL 2QHRL 2GAZA 3BD5A 2AXGA 4NN5C 1VCAA 4TQEH 1Q9LB 3OJDA 2JIXB 4I18A 4JY5H 4WU7A 3DRTA 4PRPA 4WUUA 4LGRB 3CSGA 4M02A 1V3KA 3TVMA 2DQIL 4PJAE 4TNVK 2VO5A 3VFRB 3QXUA 5IHZA 5D2NA 3MNVA 4ODUB 5C0BB 3F7VB 5IHUH 3BKMH 4K9EL 3BFOA 4NO0B 4ZNCD 4OUUA 4H20L 4OZ4B 4PG2C 1QSVA 4WI8A 1T0NB 4K7PH 2E7MA 5C08A 4LLYA 1WLHA 1ZS8B 2DLHA 3TJEL 3WUWA 1NFDB 5HGGS 5KJRH 1NCCH 4KFZC 3LN5B 1Q38A 1WAAE 4J4PC 1IGIL 5DMGD 5EU7C 3MRPB 3MLWH 2FJFA 3AB0C 3VRIB 1NC4A 3KJ4B 3BEWA 5FO7B 4BELD 1M7IB 3IDJB 3VXNB 1YN7B 4XX1E 1RZIB 2F54A 4JFZL 4OLUL 3K4ZA 2VKXA 1FP5A 3WD5L 5ETUA 3QXAB 3B5TA 4HDIB 5AD0A 1KIPA 4GJTB 3BHBB 4G9FA 2VDNL 1BAFH 3GGWA 4XNZB 4MX7A 2VYRE 3BKYL 4KZDL 3AXLB 1FZOA 4RQQB 2DQEL 2ZG1A 5JIKA 1L0XA 4JZNA 4J3TA 4UU9A 2O26U 5TE4H 3MNZA 1J88A 4U2ZA 5DD3H 4ZUWB 1EXUB 4MXWL 2P43B 1NEUA 1S7SB 3V5KA 3ZTNL 3F65A 4TUKL 5HYQA 1KSRA 1JHKH 2R2CA 3T0XA 4ODTL 1CU4H 5JORA 2NY5H 3PQYE 5TGBA 1RZ8A 3MC0A 3MRFB 3BPOB 2R0KL 4MA8L 3NPSC 3FT3A 1IEAB 3KG5A 5FYKL 5CEXA 3QI9B 4XP6H 3QO0B 4FFZH 3FTGB 4HLJA 2IJ0C 5D1XA 5KSAA 4JFXB 1P4LA 5EO1A 3GBLA 4BZ1L 4Z5RB 1U8NB 5C9JA 3C5JB 3BX7C 3BVNA 1KJMB 3QYCA 1OWWA 4PJHB 1B4JH 1YDPA 1QYGH 1XFPA 1CZ8L 2W0FA 3SQOH 3WEXA 1TETL 2NY6B 2QLVB 3S35H 2Z8WC 1XGRA 2GEEA 1GL4B 2R4RH 5I2IB 1U92B 1U42A 1MI5A 2YPVL 2N56A 4LPTA 1IBGL 4IHOA 1DQMH 2CRIA 5DJXA 3KPRA 2YBRA 4I18C 1BJMA 4JGUA 3QUZD 3NACL 3TVMC 1F58L 2YUZA 1OGAE 1U8QB 2YUVA 5FO8B 3IF1B 3WS3A 4ELMA 4PFEA 5DVLA 1A6WH 4DN4H 3HMWH 5D2NC 5E08L 4QHMA 1YPZB 4PUBH 4Z7VF 3BMVA 5F1IB 1I3UA 3WDHA 2GIYA 5B4MC 2EYRB 4EXKA 5L0QC 1WWCA 3D0LA 1NJ9B 1I8MA 4K07A 1TZIB 1UJTA 4OCRH 5T3ZL 3ZDXF 3WXVL 1AFVH 1K4CB 1OM3L 1I9IH 1U8PA 5FM5O 4Y19E 5FKAA 5A2FA 3QUYD 2OLDA 4G6KH 1NCNA 3PV7A 4HT1H 1PGRB 4V1DE 3MLUL 4XCCL 4G6JL 4U6HA 3MBEB 2Q1EA 1GIGH 2E9IA 3RVVD 3FQWA 3CLFL 3D48R 4PV8B 1ZVYA 2P5EE 1NMAH 1QFWH 2ZUQC 1M7DB 3UYOD 4KUCF 3HI1B 3LRGA 2G5BA 1UVQA 2R2EB 4W6WB 4YHZH 2EDBA 2D7OA 5ACZB 4LCYA 3U7WH 3QPQD 3LRHA 1GXEA 1AGFA 2YD4A 2RAMA 2ENYA 5CLTA 4PIRF 1YEDB 5CCKH 3OAUH 4YAQB 2J8UB 1JPST 2FEEL 4CADA 2CDEB 4XXDB 1U2HA 3CC5A 5D4QA 5GS0D 5ALCH 4HK0A 1VGKA 5I1AA 4L3CA 4JRWA 4HGWA 3L3HA 1QR1A 1OAXH 3GM0A 5GGRA 1CYGA 4HCRA 4QHLA 5D1XC 1OSZB 2VIRB 5KSAC 1YEGL 5EU3B 4H0IA 2C4FT 3OXSA 4PG9B 2AK1L 1FBIL 3L5WB 1MF2L 4RMUA 4HFWB 1BFVH 3O81A 4HUUA 5B39G 3UO1L 3O6KL 3QUYA 1ZHLA 1Q9OA 5I66A 4WI7A 4GKZB 2HFFB 2VXUL 3UJTL 3QJFB 4R2GC 3UZVB 4DEPC 4HS3A 4WCYL 1F8TH 5EOCJ 4F9PA 4NZRH 3ARTA 4WI3A 4AL8L 3SDCB 1MQKH 4JVWA 4MJIE 4Z7VE 3AREA 1MHEA 2C7UB 3QEHA 1OD7A 1J9CT 3PNWB 1SEQL 1J12A 1CXLA 3DIFB 3CU7A 4P4KD 3ZDXE 1MLCA 2CUHA 4NCDA 4YXHL 2CK0H 5HJ3B 1KG0B 2J6EA 4DKAA 4JM2F 5HYJD 3QUMA 5IW1A 2VXTH 3LPGA 2WK2A 1QFUH 1ZGLB 3UBXA 4KUZH 5IWLA 4BFIA 5JOEA 2VITB 2D4FA 4YIQA 5FCUL 3FT2A 3EO9H 4HQQH 4X6BA 1PG7X 3SKJL 2DQJL 1XF1A 1OPGH 1SYVA 1XGTB 3IDNA 4NRYB 3VJ6B 2OK0H 4UQ2B 1XZ0B 3F62A 3KPLA 5MHSE 3ABZA 4Y2DD 2WIIB 3GO1L 4N1HB 3MUJA 3GSUB 3GMPB 2DQDL 3E3QC 3BZ4A 1OAZH 2HMID 4YK4B 1AO7E 5AZEL 43CAA 1MRDH 1WCQA 3T2OA 5TDOB 4KRPD 1C12B 1BVLA 2XTLA 2LTQC 1JCKA 3SN6N 1MRCH 4NQDA 2HTKD 1GGBH 3N9GH 4JKPH 3O2VL 3DRQA 3R06A 4GT7A 5ERWB 3DX8A 4RMQA 5F9AC 3PGFL 5IOPB 4NFCA 4M5ZH 4ZOBA 2GJ6E 5EU4A 3O3BA 1T2XA 1LMKA 4P5TA 1QVOB 1VFMA 2HFEA 5TF0A 3SY0B 2VQ1A 3IFOA 4P4KA 2VDLL 4RNRA 1ZK9A 4TOYL 2HLAA 1NCUA 4G8GB 5K33A 3W11D 5GSRB 4PJ8B 4JFQA 1OT1A 4RDQF 5HYJA 4JDVA 3QT2A 5IB2B 4L4TA 5C0IA 5CZKA 1PG7L 1ZT7B 1F2QA 1I1YB 3B2VH 2APFA 4XGZB 4KKBD 5DQ9A 1IAOB 4CVUA 1ODAA 4UDUB 2H1PH 4PJGA 2BK8A 1HDMA 4X5LA 1MFAL 5IHLB 3QUYC 2BDNH 3OB0H 4TRPH 2R29L 4PJFB 1X5XA 1H15B 3D3VE 1ZWIB 4Y2DA 3MLXH 4JAMB 3EJYD 4NZUH 5INCB 2DQGH 3I6KA 2BXZA 4LGPB 3C08L 5BZWA 4F9PC 2NY0D 1NUDA 3EOTL 3FN0L 3VXSB 4DCQA 3RUGA 1B6UA 2ZPKH 3AREC 4LCCA 2W1NA 2AJVH 4UTBL 3RI5K 3DWTA 4XNYH 3WDIA 2E9WA 1DBMH 4ETQA 2FBJH 2Z91B 1PLGH 4LDEB 1DTUA 2OL3H 1NBYB 3CDGB 4PJAB 2H3NA 3D18B 3BIBX 25C8H 2F53D 4P23B 1K4DA 4XNMA 2AI0L 2F8XC 5DQJB 