3S3BB

Structure of thermus thermophilus cytochrome ba3 oxidase 240s after xe depressurization
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3bB02
3QAPA 3ABWA 3SBRA 3NT0A 3OE8A 1QKPA 4DP6X 5H2NA 3NYAA 4JQ6A 5D4JA 3NJIA 1PMYA 1AACA 3DKHA 1P8HA 1GS8A 1C8SA 1MZYA 3AY2A 1BRDA 2IDTA 4HHWA 1SHXA 4YSQA 2EIJB 4BVNA 1MG2C 2BHFA 3MBVA 3C9LA 1NINA 3AW5A 2AZAA 4JHUA 5B1AB 1BRXA 1IKOP 4HCGA 3AG4B 2FJSA 3V2YA 2BRDA 1NPJA 4BEZA 1OE1A 4P5SA 3CODA 1GU8A 1ZDSA 2HPYA 4UF7C 3NY9A 4A4MA 1CUOA 1ID2A 4A66A 2Y04A 2AT9A 3QJQB 2VMJA 2ZWNA 2BP0A 4HIPA 5H2LA 4GRVA 2UXGA 3RZEA 2XU9A 5EN0A 2BZCA 1URIA 2FT7A 3IBOA 2VM3A 3CVBA 1L9TA 5LDUA 3ZIYA 1JZGA 5JJNA 2B3IA 4DP9X 5J7AA 1MDAA 5B6XA 5D4HA 1DZEA 1AG6A 4BXVA 3NP3A 2PCYA 4HYJA 1A65A 5I5IA 3HAPA 5TGZA 2BZ7A 3VW7A 3TBCA 1GW0A 3WG7B 1MZZA 2E86A 1QM8A 1JZFA 1PY6A 2J56A 3PBLA 3FQYA 5B7FA 4HAKA 4UAHA 3S3CB 1BEXA 1ASOA 3EMLA 1AP9A 5AHYA 1PNDA 3CAPA 1L9QA 2BO0A 3PAUA 4E9XA 1OOWA 1L9RA 1IW9A 2ZXWB 1ET7A 1NTDA 2GI0A 2VN3A 3CG8A 3MBWB 3NYKA 3UGEA 4CSPA 1AS6A 1XB3A 4G70B 2VT4A 4BDVA 3PLYA 3H4FA 3SBPA 1TN0A 1M57B 2NTWA 5E9NA 2F93A 2M3GA 3KJ6A 4G71B 5I6PA 3X1FA 3DQBA 4YL4A 1J5DA 2HLEB 1J9RA 1SDDA 3PQRA 2XVBA 5JJJA 2BP0B 2VW4A 3NSYA 1VLXA 4KOBA 2L6XA 3QDCA 4PXFA 3WNIA 1GS6X 2CAKA 2QPDB 2Q5BA 2HX9A 1HFUA 5B6WA 5ETZA 2YAEA 1TEGA 3WNJA 1JFPA 2PLTA 3FU7A 2R7EA 2UX7A 3FU9A 2YCXA 4K9JA 3ABLB 3OMIB 5B6ZA 4DJHA 1PZAA 1NICA 3PWHA 4UG2A 2IWKA 3ABMB 2YDVA 2FQDA 2FQFA 1BYOA 2J4YA 2DV6A 2OJ1A 5G2DA 3HAOA 1ADWA 3QBIA 1BM1A 5H2HA 2PPCA 1S52A 4IARA 1XB8A 2IDUA 2XX0A 1XIOA 1VGOA 4XXJA 2YCYA 3QJUB 3RYMA 2PEDA 4DKLA 4K5YA 1E65A 2B08A 2DWSA 2Y02A 1PLAA 2ZIYA 2DYSB 2UXFA 1KDJA 1FA4A 5G28A 1M56B 3C75A 4GY4A 3NS0A 3X1EA 3EH4B 1BQ5A 4KO7A 3ABKB 1EHKB 1ASPA 1SF3A 2EIKB 2LNLA 2NRDA 1JV7A 2PCFA 3OMNB 4G7RB 1M9WA 1AQ8A 