3S37X

Structural basis for the function of two anti-vegf receptor antibodies
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
110
structure length
110
Chain Sequence
b'GYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1121B Fab light chain
publication title The Structural Basis for the Function of Two Anti-VEGF Receptor 2 Antibodies.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system/transferase
total genus 16
structure length 110
sequence length 110
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s37X00
5L2KD 3MRPB 3NIGF 2QSCL 4GRWB 1MCWW 2G60H 1QZ1A 1VEOA 1CGUA 1QVOA 1GIGL 4EVNB 4Q6IB 1AKJA 4LCYA 1BVKA 3BT2H 2FLBT 4M6ML 3WNLA 4BH8A 5D5MA 2NXYB 3QXAA 4TNWF 2DKMA 4KUCF 4JEGB 2EH8H 1OGAA 3S34H 3F65A 4N8CH 4P4KB 1SY6A 1AHWA 5CCKL 4RX4D 3VWJB 1KIQA 5BS0E 1P4IL 5F9WB 4NQVA 3QDJD 4OZHF 4ZQKA 1AQDA 2BY3A 1KELH 3QUXA 5J7CC 3U0TA 2D0HA 3BHBB 3X12A 2VSDA 2FIKB 4F8QA 4X7SH 3BPNB 3FONA 5EU5A 3NFNA 1YNLL 2YEZA 4M3KB 4FS0A 4PGCB 1KFAH 1KJMB 3QDMD 5BVJA 4HBCH 1S8DB 2DKSA 1KB5A 2AW2A 2ERJC 4OLUH 2DQUL 3C9NA 1CICA 3LIZL 3IAPA 4K94C 4M6AA 5DWUH 3H9ZA 5F7YC 3REWA 3Q3GB 3SCMB 3LH2H 3UX9B 3RNKB 2C4FU 3UMTA 1Y6MR 3WS6C 1T3FA 4GG6A 3OAZK 1G0XA 1MHCA 4U1MB 1HEZB 4WI4A 1PKQA 1RUPL 4ZUTB 4HKZB 4PRPE 4JVWA 3X13A 1Y18A 5HHVH 2CO7B 2FL5B 4YHKL 2OL3A 4PV9B 5D7JC 4D9RD 3P4NA 1IGTA 3E3QE 3MRKB 1PLGH 5I1GH 5L2KE 5CLTA 3WHXB 3QIUA 2X89D 5E08H 1SJXA 1GOGA 4RQQB 4HGKC 4G43A 1X9QA 3MUZ1 2MCPH 1JVKA 4FQ1H 5IVXB 2UVEA 1JF5A 2VISB 5B4MD 2ZCHH 4YWGL 3MRHA 4N1EA 2PR4H 1RZGB 5D71L 5AD0B 2OBGA 3ULUD 4O2CA 4HJ0C 5JPNA 3BKJH 2HVJB 4JY5H 3QJHA 4XMLL 1JYVA 2ADJA 1VGKB 1KN4H 3FL7A 4KJPC 2O93L 3REVA 2XWTA 5IB3B 5GZOD 3RDTA 3QDJE 3NZHH 3MBXL 5E6IC 1M7IB 3NAAL 2WWKT 1AE6L 3FN3A 2ADGA 3GMOB 3NA9H 1RURL 5I1AB 3K80A 2FCBA 4WW2B 1XF3A 4NYLA 3QA3A 3FO9B 4LNVA 3QDME 4QRTA 4ZO7A 4CVXB 1WJ3A 2PW2A 5TQ0L 2X4OB 4KROD 1U8HA 4EDWL 5HVHC 3C6SA 1AKJD 4XBGA 4QXUL 1JRHI 3MR9A 3VDAA 4GRMB 3RU8L 3GIZL 5IHUH 5FUZH 4ENEC 4RZCB 3J8F7 1OGAD 2VZSA 3VXQA 4OI7A 5EN2B 4C58B 4Z5RA 2VWEC 3MRCB 4NIKB 2C1OB 3D39B 4DWHA 4L29A 3QUXD 3PDOA 4UQ2B 2J4WL 3CMGA 2OI9B 4RMTA 2IQAA 1IL1B 3H9SB 3LQAH 5C0BA 2CUIA 2DN7A 4D9RE 4NNYA 3MQIA 5FV2A 4NDMA 3LMJH 1UXSB 1TJIL 3NGBC 2XIDA 5GS3A 1ACZA 2UWEB 5KVEH 3U9UA 4DK3A 2P43B 1IAOB 5IFAH 2R9HC 3BZFB 2IH1B 5CHNB 4QO1A 1CICD 1VEPA 5CJQL 3MCLL 3ULUE 5I1JL 3GKWL 1OLZA 3HZMB 3MODL 3HAEG 1S7UB 2A0LD 1CBVH 4Y5VA 5DFVC 4PJGE 3RBSA 2DMKA 4AL8L 1BLNB 4PP2B 2BVTA 3L3IA 3DXAB 1NFIB 4LNRB 3KHQA 3C5SB 3V4VH 2Y07H 1MQKL 1OPGH 3U4EB 4GJTB 5IEKA 3GFUA 1X5XA 1GAFL 4A6YH 3LD8C 1U42A 3WIIL 1N3NB 3DRTB 2F53B 1ZHNA 2QEJA 3TBWB 3SQOH 1MHEA 4RAUB 1I9RH 2DQFB 4HF5H 1X7QB 1JL8A 3QIUD 1AFVH 3L5WA 5IROC 3MOBH 3SDDA 1CFNB 1PQZB 3TT3L 5IQ9A 3VH8B 3LHPH 4TUJA 3HTLX 1I7UA 1NEZB 5INCB 1BBDL 4G8FB 1NDGA 4MJ4A 5F70A 3TWCH 3MFFA 5D5ME 1QNZH 3BD4A 5CFHA 1OGAE 2EE2A 4HUKB 5IVZA 3U82B 2AJZA 4APQA 3V6OA 1EBPA 1A5FH 2DD8L 3RDTD 2AJSL 3RX8A 3JTTA 5E56A 5TE7L 3RX5A 3VD4A 4UU9B 5HGBA 5IESL 4XMPH 1PG7H 3QB7C 1HOCA 1F42A 4G6AC 3DURB 1CE1L 5FHBL 4LSSL 2BVQA 5T3ZL 4OV6F 2Z92B 4MDIA 3C6LA 2JJSC 3HZVA 4LVHC 2Y1VA 3G04A 2DTSA 1I1RA 4JFEB 1LK3H 4ODTH 3MNZA 5BRZA 1MRCL 2RAMA 5L0QC 1EEYB 4E42A 1A3LL 1FN4A 3VD3A 4NJ9H 3MRRB 4JVUA 5EBGA 2HJKB 2UV3A 4GAJL 4MJ5B 5FM5M 4NOBA 3G6JB 1CIUA 2W1NA 4X5XB 1G9MC 5B38G 4GG6E 4LLDB 5FO7A 2H9GB 1CS6A 3ILPA 4AQOA 3BRDA 3TBTA 1AXTL 1MJ8L 3U6RA 4HT1L 2MTPA 1L6XA 1PKQE 4LPVA 2GT9B 1KLGA 5F9OL 2AEPH 1U8JA 4MQTB 4ODSH 3TVMC 1JFQH 3UYRH 3V5DB 5C0BD 3EDEA 1RZJC 1OF2A 3O0RH 5IW6A 3EYSL 3MUGB 5F21B 5C0GA 1YNKL 4JQXC 3GMMA 1HH6A 5GRZA 1R3JA 3GIVA 1YJDH 4PLNC 4WHYH 4U6YA 4IMKA 3W82A 1F4YH 4K23L 3U2SB 4LVOC 1RD6A 2BC4B 4WI5A 2BNRB 4L8SB 4ODHH 3RL1B 2HAZA 4PJGF 2V5SA 1NGPL 3W9DA 3ZE2E 2VXUH 3QFJB 4JG0L 4OQ1A 1HDMB 3NH7H 4KK6C 2EDRA 1ZEAH 3EOTL 1AJ7L 1B2WH 5C2BL 4O4YH 4PGBB 1LP9A 1MF2L 5DRZB 5B3NA 3I3DA 5DDHA 2GY5A 3T65A 1J0IA 4BFBD 3NCEB 3MREA 4P23B 3QCVH 3IDMB 1H3XA 3UTSB 4HLJA 3ECBB 3LEYH 4XPAH 3S36L 2A73B 5CZXC 4F3FB 3SDDD 1SJEB 3ARUA 2FWOB 4LCIH 3CPLB 3DNKA 2JJWA 2DMCA 5D5MF 3EKCA 4MHHG 1ZLVK 1NAMA 4DVBA 4APQD 3K1KC 4WDIB 3CJJA 4N90D 3CFJB 5I1DA 1HQRB 5KSUA 3ZSTA 3OX8A 4Y5YC 4XX1G 5D93B 1CL7I 2B4CC 3CDGA 3JV4B 1J05B 4KKAD 4R3SB 4YBLB 1E4JA 5B21A 5DQJA 5C0BE 3OG4B 1WFUA 4I18A 1T1WB 4KJYA 4GBXB 5I1EL 2CRYA 3NABL 3C6LD 1LNUB 3ALWA 5IB1B 4CW1B 1D7FA 5TQ2H 2XZAL 1XGQB 5E8DL 4M1GL 3RWDB 2A9NL 1XF2A 5BRZD 1BZ7B 2GFBB 1JTPA 1WIUA 2VR9A 4HS6A 4QEGA 3QXVA 4AT6A 1OOAA 4HUMB 3JTSB 4YXHL 1EJ6A 2VLLB 2C3WA 1ZHKB 2H2SD 4JKWA 1C16A 3C09B 3F7VB 1N8ZB 3LKQA 4Y0GA 1LWRA 4LARL 2I9TB 4U1JB 3WLBB 1DL7H 2OJEA 4DZ8A 3WFBH 4GG6F 4M93C 5IG7B 5LBSH 1J7VR 1FO0L 4H26B 5KN5A 4KWUA 1YA5A 2BNQB 3RZCA 1TJHL 1XH3A 5CEYA 5CBAA 5GS0D 3OJMB 1C1EH 2DL9A 2CIKA 1JPGB 4ZYKA 2X40A 4OF7A 1RMFL 3AXLB 2B1HH 3FO1B 3LQZB 3FQXB 5I73C 4V1DA 3MJ6A 5IEHA 5BJTB 3LRSB 3RTQB 1NUNB 2RGSA 4OIIH 3GSUB 3M07A 4X6EA 1FGVH 2ZUWA 5E1AA 2ZSVA 1J1XL 3ZYOA 1NBQA 4GAFB 5DRXB 4ODUA 5LGKA 2O5XL 1QOKA 2R0LH 4M7JH 4PRHB 4IOFC 4U1NB 1Z6JT 5HHNB 