2ADGB 2ARJQ 1B0RA 5IWLC 4LVHC 5AAMA 5ABDE 4PP2B 5H94B 1IEHA 1YMHA 2A6IA 1TQBB 1MCCA 1G9MC 5DZNA 2X09A 1QRNE 1U9KA 5L8KB 1MFCH 3HI6H 3R0NA 3QUXB 1CWVA 1D5XB 1IAKA 2HKHH 2DQTH 4HJJH 1JVKA 4KVCH 3MRJA 3VXUD 3EDDA 2NZ9D 4XB8A 2JIXD 8FABA 4G5ZL 5GRUH 1MHHB 3U48A 1K2DB 4JFEE 3V4PL 3QJHA 3S5LB 1ITCA 3GSXB 1MFEL 4XAWH 2UZIH 3VH8G 1LILA 5GJTL 1CDBA 4LSPH 1ADQH 4R4BB 1FC1A 5LBSH 1YQVH 5DFVC 3PE9A 4P5TC 2E8ZA 4X7FC 3C6LD 1UXWB 2LABA 4JY4B 1MEXL 4P4KC 5CWSA 4APQC 5D7JA 5ALBL 4HG4K 1IQDA 5T3XH 1VB9A 2VRAA 5FB8B 3PQYB 3LEXA 5DGRA 5GRZA 1ZVHA 5T1LA 4YHLL 5ESQA 1YC7A 1BLNA 1RUML 3LS5H 4OAWA 4QHUA 3QQ3A 1ORSB 2F58H 3RVTD 2VXQH 3OV6A 4M6OL 3MCKA 3KPOA 4YE4H 2YA1A 4M61B 3EFDH 1CDYA 3OL2A 3M1BB 3VRJB 7FABH 1SYSA 3EZJB 1WIPA 4OV5A 1U36A 4MB3A 4R7NA 4DKEH 2PYED 5FO9B 5FGCE 5EBGA 2DQHH 2QJDA 2Y1VA 3VXUA 3MLYL 2MSPA 4WEBL 1QRKA 4KJWD 1RZKH 2E27H 5EWIH 2ZUUA 1VEMA 2HT2C 1UADC 3MRBB 1ZLVH 2LFGA 2VLKE 4HKBB 1IT9L 4LCCC 4UT7L 4H1LB 4QRUA 4KK6D 1JGDB 1O7SA 4JM4H 1WBZA 1LO2L 3MRLB 4L9LA 1JNNL 2HTKC 1QKZL 1VSCA 1J8HE 1EFXD 2ZSWA 4JRXE 4Q7DA 1JHLL 1KXQE 1NLDL 5T1DH 2DQCH 4PRAB 4TSCL 5KOVC 5GGSB 3C6LA 4KY1H 3NAAH 3FOMB 3V7AE 4HIJB 3HI5L 4XC1H 4NRXB 5JMRA 3W11C 4ODSL 5I30H 5J7CC 4QXUL 2DDQL 1F3DJ 1LEGB 3DGGB 3LKNB 4K2UH 4E5XB 5DXWA 2YRPA 1WJ3A 3TZVD 3VI3F 4Y19B 4YQXL 5HY9A 4JZJA 1JWUA 3QDAA 1FIGH 2MJWA 3ZL4H 5HGHA 3MZGB 5FV2A 3AS3A 4R26L 2ERJB 1H3PH 1M6OB 3ZE0F 3GKWH 1KELL 2P5EB 3QZWB 2PYEA 4OFDA 3I3EA 5HYSA 3OKOB 1Q0XL 5GRVL 5B38B 3UMTA 2EH8H 3C60B 1Z9LA 4FQHA 4ODBD 1A7NH 5D1QD 3QUKA 4OZFB 5C0JB 4EIGB 2ZUSA 3CFJA 1TCRB 1ZT4A 3KWWA 3BWAB 5D7JC 1ND0A 4K8RC 4NHUA 4LNRA 1IC5H 2AEPL 4LLQB 3V2AR 5F21B 2BP3A 1CFVL 4KHTL 5K93A 1LK2B 3O9WD 5LGHL 1KJ3H 4NCC1 1F6LL 4G9DA 3KPNB 3D69B 1G9NC 3S96B 1SJEA 1DQQB 1CBVL 5I8KL 4QNPF 4JFYA 1MAML 2NPLX 3MXWL 3K8KA 4EVNA 1ZA3A 1RHHA 4I13B 1Y6MR 5DC4B 1I3GL 4RMWA 5JDJA 3PP3K 5D7SH 3W2DL 2A1WL 4NP4L 3V0WL 4W4OA 5DJ2B 1FVEA 4DW2H 4DZBA 1MJJB 3OG6B 1VPOH 3UYRL 4MJIB 4Z7VB 4OD2B 2DIAA 3LKOA 1ZSDA 4MSWB 4L9LC 3RU8L 4GLRH 4HXBL 1DSFH 3KR3L 4HCRH 2UWEF 4KJPD 4QKXB 1AY1H 4M1CC 1KUMA 3WFBH 3MA9H 1HXMB 5J12B 1ZHBB 1X5AA 2I60H 4BH7A 3O3EA 3VI3E 1DL7L 2NX5E 4MHHI 4UDTA 1RULH 1AR1D 3C6LC 3F12A 4JFFA 5E8NB 2IH3B 5ID1B 4CMHB 2UUDH 1SM3H 1KB5H 4DOHE 1AGBB 3RNQA 3F7QA 5E9DE 3QQNA 2YXMA 1SBBA 2QSTA 3LKRA 5K9JH 3G5VB 1IGYB 3O9WA 1XAUA 3LPWA 3GMQA 5KBNC 4KC3B 2HJFA 4YBLC 1X5GA 1JGVH 1YQ2A 2GTWA 5IK3B 5MI0C 4JZJC 3RVTC 5MEQB 1I75A 2RB8A 4A6YA 5TJWK 4R7DB 3BD4A 3T4AB 3U0PB 5SWSE 1MCNA 4OLWL 3QPXH 3CCHA 4LQFL 2A6KA 4RRPG 5C07E 4DTGL 1BD2A 5C0FB 2Q6WB 5AWNL 1EVTC 4HIEB 5CD5D 3QNYA 1B6DA 3QUMH 2VXSL 5F7LB 4BFGA 1GH7A 1T83A 1U95A 4Z76A 1BQHA 4HS8H 1HH9B 2NXZD 3EYSL 5F89B 4GRWH 5GS0H 3NIGF 3O41B 5F1OB 5E94B 4Q0XH 5ITFB 3OJVC 4OBRA 1RK1B 1TENA 4JO1H 2XOTA 5FIEA 4JFOA 4M48H 2F5BH 2EIBA 3GSNA 1S78C 5A2LH 3MV11 3WIHA 4YX2L 3QDJE 4QNPE 5LJYH 1W0WA 2ICES 5JUEH 2O5YH 4NRZA 3K74B 1T04B 4ZFZB 1KXTB 3PUCA 4Y4KD 3Q3GB 5F3HA 3NIDF 3MLVL 3H3KA 3HZYB 1A7QL 3GSWA 4RGOH 2VWEC 1KCSL 3FO1A 4XAKD 4G6AD 3DVNA 1EAJA 1BMGA 3OKDA 2UWEE 2Y5EA 1PQZA 3BN9D 2IH1B 4DVRH 4XHJC 4RWYH 4WI9A 5GSVA 3UC0L 2M2DA 1VFAB 5A2KH 1BIIB 4JFDE 4K8RL 4W4OC 4JM2B 1H3UA 5D8JL 1D9KB 3DOSA 3VMOA 4UNUA 3RVUD 1IJ9A 2AKRA 5GGUA 2CIIA 3DROA 4DKDC 2VDRL 5D5MF 3LD8B 1G9NL 4JCLA 1U93B 4EBQH 1I8IA 1KT2B 4Y4FD 3KPMB 4EEEA 3WLBA 1KACB 3U1SL 2VB5A 2YPLD 1A21A 3TO2A 5LWYH 4X6FB 3ZDZF 4TPRH 5KN5B 5D96B 4MCYB 2ICCA 4MNHA 1Q94B 3WSQH 3QXTA 1FAIL 2B39A 2GSIA 4XMLH 2AJSH 4X99B 1CFTA 4ZAKB 3O9WC 2VKWA 4HW6A 1QRNB 4HXAH 3PP4H 3VXMD 1B2WL 5I1HH 1J05B 2BVPA 4JHZA 5BS0E 1RUPL 4NNPL 1A9EB 3NIGE 4BQ6A 3ECBA 4AG4H 2H2SD 4BH8A 2WANA 2O5XL 3Q1SL 5I9QB 3BKCH 3TNMB 3I6LE 2NY3C 3DARA 1G6RL 4JFEB 3BE1H 3ULSB 4X5XA 1T83C 2W9EL 1UM6H 3DPBA 5DVNA 4HJGA 3BPNC 3LH2L 5CD3B 2Y72A 2DI7A 4J6RL 3K2UL 1FNEA 5BV7H 2A74A 3NIDE 4O9HH 4MDIB 3ZHDA 2FLRT 1OVZA 1MVFA 2MCPH 3HTLX 1O5DT 