4MFHA 5A45A 4NC3A 1N70A 1J9QA 2Y1AA 3ZPQA 3DDLA 2DYRB 1GSKA 3AZUA 3T9WA 2H47C 2I7OA 4QKTA 3V9EA 1WAEA 3AYMA 3CDZA 3QQXA 4AI7A 4E9SA 2H3XC 4LDLA 2RACA 2YXWA 1QKOA 4N4WA 3G5WA 3OD3A 4HZ1A 1L9OA 1IUZA 3QAKA 1ILUA 3FU7B 1VJMA 3HAQA 2R7EB 2I20A 5KKHA 3FSWA 1KG9A 2WO3B 4DPAX 4QLWA 1H2SA 3UZCA 1H68A 2VW7A 1IBYA 3CVDA 1GS7A 3D12B 1TN5A 1L9SA 3FSVA 4GPOA 1PLBA 2EINB 2PPAA 2ZONA 4KOCA 3X3CA 3T6XA 1W6WA 1BYPA 1CC3A 2TSBA 5AZDA 4YSCA 2WSDA 4DAJA 4YSPA 1AAJA 3S8FB 4KNTA 3OE0A 1NDTA 4A2EA 1KBWA 1PZCA 3UZAA 1JVLA 1M0LA 2VM4A 4WW3A 3EH5B 4X1HA 4BEYA 2FNWA 2EILB 1TU2A 1ZIAA 4M3HA 2F95A 5B1BB 2I85A 4QIDA 1JXGA 2UXTA 1S51A 2XYBA 1S54A 2YCZA 1PAZA 4JKNA 4A67A 2HRGA 4A2HA 2FQEA 3VHZA 4HCIA 3TA4D 1ZV2A 1FBBA 2A3TA 1KCBA 5AX1A 4TXVB 4A2FA 2ZZLA 1QHQA 2HZHA 1J5CA 4E9QA 1JOIA 1BAWA 2HXAA 2GB2A 3ZX1A 2NTUA 1L0MA 5LWEA 1WS7A 5AZUA 2CALA 4PAZA 1E30A 3HEIB 4J4QA 5ANHA 3PXOA 4X32A 3QJVB 1ZIBA 1DZ0A 4CSZA 4KNUA 3EH3B 2IH8A 3S8GB 3ASNB 1AZCA 3SN6R 1YLBB 1F4ZA 2BWDA 4YVNA 1JZHA 1TEFA 2QPEB 1C3WA 1UAZA 3FS9A 1AZNA 4KNSA 1NZRA 1F88A 1OCOB 5I26A 1M0KA 5B34A 2KSYA 3PXLA 1PXSA 4BWWA 1E0PA 4GP4B 2HX8A 4BV0A 3GXUB 1V54B 4Q89A 2AFNA 5PAZA 5TK2A 4BDVB 3ODUA 5DHHA 2YXVA 3NJJA 2IAAC 1F50A 3X1NA 5DYSA 1TKWA 1L9PA 3GDCA 3NJNA 4GXFA 2FTAA 1CWQA 1DYZA 2HRHA 4MQTA 2IDSA 4ZK8A 2IWEA 1SJMA 3D4SA 3HARA 1IBZA 1N68A 3ASOB 2YQBA 4OV0A 5A8EA 4X31A 1PY0A 1OV8A 1AZRA 3AYNA 3UABA 1XJIA 4XTOA 1AZUA 2XUWA 3TBBA 1AIZA 3QJSB 4WKXA 1NWPA 4BWBA 1UATA 4AKOA 1O0AA 3ABGA 4DP4X 4EA3A 2W8CA 2J5WA 1M0MA 3QBGA 4FPDA 2PPDA 5B1JA 3P0GA 5BR2A 2XV3A 1KBVA 3NY8A 2I21A 1PF3A 4G7QB 1S8LA 1JERA 4HWLA 1ET5A 1QLEB 4JKVA 4DP5X 2CBPA 2GSMB 4G7SB 5G2AA 5G53A 2QDVA 3FQ1A 3WIAA 3FYIB 4HHGA 2WO2B 5A7EA 2YARA 1BRRA 5ITEA 4BUOA 5AFAA 2KS9A 1RCYA 3AG1B 3IN2A 4EJ4A 2Y01A 2FT6A 1NIAA 5AKRA 2WJKA 