4ZFZB 2C4XA 3O6KL 3H6JA 4XNZB 3KLHD 1OCWL 5TGBA 1WFNA 2MNUA 3MLRH 5DZLA 3I75A 3ZE2F 5MEPA 5EO1B 1B6DA 3UTZB 1RIHH 1CCZA 5EZOH 3O45A 3V6OE 4OGAD 3QFDA 3V4UH 4N90E 4F7MB 4KUZL 3RNQA 4K7FB 4ZUWB 3OKLB 1F4AA 3VXOA 2OZ4L 4OTXH 5TDOA 3ARYA 3PGDA 1CTNA 2MQCA 2A38A 2Y06H 2E6JA 1GGIH 4NUGL 2V7HB 1YECL 2F8XC 1PEZA 4U33A 1BF2A 3EO0A 1KPUA 2J8OA 1CT8B 5BRZE 4FQ2L 2UYLB 4XT1C 5ADOL 1I8KA 2RFXA 4NQDA 3WD5L 5I0ZA 4HS3A 2FEEI 2OK0L 5ETUA 1KJ2H 2LVEA 4PRIA 4WV1B 5GXBB 5D8JH 2EZ0C 4R0LC 1DEEB 4WEMB 1D3CA 4F7CA 3TO4B 1UACL 3ROOA 2E6QA 3RIAF 4DN3L 1CFSA 1J0HA 4XTRD 2VZ1A 3OJDB 5I15L 4LFHD 1ROWA 2HH0H 1X6LA 2DQJL 3QZWG 1K85A 5ELIA 4XCFH 1AD0A 1IC7L 2EE6A 3MRJA 3NZ8B 1IKFL 5C0AB 2Q7NA 4JO1L 4JO4L 1OAZH 1IGIL 4DKEL 2WUCH 3SBWA 1D5ZB 1FC2D 5DF0A 1YEKH 3KR3H 1OAQL 3P0VH 4CMHB 3FCTB 5C0CA 3FQUA 1HNFA 4KRPC 3UZVB 1GGCH 2XKNB 5I76A 1T20A 3LKNA 3T0VA 4FQXA 4MYWB 1BX2A 2BCKA 4N0CC 1J1PL 4URTB 2MSPA 4ZO8A 4OQTL 2FLRT 4YHYB 2BHZA 2EIEA 2V2WB 3V0WL 3ZDYE 4KKNA 3A6BL 3RZCD 5SV4A 3TT1H 2BVPA 1DVFB 4M1CD 1A3RL 1X6NA 1ZA6A 1LP9E 4YGAB 1MLBB 4GMSH 4Y4KC 2EIZA 5HI3D 3VCLB 3S36X 3JWOL 4YFLI 2DI8A 3HNSH 1P7HL 4V1DD 1ACYH 3NTCL 1FIEA 1HHGB 3BQUA 4FQHB 1OW0C 5CINL 1T03L 4I48A 1UJ3B 2Y7QB 2YD5A 2DMBA 3HC4L 3A0OA 1XEDA 4UINL 2F9BT 1HHJB 4R4FL 2X4TB 4WY7L 1MWAH 3K1DA 3MRMB 4S1QL 4LSTL 1A4JA 4ZUSB 3WIFA 1T2QH 3MNVB 3ZKNC 5AG9A 3QO0B 3QIBB 4RFOH 2ADFL 1LEKB 2C9AA 2VLRB 4G7VL 5L9DH 5HY9A 5DMGD 1CXEA 4DFHA 5J0BA 2PXYC 4XNYH 4IJ3C 5DJ8A 5JO5B 5I1IH 3MZTA 2R8SL 4KMTL 3RWGA 3JWDH 1X4ZA 2V7NA 3C08L 2GITA 4G80A 4UTAL 3HMWH 1GVIA 1QLEH 4FP8L 4JFYA 4C56B 3I6KA 5KBNC 3DPBA 2Y25A 3RVWD 2H26A 4QRRB 1MIEH 4ZSOA 3F6LA 4OGZA 2AEQH 3TPUB 3DMMC 1QBAA 2BDNH 1FNGA 3BZEB 3KAAA 2V2TA 3LZFL 5I1CL 1UKSA 5ECJE 3KVQA 1NAMH 1QP1A 5DK0A 5TE4L 2DQHH 2NY5C 1BJ1J 2X10A 3D0LB 2Q8AL 4NQDD 2H32B 4HEPG 4NN6B 3SE3C 1VHPA 1NMAH 4PRID 2X1WL 3RY6C 3PL6A 3KYMA 3T09A 1C5CL 1B4JH 3HRZA 1XR8B 5LAXB 5IF0A 1GH7A 1WICA 2IPUK 2J2ZA 3EYFB 1AGBB 4MB4A 2HVKB 2R4SL 1CI5A 2C26A 5L88L 5T1MA 2CKBH 5CILL 3WN5C 3DSFH 5DQDH 2D7QA 2QLVB 1K6QH 1ONQB 1EEUA 2OP4H 1T1YA 2JJTC 4MJIA 3LKOB 2ZUXA 4V1DE 1BGXL 1HCVA 1OTSD 2XTLA 3FFCA 5FYJL 2BOCA 2K7QA 4J8RA 3FB8A 3V79C 2X4SA 4J4PC 4G6FB 5ITBH 4PTUB 1UCBH 5D4QA 4Y8AA 5F97E 3WJJA 3SO5A 1A2YB 3N1QC 5ISZA 5C0CD 1DQQB 1X5JA 1I9IH 4D2NA 5T1LB 4FQXD 2QJDA 4W81A 3R0MA 4DEPB 4QHMB 3HLAA 1F00I 4WUUB 2BY1A 3VFPB 2X4UA 3ZDYF 2ICEA 2OS7A 3O41A 4LRNL 1JPFA 4NJAL 3BH9B 1RFDH 2NXZB 2Z93B 4M43H 2P8LB 4LKXB 2NQCA 3MLSL 1LP9F 1VERA 4OZFA 5DT1L 1BIHA 1NMBL 4L9LC 1WVZA 3MRGB 1P84J 4G5ZL 1FQ9C 4P5KB 2ZJSL 3QPXH 1G7MA 3PNWA 1ADQA 5EBLB 5EG6C 3IF1A 3JV6A 4U1LA 1SVCP 3BQUD 3QXTA 2BSTA 5KSVA 1FPTL 2VAAA 3X3FH 4TN9A 4AEFA 2DYPB 4NQDE 5I19H 5HGAB 1K4DB 2EE9A 5FK9A 2IWGA 4PG2C 1RIUL 1H5BC 1TZHB 2X70B 3G5ZA 4OZHB 4PRIE 4YDJA 5E00B 1CLOH 5FXCH 1HINL 2DLEA 1KJVB 2CDFA 4PB9L 4KAQH 2AAVA 2I9LA 4OM0H 1KIPB 1DCLA 4OCYH 2IAMC 2VABA 3H9HA 4FG6D 4NOFA 2P8MB 3WIHL 1KCSH 3KYNB 4YFDB 5GRJH 4QOKB 1A6ZB 5D1XB 1NJ9B 1U95B 2W60B 5EU4B 5IMOB 1FL6A 3TYFB 4PG9A 4RWYL 5I18H 3R1GH 4AG4L 3BMVA 2MWCA 4NHCH 4UT7L 1PY4A 1NCAH 3EYOB 1U36A 3RWCA 3WFDL 1FFRA 4DZBB 4Z0XA 4X5LA 4K3GA 3I6LD 4H88L 1NFKA 4Y19B 5C0CE 5T5FH 3E8UL 1E6JH 1KULA 4W6WB 5JORB 2P45B 2P7TA 1QBLH 3DGGA 1JGLL 1ZLVH 3EFFB 4OJFH 3PL6D 1CQKA 5D1ZA 2VDNL 5FF6B 2AKRB 2FX7L 3TP4A 5FYLL 5ITFB 4QRQA 2A2QT 1K4CA 1CQYA 4CL7A 4S1RL 5BMFH 1J8HB 2JB6A 4G8GA 4U1IB 2ITDA 2FBOJ 2NY1C 1JGUL 1A1MB 5CIPB 5ALBH 2W92A 4YDIL 3QIWB 4GH7B 3MSPA 3I85A 1FL3B 1TQBC 2DJ4A 4MJID 1ORQB 2VXQH 1QFWI 1UYWL 3CH1B 1KYOJ 4RA3A 4N8PA 3FFCD 5MEQB 5JXAH 1ZKAA 3U7WH 4LCWB 5E8NA 1XF4A 3MV8B 2FJFA 1NUFA 1W0VB 2B0SL 5DRNA 5AG8A 3TO4C 3BGMB 4Y4HC 1MPAH 4DVRL 1VPOH 3AREB 4I2XA 4DCQB 3T4YB 3KYOB 5HYSA 4Z7VA 5ISZD 1GYAA 4XPHH 4J3OC 1EFXA 1K5NB 2CKNA 5ACMA 1J0YA 2LFGA 2P5EB 4KRMB 3RWEA 5DC4B 5FUCE 5I6XB 3LPGA 3VFTB 1EXUB 4BZ2H 5KZCD 2HA1A 5FECA 3B3IB 3P30H 3I3BA 1T83A 1TTGA 3BWAB 4HD9A 2Z0BA 1DQLL 2F74A 5IGXH 1QSEA 3BYYA 1KLUB 4PJFA 4YX2L 4JRWA 4ZSOE 1E4XH 3FMGH 4F37K 3IJSA 2O5ZH 4WFGD 4LGRB 1DFBL 3GSRA 5HBBA 1A7PL 5GRXG 5J9PB 1DBBH 4OGXL 3QUZC 1JIBA 2DWEA 4PB0H 1AH1A 1G7LA 1UM4H 5EU3B 3GMPB 3SDCB 3I6LE 3WO4B 5BS0B 4NKOB 4XI5D 5GGTA 2NY0B 2NZ9C 4W70A 3HC0B 3L9RA 4NHUA 2YPKA 1BFTA 1MCLA 1FFPB 2VZUA 3ARGC 4NCDA 5JHLL 5J13C 1A6WL 2HLAB 3BP5B 4NN5B 4FNLH 2W0FA 2FX8H 4WO4C 2H45A 4MS8D 1S7WB 1F3JA 4R96A 5FGBC 1BJ1H 1P7KB 1TIUA 4M02A 5DD5H 1IM9A 4L9DA 1Z0NA 2OQJA 2ICWB 4MJIE 3O11A 5TPWL 4QCIB 1KNOB 3SKMA 2ZZUT 3INUL 1QPPA 2JB5L 3FFCE 5MENA 4F58H 3ES6B 4GQ9L 4N1HB 1MFCH 4QKXB 2G5RA 4L3EA 4JKPH 1ZLSL 1BZ9B 3ZTNH 2BSRA 4QRUA 1NC2B 1KXQE 1Q9LB 1NAKL 1I9JL 4XH2A 1R3HB 2VDML 4YLQT 4EI5B 3FN9A 2VQTA 1CXHA 3A67H 3RP1A 3OKDA 5CJBA 3UDWA 1JNJA 2VERN 5C0FB 4GAGH 1ZAGA 1GL4B 3TYGH 5ISZE 4R97C 4NKDA 1A7OL 2FATL 1NGZA 3DJ9A 3SHSA 3IFLL 4LP5A 5DJXB 5D1ZD 5SWSA 2GCYA 2ATPA 2E27L 4I13B 3GM0A 4JHBA 5E8OB 4OUUB 3L3HB 4Z77B 1JGEB 4JN2B 1R5WA 4BJLA 5L2KB 4G8GD 4YDLC 4HWBA 3VG0H 3QEQA 2GK2A 4MD4B 3BRGC 4OLWH 5F7LB 4AM0A 4PJEA 1Z5LB 3MGOB 1P5VA 1PVHA 