4XRCA 3MCLH 3QQ4A 4KV5F 4XPBL 3G04A 4QY8A 1J1XL 4M3JA 2YPLA 2YD1A 5F7DA 3OPZH 4JB9L 1F4YH 2GITB 1U91B 1AGEA 1H5BB 3C2SA 3DHJA 1T7VA 4A2LA 2OZ4H 4N0CD 3Q5YA 5E6IA 3V0VB 1WFUA 3EOBA 4TUOA 4LSVH 4N1CA 3RWHB 1IQWL 2XPGA 3IJYA 4ZO8A 2YKLL 2DMCA 3MRKB 5DD1L 4LSQL 1YJDH 3VXMA 4FNLL 3RWEB 2EO1A 3T1WA 3TIDA 3OR7B 5FGCB 1YEHH 3TBSB 5ICXA 1NLBL 3A6BL 1GC1C 2VDPH 3NH7H 4OD3H 4RMRA 3EJZD 4S1SL 3HE7D 4MQXD 2CKBH 2P1YA 2D7TL 2VLKB 4QLRA 3MV7D 1KYOK 4I9WD 3ROLB 4KH2A 1IE5A 4X7SL 2V5YA 5EZIH 2AABL 2ZUTA 1N0LA 3R8QA 5GS2D 1J8HB 3MUZ1 3JV5A 3QDGA 2NXZC 5FDYA 2NY4B 4JRXB 2X4NA 4K7PX 3DUSB 3WFCH 3I84A 2MHAA 2VDOL 5IB4A 3RL2B 1OSPH 3M17B 4U3XA 3F7YA 5BRZE 1FCCA 4JQXA 3T8XA 2XWBB 1G6VK 1VFOA 1KBGH 4QRTA 2BSTB 5IESL 3AAZA 1MWAH 4PJDA 4PREB 5FA4A 2R4SL 4ODVH 5GRJH 1DDHA 4I77L 5HDLA 3WFDL 4P3CH 4IMKA 1ZHKB 4PJBF 4X80L 3IXTB 4XPAH 4AM0A 1RUQH 3F5WA 2DTMH 4G7YH 5IM7A 12E8L 4P3DA 2XZQL 4JN1H 1ULVA 4DZ8A 5BXFA 3NCYS 1KCUH 4ZPTB 3RY4A 2EIEA 3V6FA 4TQEL 4CRPA 1MCWW 4G7VL 4JY5L 2ICWA 4X6DF 1KNOB 1ZA6B 3BZFA 2XFXB 3G9VA 3BH8A 1OGAD 3DO3A 3NPZB 1AC6A 3MPCA 5IJVB 3BN9C 3M8OH 2VZOA 1F11A 4N68A 2ESVD 5DDHA 1N5AA 1EBAA 2PW1A 1KB9J 4HUVA 4C83A 5J57B 3VGBA 3F6LA 1MOEA 3BKML 3I02A 2VLME 4CN6A 5HHOB 3MV7A 2YS4A 1ED3A 1MCIA 3WJJA 3RVUC 4PD4J 3PWLB 5DMIL 4K7PL 3L1OH 4GUPB 4KXZI 1QEWA 3L9RB 3P9LB 3BRGC 5ID0A 3BW9A 2EO9A 4MWFB 4QHKI 1RZJH 1MHCA 1NCCL 4X4YA 4V1DD 4PJEB 5ENWA 3MLWL 3BIAX 1I1FA 1S7WB 4U1LB 1G7LB 4LSUH 3LV3A 2UZXB 5EO0B 4X7DC 2XN9D 5C3LD 2VLJD 5E6IC 3P4NA 3S35X 4LKCA 1YN6B 2CMRH 4PPTA 4OQTA 1KPVB 4L8DA 35C8L 3C60D 5HDBF 4NN7B 3QIWD 5TE4L 2H32B 3GSNL 3UTZA 1D3CA 3R1GH 3W82A 3MV9B 5IV2B 2H2SC 1DUYA 4F58H 3QXDA 1X6LA 4GG8B 1JHKL 1VEOA 4XVJL 1CU4L 1Y18A 1RU9L 1AD9A 4FQ2H 1U3HD 3RI5F 3U9UA 1HHGA 2B1AL 4S1DC 4PGDA 2ESVA 5EBWA 3E8UL 3G6JF 1WC7B 4OLEA 4P57B 4PTUB 2EIZB 3OB0K 1FYTA 4FFZL 3SKOB 5ESVA 3FCTB 4UV4H 4LSRH 2V17L 3DSFH 3QO1A 4PJBE 3K81A 1R0AH 2NX5B 4NQXB 1KCRL 4JQXC 4RMTA 5JW3L 4RAUA 4JANA 5IFAH 3EGSB 3ARBC 2FR4B 3TH4T 1GGTA 1B4JL 4K3JL 1QYGL 1ZANL 4DOHB 4ZFGH 2XWTA 3SQOL 2YC1B 3GSVB 5E9DB 3FT4A 3T2NH 3L5IA 3S35L 5I1KL 3FAWA 1WTGT 3FZUD 1IILE 3RRQA 4PJIA 1RHFA 4IMKC 5BJTB 2E6PA 5I1GH 5I76B 3PWPE 4C56E 2PTTB 1SEBA 2CRZA 4PJ5E 2XN9A 3W5NA 2VLJA 1FNAA 5SWSB 3ULUC 1DQML 5GGVL 1IM9A 3D0VB 3T09A 1LD9A 3KLDA 4CW1B 5GRWA 1LDSA 1S9VA 3E6FB 5E8PB 1UZ6F 5FECB 1DQJA 5JHDD 3SDDA 4NQVB 2ADFL 3QIWA 1P7QA 2P47B 3OWEA 3RDTB 5EPMA 5F7MC 3O3DB 3EJZC 4L8BA 1QBLL 4PUBL 2JK5B 2WWKO 1II4E 3WJJC 4JVUA 3GRWH 3FQRA 2DYPD 1QG3A 1EGJA 2X4PB 4GXUM 4OCRL 3TN0D 1U3HA 1NDGA 3MJ9H 2A77L 2X7LA 1I9IL 2XZAH 5IFJA 1CTOA 4A6YH 3HB3C 3QDJB 4WI2A 1R3HA 2G9HB 4G6KL 2FZ3B 4HT1L 2ILLA 1BJ1H 3WCYA 3WLWD 5HDBE 2FL5B 3MLZH 1KLFA 1V3LA 4MXQD 4KGLA 3ZDYF 2NY1D 4YHNA 1CXHA 3LSOA 1H8NA 1AO7D 4MA3A 4P2RD 1EERB 3G6DH 5GHWH 3W5MA 1R5IB 4JN2A 5AUMA 4CVWA 1CLYH 3VFOB 1RMFL 1YYMH 2GKIA 2YD9A 2CDGA 2DM4A 2BNQE 3PWUA 1U8JB 4YHZL 4GLRI 1JHTA 5D71L 4F7MB 3U7WL 3T1FB 2ATPA 3G6JE 3GSOB 2UWEB 1Y6KR 4XP4H 3UTPD 1N2RA 2GJ6D 1FV1B 3VXTA 3MRMB 2DN7A 3WIHH 3X3FH 1DVFA 4HD9A 1GJIA 3S7GA 5ALCL 1D5ZB 2OJEB 5GGQH 3IU4L 3DUUA 1G7QA 3L7FB 2FGWH 1T3FB 3Q6GH 4LLUB 2X4RA 4MNQE 2I27N 3EJJX 4K71B 4XX1G 3TN0A 4JG1H 5IW6B 2NW2B 2YZ1A 1ZLVK 2BCKB 3IAGC 2V7NB 3S5LG 2A6JB 3TPUB 2GY5A 3MOBH 1FN4A 1A2YB 3D3VD 1I1AD 1DBKH 1FSKC 4YBQC 4BK5A 2EKSA 1UZ6E 1Y0LB 1P9MC 1YYLH 1J0IA 3HE6A 1F8TL 4MAYB 4HS6B 4JM2D 3NGBB 4NZRL 3D39E 1MQKL 3VFMB 1A47A 3MODH 1FPTH 1WICA 3MMEB 3RPKA 1INQB 1ZT1B 2B1HH 1S7RB 4KROB 4MJ4A 3IB4A 3O45B 5DJ0B 3MRHA 3E1F1 5DRWA 5IVZA 3SDDC 1TPXB 3QIWC 3QWOA 4UOW1 3O4LE 5EC1A 5EZLA 3HLAA 4R97B 4HAFA 1T2JA 1QFUL 4PBXA 4M4RA 2M1KA 3RP1A 2DQUH 5MEPA 2IPUG 3ZDYE 2Q8AH 1UYWH 1IC1A 1U3HC 2FRGP 5E6YA 1Z2KA 5TDNB 4P2OD 3REVA 4OGZA 2FATL 3DMMB 5KVDH 2AK4B 3H6JA 1CF8H 2D9CA 4P5MA 5KSBA 3D87B 2D31B 4GS7C 3FO2B 3GSRB 4JDZA 4W81A 3RGVD 4F33A 4H1LG 1KJVA 5I18H 2I5YH 3DXAA 4URTB 3GEWB 3K1KC 1NGPH 3KLAB 1I9JH 1MRDL 4JFED 4YFLI 2YPKA 4AYFA 1EPFA 5K9QG 4NQTA 3GI9H 4K7PY 3FZUC 4JKPL 2RQ8A 2F19L 3FHAA 3TT3H 2CLVB 3JV0A 4N8VB 5D5MB 5EIIA 3FQTB 2ITDB 4XCYA 3BKJH 4K3DL 4ZYKA 4I0PD 3C5ZD 5KSVB 2IQAB 2HRPH 5FUZH 1P6FA 3NABH 4RAHA 3CZFB 1JYWA 2IGFH 1DVFC 5FYJE 1HHHA 1UENA 3OKKA 2X4UB 1DUZA 3ULVC 1HILA 3JV4A 4XH2B 1OHQA 4J8RB 3T04D 5F97E 3K8MA 5F1SA 3BEVB 2AJZB 4AIZA 3LRSB 5B8CA 3B6SA 4M1DH 2I9LA 1L7TH 4M43L 4Z7NF 5HHPA 3BXNA 4HUWB 3OAYH 1D6EB 3TN0C 1AGDB 1BP3B 3FB6B 5L8JB 1ES0B 3N1FC 1CL7I 4HUXA 4UQ3A 5T1KB 5LAXA 5B38G 2X4OA 4GW1B 4XP1L 4NZUL 3G6AA 3WLWC 3RA7H 3HE6C 3IXAA 4U6XB 5ANME 2AGJH 2OS7A 2V7HA 5JXED 3TESA 3NCMA 4WW2A 3CMOH 5KANI 4FFYL 1A6ZB 1JGUL 3JVGA 4M6NH 1A6VL 4J1UA 1LE9A 1NGYB 1HHJB 4G3YH 3PL6B 4XNYL 1DBML 2FBJL 1PLGL 1ZE3C 3QULB 2OL3L 3RWCB 3G9AB 2PO6B 4OZHA 3EUUA 1CXKA 2Z92A 5CBEB 4I0PA 1NFIA 3E0GA 2JCCF 4DVBA 4JPVH 4P9HC 5BO1H 2BMKB 2EZ0D 4HKZA 3STLA 3L7EB 3R0MA 4U1HB 4LPWA 3HFMH 4NKMB 4QXWA 2BVOB 1A22B 1P4IH 3HPLB 1I1CA 3H9SD 2APTA 1YUHA 2EDLA 3ZZ1A 3ARDB 2HTLD 4QRQB 3B3IA 2SEBB 5E00A 4CN4A 1XF5A 3HPJB 2HKHL 2DQTL 4HJJL 1T20A 4YFEA 4CDHA 3GBMH 1XCTA 3LMJL 3U79A 4K23H 4O5LH 1OW0A 1ZMYA 3MRQA 3NCEB 5JQ6L 4Q97A 3CVIL 3OJ2C 4DQOL 4MQ7B 1OY3B 5HPMA 3QIBD 4NGHL 5F3BA 1PEZA 5C9KA 5GRUL 2ARJA 1QSEE 1WTLA 1D5BB 1G1YA 3G5YB 1PZ5B 4X9HA 4XBPB 5F9OH 4X4ME 5DHVH 1IGFH 1KOAA 3IFPA 4KQ3L 1X44A 2R9HD 2Y36H 1DLHB 1ACZA 5JXEA 3P77A 1EGJL 1EH9A 1CD1B 5AEAA 4LSPL 1ADQL 1F3JA 4Z7NE 4R0LB 3WHXB 5TE7H 1NUGA 2G60L 3C09B 3GNMH 4PJCF 3SKNA 1JPFA 1JNHA 3SDAB 5JOPE 3VFPB 3I6GB 4W4NA 2QQNH 1BWMA 3N1GC 3DGCR 1TJGH 2ZSVA 1JYVA 4LLMA 5FHAH 2G2RB 1DE4B 2EH7L 2J88H 3TYFA 5DC9B 5B8CC 3D85B 5JDSB 4ZS7H 4KRLB 2F58L 2R2BA 5J3HD 1T5XB 4XZUA 1A14H 2X1XR 4PJBB 4YE4L 2Z8SA 1NAMA 3EFDL 3H9SA 7FABL 1JF6A 2YOCA 4NNXB 1AXSB 3H9HA 1XF2A 4DKEL 5D7IA 4TVPL 5MEOB 1UCBH 3OGCB 5I1IL 4LPXA 3VW3H 2B5IB 2W9DH 4H1LH 2WNGA 4Y5VB 5IGXH 1ETZB 3KPPB 4OZGA 4Y5XA 4JPIB 4H5SA 5GGTH 4X6DB 1DR9A 1MCJA 2VZVA 1RZKL 1N6UA 2E27L 5ICYA 3G5ZA 5EWIL 4KJQC 4KMTL 3ULVL 1U3ZA 5BQ7B 2JCCE 3JTSA 2E7BA 4C56B 4WW2C 2NTFB 3IETB 3JVGC 3VWJD 3OF6D 1A6AB 4XVTH 4U4BA 1C5CH 5EIQA 1DQLH 4YEEA 4FZEH 2MOVA 1AQDB 2EXWC 2EC9T 2FIRT 3T0DA 4QCIA 5IJKA 2YA0A 4M1GL 1F45A 2CXGA 4I0PC 2DQCL 1WF5A 2VNCA 5A3ID 3X11B 4QRSA 2F74B 5KVFH 2A2QT 3P73B 3HAEA 4KY1L 3MQIA 3UDWA 1T0MB 3KYKH 4PV9A 2K7PA 5I30L 5CHNB 2GQHA 3FFCD 4UUJB 5EORH 2BVTA 1XF4B 4CUCA 4Y4HD 4YWGH 3HZVA 5E2JA 2CRMA 1G7MA 1PD6A 4KPHH 3GJFH 1OW0C 3ZL4L 5KZCB 2P8PA 1MCBA 2XNAA 2E9BA 3IJHB 3WV0A 5C07D 4JHWL 4NJ9L 5FGRA 4LASH 4X4XB 5DRXB 1CICD 4L29A 5JO5A 1EEUA 3BDBA 1S7QB 1X5LA 2HN7B 4L3EE 3LQAC 4P9HL 4FXKB 2R1XB 1NKRA 5FUCE 2JTDA 1SBSL 5SWQA 2BNQB 3GIVB 2BNRE 4P2CG 2EH8L 5KW9H 5JXEC 2AV7B 4Q9RL 1W0VA 3G6JB 3PV6B 3I9GH 1XT5A 1A7NL 5FHBH 3VWJA 3OF6A 4OGYL 4NJAH 1S7XA 3MRRA 1IAIM 4X6EA 4N0UB 4CVXA 1N7MH 1P1ZB 2R1YB 1GZQB 2HVKA 4MD5A 4YHPA 1IC5L 3EO0A 3X14A 1R3JB 1OAYH 3T2QA 4MJ6B 4WGWB 2CLZB 2AJ3B 1KJ3L 2EZ0C 4L4VE 2FHFA 1OB1B 2WZPD 4MNQB 1DEEA 1K8DB 3P4LA 3VE0B 1CDHA 1MPAH 2VLLA 3QCTH 5F9JA 1A4KA 2H9GA 1OTUC 5D6DA 1RJYA 4LSTH 4R4ND 1CXFA 3FFCA 1ZVSB 4NYLB 5KVEH 4NT6A 4ZD3L 3V6ZA 2HTLC 4FFWC 3ZYZA 4KKCD 2I9TB 2CQVA 3FRUB 4JJ5B 1WWAX 3LKQA 2J7LA 4Y5XC 2PXYC 3GM8A 2GI7A 5D9SA 1AIFB 1KCLA 1S7UB 4LIQL 2XA8H 4JFDD 1RK0B 3KYAA 3D39B 3PWNB 4DW2L 4JJHA 3VGDA 4XTRC 1CICA 1I8KA 1VPOL 4E41B 3Q48A 4AIXA 3S3PA 3VFRA 4ZFOL 2L0DA 2R9HC 1AY1L 3S4SB 2ZUYA 4ESKA 5IJKC 2I60L 1M1SA 5C0AE 3OKNB 1Z9OA 3PDDA 1GSMA 3O4LB 1T0NA 3WO3B 2IQ9L 1UFUA 4D8PB 3T77B 4LCWD 3UTSE 1Q0YL 2XTJD 3UDWC 1PJ9A 1NFDA 3TBVB 3LN5A 5JTWA 1MUJB 3GSQB 4NZTH 2NLJB 1A6PA 4PRDB 4QRRE 2IMNA 1M7IA 5BS0D 1YN7A 3V79C 1RZIA 4YDKH 3FRPG 4ALAL 3DVGB 1GHFH 3LOWA 3PHOB 4LCIL 5IQ9A 5D1ZB 3QXAA 1KJ2H 4IM8A 3SJVD 3UPAA 3BHBA 4NPYA 1WBXB 2NY7H 3AXLA 3I75B 4JREB 2EXYD 4MNGE 3VFNA 2V5MA 4XWOD 1MCPH 2VN4A 1U8KB 4HS8L 3RVXC 1T6VN 4U1KB 4ZUWA 