1TLKA 4WFGE 4ACPA 1N4XL 1DBKL 1NCCH 1MHHA 2Q8BL 4L8CB 3RWFB 1SJHA 2RIKA 3BPLC 1F8TL 4Y2DA 4I5BA 1JWMB 3FQTB 4HBQA 5IW1A 4AEEA 1WF5A 1BJMA 4HIJA 4KHXL 3WEXB 1H3PL 1E6OH 1MCEA 3L6FB 5C92A 1KLFA 1GIGH 5C2UB 5DMKB 4WHTB 5DA0B 3M1BB 1EFXD 1A6TB 1CDGA 4M6MH 3PP3K 1NGQL 1SBBA 4I3RL 4QWWD 3B2VH 5C09A 3P9LB 1NGXA 1XMWA 5LG1A 3VU2A 5IV2A 5CCKH 3TCXA 2EE3A 5GRYA 1P4IH 1FAKT 5DSCB 4FQQA 3GJFK 4TUOB 2Y6SD 3QDMB 3RIFF 4I3SL 1MRDL 2AK4B 1QSED 43C9B 1QLFA 1BFSA 3U9PH 3KPMA 4FXLA 3L3GB 5E94B 2Y9RT 3MGTA 4GKNA 2YA1A 2Q3ZA 3MRBB 5BZWB 4PY8I 1MJJA 3V8OA 1YNLH 4EXKA 4XVUD 5A2FA 5JNYB 1A4KB 1RJZB 4ZFGL 4RMSA 3BKML 1JHTB 4FABH 5D96C 3GM8A 3MYJB 1AY1L 1MCBA 1P53A 3HAEA 2ORBL 5DI8B 5ICYB 5E2TL 3IYLW 4YBQC 5GSRB 1OHQA 3WFCL 4NO2A 1B4RA 3CNKA 4G8GE 1UZ6F 3CVHB 4Q6YA 1RUPH 2G9HA 1EVUA 2IH3A 1U8NB 3DIFA 1IM9D 4N0YL 2HFEA 2AV7A 1MCNA 3I02B 3O81A 2WQ8A 1N0XL 2BSSB 4YHKH 2XTJD 5MEND 4WTXA 2Z31A 3ULSA 4OI9A 2A1WH 4K3JL 5ID1A 4L3ED 4JJ5B 1TVHA 3F5WB 4YHML 5I16A 2VXTH 3QDAA 1PGRB 4I2XE 4NT6A 3PXJA 4Z7VE 4PRDB 1J9CT 2HG5A 4M8QA 4YWGH 3MOQA 4H0HB 5D71H 1MEXL 4IS6A 4ZXBA 5C6WH 1C5DB 1IM3A 2VDPL 3DETD 3BW9B 5HPMA 2Q87A 4XMLH 4PJHA 4Z7QE 5SWSD 3QHFL 1U41A 2CJUH 1S7SA 4D0DB 1PDKA 4LEXL 4L8BA 5JTWA 1KTRL 3NAAH 3RI5F 3QEQD 4E41A 1JZ8A 1AE6H 4QHUA 4CBPA 2N7AA 1QSEE 3F8UB 4PJFE 2V9TA 1JK8A 3M45A 2NW3A 1D5MB 4XPFL 1DLHA 1FDLL 1AKJB 2EDKA 1G84A 1RURH 2XRAL 1EK3A 3BZ4A 4BH8B 5D5MB 4Y2DD 4XNUL 1FNHA 1R24A 1OGAB 2HT2D 2NZIA 5TQ0H 4XVTL 4KTEH 2OXGA 2M2DA 1FORL 1FIGL 4EDWH 3OG6B 3ARXA 4HPOH 3S35L 5KSBA 3BN9C 1AQDB 3QUXB 4QXUH 1OY3B 3U0TB 3RU8H 3GIZH 3C60A 5C09D 4WJ5A 5FHAL 3X12B 4HG4J 1W0WA 4HC1A 5IBTL 5DZOA 4NBXB 3QWOA 5B38A 1JMXA 5C0EA 4CUCA 3FONB 5EU5B 3RZWA 4PLKC 3NFNB 2IMMA 1OWWA 2YEZB 2FYYB 4L3AA 5DHXB 2J4WH 3DO3A 5BVJB 2H3NA 3NACL 2X05A 6FABL 1KB5B 1FJ1A 2HRPL 3TN0B 3C9NB 2XTJE 5EOCL 5MENE 5I1KL 2NY3B 4L3EE 1TJIH 3REWB 2PN5A 3TZVC 2FEDD 5I6XC 1T3FB 4HQQL 1JTOA 3OR6A 4UMGA 1MHCB 5E4EC 3MCLH 5I1JH 3AS1A 2DTMH 1PKQB 2CXGA 4W4OA 2NY2B 2YZ8A 1UWXK 5SWSE 5ICZA 4HIHA 3VE0A 3VG9C 1RAMA 3X13B 1Y18B 4AL8H 5DQ9B 3MRLA 3P4NB 1IGTB 2VL5A 4BSWB 2EDDA 1R3IL 5DLML 3QEQE 2VXVL 4V2CB 1CTOA 2BFVH 4G43B 4PJEE 5J1AA 5C9JB 3GDBA 2E7MA 1GAFH 3IJYA 1ZGLA 2F58L 4JHAH 2N1KA 3WIIH 3MRHB 2GIYA 1WFOA 1YDPA 4O2CB 2Z31D 5JPNB 1A1OB 5FKAB 2GUOA 3UPRA 4NO5A 1QFWL 2ADJB 4NN5C 1BREA 3EZJB 4K9EC 3ARFC 4PJ8C 4Z7VF 3TT3H 5JA9A 4U7KA 5HVGB 4R90L 3DHMA 5C0IB 4ZXBD 1G7JA 2G5BA 3FZUD 1P9MA 4Z76A 4Z7QF 5C09E 4ODXA 1TDQA 3JV0A 3E1F1 1C12A 4WNQA 2WWKO 2O5YL 4NSKA 2DD8H 2AJSH 4F9PA 1XF3B 5TE7H 3D25B 32C2B 4NYLB 3QA3B 4PUBL 4E41D 5IESH 3CZFA 1SHMA 2PW2B 4PJFF 3SEPA 1CE1H 2YPLA 5FA3A 2D03L 5FHBH 4LSSH 1U8HB 5T3ZH 1RPQA 4KQ4L 1S9KC 1B88A 3IAQA 4C83A 2D2OA 2VR5A 1AIFA 1P4BL 4YPGB 1HE7A 3VXQB 2ARJQ 1A3LH 3OTTA 4N9OB 2GY7B 4UIMA 1U8OA 3V0AC 3DHJA 3L5JA 4L29B 3PDOB 4GAJH 3TBYA 2ESVA 4I0PA 4CN4A 3MV11 2IQAB 5DJ6A 2EYRA 3C60D 3G5YB 4U05A 5C0BB 2XQBL 3EJZC 4L8DA 3SKUD 3B9VA 1VFOA 4NDMB 3OHXA 1MJ8H 1FYHB 1N7ML 4XP9L 4YC2C 4HT1H 2AGJL 4TVPL 5A2LH 2VDOL 1KPRA 5GRWA 5F9OH 1CK0L 1ZSDB 2HKHL 2PYEA 5AZEL 3PABB 1K3IA 4DKAA 3EO1A 2AJ3A 4HKXA 3FT2A 3B9KC 3EYSH 4MMXC 4F15B 1YNKH 5GS2H 1EIBA 4OLVL 3MO1B 1KF9B 4JE4B 3JVGC 2XQYK 1JWSA 4K23H 3JZ7A 5GRUL 1MELA 5DUPH 3WS6A 4EIZC 5D70L 4LQFH 1T0NB 4H8WL 5CWSA 3DOSA 1EH9A 2I07A 1X5HA 5IEKB 5GGSY 1NGPH 4ODWB 3D85A 4PJHE 3QT2A 4JFOA 1KN2L 1DE4A 3SKNA 4JQIL 4X5WA 2B20A 4JG0H 1UA6L 4PREB 1MH5A 1M1SA 5D7JA 2YRPA 3QJFA 1BQHG 3EOTH 4E41E 3EHBC 1AJ7H 4O2FA 5C2BH 4PJEF 5I66A 3SDDB 4XP6H 1MF2H 5IQ9B 3KPOB 3FFDB 1UM5H 3UTQA 1MCIA 4TUJB 3LN5A 1I7UB 4OFDA 4MNHA 1NDGB 2DM7A 3MFFB 1XGTA 3S35X 3DX8A 1A0QL 2D4DA 3S36H 1GC1L 3DVIA 3PP4H 4N0UB 5J1TC 5ENWA 5IVZB 1RUQL 1JUFA 4IRJC 3EYQD 5KG9A 1ERNA 3JTTB 5KSBE 3TNMA 3PHQA 4NC0B 4JREC 1ZGLP 5E6IA 1INEL 1HOCB 3PDGA 3BIKB 2YZ1A 4EUPG 2IBBA 2BVQB 5B4MC 1G9NL 2ICWI 3P2TA 3T1WA 1JCKA 2KUTA 4MDIB 4S11A 5M94B 2R56H 3ULUC 1W0YT 5I8EA 3VGDA 5BRZB 1KENL 5CJOL 4K3EL 1NC4A 4QF1B 5DHVH 1SBSL 2YPLD 2BX5A 3QZWA 4WHCA 3VA2C 5I1EH 4ZMAT 4TVSa 4BZ1L 1T4KA 1TCRA 2XZAH 5E8DH 4M1GH 4KJWD 4BSVA 4K55A 1LK2B 2DKUA 2BVEA 4UAOC 4RA0C 5FO7B 3ILPB 5HYQB 1U3ZA 4YXHH 3TBTB 2IC2A 1PBYA 2BK8A 3U6RB 2D7TH 5GIRA 4LARH 3EOBA 1KLGB 1ZLWH 3MV7B 2ESVD 1FGNL 4I0PD 4KROC 5BXFA 3TA3C 1XT5A 1WK0A 3MLTA 4U1GB 4PD4K 1FO0H 1OF2B 3QUYA 4D8PA 4EUPH 5IW6B 1TJHH 4X7EC 5C0GB 5T5NG 3GMMB 3EJYD 1HH6B 4GAYB 3GSNL 1R3JB 2X7LA 4TNVF 3X11A 3BP7A 2PYED 1AHWC 2E7LA 3ET9F 5IKCB 2CDEB 1PKOA 5HPOA 5EULV 1YQVL 4IRSC 4MXWL 3RJDA 2P24A 3ARWA 1V3MA 3DSNA 4WFED 5FOBA 3DTXA 3MLXL 4QTIL 3W9DB 5JXEA 3A6OA 3UP1A 1II4E 1R5VA 1BD2A 1ZVHA 1EDQA 2O5XH 3L3DA 2E7CA 4HCRH 5IB4B 1ITCA 2V9RA 1LP9B 3O6KH 4DQOL 5I74C 1OTTC 3VMOA 5TF0A 4PJHF 3RPKA 3D85D 5DDHB 1CICC 4J3WA 3SGJA 5EWIH 3TV3L 3MREB 4HWUA 3D87B 4EQ2A 4KUZH 3VXPA 5D7JD 3ULVD 1UM6L 1DUZA 3QRFM 4XX1E 2OZ4H 1RY7B 5IROA 3UTOA 2YPLE 3O3BA 1J87A 4UNUA 3JXAA 4NUGH 5D9SA 5F89A 1NH6A 1YECH 5F7EL 5DJ2A 3IS0X 1AR2A 4CVUA 4GW4A 5ACZB 4HJ0D 5C9KA 4FQ2H 4GG8A 1NAMB 4DVBB 1D5IL 3ARBA 2PUQT 3VRJA 