3HS0A 1EXUA 4UT9H 2J5LC 1N8ZB 1S7SA 1CXIA 1KTDB 3RPIB 3VWJC 3V7AG 4WGVB 3NZ8B 1A6UH 4JO1L 4IIQB 4M48L 4HJ0D 1IEAA 4OIBA 2Q86B 3QO0A 4WEUD 2YWZA 2O5YL 3TA3C 5HI3D 3VXOB 1YEKH 1UB5A 5A3IC 5HSFA 4N9GB 1U8NA 3C5JA 5CP3A 2CO6B 1IMHC 1TVBA 4LCWA 4C54A 4U1GB 5FYJU 5IEKB 5CILL 1T7ZA 3LQAL 4GMSL 2ZNWA 5DI8B 4XCNB 3H3BC 1TCMA 1DN2A 4HH9B 4RGOL 5D6DC 5JW4N 1SQ2N 3CVHA 3MJ8B 1KTLB 5HVFB 5C0DB 1BIHA 4HKJA 4Y89A 5DT1H 5IVXB 5IT2H 3A6CL 2XICA 4M7LH 5HHVL 1CT8A 2FX9H 1RJLB 2Q7YB 3ZKXB 3BISA 5ANMB 1JGLL 4I0KA 1JN6B 1YA5A 5CJQH 3SJVA 4Y1AD 3U36B 2X89D 4K94C 2JLLA 1N3NB 2YZ8A 5IG7B 4XBEH 5KG9B 5FO8A 4EUPA 1MCRA 3IF1A 4UAOB 3T0ED 3V5DB 2BVQA 5F1IA 5DUPL 4LMQE 3QXWA 4DAGH 1NAML 3CSYB 3VMNA 1VADB 3KHOA 1OARH 2EYRA 4QF1A 5FGBA 2NW3B 2ZJSH 3KPQB 3RNKB 3L3OB 1NJ9A 1NBVL 4MXVF 1GOFA 1G84A 1TZIA 5BRZD 3RWJB 5LWYL 1QD0A 1MRFH 4B53A 4OCNC 5J6HA 5DJ6B 2C3WA 3WSQL 4M5YH 2HFGH 2QQQA 1KLUB 4XMLL 4R90L 1CGYA 3AC0A 2ZCLH 3MBEA 1CFQB 3MROB 2W65B 2ATKA 3KJ4C 3OKEB 3PP4L 1IC4L 3IGAB 1KPRA 4Q58C 1DBAH 1FG2B 2NXYC 2UVEA 5EU7E 3O8XD 1FH5H 1M7DA 4WO4B 4H25B 1BVKB 1CL7L 5J89A 1RUAH 3HI1A 1BEYL 4KHXH 4GBXB 4NKDA 2HVJA 2R2EA 3H7BB 3CU1A 4KKCC 2RR3A 1QSEB 4GAGL 5ACZA 5JA9A 4RCAA 1S8DB 4NO5B 4NKIH 3SCMB 3BE1L 5I6XB 2IAND 2CDFA 1U8MB 4U0QB 5EC2B 3W0WE 2VLMD 2X4TB 3TYGH 4XXDA 4Y1AA 2X89A 4ZUUB 3O6LH 3VXPB 3W9EA 1RD6A 3BPOC 5BV7L 4E0RB 4OIIH 3BZEA 4I5BB 4OZIF 4EQ2A 1EEZB 2WIMA 1X4ZA 3T0EA 4TSBL 1U58B 1OSZA 2VIRA 4X0KB 5SWZD 4UIMB 4QOKE 2UVFA 3L5WA 4BSVB 5FOBB 2GCYB 5JHLH 1F4YL 3CXHK 4XMKL 2C3XA 3TBYB 1NBQA 4GKZA 3ARGD 3THML 3F6IA 2DIJA 3T0BA 2NY6C 1SHMA 3QJFA 3MACH 1UH4A 2DWDB 5F88B 3T08A 1J1OH 4ZTOL 5DHYB 2Z9TA 3SDCA 1YEHL 1A0QH 4XNUH 3TT1H 1YECH 4JDTH 2VDPL 2R1WB 5C7XH 5CS7A 3PNWA 4N90E 4MXVE 2M8XA 3DIFA 1H3TA 2JCCB 3IS0X 5DK2B 4DKFH 4XVSH 2OQJA 3QNXA 5FM5M 1ZHNA 4XVUC 2NY2B 4QHNA 4YDIH 3PDOA 3D25B 4PRPE 1MJUL 4WUUE 4RFNC 4YR6B 4OLYH 3KXFB 4OLZH 3U4BH 1ZGLA 5DUBA 1MCFA 3WFCL 5FGBC 2W60A 3MGOB 2JF1A 1OSPL 3MGAA 1EO5A 1FGNL 2VITA 3QRGH 3RL1A 2ZCHL 5LQBH 1LK3H 4HJ0C 4CU6A 2YMXL 1KBGL 1FFOB 1U2CA 5KSUB 4NRYA 3DI3B 3VJ6A 5KS9F 3U4EB 1K85A 3DI2B 3MBEC 1S5IH 4O4YH 4ODVL 3W39B 4ELMF 4P3CL 2Q76B 3VI4F 4K94L 4MD0A 3UAJC 5T3XE 2DTML 3PWPD 4G7YL 4ODHL 4PJ5D 43C9B 1YNTB 3LQMA 3TH3T 1UQSA 3C8KB 4P5KB 1C12A 2DKSA 1MFNA 1VKXB 4HMDA 2F54E 3X3GL 3X13B 1BPVA 5T33H 1AP2B 4HGMA 4PJCB 5I19H 3DVIA 4OZIE 4L3EB 3M8OL 3MFFB 3I3DA 3QG6A 4G42A 4PP1D 2BNRB 1QVOA 4X9IA 5HBBA 3SY0A 3MBXH 2JELL 5BZDB 3ILPA 1PYWA 4K3EH 1MLBB 4G8GA 4GO6B 3MLSH 5GSRA 1RZJL 3T0EC 5INDB 5IB2A 1ORQB 2YUXA 3NBNA 3ZHLA 1ZT7A 1I1YA 5DMKB 5FDWA 4XC3L 4WRLA 5EN2B 2H6PA 5CJBA 4U49A 3U7YH 1T4KA 4LSUL 1HINH 3UPCA 1JZ6A 5C2UB 5K9QI 2IEPA 1QO3B 2P49B 5B22A 4PJFA 3C5SB 1H15A 4LNVA 3SE4A 4JAMA 2BNQD 2XG5A 5INCA 4UB0H 1T1XB 4YHIB 5C2BH 4PY7B 5JW5A 3SDCC 3BP7B 4O2CB 1A9BB 4NDMA 2DM7A 3JBG7 2ZG2A 1GOGA 3R1GL 2EE3A 4F58L 2B4CC 4E9LA 1ACYH 4M8QA 3OAYK 4GAYA 1M05A 5IMOA 5BMFL 2XG4A 5EOCH 1TZGH 1WQVT 1P7KB 3CDGA 2BY3A 3U0TA 3VG0H 1UWEL 3BP5A 3KYOB 5KS9E 4UIKH 4P23A 4RMSA 1C5DA 4JO2L 1X4YA 2ADGA 1FYHB 4UV4L 3RWFA 1BGXL 4ELME 4CU8A 3DSFL 3VI4E 5C0AB 2YSSA 1MIML 3UTSB 4AEHL 1FNSH 2XKNB 1PFCA 4D0DB 4ZFGL 1FG9C 4GMTH 5IBUG 3T2NL 4JR9L 1GGIL 2D03L 2X1WL 4Z7WA 4QRRB 2EDKA 4PRIA 2IFFL 3A67H 3RWIB 5I1GL 4AIOA 4MCZB 4U1JB 2C3VB 4NQSB 4ZFFB 2GSGB 4N5ED 4GRWF 2A9NH 2WSKA 4P48A 5TFSL 4FQXB 3U46B 3KDMA 2FJGA 4OSUL 1E28B 4YDLB 4HWBH 5J1AB 4BQBA 4MNGB 5EA0H 3UTQB 1U8IA 1SY6H 1CIDA 2GJZA 1HHKA 3ES6B 2IAMD 4XPHH 3GRWL 4I4WA 1JMXA 4HWNA 3V8CA 1NDMA 1YY8B 1T1YB 4X6CF 3MJ9L 3PQYA 4PJ8C 3MGTB 3QDMD 4GW5A 5GS1A 2XZAL 1CFNB 2E6QA 2CRYA 3T65B 2DBLH 4D0CB 3QFDA 3EFFB 4NBZB 3EW3B 4IDJH 4TTGA 5D1ZD 6CGTA 3M1BA 1CDUA 5FUOL 2FSEB 5GHWL 2PUQT 5EDXA 4NFBA 3P0VL 5JIPA 4H8WH 3SE4C 2P8MA 1YYML 4LAQH 1WZ1H 4OCLC 3BUYA 2AQ2A 5H35B 4KK5D 3MRBA 3ELAT 5DGQA 2OR8A 4HKXB 2EYTA 1QLFB 1JZ7A 2H2PD 3K4DA 1HOCA 2IPUK 4XP4L 3QIUB 