3TGXA 4F57L 4KJPD 2IANA 3WD5H 5KSBF 2JTDA 1IGFL 5F8QC 1SEQL 5I1DB 2FO4B 1S78C 5KSUB 3OX8B 3QIUC 4NNPL 2OK0H 3CDGB 4ZOEA 4NQUA 2ESVE 5DURB 4RBPK 5E6ID 4ZAKA 1FNEB 5CGMA 5DQJB 1FYTA 2ITCB 3NCJL 4DN3H 1CXIA 4KJYB 1JRHH 4XBPA 1VADA 2Z4QA 1E28A 1AGFA 2HRLA 3PGCA 3EOAA 2JJSA 2GSGB 2CKBB 4MZ2A 2PYEE 4PJBA 4AT6B 1NC4D 2DQJH 4YGVA 4L5FH 1XGYL 3RDTC 1YEHL 3ZYJA 2HJLA 1WZLA 5HHMD 1B6UA 1C16B 3LKQB 3ZDXE 4HKJB 4WFEE 1E0OB 1IKFH 4JO1H 2VITA 4JO4H 1JNLH 3VFNB 1ZT4A 1IGIH 4DKEH 1PZ5B 4XB8A 5EFIA 5KN5B 5MI0C 1OGTA 3VRLE 1QG3A 4IEFB 2B8OT 1XH3B 2R15A 5CEYB 4AIXA 3MJ9A 5GGSB 1M7DA 3H0TA 5L8LB 2W9DL 4ZYKB 5GJTH 4KRLB 4WRLA 1J1PH 2PNDA 25C8L 4PFEA 3TVMA 4WTWA 1Y6NR 3V0WH 3IFOA 4V1DB 5IEHB 1IFHL 3QUYD 3A6BH 5C3TA 4XPGL 4K94H 5KVGL 1A3RH 4J3TA 3ULVE 3O2DA 4JPVL 4ZO6A 5E1AB 3RWIA 2ZSVB 3VXTB 5EOTA 3JWOH 1X5IA 4JCMA 4WI2A 3EOYG 5DGRA 3DO7B 1V3KA 4PD4J 3NTCH 5TGBB 5CINH 3I75B 2BJML 5MEPB 2L4OA 1F58L 3HC4H 5JMRA 4JM2A 5DFVD 5JXED 1IEAA 4UINH 3O45B 1BD2D 4R4FH 2YUZA 3RNQB 2R1XB 4WY7H 4S1QH 4LSTH 1T89C 5CP3H 1BWWA 3VXOB 3F12B 5TDOB 2WP3T 4G7VH 5HVFB 4RIRB 2XACC 4OT1H 3ARVA 2R8SH 1UADC 4KMTH 4B41A 1H15A 3C08H 4Q7DA 5EBMA 4FZ8H 4Y5VC 3VFUA 5F7KC 3LCYA 4UTAH 4FP8H 4CU6A 4YK4C 2RFXB 1I7TA 4NQDB 5JDSA 4MB5A 5HHME 5DS8B 5KOMC 1WZMA 3FHAA 4F2MA 5ETUB 4NKIL 3CFCL 2IPTH 5I1CH 4RRPA 4F7CB 1NMCC 2X41A 3FB5B 3ROOB 4PJIA 5TFSH 4UV7L 3ARBD 4G3YL 4BFIB 1FVCA 1CFSB 2M1KA 2IAND 1G7QB 2Q8AH 3WXWL 3DUUA 1OAKL 2VWEE 3L7FA 2BY2A 1WBYB 1FNFA 3W0WA 2EDTA 5F7UA 1MVUA 2CK2A 4Y5YA 4ZAKD 1M7XA 3OWEA 4ZG1A 1C5CH 1FYTD 4G6AD 3Q6FA 3ZYIA 2KZWA 3GKZA 3MRJB 4NRZA 4LDOB 5EO0A 1WEJL 3FB7A 2R4SH 1QRKA 4HIEA 5CILH 4P46B 3EBAA 3I84A 4APQC 1YN6B 2CRIA 4U7MA 3R06A 1IGJA 4LIQE 3KPRB 3FQUB 3K74B 5C0CB 5I76B 1UXWA 3ZDXF 1T20B 1HK6A 3LKNB 3BFOA 3SPVA 5FO8A 3O4OB 4D9QD 1YN7A 1BX2B 2BCKB 3N50A 3QUMA 4M9PA 4U6XA 4U2ZA 3WUWG 1RJCA 1RZIA 2UY7A 1C8PA 1BD2E 1FL5A 3C6LC 4RMRA 4EZMA 3W11C 4YXLL 1X5LA 2PTUA 5I2IA 1ZA6B 1JZ6A 4KI5C 3A6CL 1RZFL 1MFAH 2UZIL 2EECA 1MLCA 3TVMD 2H2SC 3MJGX 3OAYK 3EO9L 3OGCA 1RV6X 1MFDL 1EERB 4FXGA 4NJAH 1FFOA 3ULVF 2WBJC 4I48B 2FRGP 4X98B 1TTFA 5DT1H 4S0SD 1O7SA 1NMBH 4G5ZH 5EIQA 1XIWC 2ZJSH 4X80L 4BH7B 1LMKA 1TCMA 3WIFB 5GS0C 1IILE 5AZ2L 3P9MA 4JR9L 1Q72L 5ADPL 1VACA 3QEHA 1KACB 5HY9B 1INQB 2AJXH 4U49A 5ID0A 1MCDA 3CXHK 3MJ7B 5DJ8B 4JM2D 1S3KH 4IBLT 2IANE 1HSAA 1U58A 3RWGB 3QUKB 3U7YL 4G6MH 5CSGA 4W6YB 1RIUH 4G80B 5IWLA 4NUJA 3CSYA 3I6KB 4NKMA 4K9EL 2H26B 1FYTE 1HINH 1KT2A 4ZSOB 5TJWK 1FZOA 1EHLL 3KG5A 4PB9H 4XRCA 5F6HI 3PXHA 1FNGB 2JCCA 2V2TB 3W81A 3U30B 5DJDA 4F7PA 1MCKA 1BEYL 4GRLC 4PJBE 3THML 2XWBA 2P49B 4OGAC 1JPSH 5HHVL 3WIHH 4X6DA 2C3VA 3KPPA 3OKKA 3IDNA 5D72L 5D2NC 1T6VN 4RWYH 2PKDA 4QRPA 4AG4H 3LEVL 3O8XC 5EIVA 4D9QE 1MHPH 4UT7H 5J3HC 1X3DA 5F3BA 3S3PA 1JZ4A 3VWKB 1OARL 4R0LA 5GGUA 5IF0B 4FQ1L 3SGKC 5LXGL 3MA7A 2CRZA 1S9XA 1CG9A 4H88H 2ENYA 3E8UH 5DJYB 5T1MB 2BRQA 1HH9A 3U4AA 4J6RL 4XZUA 3W0WD 2VZ3A 1JGLH 4OV5A 4JRYB 1BECA 1T1YB 1KN4L 2VDNH 4MJIB 3QWRA 1QRNA 2FX7H 5FYLH 4OLZL 4M7LT 4HHAA 3KHOA 3NZHL 4J8RB 3HPJB 2VQUA 1U3YA 3HG1A 3FB8B 4J1UA 4YZFE 5JOEA 1VFUA 4LLWA 1Q9WA 5DD0H 1JGUH 2X4SB 4YDIH 1U3JA 2Y4SA 4P2OB 4O51A 4OLEA 3FOMA 2ZCLH 5FB8A 1YZZA 4O5LL 4XTRC 5ISZB 1UYWH 4Q58C 1DLFL 4U6HB 1SYVA 2PTTA 4GRWH 4KKLC 4NFCA 2B0SH 2OR7A 2VE6B 1I4FA 4YHZH 3HLAB 3OGOE 2FHBA 4GKSA 4I18C 1MCSA 3O41B 1RZJH 1ZLUK 1JPFB 5KZCB 4LASH 5MP6L 3LEXA 2QADC 1BIIA 2APBA 3OV6A 3AGVA 1CDBA 1IEHA 4HV8B 4Y4KA 4X99B 1G7MB 3PNWB 4U3XA 4HAFA 4JFDA 3IF1B 4U1LB 3CUPA 4TRPL 4WEUD 3D18A 4X4MA 2VAAB 1M6OB 4LLAA 5JLZA 1DQLH 4ZPTA 4YX2H 2G2RB 4UNTA 3RZCC 4O9HL 5I71B 3NCYP 4DAGL 4PJAA 1OAYL 1MCRA 3G5ZB 1A7PH 1LD9A 3GSXA 2JJUA 4OGXH 2DWDB 1KJ3L 1OSPL 4DTGL 2J5LB 5ALCL 4PJIE 3LY6A 3VXNB 2PXYA 2CDFB 4LLMA 2EKSB 3CFBA 4OLXL 2I9LB 3CX5K 3BUYA 1N6UA 3W0WE 1IC4L 3BX7C 4N5ED 5AAMA 3RL2A 4P48A 4XC3L 5JHLH 1A6WH 4MA7L 5I75C 3D48R 3CXHJ 3K8KA 1NBYA 1KCVH 1FL6B 2Z8WC 3CVHL 4JZJB 5B8CB 5DMGC 2EYTA 5CGYC 3OMZA 5JW3L 3KYAA 5IW3A 3TESA 4M7ZB 5KVDL 1E4KC 4PJBF 1LO5B 3BPOB 3IETA 3RWCB 3VW3L 4ZFFA 4Z0XB 5H35A 4UUJB 4E0RB 3Q5YA 3HI5L 2HTLC 5E5RB 4XNMA 3INUH 1KXVC 2JB5H 1I9RL 2P7TB 3DGGB 4GQ9H 4QRPD 5D7IA 3SE3A 4UQ3A 1ZLSH 1JNHB 3UBXG 1A14L 3EW3B 1AFVL 5D1ZB 3MOBL 4I8DA 1NAKH 2EZ0D 2VUOA 1I9JH 2YD7A 3RY6A 1RULL 3BP6B 2VDMH 1K4CB 3RGVB 2JB6B 4G8GB 3RWJA 1YY8A 2ZSWA 1A7OH 4RBPH 5LGJB 2FATH 1C5BL 3P0GB 5EUKA 3WN5A 4RCAA 5HGDA 2VO5A 1ZHLA 3TIEB 4R2GC 2BY0A 3QWRD 1QRND 1XGRA 4DGYL 1SJVA 4LSQL 1PFCA 1C7SA 1GGBH 5E8NB 1XF4B 4YZFF 2FJFB 4X8JA 5E2VH 4Z6AT 3HG1D 2RCSL 1PG7L 5DRNB 2GAZB 4RGND 1FZKB 2VJXA 4J4PA 1LDSA 5HYSB 4Z7VB 4YPJA 2UY6A 3O9WA 1EFXB 1DBKH 5EIIA 4YE4L 2Q8BH 1OSZA 1F8TH 4ODTL 3KJ6L 1SY6L 4JM2F 3RWEB 4KDVA 4KHXH 4N0CD 1MJUH 3N1PC 1AD9B 3QG6A 4G6JL 2FECL 4MLIA 4MXVE 3QI9A 4JQVC 2CLVA 5CBEA 1DQDL 2YD9A 2F74B 3SBWC 1NGQH 2BOBB 1WFTA 2C1PB 2P5WA 2ZUTA 4PJFB 4I3RH 2EDXA 4Y4KD 5DD6A 4S2SB 3WKML 3CU1A 3SY0A 4JFDD 3GSRB 2JCCE 2ED9A 2GW5A 4FQXC 4DUXA 5KVMC 2DWEB 1KB5L 4GXVL 4PYGA 2X2YA 1MRDH 3PHOA 4I3SH 2YMXH 4NBZB 4X6DE 4IRZL 