5E56A 4BZYA 5HYIA 4Y5YA 4U0RC 1LP9A 5I1JL 3MRLA 5IR1B 4PJGF 4JO3H 3BIKB 1X7QB 3I2CL 1XIWD 1RZGB 3BJLA 5EZJA 2DBJA 4GW4B 1CCZA 4NN5B 1J0ZA 5CMAA 4NIKB 4PRAA 4P23C 4QWWD 4S2SA 2FGWL 5GGSA 4FP8L 4D9RD 3CJJA 3KPSD 1AKJB 1D5IL 2IAMA 1I4FB 3RUGF 1TQBC 1IZJA 1UM4H 3GBNL 3QDMA 4GRWE 3LKNA 4E5XA 4F7EA 5I1LA 3OHXB 4Y19A 5TH2A 4H0HB 5HPOA 4ORGB 2C4XA 4ZS6D 2XZCH 3I50H 5KVGH 5L2KD 1HXYB 1X9QA 3U83A 4ZTPL 5CBAB 3HUJA 3MRDA 4DJMA 1UT9A 3QZWA 3AB0B 5I8OH 4EUPH 1BOYA 1Q9WB 1RIUH 2B1HL 2VDML 3OKOA 5L6YL 5ISZD 1H3VA 4JY6B 4NSKB 4U2YA 1F90L 4LSSL 4NQDE 4JCMA 3CX5K 5E2WH 5E99H 3F58L 5HGBB 1VERA 4OZFA 4RAVA 5DA0B 3ESVF 3GJFK 1TCRA 3W0WB 2DQUL 2GY7B 3BWAA 1BZ9A 2PW2B 1XIWA 2BHUA 5CEZE 4P99A 5TQ2L 1FL3A 4LLQA 2Z93B 3MLTA 5GS1C 1JNLH 4PB9L 2VABA 1LK2A 2DAVA 3WYRA 3D69A 1KIRB 3INUH 4RZCB 1UM5H 1CF8L 3KPSA 3F8UB 5HYJE 5F6HI 2HFTA 3NPSB 3MXVH 1XH3A 5C8JB 4L4TE 3O2WL 4QOKB 4KMQA 2I5YL 3STZA 3BP4A 1WFTA 1ZV5A 1BZ7B 1R5VA 4MLIA 4PY8J 5TE6H 4WTWA 1K5NB 1NGPL 4PJGE 4OM0H 4P2QD 2VLRA 1IC7H 5IB5B 1OAKL 1HKLH 4ZUSB 4MLSA 3GI9L 1KEGL 1BFOB 2MFNA 1E6JH 2MNUA 1HHIA 5D93B 1EDQA 5DJ2A 2DM3A 1MJJA 1UWGL 3IT8D 4KK8D 2IG2H 4Z95L 5E2TL 4MJIA 4Y5YC 1EO7A 5FUZL 3NABL 4IJ3B 1NGQH 3KS0H 2IGFL 5K59E 4I48B 3RUGE 5JXAH 3VD5A 1HQRA 3GHBH 5ISZA 1N4XL 2GAZB 4LRNH 1HXMA 5B39B 2GYSA 2AXGB 2MPAH 3OJDB 4I18B 1JFQH 1HZHL 4WU7B 3QBTB 4ONFH 4WUUB 3DX9B 3RTQD 3K8LA 4M1DL 1L7TL 3MOQA 5ID1A 2IAMC 5IHZB 1G7HB 1N59A 4HK3N 5J11B 5C92A 3MNVB 1NMCC 3MTRA 2K7QA 1A3LL 4LLVA 1BOGA 3G5VA 3EYUH 5IK3A 2DJSA 4IRSD 1INEL 4CDGC 4LLYB 1OCWH 3VFTA 3H0TB 5IW3A 3QHFL 3T4AA 3QAZB 2M26A 1MREH 3MV01 5ICZB 5DD0H 1FORH 5DQDH 4QTHA 1F3DH 5CIPA 2AV1B 4XMPH 4OCWH 1EFQA 2FJFB 3CMOL 5DF0A 4HIEA 1NC4B 1E6OH 3BEWB 3VWKD 2F54B 3IDYC 4LP4A 4Y88A 4FMKA 1RPQA 3MO1B 3ALPA 3G08B 2MTPA 5F89A 5ETUB 3O41A 2H2PC 2EDJA 3LAFA 2IBBA 5AD0B 4OZIB 1L9NA 3RZWA 1NEZG 4ONOA 1NQBA 3ZMRA 4HZLA 3KJ6H 3GGWB 1Z5LA 4JPVL 4XCFH 1FZOB 1CGWA 4HWZA 1MAKA 4JZNB 3HFML 4YHMH 1JYXA 1NGXB 4B50A 2FO4A 2LAAA 4FQIL 3IDMB 4CVZA 4BK4A 5HYQB 1JWMB 3AS2A 4ZFZA 1N0XH 4YHKH 1RZ8B 5I73B 2UYLA 5DSCA 3S36H 1UB6A 3FT3B 5T5FL 3BAEH 1IGCH 4WFHD 2KDGA 2W9LA 3B9AA 3VGFA 1P4LB 5ELIA 3JXAA 3T0WA 4IRSA 4OQ1A 4OCXH 5F9OL 3MOAH 4XI5D 1FO0A 3QHZL 1Q1JL 3PIQA 2A83A 2W0FB 3PXHA 4M7ZC 2QQLH 2Y4SA 3VXUE 2AJXL 4XB7A 2AEWA 4DEPB 1XGRB 5TE7L 2QEJA 3GNML 4KDVA 2WUCH 4KJYA 4XXCA 4UBDD 4LPVA 1U93A 2QQNL 1CK0H 4OFYA 1TJGL 1DN0B 1KT2A 1AXIB 3P4OB 4MMZC 1AH1A 3O2DH 5KS9B 3ARFD 5TPWL 4L4VD 4POYA 3SGEH 2DMBA 2UY6A 1CE6A 4ZS7L 4X6FA 4FQJH 4CMHC 5HD8D 3LDBB 3S9DB 1A14L 3WS3B 4ELMB 4K7FA 3OMZA 4X99A 1MQ8A 4YUEH 5L88L 4ZAKA 4PTTA 4YXLH 1QRNA 5EZOH 1UCBL 3D0LB 2ICWJ 3VW3L 2W9DL 3WXWL 1J05A 5IGXL 4D94A 1NGZA 4XCEB 5GGTL 1NKOA 1U8PB 3NIFE 4FFVD 5CINH 1LO3H 4GOSA 4U6HB 5J06A 4WTZG 4FQLH 4YHYB 3TNMA 4XVTL 2FHBA 5CSGA 2QSVA 2VAAA 1DQLL 2VZ1A 4XPFH 2LQRA 4YZFE 3SEPA 3ULSA 4FZEL 3HNTH 3AS1A 1T2QL 3D9AH 1PDKA 2PYEE 1EJOL 1K6QL 4PB0H 2ZOKB 1BQLH 5MP6H 1M71A 4KK8C 5CD3A 3MRGB 1G7IB 4HMCA 3TGXA 1C5BH 3ARZA 3FN9A 1GVIA 4F7TA 4Z0XA 1AQKH 2AEQH 5GIRA 1X5ZA 4ZOCA 1YEEL 1DBJL 3GMRB 4CADB 3EDEA 2DQFB 4QRRD 2P5WD 1TQCC 3ARFA 3CC5B 3H9ZA 3ORJA 3QUZB 4HK0B 5BVJB 3VH8B 1VGKB 2JJWA 4KPHL 5I1AB 5GQBA 1H5BA 3TH2T 4L3CB 4HGWB 2X9XA 2EIDA 3L3HB 3ZKSD 4ACPA 1QR1B 1U41A 3V0VA 4KRNA 5FYKD 4ENEC 4QHLB 3RWHA 1A1NB 4EN3D 3X12B 2GFBA 1G1CA 4IRSC 1NCWH 4KI5D 1OP5H 3VFVB 2VWEE 3OR7A 1MAJA 4HUUB 3TBSA 3QUYB 4WY7H 4OV6F 1ZHLB 5I66B 3DNKA 2BX5A 1KB5B 3U2SB 1KGCD 4ERSH 4NJAL 1KIQA 4YXKL 2FEEI 3TFKC 4XXCC 4KKLC 1NC2D 2RIKA 3LN9A 2B2XH 5F9DC 1P2CB 4WW1A 1OAYL 4FXGA 4KK9D 3DUSA 2FB4H 3RL2A 1HI6B 1EA9C 2IBZX 3M17A 1MLCB 4P59L 2MWCA 1S9XB 3U30B 5D96C 3QUMB 1WIUA 5HHMD 1KEMH 2BSTA 5D7LD 4ZMAT 1KC5H 1MPAL 4FMFA 1UACH 3SPVA 4JFFE 3CUPB 4LSTL 3UBXB 4ZAKC 5E1HB 4PREA 4QTIL 3P11H 4GRWB 5KVEL 2P5WA 1ZHKA 3MR9A 3FT2B 1MFBH 1GCFA 1FRGH 4X6BB 1V3JA 5FYLE 5T3ZD 1T0PB 1CQKA 4LU5H 