2CMRL 5CJXA 3O0RL 4NHUB 2YPKB 1HHKA 3KJ4B 3QPQC 4QRPE 4PG2A 1H5BA 1P1ZA 1NEZG 2BMKB 3F62A 4XCYB 1LO4L 4PJIF 1V3LA 4PJCA 3ESUF 2PXYD 4ZFGH 5EUOA 3BKMH 1G9EA 3TJEL 2W0FB 3T04D 4XCEA 3BQUC 1R6VA 3PWNB 1F3JB 4R96B 4KKBD 1AY1H 2X9XA 2IAMA 1IM9B 2ORBH 4XAKD 2OQJB 3PIQA 3O11B 2OL3L 1U92B 3SKMB 1QRNE 2VXUL 1IC1A 5HI5D 3VFGL 2XTJB 4PBVC 3WFCH 3T0XA 4L3EB 3O3UN 2BSRB 3HG1E 4QRUB 4O4YL 4K8RC 4RGNE 4XH2B 3HNTL 3E2HB 3VDCA 2H8PA 3OKDB 4N0YH 4QHKI 2FZ3A 2JELL 3GSQA 1N0XH 3LEYL 4XPAL 3HFML 2Z91B 3SDAC 43CAB 1NGZB 4K3JH 1WCBA 1ULVA 4FG6C 2DIBA 4YHMH 5SWSB 2GCYB 2ATPB 4B7IA 5F9JA 4LCIL 2Z8RA 3V8CA 1R5WB 2EXYD 4GFTB 1MEXH 1KG0B 1QQDA 3QEQB 4O00A 4C4KT 1EJOL 4PJEB 2V9QA 3QHFH 4JFDE 4LEXH 4G8IA 1SJHB 4ZFOA 4X4ME 4PRBA 4MA1C 1BVLA 3PL6C 5IW1B 4H1LA 4TSBH 4FFZH 4HIJB 4Y5XC 1U8PA 4J4PD 3P9WB 3VXSA 4XPFH 3OJ2C 3O9WD 1FDLH 4PJAE 4PV8A 2XRAH 5TQ2L 2QR0A 4FQJL 4XNUH 5IIEA 1NGXB 1HI6A 3P0YL 2MQ0A 1UZ8A 1XGUA 5IV2B 2XPGB 4XVTH 1JV5A 1FORH 4MXVF 3S35H 1GPOH 3QI9D 4WW1A 1H8OA 1EEQA 1DL7L 4XAKE 5FKPB 2P5WD 3WJJC 3KPLA 1QLFB 5FHAH 3KPMB 5IBTH 3P3YA 3MGTB 4GKNB 3CCHB 3GMQA 2JCCF 3T8XB 3QO1B 2HYMA 1QLRA 4UNVA 4PR5A 4YHNA 5H37G 1MJJB 4XGZA 4PY8J 4TULH 3G5XB 5JW4R 3QUZA 2YA0A 3NACH 3R8QA 4X6DF 2WSKA 2HRPH 2DQCL 3GMNA 3OB8A 4TTDD 5I1KH 4OIIL 5D7IE 1WLHA 1GRWA 3G08A 3KWWA 1KV3A 4CVZA 1WCQA 3MCKA 2R0LL 3QH3B 4HQQH 4M7JL 4Q97A 2RR3A 4NO2B 1NGWA 4X6BA 1F6FB 1ZK9A 3O3EA 2G9HB 1P69B 1U9KA 4MD0A 2IH3B 2IAMD 5KSAB 5FGBA 1PG7X 1A6VL 4HULB 2AV7B 3EDJA 2X1OA 1RIHL 1MSPA 5EZOL 3V4UL 4KTYA 3ULSB 1ES0A 2F5BH 4TTGA 5JA8B 4K07A 1R3IH 5DLMH 1TVHB 1BQHA 2PO6C 3HE7A 5F1NA 1I8LA 2WLYA 4EBQL 5GGRY 4EDXA 4NT6B 4OKDA 3SO3C 3DBXA 1P6FA 2F58H 1MAML 4MS8C 4OCSL 4U2YA 1I8MA 1P4LA 2HG5B 4M8QB 4MVBD 4I4WA 4L1DA 2R1WA 1D5BA 1IM3B 2VKXA 4FQLL 3MBEB 4HDIB 2EXWC 1Q0YL 3Q2CA 3QAZB 5HPMB 1V7NL 3PQYA 1M05A 4PJHB 1QFWH 5DFTA 2ILLA 1K9TA 4MJ6B 3OL2A 1S7SB 1PYWA 1QUNA 4L8BB 4EI6B 4R90H 1F4WL 2HN7A 2UZXB 5D8JL 2IQ9L 8FABA 1ZVYA 2NY1D 2P5WE 4FMFA 3NPSB 1JK8B 4NRXA 2IBZX 1GOHA 2NW3B 3GJFA 1DLHB 4CVWA 2NR6D 4MCYB 2O5YH 4QT5A 5B22A 4FFVC 4JHZA 5D1ZC 2YD3A 4PUBH 5ERWA 1O5DT 1UCTA 1R24B 5GS1B 1JHKH 3VXSD 3CZJA 2D03H 4RGMC 4PJAF 4U4BA 5KSBB 3OXRA 4AY0A 4KVCL 2D7PA 4DUWA 4JDZA 4KQ4H 1VESA 2X4NA 3BP4A 1BWMA 1P4BH 5FCUL 2EDBA 1T7YA 3C60B 4KJQC 4JVPA 4WJ5B 4WI7A 4HMDA 1W0WB 4OCXH 2G75B 1ZANL 2UUDH 3KR3L 3QXDB 5EUOE 4Z7WB 5ESVA 5C0EB 2APVA 3D69A 4YQXL 3HC3L 3BGFB 5DVOA 4N8VG 3MRQA 1EA9C 3FJTA 2AJVL 3WSQL 1EEZA 2XQBH 1IAIL 4UBDD 2XN9B 1H8SA 3NCBB 1FO0B 1N7MH 2EKJA 3UO1H 4P5MB 1G7HA 2AGJH 4XNQA 2VUYA 3QUZD 3L3OA 1CK0H 3ALPA 5AZEH 2HKHH 3KPQB 3OR6B 4XNXH 1A7NL 3HNSL 3OKMA 3H7BB 3VD9A 3C8KA 3ARDC 1LE5B 5D7IF 5EPMB 3PG2A 2MMXA 4UB0L 1LO3L 3UAJD 4JZNA 5ICZB 1CVSC 3BMWA 3FRUB 2D31A 1S7XA 5GRUH 5J8OA 4OCLC 5D70H 2VL5B 2M8XA 4H8WH 4XP4L 4XVUC 5L9DL 1NGYB 3ILQD 1X4YA 4XNYL 2AABL 5DTFB 4X4ZA 1N2RA 3IJYB 1DN2A 5I1IL 1KN2H 4RFNC 3MNWA 1XR9B 4JQIH 3HE6A 3S37L 1YDPB 3VGAC 1UA6H 4ZD3L 4M00A 2GUOB 3HMWL 1QLEL 4KK8D 1YYLL 1F90L 4NO5B 2RBLA 3HE7D 3UPRB 2DDQL 3VGFA 2NPLX 1VEMA 2AEQL 3VXSE 2VLKA 1Z2KA 4P2RB 1QTYT 4Z0BH 4ELMA 3T0DA 2I26N 2G5BB 2R23B 1NAML 1A0QH 3HZYA 1T7VA 4FZEL 1GC1H 2ZKHL 3PQYD 3KGRA 1NL0L 4BYHA 1KTLA 1RUQH 4M6NL 4P2CG 4WNQB 1T22A 5IBUG 4NSKB 1T80A 2AP2A 1XAUA 3KLAA 3H9YA 1NMAL 4JZOA 4H1LH 3U36B 3AFLA 3CZFB 4KH2A 1B4JL 2YPLB 3UDWC 5FA3B 4HSQA 1G9NH 2HMID 1NUGA 1LVEA 1TMCB 3DETC 1W8OA 4C83B 1AIFB 2DJSA 3CLEL 1KENH 1MAJA 5CJOH 4K3EH 4GS7B 5GQBA 1SBSH 1Y6KR 4UIMB 4NQCA 3LQAC 3IGAA 4BZ1H 4OM1H 4OBRA 5DJ6B 4MA8L 5EUOF 4L8DB 1CGYA 1GZPA 3OHXB 4Y2DC 1VFAB 1KPRB 3F7PC 1FGNH 4WU5A 4ZNEA 5JIHA 3W39A 3HUJA 5I8OL 4KDWA 1CDHA 3EO1B 5D6CA 4HKXB 2ERJB 3FT2B 3SGDH 1RFDL 4AENA 1D9KA 5DEGA 1TZIA 2AERT 1HWGB 2ED7A 3E6FA 5GGRB 4M4RA 2OTWB 3GSNH 15C8L 3LS4L 2X4QB 3RRQA 1JWSB 2CGRH 1MFBL 5IB2A 3ZO0A 2VRAA 5DJZA 3T2NL 1JI1A 1YQVH 1XCQA 5CWSB 4MXWH 1XF5B 2A83B 2I07B 4ZNCD 3PQYE 3B5TA 4W68A 3D85B 4KFZC 3BH8A 3MLXH 3O3DB 4QTIH 4JFOB 4WGWB 5SX5K 3SKNB 5E7FA 4BQ6A 4PGEA 3ISWA 5I19L 5FM5O 1RI8A 4YBQD 1MH5B 1FZMA 5D7JB 3QJFB 1INDL 2QSVA 2Q7YA 4KZEL 3JWNC 2AXGA 4O2FB 5I66B 4NZDA 2ED8A 3UTQB 1A7QL 2CRMA 4JKLA 3LN5B 3HE6D 3LSOB 4MNHB 3HMXA 2DQGH 4LRIC 1XGTB 5IFJB 3GHEL 4F37F 4AYFA 5CEZH 1UM6H 1VKXB 3H3KA 5ENWB 5C8JA 3ARZA 1JUFB 1RZ7L 1ND0B 2C7UA 3TNNB 2VLKD 4PJ8A 3O2VH 3KPNA 2XI9A 5F7EH 4UT9H 3R1GL 1FVDA 3TNMB 3BRFA 3FTGA 4NHCL 4G7YL 5E6IB 1OAXH 1BM3H 2NY6C 5F7NC 2GTZA 5K9OA 2H32H 3LV3A 3GMRB 2ICWJ 3NCCB 3VD5A 1QR1A 4F57H 3SKOA 2Z31C 4KVNL 5I8EB 4FFWD 4U6TA 4BUHA 2YUVA 5AUMB 5J12C 2FDBP 4O2EA 4OJFL 2DOCA 1NC4B 1IRAY 4JDTL 3DV4A 3S98A 1RZKL 4HMEA 4PJ9A 2CLRA 2DS4A 2YKLL 4ZXBC 4B5EA 2J8UA 5BMFL 3FZUC 5HVHB 1T4KB 1U8LA 3U4BH 4OZIA 2FR4A 4BSVB 2J88L 1N5YL 1CVRA 3WS3A 2J6EA 4DKDC 2VXQL 1XGYH 5HHPA 3I50L 4NQCD 5IQ7L 5GIRB 1OQXA 5KAQG 4NM4L 5E0QA 3BN9D 3STLB 2LABA 3WUWA 3MRFA 1YJDC 4UOW0 1UT9A 4XPHL 4JFZH 1MAKA 3H2WA 1E27A 1MJ7L 2A6KA 4RAVA 3S37X 1RIVL 2P8PB 3NGBB 2X7LB 4PLKD 1OM3L 3X11B 5DRWA 1ZT1A 5H2BA 25C8H 1FFNA 1KTDA 1V3JA 2H6PA 4RX4A 5T33L 2W9EL 