3LEYH 3KPLB 4HPOL 4EN3A 3U7AA 1KNOA 1G0YR 2XFXA 4PRHD 2BOBA 5FF6A 1BD2E 2AJUL 5IJVA 3RVWD 5F72S 4XI5C 1RIHH 3SE3A 4X6CB 4CMMB 1AKJD 1BVLB 4N8PA 4YHOH 5HHOA 1LGVA 1NSNL 3TNNB 3DX8B 2KH2B 3ETBF 3IVKB 1OP3H 3L9RA 3P9LA 4W70A 5JW4R 2E8YA 4MWFA 1NC2A 1C08B 4ELKB 3O3BB 5CP7B 2HFEB 4QRPD 4PJEA 5HYFA 3BZDA 4P4KB 3IFOB 4IOSD 4RNRB 4IS6A 4U1LA 4QHKJ 1H5BC 4J4PD 3MJ6A 5EO0A 5HYJB 4YDKL 1VDGA 1GHFL 4JDVB 5D7LA 4L5FH 4NQED 5IBLC 5DVOA 1YN6A 1FZMB 2DJ4A 4LFHD 1KJ2L 4PLKD 4K9EC 3PGCA 3GUTA 1A4JB 4PJGB 1X6NA 3WUZA 1ZLSH 2E7CA 3LB6D 2ENSA 1MH5B 4EOWH 5FYJH 2EE2A 1U8HA 1EJ6A 1UH3A 3MV9A 4HIXH 1P5UA 5IV2A 4Y2DB 4UT9L 3UX9B 3WFEL 5JNYA 1HYRC 4GG8A 5JIIA 5DO2C 4IOFC 4PRHA 3MX0A 4HC1H 1A1MB 1PAMA 5IVOA 1A7RH 3RUGB 3SDYL 4P57A 1WC7A 3LZFH 2NY4C 4KRPB 4LPUA 3FCTA 1B9ZA 2QSCH 4ETQB 2V2XA 3GFUA 1IFHH 3FB5B 4R4FL 3JWNC 3JWOH 1RVFH 1K4DB 2XV6B 4XNMB 5EIVA 4YDJB 4QRPA 5DA4A 2FGZA 1RAMA 2FD6H 4Q9QH 1YMHB 3BP6A 1JP5A 3O4OB 3CFCL 5I76A 3V4VL 5DT1L 5IT2L 1XGYH 4NQEA 2FX9L 1L6XA 5SWSA 5HHQB 1IAKB 3D0VA 4N90D 5CJQL 4CW1A 2R23A 3MRJB 3K4AA 2QADC 3VCLA 5FECA 1I9EA 4MD4B 4KI5C 4POZD 4JKLA 5I75C 4XBEL 8FABB 2JKXA 1NL0H 4PRPD 3B4NA 3G5XB 3N1PC 4KTEH 3J8F7 3SE3C 4PJDF 3O3DA 3TVMD 5H8DA 3IDXH 3REWB 3QJHB 4MQSB 4S0SD 1OARL 1TNNA 1OF2A 3OKMA 2X4PA 1IGJB 4PLOB 4X4ZA 2C1PB 5DLMH 1MRFL 1MY5A 5B4MD 3ULUF 2WLZA 1KTKE 3DYMA 2BOCA 1ROWA 4M5YL 2BNUA 3QDJA 5C08D 2G9HA 3KLHC 2FZ3A 3HN3A 2ZCLL 1JNJA 2XY1A 5EBMB 5CWSB 2CKBB 5A43C 5CIPH 1F4HA 4NFDA 3LEXB 4JPKL 4HIHA 3TV3H 2F53B 1FH5L 1R5IA 2YPLE 4C4KO 3C8HA 3DLQR 4X8XA 3VFOA 1T7YA 5ESAA 4QHUB 3S98A 4GQ9H 2F54D 4UT6H 3EYVB 4IMLA 1U8OA 4EDWH 2P48B 3DV4A 2XQBH 3MCKB 3KPOB 1MHPL 5EU6A 4NN7C 2VL4A 4NKIL 4FOMA 2R2HA 4G9FD 1SYSB 3GSOA 2UWEA 4OV5B 4B7IA 3GHEH 3VXME 2IC2A 3MRMA 1MNUH 3CSPA 4PJ9A 3BT2L 4LHQB 3TYGL 3WS6A 3VXUB 2Y9RT 1MWAB 3O6LL 4HF5H 1D5ZA 3RWDA 2EICA 2NNAA 5LVEA 4OIIL 2XQYG 1P84J 3RVWC 2EDTA 4ZUTA 3L7FA 4LPYA 4QRUB 4MJ5A 1D7FA 2VC2L 2XKSA 2JJSA 1J0JA 5IW6A 3NFPB 3CNKA 5D1XD 1FLRH 3SGKC 5KSAD 5JHLL 2G75A 2A6JA 2HJKA 5T5NG 5FFLA 3QCUH 3C6LB 3BRFA 4XPTL 2HWZH 4HS6A 1J1OL 1YNLH 1LEKA 1IKNA 4PJDE 1LHZA 4R2GD 3Q5TA 3QSKB 4XNUL 1YECL 4JDTL 5C7XL 1MI5D 3HMXH 4B7LA 1JWUB 4HAGA 1HQ4A 4PLKC 1ZT1A 3HG1A 4DKFL 5HGHB 1QTYT 3IFLH 3SQBA 3ULUE 2ITCA 2IPKB 1KCVH 3KPRD 3T2PA 1UWXH 3LB6C 4YDIL 1JI2A 1PX3A 1Z3GL 4OLYL 2PYEB 3D2UD 4Y0GA 3U4BL 4R3SB 5B3NA 5DD6A 1FZKA 3TP4A 3QRGL 5J9PA 5HYSB 5LQBL 1DZBA 1K3ZA 3MV7E 3MREB 4I9WE 4FQHB 1QNZL 4GXUN 3DMMA 1A3QA 2YR3A 1KFAL 1X5HA 1KIUA 2AK4A 3WMSA 3CFJB 1S5IL 4O4YL 2D31A 1EFXB 3GSRA 3ALXA 5IFHH 1LDPH 2V2WA 1QBAA 2DLFH 5EOTA 3KLAA 3T3MF 4J12A 3QA3A 4NQCD 5FEBA 1T03H 1JK8A 5JZ7D 5J13C 1A5FH 1SJEB 5T33L 1MIEH 2IBZY 2CLVA 5I19L 5D5MA 3FQTA 5MERA 5DR5L 5KSVA 1W72H 4KWUA 4N0YH 5IMMA 3HRZB 3O6FA 3TZVB 5TQ0H 2C1OB 4PJ9C 2JB6A 4NNYA 3WS6C 2FO1A 2ZCKH 1RIVH 5I16A 4HBQA 4MVBC 5HI4C 2W07A 4LEXH 4POZC 4F3FB 5ADPL 2YHGA 3ARYA 3MLSL 4J8RA 4P0DA 1XMWA 3QEQD 1FVEB 4DZBB 3BEVA 2V5TA 3D2UA 1ZSDB 2JJSC 4XPGL 3WHE1 3VFUB 2ESVE 4HUWA 4KRMB 1FYTE 4OTXL 1P69B 2F15A 2QR0A 1ES0A 3EO1B 3U7YL 1E4XH 2VOTA 3EZ8A 4MB4A 2AAVA 2D0GA 1GPOH 1SJHA 5HVWA 3ZE1F 5D1QB 4LFHG 4L8CB 3CPLB 5T1KA 3WN5A 1IL1A 3F12B 4N9OB 2EDRA 4MAUL 1C16A 1G9EA 4Q6IB 4PR5B 5C2BL 3NGBC 3RNQB 4HWEL 1IKNC 3UCRA 3LKRB 2DB8A 1A64A 1SJVA 1I3RB 3CK0L 1IGIH 3O9WB 1A6ZA 4HBCL 2HJFB 1EX0A 4NQCA 1HHJA 3RY5A 3ET9F 1XCQB 1UXSA 4A6YB 3PL6A 4KROC 2HRLA 2XN9E 3ARED 5I1EH 1R3LB 1ACYL 2VLJE 4WUKL 5JLZB 3QULA 4P9ML 1QLRB 5EOCL 1TZGL 3CCHB 2A6KB 3VG0L 2K1MA 2OXGA 2HYMA 2VDNH 3CDYA 5IMLB 4Q74A 1IGTA 2A0LD 4R97C 1S7TB 2BMKA 4YO0B 4GSDH 4U1SB 3DX7B 3L7EA 4U1HA 4Z76B 5KVMC 1BQHB 2PKDA 3CFDA 3HPLA 3QEQA 3T3ME 1O0VA 4MXWH 1FNSL 3GIZH 5ADOH 4TUKH 2VMFA 3DMMC 4QRQA 3MA7B 2SEBA 3HPJA 3JWDH 3BH9A 4JFOB 4GMTL 4MA8H 3FQUB 2YN3A 2PN5A 5FYKH 3B83A 2VXVH 1W0WB 2HJLA 5I8EB 5HGDB 4MQ7A 3RGHA 2CGRH 2A9MH 5HHNB 3L3DA 2A9NL 2ZUXA 4RWHA 