1D9KD 4XPGH 5KVGH 5FOBB 3P30L 3B9KA 1UENA 3DTXB 4JPVH 1J0JA 1NEUA 2NY4C 3FMGL 5KS9A 3TH4T 1R5VB 2VLKE 1BD2B 3JVGA 2GEEA 3L3DB 3S96A 2XNAB 3SGEI 5EU6A 1YPZB 3VA6A 4ELME 1DBBL 1CFTA 3OF6A 1UB5B 1YEJH 1UM4L 4H20L 5BV7C 5IJVB 5BOZG 5LKNA 4QXTA 1N5AA 2W65A 3LD8B 2FD6L 3T0EC 3VXPB 4LLQA 4P9HC 4WWID 1DUZB 4HEME 5EBWA 1LEIA 5DK2B 5CZVL 4Y88A 4FNLL 5DJ2B 2CR3A 3HR6A 3PE9A 4GW4B 3UPAA 3ME0A 4PGDA 3V7MA 2VMFA 5DD5L 4GG8B 1Z3GL 1NCUA 4P49A 3DECA 3VRJB 3MRPA 3OKEA 4MWFA 1R3LA 4PLJC 3FAXA 2IANB 5FYJD 2B5IC 4PJ8D 4NQCE 4IRJA 5E7BA 2EICA 3MACL 4NKIH 3CFCH 1J88A 4EVNA 5FOJA 4Q6IA 1DDHB 3C5ZC 1FVEB 4FQPA 4X0KB 1FYTB 4LF3B 2P4AB 5ACLA 4XBPB 3WXWH 1OAKH 2EO9A 1AGFB 2WUBL 4M3JA 4P4KA 2R39A 5GISL 3PGCB 3O6ML 4LVHB 2KH2B 2F5AH 4ZNEE 5C3LD 3HUJE 5FYKD 5L0QB 5AAWA 2ZPKL 4PJ9D 1A6UL 2HJLB 4NQTA 5T5NF 4NO0B 1YMMA 4UIKH 3L3JA 2EDWA 2VITB 4OLWL 4NO3B 3DYMA 5CP7A 1ZT4B 5EFIB 2UZYB 4HIXL 3IXTB 1OGTB 5SWQA 1KJMA 1I85C 3F7QA 3RVXC 3GBMH 4UILL 4KQ3L 2Z9TA 1QEWA 3AC0A 3H0TB 3TPKA 5E2WL 3RIAK 1E6OL 3TVMB 1B0RB 4GSDL 3TA3A 4UT6L 3EJZD 3FN0L 1AP2B 4YXLH 5C0JA 2X4RA 4KJWC 3VFMA 1KCUH 3RWIB 3A6CH 1RZFH 4U1MA 5EOTB 3B2VL 4GS7C 2UZIH 1ADQL 5DVNA 4HGWA 2QV2A 4ZUTA 3H42L 2GYSA 4NQSA 3EO9H 1MFDH 3K46A 4LVOB 1EUUA 3LRGA 4IRSA 4I0PC 3D3VA 2EEDA 1FRGL 3B9KD 1JMZA 3KNBA 5CMAA 4JLRA 3MRKA 4G42A 2A6DA 3MC0A 5FYJE 3U9PL 4X80H 4ELMF 5HXMA 5EU6D 5AZ2H 3EJYC 4PJDA 4JR9H 4AIOA 1ZA3A 1Q72H 5ADPH 2DBLL 3OF6D 4NQXA 3SE4C 3WE6B 4FABL 4L4TB 4XXDA 2ZNXA 5JW5A 2WP3O 3GSOA 3OKNB 3CDFA 1H15B 3IU3A 4HFUH 4HUWB 5EBMB 4MGXA 3U7YH 1R3KA 5F1IB 3VFUB 1F2XK 3M8OL 3RAJL 3EHBD 2IADB 4K9EH 1M7IA 1OL0A 5FYKE 2DF3A 1I7TB 3IS1X 4BM7A 5JDSB 2R2BB 1EHLH 2J8UE 5I8KL 1JGDB 1QYGH 3GMOA 3QQ3A 4OZIE 4WI8A 1BEYH 4PJIB 4WW2A 5J57B 1FVCB 2E7BA 2GSIA 3THMH 1NBZA 3DUUB 4CVXA 3RHWF 1EHXA 4IRJD 3ULVC 4IIQC 2X4OA 3UROR 5D72H 2A1WL 3V95A 3LEVH 1MVUB 3UBXA 5A3IC 4Y5YB 1CR9L 2VXTL 2XA3A 5JIPA 1OARH 3Q6FB 4LBEA 4NRZB 5EO0B 5LXGH 5DK3A 4DFIA 3FB7B 2VDRL 3V6ZA 2E5EA 4P4KD 1FG2A 4HIEB 2C3HA 4KV5E 2SEBA 3MRCA 4J6RH 5JW4Q 4RNRB 3HUJF 3D39A 3R06B 3TFKD 1BOGA 1J5OL 2CJUL 5C86A 1UXWB 4OLZH 2EDHA 1A21A 1HHHB 1UWGL 5FO8B 1YMMD 2PW1A 3QUMB 4U6XB 3S4SA 1UXSA 4MHHI 5KS9E 1RZIB 5J6GA 4O5LH 1FL5B 4M93B 2V5YA 5DJAA 1FH5H 5EU6E 3PV7A 5I2IB 1DLFH 1AXIB 2IH1A 4LHJB 2JF1A 3BVNA 1HIML 1KTKE 5GJSL 5F7HA 1MLCB 4KTEL 3TA3D 3OGCB 4FXGB 4HPOL 5INDA 5I73B 3H8NA 1FFOB 2WM0A 2D3VA 2F54B 3DXAA 4YHPA 5MP6H 3T0BA 2R4RL 4JY6A 4JAMA 5C0DB 4M48L 3BPCB 2D4FA 4H5SA 2VR4A 4CAGA 1UG9A 3P9MB 4EN3C 2GJJA 4TRPH 4LU5L 4IRSD 3QEHB 3D3VD 1N3NA 3DRTA 4XWOC 5C6TL 5ID0B 4YIQA 2R69H 2YBRB 5GGTL 3QUYC 4CJ0A 4YH6A 1HSAB 2ZG2A 1U58B 4O9HH 2OJZL 4TPRH 4DAGH 1REIA 4U1KA 4M03A 3TBSA 1OAYH 1T89A 4NUJB 3C5JA 1WAAA 4FQCL 3QQ9C 4LPCA 1KJ3H 1NEZA 1OSPH 4X6CB 4DTGH 2E7LC 4G8FA 4HIIA 5ALCH 1OTTD 2VDQL 5SX5H 1FZOB 4YJZL 2R2HA 3BYTA 3MRNB 4HK0A 1WZ1H 4OLXH 1BJ8A 5F6HJ 4WU7A 2JCCB 2DTML 4X9BA 2WAHA 4MSWB 1QFOA 4F7PB 5D6DC 3RVVD 5F7DB 5JXEC 1IC4H 3DROB 4P57A 4EXPX 4UU9A 2XWBB 4YHLL 4X6DB 1CD8A 4XC3H 5K9QG 3KPPB 4MA7H 3OKKB 3IDNB 3DURA 2J8UF 3S6CA 3CVHH 3GJEB 4QRPB 2DLHA 4OZIF 1W72A 1YMME 5JW3H 1S7TA 5F71A 5F3BB 5DFWH 2BFVL 5KVDH 4R0LB 3RBGA 3SGJC 5K59E 3IDYC 3NPZB 1Z9SA 3VW3H 3B5HA 4JHAL 2ATKA 3ULUH 1T21A 3HI5H 2PCPB 1S9XB 1CG9B 1DBJL 3PUCA 1EEYA 5FFLA 1TQCC 1S78D 1A14H 4OV5B 2HJKA 4MJ5A 4Q2ZA 1RULH 4WWKC 3G6JA 4CGTA 3V2AR 1FHGA 4HWBL 1MFEL 5T3XD 2X6MA 5DVLA 2H9GA 4J1UB 4KV5F 1X44A 4LLWB 3P40A 1Q9WB 3MLVL 3OKOA 2AXFB 1C5BH 3ARBC 4JFXB 3V52L 4O51B 3FOMB 3BDYL 3D39D 5F7WC 2GT9A 5KANG 4KK9D 3MMEB 4DGYH 5MEOA 2LU3A 4LSQH 1SYVB 4KRPB 4I1NB 3D3VE 4ZAKC 1OP3K 1P7QB 2RCSH 1I4FB 2IALA 3MUGA 4GKSB 5KS9F 2XOTA 4WHYG 1CFVL 4LSPL 4PJDE 1BIIB 3SDYL 4YE4H 3KJ6H 1SY6H 2BNRA 4Y4KB 3WMSA 3RUGA 1IQWL 3MGAA 4G6JH 3CUPB 3DXAD 2EDQA 4E5XA 1KSRA 3I9GL 2XG4A 2WBJA 1DQDH 4NRYB 1JNNL 4ZPTB 3O6FC 5IHZA 4NNXA 1XIWA 3WKMH 1CFBA 4PJAB 3ZKXB 2XWJA 1LD9B 3GSXB 1HWHB 4Z18A 3IAGC 4P23A 1KB5H 3IDMA 1TNNA 3P77A 4GXVH 2PXYB 4LLMB 4IJ3B 2A73A 3CFBB 1SVZA 4IRZH 2CMRH 4PJ7A 1EAJA 1SJEA 3BUYB 2VC2L 1AC6A 3H3BC 5L8KB 1A7RL 4K2UH 1LO4H 4ZUUB 3G5VA 3MFGB 3Q1SH 5HDOA 5E8PB 5DUPL 2ZOLB 3TJEH 3QRGL 3DMMB 3MCG1 4LQFL 5T3XE 3ULUF 2EYTB 4BKLB 5K93A 1EVTC 1YEDB 2FHFA 2XKUA 4JM2C 1L9NA 3D39E 3IETB 2MHAA 9CGTA 4ZFFB 5H35B 2OL3H 4GRLA 1FSKC 2QQKL 3JV4A 3MX0A 5DMIL 3VFGH 3D6GA 1Q1JH 2OTUA 2KBGA 4JANB 5D7IB 4UQ3B 5D2NA 4GBXA 5K59F 3O8XA 4XP6L 4C55A 5L8JB 4CW1A 1ETZA 2AI0L 3HNTH 1XGQA 4C57C 1UM5L 4POZC 4Y4FA 1TZGL 4JN1L 2GFBA 3CIQA 2JELH 3SGKA 1YY8B 4B7LA 3LS5L 3JTSA 3HFMH 1CN4A 2VLLA 1SMOA 4RFEB 2Q1EA 4R4BA 3WN5B 3PP4L 5HGDB 4OFIA 1N8ZA 5BW7C 1ZHLB 3N0PB 4LAQL 2P47B 5ICXB 1NPUA 3DRQA 2I9TA 1FE8L 1XGRB 3WLBA 4NWTL 3HA0A 3UTTA 2MQ3A 3DXAE 1MFNA 2L0DA 3WDHA 4H26A 4X8JB 3DGCR 3HPLB 2X1QA 4NC1E 3IJHA 1TPXC 1EJOH 4CDGC 2RB8A 4AH2A 3MRIA 2R56L 5C1MB 1JN6B 4DW2L 3GBNH 3AXLA 3LQZA 4J3VA 4N0RA 5EIIB 1OSZB 3HB3D 1I8IA 3T1FB 2JK5B 3RKDC 1F6LL 4OFPA 1LQSR 5I9QC 1U8IA 1U0QA 2MOVA 3QG6B 5BZDA 4QRSA 1AXSA 4PJDF 3TBVA 1PSKL 3W11D 2CLVB 3C2AL 4G9FA 4PRHA 5CBEB 3TIDA 1WAAE 4U1NA 3CFDA 4FQJH 5AWNL 4HC1L 5HHNA 3BZDA 4KI5D 4RMVA 2BNRD 4L9LB 4POUB 5DD6B 35C8L 3P0YH 4OCRL 3NMEA 2D7TL 4MNGA 3UTZA 4OSUL 1MUJB 4K7FA 2WBJD 5BV7L 5J11C 1GZQA 4N8VA 4ZUWA 3MLPA 3PHOB 3RY5A 3OKLA 5JHDB 4H25A 5HHXH 1XIWD 2DLFL 3UZQA 1F4HA 4P9HL 1HHKB 2YWYA 1H5BB 1P1ZB 2VZVA 3QDGB 4P23D 4FMKA 3T77A 4WW2F 1UH2A 4PJCB 1LGVA 5EUOB 4PY7A 4XCEB 2DQCH 2QHLA 2UYLA 3LDBC 4LMQE 1QO3A 4BQBA 1F3RB 2IAMB 4JGJA 2DBJA 1MREH 1TTUA 1B0GA 4B53A 1T7ZA 4WV1A 3K4AA 3ZTJH 3G6JE 3WFZA 4GQPH 2Z35A 4HCRL 1ORSB 5HGHA 1EUTA 4LOUC 1DBAL 1MIML 2H8PB 3O2WL 1DTUA 1E4KA 1A6VH 5EWIL 4KRNA 4GRLD 4QHKJ 3V7AG 1MCHA 1OQOA 2FZ3B 5IMKA 4LQ1A 3GSQB 4PJXA 3K4DA 5IWLC 2VNCA 1WCBB 4YDVB 5AYUL 4GBXD 4N5EC 3JV5A 1FFQA 3O8XD 2EO1A 5F9JB 5J3HD 4HWZA 4EBQH 2GJ6A 4Y4FD 4M7LL 4OCSH 1MAMH 2R0WL 2DL2A 1D5ZA 1QQDB 1H3GA 4FQLH 4F80A 4OIAA 2NY1B 4KI5E 1Q0YH 4XWGL 1V7NH 2BNRE 4XCCL 1TQBB 3RUGE 2I5YL 4D94A 4IHOA 4PP1C 4C4KO 4OF6A 5HHOA 3FOLB 3UTTD 2CDGA 4ZFOB 2N56A 4PRBB 1BVLB 2BERA 1F4WH 3CU7A 4H1LB 1DVFA 2IQ9H 2XKSA 1GHFL 4Y4HB 1U8PB 5TDNA 3VXSB 5DC0A 1JRHL 3NIFE 3V5KB 4TVPD 4PV8B 4FA8A 2QR0B 5C6PB 1F02I 4FN0A 2V2XB 5IIEB 2F8VA 4KKLD 4KXZI 5BCAA 3HR5A 1HI6B 1T0PB 4L5FL 1UZ8B 4F7TA 3P4MA 4MA3A 4EOWL 3T3PE 1JV5B 3QQ4A 4PJ7E 2KDGA 1G7PB 3GEWB 2E9WA 4ONHA 4KVCH 1HXYB 1WAAF 4G9FD 4PRHD 4RGNC 1NLDL 3MRMA 4ZUSA 1JNLL 4JQVA 5D1QC 2QADD 5FCUH 3MNVA 3QO0A 3KPLB 4X7CC 1IQDB 1ZANH 3L5HA 5D7SH 4JFQB 5GS0H 4EIGB 5IMMA 3EDKA 1QLRB 2AS5M 1T0MA 4PR5B 4YQXH 4YHNB 3HC3H 3RI5K 4XGZB 1P84K 2XZQL 1JJUA 1BBJA 4AK1A 3QUZB 5GJTL 1Q0XH 2AJVH 3WSQH 5F8RC 1IAIH 5IVNA 1Q38A 1GXEA 2CXKA 2WINB 3GMNB 4K94L 4ZOBA 1AGDA 2Q76A 5FA4A 5C07A 3P4LA 5D2NE 1P6AB 1VENA 3KWWB 3PDDA 4K71C 4CVZB 3GSNB 3VFWA 3MCKB 1J0ZA 3ARGB 4LEOA 1KXTB 4AZ8A 5J13B 3BOVA 3IFNL 1A7NH 4HJGB 1NGWB 4RAHA 4X6BB 4WO4B 3BEWB 3EUUA 3O3EB 5K33A 5GZND 2VLMD 4WI9A 4UB0H 1LO3H 3G6JF 4JPIA 2XICA 3ZKXC 3ULVL 3WV0A 3UJJH 1Q9OA 3UTTE 1KEML 3KXFB 1PX3A 4XP4H 1KEGL 1QFUL 1CU4L 5CGYD 5F1NB 3EYVA 2AABH 3OQ3B 4OT1L 1EGJA 2W38A 1ONQA 4YNYA 4TVPE 4KKBC 2DIAA 3S37H 1KGCD 2HTLD 1EBAA 4B50A 3LKOA 4FZ8L 4R97B 4ZD3H 5CEXB 2R0ZL 4U0RC 3SDAA 1M05B 1L9MA 1F90H 1YYLH 4UTBL 3QHZH 2DDQH 2ADIA 5HI5C 2GJ6D 1PYWB 3B9DA 3AAZB 5I8CA 3OB0H 4ZS6D 1A1NA 2HN7B 4G9FE 4LHUA 4PRHE 2IPTL 4YDLB 3C87A 4KI5F 8FABB 4QYOB 4FZEH 2ZKHH 5TFSL 1NL0H 3RUGF 5T1LA 4M6NH 4R2GD 4OCMC 3BDBA 3EYUL 3WKNA 1U3HA 1B9ZA 5HHOD 3VFPA 4MNGE 4N1CA 5MERA 2AXHA 2EEBA 3T4AA 3BPLB 1DVFD 2NNAB 4LKXA 3VGGA 5FM8A 1KYOK 3BDXA 3HKFA 2YRLA 3NIFF 4Y5XA 5JW4M 2EXYC 4R9HA 5DJ0A 5CJ5A 4JRXB 3VI4E 4XXCA 5TE6L 1MCFA 4PRNA 3IDXL 3BP4B 3NIDE 1OP3H 3B2UC 3CLEH 2DM4A 4X7FC 1K2DA 3T3PF 5ESVB 4PJ7F 3WO3B 1WITA 2DYPA 1H3TA 3NFPA 1G6RA 1I3RB 2VLME 2WLZA 1AGEB 3GRWA 3MRQB 1FV1B 5HI4D 3BKCL 4MA8H 1M71A 3O9WC 4P4RA 1KJVA 5F88B 2CUMA 1G7HB 4CMMA 4XNQB 1IJ9A 1MFAL 2K3TA 4FOMA 1KIPA 3L3OB 4LIQL 5E99L 2H41A 5I8OH 3OKMB 4GO6B 4PJXE 1KGCE 3QI9C 2ARJB 5CGTA 5D96B 3KYNA 4OGYL 1DBMH 5C07D 4OAWA 3CFEB 1NJ9A 5EU4A 1BFVL 2X9WA 3QPQD 4JZNB 3LS4H 15C8H 3ESVF 2OYPA 2ID5A 1N59A 1MFBH 2D31B 2GJ6E 2Z8VC 5HDLA 1S7XB 3AROA 3MJ8B 3T2NH 3EYOA 3K0WA 3V9FA 5HDBE 1S5IL 2HJFB 2AJXL 1CLYL 4WVRA 2D9CA 1N2RB 3GI8L 1ZGLM 1S7QB 1S3KL 3MNWB 5CJXC 2I24N 4ONGL 1F97A 4Z8FH 4TTDC 4NZTL 1MCCA 5HHOE 1UKQA 4G6ML 1JYWA 5ITFA 5DUBB 1INDH 4I3GA 4KZEH 3MA9L 4LPYA 2Q6WA 5E2UH 4O58L 4K8RD 2PO6A 5CIPA 1A7QH 1LO2H 2R2EB 1SMAA 1FL3A 4ELMB 2ZCKH 3GHEH 1UVQB 3HZYB 3GNML 2FIRT 4KMQA 3SDAD 1T2XA 1KTLB 4HFWA 3RPIA 1JPSL 1RZ7H 4CADA 5DEFA 1WTLA 4ESKA 4P3DB 1CL7L 3KLAB 4JZOB 4DCQA 2CR6A 3KYOA 4LHUD 4WCYL 5JUEL 4G7YH 1MHPL 4U1HA 1TNMA 5BQ7A 5EH1A 5T1LD 4MVBC 1KIRA 1U3HD 1SM3L 4KVNH 1LE9A 4WUUD 5E9DB 1WISA 2NXZD 2ZOKA 1CD1A 2HWZL 4JDTH 4KHTL 3BWAA 1RU9L 1RZKH 4NQCB 3DVNA 3R8BB 1KLUA 2YKLH 3VI4F 5C07E 3NIDF 5DD0L 5A16A 3SQBA 3MOAH 1AI1L 2J88H 2ZUYA 1N5YH 1K8DB 2ZCLL 1G9ML 1GZPB 2NR6C 1I1CA 3MJ9L 4M7KL 3I50H 5IQ7H 4GT7A 5EU3A 2DYPD 4OCNC 3S3SA 4NBYB 1KCRL 4NM4H 4WU5B 3HC0A 4YHZL 1OB1B 3W39B 3OJVC 4P5TC 3HUJB 4NN7C 4R7NB 2FJHA 2ICES 2CUHA 2DLTA 1RZJL 5D6CB 3R0NA 4CNIA 3O2DL 4AENB 4LASL 5DEGB 1WIOA 1TZIB 1MJ7H 2PF6A 1PG7W 4YUEL 5E4IA 3VXUA 3E6FB 1RIVH 4OKVA 1NFDA 1EPFA 1OM3H 5IB2B 4G8EA 3TF7C 3TZVB 2VIRA 3L95B 2EC9T 5DJZB 4PJXF 1XCQB 5T33H 2W9EH 5E4EB 4U1SA 2XZZA 3ARDA 3T0AA 4X8XA 2EH7L 4X7TA 3BH8B 3IDGA 3U46A 4UBDC 4PGEB 1LEGA 3VG9B 1NC2A 4J3SA 4MD5B 1DANT 3WL9A 4ERSH 1R3HA 4X9GA 4EI5A 5HDBF 2CIIA 5C0FA 3O4LA 3QCUL 3E6HB 3OZ9L 4MB3A 4FRWA 2FBJL 2GKIA 4H20H 3H7LA 5DEZA 5JDJA 1T5WA 3IU4L 5DJXA 1L7IH 2FD6H 4KZDL 1QR4A 4WUUE 1MQ8A 1C08A 3V5HA 1A64A 3IVKB 4RSVA 1VFBB 5E8OA 2HT3D 3UAJC 4P9ML 5IMLB 2PO6D 5CZVH 2C7UB 2FEEL 3ARFB 4PJ8B 1KCVL 3KPNB 3UXFA 1FVDB 3MGOA 3ILQC 3FTGB 2EIBA 3ARQA 2IBGA 2DLGA 2GTZB 12E8H 1Z3GH 2EXWD 5K9OB 1S7RA 1QR1B 3LV3B 1JWMA 3SKOB 4ZPVB 5FCSH 1MCPH 5JOFA 3AS3A 2IBZY 3WEXA 5IBLD 2LTQC 4KK8C 4YHOL 4QGTA 2B4CL 3HE7C 3MACH 1OWRM 4QLRA 4K7PL 1I8LC 3AMLA 5C0RL 5LQBH 4UI2A 3DV4B 1A6AA 3AS0A 2CLRB 2JLLA 2J8UB 3P9LA 1IMHC 3GK8L 4NZJA 3Q5TA 1U8LB 4LCCC 2WUBH 4MQ7A 