4YPGA 1KENH 1CZ8H 2H8PA 3GSWB 5FK9B 1TETH 4NQDD 1FL5A 4LHJB 4R0LA 5D2LF 3WHXA 3O6FC 4EI5D 5KSBF 3DVNB 4LVOC 1SY6L 5K9OB 1PQZB 4XP5H 3V4UH 1MJ8L 1IBGH 3HR5B 4I2XA 5CEZD 5DFVD 4P5TD 5DFWH 2G2RA 3ZE1E 4LOUC 5C0CD 2XRAH 4APQD 1FNLA 4G80A 3NACH 2BXYA 5JHDE 3GDBA 2AKRB 2DBLL 3D85A 3WUWG 2CIIB 3DROB 3BDYH 1A6TB 3MYJB 4IDJL 4EDXA 4PJBA 1XGUB 3QH3A 3Q5OA 4L4TD 3UXFA 3NVQA 2NXZB 1I8IB 3O3AB 1AXSA 3BGFB 3WLBB 2YEZB 3IFNH 1MJ7H 3FO0H 3WN5C 1ETZA 3WXVH 3KPPA 4LVNB 1J0YA 4LAQL 1WZ1L 4X6DA 3S3JA 1OM3H 3GJEB 5IEHB 3P9MB 1KLGA 3O3UN 1TTUA 4NZDA 5DUMH 1FNHA 2Y23A 2GSIB 2H26B 5BQ7A 4Z6AT 1HIML 3MLUH 5DTFA 4R8WH 1PVHA 2NTFA 3IETA 3OKLA 4U1NA 2HT2D 4OJFH 4PJXA 3CLFH 1NANI 4P2RE 5JZ7C 4Y4KB 2BVPB 3PL6C 1AQDA 5EUKA 1DANT 3QFJD 4J2XA 4QXGL 4BH8B 1KULA 3RY6C 4EI5A 1E27B 2F74A 1D6VH 3DO7B 1TVDA 3P73A 4X5XB 3UTPE 4PGCB 2BSRA 4WW2F 3U82B 3H3PL 2OSLB 5C0CA 3EOYG 5HYEA 4APQA 4DK6A 1S5HA 3KYNA 2X4QB 3AM8C 5DURD 2A74B 4I1NB 1EVUA 3NN8B 1LO4H 5KVGL 1QR4A 2N1KA 4NQUA 4XRCB 4Y4FB 5D2LE 3FB7A 5EOQL 1YEGH 5KSBE 3K1DA 5DRXA 2AK1H 4JFPB 3CZJA 2YPLB 2O5ZH 3TIEB 5F7DB 1JGEB 1CLOL 3WKMH 2HN7A 3DXAE 3RX7A 1QBBA 1OLZA 4FXKA 1AGEB 1B88A 2R0WH 3GIVA 1RURL 1OD9A 3EOBB 4TUOB 2VXUH 3G6JA 3VRLE 3IJYB 2YD6A 4R0LC 5E2WL 2OYPA 4WCYH 2VSDA 3VXMB 2ZKHL 4N0UA 4AL8H 2R1YA 1GZQA 5GJSH 5LCVL 5SX4I 3BJ91 3JUYA 4ORZC 4WEMB 3QFJA 4HX1B 4O2FB 1R3KB 3FL7A 3R8BB 1R3JA 4HLZG 5DK0B 1JNLL 1FL6A 5D7JD 2A0LC 4JFHD 4ZQKA 2AJ3A 4K8RD 3V52L 4OFKA 3QWRA 3INUL 1OB1A 1OP5K 1K8DA 5DS8A 1HNGA 3EHBC 2DM2A 5T1LD 5M7QA 1WBYA 3N1QC 4RBPH 1OAQL 3VE0A 2GJJA 4IRJD 2AJYH 2OXHA 2MMXA 1ZOXA 2X4NB 2MHAB 4NYLA 5IB4B 3OSKA 1J1PL 4OM0L 3F7YB 5FCUH 3SHSA 3FRUA 1IC7L 3JSSA 1HKLL 1PEWA 1MCOL 4HIIB 4B5EA 1AIFA 3SKJH 1QSFD 2DQJH 3GMLB 1DLFL 1E6JL 1DBBH 3AAZB 3D39A 3PWNA 1UEMA 4M93C 2CH8A 4PJDB 5FA4B 3GO1H 2D3VA 2DWEA 2IG2L 4E41A 4DUWA 4WWID 2V2TA 1NUFA 1V7NL 2X1PA 1HSAA 4HFUL 1AXTL 1NGQL 4I8DA 4RGMB 3F5WB 5IM7B 3DHMA 3KNBB 4PRBB 5JXAL 2YUWA 5ILTH 4P3DB 1K3IA 5T1MB 1I7RB 4DZ8B 5BXFB 1PZUB 3O6MH 3S4SA 5D7IF 4JHBA 1CFSA 3B43A 2JJVA 4LEOA 2LVCA 2ZWLT 4OZGF 4M1CD 3HHRB 4EI5C 3O2VH 3O4LA 3VFGL 3BZFB 4D8PA 1NCTA 3BH8B 5DEFA 1LE5A 5HI5C 3RKDC 1F11B 2VJXA 5DDHB 5F9WB 2OX5A 1N5AB 4HUVB 2JJUA 3WNPA 3TWCL 4C83B 2X44D 3LKPA 3HE7B 5DHVB 4MJ2A 3I02B 1MUJA 2WBJD 2WMPA 3MV7B 4C57C 1ED3B 2NLJA 4PRDA 3EYUL 3S36X 1PBYA 1RI8A 4M7LT 4BZ2L 2ICEA 1QEWB 1KPUB 4UI2A 1RJZA 3TBWA 3P3YA 3BW9B 5BOPA 1MREL 4IRJA 4D9QE 1CS6A 3IAQA 5F7FA 2VR4A 3FB8A 5DD0L 4BFBD 1PG7H 1FORL 2L4OA 5DQDL 4WV1A 4XMPL 4OCWL 3PWVA 4LF3A 4EI6B 2D0HA 1E6OL 3I75A 4LDOB 1OP3K 3WFHA 4F57H 3LV3B 3OTTA 1QSFA 4AENB 1MFAH 1U8KA 3KS0J 3P4NB 3T4YA 4BKLA 2R29H 4LKCB 5IB1A 4ETYA 1N8ZA 4G6FD 4L8DB 2ZZUT 3NZ8A 3KJ6L 4XT1C 4NHCH 4KGJA 5HVHB 3FN0H 2P4AB 4DGVL 1VFBA 2Q86A 3UBXG 3BQUD 4YHML 5I15L 2AXFB 2VL5A 5B3JE 1NBZA 1S78D 5GISL 4ZDHB 3SOBH 2HLFC 1N0XL 3S8WA 1Y18B 2J1KA 5LGKA 1AD9B 1OGAB 3VA2C 1WFOA 5CJOH 1HHGB 1OTSC 4GKNB 3S36L 3SGDH 3U9UB 3T3PF 4PGDB 2Y25A 5DRZA 1G6RA 2ESVB 5F8RC 5I0DA 3PHQA 2Y07H 5ESVB 3HZMA 4HH9A 2QKIB 2WBJA 3QO1B 5DJYA 2WLYA 3MJ8A 4R96B 3H9SE 1D5MB 3EIFA 3HCVB 4RAUB 5IVXA 4UNVA 3MV8D 3U4AA 4JANB 5D7IE 2W0LA 3MOAL 3UZEA 1DJSA 2L7UA 2NZIA 2UZYB 1RJLA 3CMGA 2XWTB 4OZGE 4V1DB 1JN6A 2QQLL 5EULV 5EUOF 4XHJD 3U36A 4OCYL 2HT3C 1N3NA 5IG7A 4X5WA 3J7HA 1SEBB 2XN9B 1WEJL 3DUHA 1U8LB 2VLJB 4M6MH 3GJFB 3V5DA 3V4PH 2PR4L 2DICA 4G8IB 4OGXH 3O2DL 3KPQA 1SVCP 3VDCA 3SDXA 4HEME 1JV5B 2EDHA 4LHUD 4MZ3A 2IPTL 1ZEAH 4HLZH 4FQJL 3QIWB 3ZTJG 2Y7QA 1BQUA 3BQUA 5EPMB 5C3TA 4L8BB 4JFFD 1MEXH 1CFQA 4YXLL 3MROA 5EZOL 3L3JA 3OKEA 4R9HA 1U3HB 3IGAA 1NDGB 1FG2A 3VFSA 2X7LB 5FYLD 4IRJC 1SMOA 5IFJB 1RUMH 4WO4A 4H25A 5CINL 1R3HB 1BVKA 1LO3L 4WV1C 4H88L 2Q20A 1TIUA 4GS7B 4TTDC 1S8DA 3SCMA 1BD2D 1LEIA 3MV8A 4MA3B 3HNTL 1U8MA 3D9AL 1AD0A 3C2AH 2NY3D 5AUMB 3S34L 1KB9K 2Y5TB 5E1AA 3B2UC 5CSBA 5MP6L 2CDGB 1DANU 3CH8A 1DFBH 3MLYH 4ZUUA 4WEBH 3VXPA