2FR4B 5GISH 1S7VA 4FFVD 3O6MH 1CFQA 1FLRL 4PRPB 3WS3B 2QKIB 5DSCA 2ZUVA 5HHPB 2ZPKH 4TUKH 1IGYB 1A6UH 2FH8A 2AK4A 5EB9A 1GGBL 3D2UA 3QUML 5E2VL 2ZNWA 1U8QA 1X5ZA 5E94A 3MLZL 4WHDA 2A77H 4FXKA 5KTEL 2HMIC 3MRFB 4KJQD 6CGTA 5TH2A 1FZJA 4HIXH 5JNYA 1NLBL 1RJZA 1E27B 4RAVB 2A6KB 3RJQB 2YSSA 4KMLB 3QYCA 4JDVA 5EZJB 4UILH 4YC2B 4KQ3H 4HG4K 4OCWL 5DRWB 5I17B 4N68A 1ZT1B 5E2WH 3FQRB 5H2BB 1MJUL 1ED3B 1KTDB 2H6PB 4GSDH 4UT6H 1W8NA 3FN0H 3QDJB 4OZFH 4Y1AA 2ZUUA 1G0YR 3B9KB 3VXUD 3JSSA 5GSRA 3W2DH 3UYOD 1ZLWK 3ROLA 1J1OL 3DI3B 1ADQH 5KS9B 2EDJA 3S96B 4D9LL 4X9FA 2X1XR 3H42H 1MCOH 5EU6B 3BUTA 2ZUQC 1JE6A 3PWVA 4TYUA 1IVLA 4A6YA 1IBGL 4QNPE 3ARDD 3HCVA 4PBXA 2BSSA 4Q9QL 1FRGH 1ZOXA 3BKYL 4QXTB 2YMXL 1N5AB 4MDJA 4N9GA 1NC2D 4KU1A 4S0TD 2CO6B 1BP3B 4LLQB 4EI5D 5EBWB 4PGJA 1MVFA 2EDFA 3O4LD 2DBLH 1LEIB 1U6AL 4X4YB 4IOIA 5FGSA 1C5DA 4HH9A 4JFPA 1DUYA 2FX9L 4PGDB 5HYJA 2IPUG 4LRIA 2Q86A 4YAQB 3M8OH 3RAJH 3SDXA 3OKEB 4MWFB 1R3LB 4IRJB 2AVGA 3N1MC 5HYSG 5I8KH 5E5MB 5IUSA 3QNXA 4JY4A 3V0VB 1D5MA 2V6HA 3BI9X 3CLFL 3KLSA 4JREB 5HSFA 4Y16C 3HE6C 1EV2E 2VDKH 4L4VA 2XA8L 5KAQF 4PJGB 4X4XB 1CR9H 5EC1B 2DIJA 3QEGL 4OZ4B 2VDRH 1YMMB 4Y2OA 3VXUE 3L3JB 3M17A 3MLUL 1NFDE 4GMTH 2VN4A 2ZUSA 5CP7B 2LE9A 1NDMA 2FYYA 4UAOB 5SWQB 1J5OH 4FFWC 5DVKA 3S5LG 3LN9A 3DVGA 2AK4D 3D2UD 3KLDA 5DMJB 1UWGH 3TN0A 1QEWB 3NVQA 4EKXA 4TSBL 4FFZL 5FO9A 2W0LA 3QWQB 1QVOB 4Y8DC 4KROB 1OP5K 3TA3B 1CLCA 1BQSA 1OTUC 4LCYB 1BVKB 5C0JB 2X4RB 3JWOC 3VFMB 5F7MC 4Q9CA 3O4LE 3QXAB 2AEWA 4HGWB 1HIMH 5KW9L 3KYKL 5GJSH 1AHWB 4NQSB 1KIQB 1JZ2A 4LLVA 4NCC1 4NQVB 1GPOL 4Y1AD 4IRSB 4ZQKB 3D3VB 1P2CA 3ABZA 5DQ9A 3KNBB 1IEBA 2R4RH 2XFXA 5CMAB 4JLRB 4G42B 4BSWA 2A6DB 3R4DA 5SV3A 4M48H 4QXWA 4BZYA 1WTGT 1R5IA 1J18A 5C9JA 4PJDB 5D7KD 4QNPF 1ZA3B 2HFFA 4LU5H 4TULL 4NQXB 3TH2T 5C6TH 5I74B 3L5IA 1L7TL 3O3AA 1YEEH 4K7PX 1A1OA 5FKAA 4KC3B 5GGTH 5LCVL 2CLZA 1CICB 1D9KC 4XXDB 5JW5B 3GSOB 3IU3B 2OJZH 1UC6A 1R3KB 2HT4C 3T0EA 4D0BA 4TSAH 1RUML 3PF2A 4FQCH 1VSCA 5C0IA 2VDQH 4GG6B 2CK0L 4YHIA 3U79A 1DQJA 2DQDL 1RQ5A 1OT2A 3QQ3B 4HXAL 5HYJD 2IGFL 4HUNB 3WFEL 3RKPA 2NY5L 3D25A 1OAUL 2GSIB 32C2A 3WDIA 1RK0A 3FB6A 4YHLH 1NBZB 2YC1A 2OL3B 5GSVA 2AK4E 2EDNA 1IAKA 2F5BL 4Z78A 1XCTA 5DUML 3UBXB 3QIUB 4LPUA 2OM5A 3C5ZA 2NY6D 4LBEB 4YPGA 3D0VA 1DBJH 3V6ZB 4L4VD 1A6PA 4LKCA 5F1KC 1FG2B 3WHE0 2SEBB 4Q0XH 2P42B 3QJHB 3L1OL 1YNTA 1SEBA 1BOGB 3REVB 2XWTB 1D5XA 4ISVA 3SJVA 3OXSA 3RDTB 3G5YA 2APXA 4HWBH 1MFEH 4Y1AE 3DUHA 1NFDF 1V7ML 1OT1A 2PW1B 3MLVH 4HJJL 4IDJH 3S4SB 4JPWL 3QNYA 2E9JA 4W6XB 5FYJU 3RA7L 3V52H 2ADGB 3BDYH 5J6GB 5GGVL 4EQ3A 5DJAB 5MI0B 4OZGA 1ZSDA 3QXUA 3WXVL 3PABA 5D7KE 2VXSH 1I85A 4PGZA 1ZHBA 3TN0D 4YXKL 3AB0C 3BVNB 4QRTB 1N6QL 1JHKL 2NY3D 4PJ9C 3N85L 5EC2A 3MO1A 4RGOL 3ZSSA 5TDPA 2YK1L 5INDB 1DQML 3C6SB 2ZG3A 1CYGA 4XBGB 4YHPB 1CFVH 4LSPH 3G6AA 3MR9B 5KOVC 3SDYH 4JY6B 3TJHD 5FYKU 4JAMB 1T0NA 2DQIL 3SGEH 3K4ZA 5E1HB 5MHSD 4OCXL 1R0AL 4H5SB 3MV9A 4Z5RB 2NY2D 1IQWH 2WANA 4ODWA 4MAYC 2B2XL 1GSMA 3FQWA 1NQBA 1Z0MA 5HYJE 3I9GH 5SX4I 2FGWL 4YIQB 2L7UA 4PREA 4P3CL 1JNNH 3SDXE 4S1SL 1UFUA 5EU7E 2NY4D 1HZHH 3I2CL 4LCUA 4NNYB 4U1KB 3WCYA 2BVUA 3KPOA 3TBSB 1YEGL 3FFDA 4X83A 3UO1L 3C5JB 4KKCC 3WUZA 3U9UB 5JR1L 3HZKA 4HIIB 4Y7MA 3GHBL 2R2HB 5E8EA 4HK0B 4XNXL 1T7XA 3SE4A 1X5FA 4N0UA 4WU7B 1N0LA 1IGCL 4L4VE 5KJRL 3HAEH 2VC2H 3T0ED 3QULA 3NCMA 1A7RH 1RUAL 4JJHA 4Y5VB 4P57B 4OD2A 3L3IB 3ZT6A 4YK4B 2K1MA 5F6IC 1KJ2A 5JQHC 3BIKA 5E2JA 4XHJD 3QRGH 1W72B 1S7TB 4HS8L 3QNZA 5IJKC 1FLTX 3UJTL 1JP5A 1NMCB 3ARSA 4F8TA 4RWHA 4LK4A 4DUVA 3U0PA 2ATKB 1T21B 2QQKH 4PLJD 4QF1A 5JQ6L 5DMIH 5C08A 1ZHNB 1MHEB 4IIQA 5EZLA 3B9EA 3L5WB 1NSNH 3LN4A 5TF1L 4P3WA 4Q2ZB 3C5ZD 2AI0H 1L0XA 1TZGH 4JN1H 1LK2A 2H1PL 3BE1H 4Z0BL 5SWZA 1CGSL 1RHHA 4NWUH 3FQNA 3LS5H 5HYQA 3FHQA 2MKWA 3OKOB 4MCZA 5CD5C 1T04A 3S97C 5MHSE 2AJZB 4HX1A 4LAQH 4APQB 2FGZA 3MV7A 3EAKA 3SJVD 1FE8H 4ZFOL 4NWTH 5MEOB 3QQNA 3VFOA 2I60L 4S1DD 1OVZA 5CSBA 4Q6IC 5HGBB 3VXMA 2GHWB 1KPVA 1FNAA 2QQQA 3ZKQD 2IALB 3IKKA 2NXYC 4GAYA 2W0PA 3QSKB 1RVFL 2J12B 4G6KL 2NW2A 1QSFA 3C6LB 4P4KC 3QCTL 4DW2H 5IKCA 3HZVB 1XFPA 3VWJC 2CDEA 1IE5A 3G04B 5F9WC 1MI5A 1S5HA 1T1ZA 3RVXD 3MNZB 3TFKC 4E42B 2BRRL 1FN4B 2WV3A 3RUGB 7FABL 1J11A 2BHUA 3UYPA 4IM8A 3C2SA 2GK0A 4IDLA 3T0EE 4E5XB 1PSKH 2DICA 4ZOAA 3C2AH 5F1SA 4OM1L 1X4XA 2WBJB 3NOIA 3BPNC 3ORJA 4RISL 5IB4A 3UJIL 5AWNH 4HC1H 1MWAA 5IHZB 4NNXB 1UB6A 4WGVB 3AY4C 35C8H 3MV9D 1XIWB 4OCRH 3QBTB 2XWJB 2O26U 4QHLA 1YYML 4EN3A 4QHNA 4P2QA 4OSUH 1U8JB 5BV7H 1MNUL 1NCTA 3P77B 3SDXF 1SYSA 3SCMC 4UDUA 2OR8A 3VGBA 4PJ7B 2DLFH 4P9HH 2F15A 5CSZA 2AV1A 2JIXA 3GIVB 1PJ9A 4ALAL 1A9EA 3G5VB 2CGRL 4U6YB 5ACZA 5A2IH 2COQA 2BVOA 1XZ0A 4K3DH 2XXCB 4ETQA 1F6AA 4WTZG 5GRVL 5D6DA 2FO4A 2MHAB 1RUKL 1QBBA 4GRLB 1BFOA 3SJVE 4XVSL 3LKPA 1FNEA 2ITCA 2OTUB 5F7FA 4OD1H 5D2NB 3KPSA 5IB5A 3O8XB 5C0ND 1DBAH 2ARWA 1MIMH 1ETZB 4LSRL 4Y4FB 3O2WH 3T65B 4P0DA 2GSGA 3K3QA 2CKBA 5DJCA 4OZGE 2Y5TA 2DQGL 2K9UA 5C08D 1CGVA 3RVVC 4DGIL 1QACA 3B6SA 5B39G 2HTKD 5CEZL 3RWHA 4R4BB 5AYUH 3T0WA 3WBDA 4HKJA 2E7HA