4NERA 7PAZA 3AM6A 1Q5IA 4MQSA 1AS8A 2YAMA 3CZUB 4A2GA 1T5KA 4DP1X 4M4RB 2IWFA 4YSTA 4DP8X 3NJHA 5TK4A 2Y03A 4W9ZA 5FC9A 2AZUA 1MGYA 1U19A 1OF0A 2G87A 2QDWA 2LLNA 3VVKA 1WA1X 6PCYA 1OCCB 4RH4A 1SF5A 2JAGA 3S3BB 1E67A 4FBZA 2GBAA 4Q8BA 2CUAA 4MBSA 1CYWA 2YAHA 3WKPA 3T6ZA 1S8JA 1PCSA 4QRYA 1JXDA 1SDDB 5F7AA 3NSDA 4N4YB 1NIEA 4GYBA 4FAAB 4DPBX 3WKQA 4Y9HA 3UTYA 2PP9A 3TASA 1R1CA 2XV0A 2UX6A 5PCYA 5B6VA 4A68A 4HYXA 2VSKB 1PZBA 5B0WA 4E9YA 3HASA 1WA0X 1KG8A 4YSAA 3FU8A 5C1MA 4L35A 3ZDWA 2R4RA 1X0K1 1L9HA 3L45A 1RZQA 1HZXA 3N2JA 3RFMA 3FPXA 2X72A 1JZEA 4DP7X 1J9TA 3GYRA 3IEAA 5ITCA 1CYXA 2Q9OA 4YSEA 3VI0A 4YSRA 1NPNA 1AG0A 3FSAA 1I53A 4AZUA 2XXGA 5B7MA 1A4BA 2Z73A 3OM3B 4GP8B 2AVFA 1PNCA 1E5YA 4KO9A 1QNIA 3QJRB 4MD1A 2CJ3A 3IE9A 4XT3A 2YAOA 3NJFA 2Z55A 1CURA 1W8EA 3OMAB 2I7SA 1AANA 2MRYA 2I1XA 3AG2B 1JV6A 3NSBA 1FWXA 2QT6A 3QBKA 4IAQA 5AWZA 3REYA 3UTVA 4JR8A 4DPCX 3CDZB 3EF4A 3KW7A 3EHBB 5B3SB 2JAFA 4DP0X 3N55A 3SQRA 4WAVA 1ET8A 3C9MA 2AANA 2XLLA 5FJGA 3NSFA 4E9TA 1ETJA 4WTQA 5I6MA 5I6NA 3COCA 3CVCA 4NAJA 1X9UA 4N6HA 1AZBA 1V10A 1NIFA 1SHWA 2GIMA 4W1TA 3X1GA 5A44A 3HB3B 3HANA 1EZLA 2X87A 5B1JC 5B6YA 4NB7A 1P8IA 3T6VA 5B35A 2YAFA 2PP7A 5IY5B 2HX7A 4XTNA 3FSZA 1NWOA 5G36A 2DY2A 1X0I1 1BXVA 4A2DA 3PAVA 4YSDA 3MX0B 2J55A 4X4KA 1OCZB 2BWIA 1KV7A 5B1KA 4GP5B 2FT8A 1J9SA 2EIMB 5I28A 2XWZA 1HAUA 3JT2A 2PPFA 1KGBA 8PAZA 9PCYA 3UAEA 2H5UA 3PDSA 4E9WA 1JZJA 4F2FA 1A3ZA 5I6LA 1BXAA 2EI4A 4AMJA 1JGJA 1PLCA 2OCCB 3FQ2A 3NJLA 4BWTA 4P5RA 3FYEB 1UCQA 5H2MA 1NIBA 4XTLA 2PP8A 2W88A 1V55B 2XV2A 3AG3B 3DTUB 2FQGA 3H4HA 3SBQA 1LN6A 4BWUA 1W6LA 1OE2A 1B3IA 3QPKA 2P80D 3UTXA 3WQJA 4BXSV 1NIDA 1GYCA 1IXFA 1AT9A 4F2EA 5EHFA 3NP4A 3OQRA 3H56A 2FWLB 3KW8A 4L6RA 2KSAA 2IDQA 3ZPRA 1PXRA 4E9VA 2R4SA 4GBRA 4UHRA 1FFTB 2GC7C 1P8UA 4TL3A 3ZBMA 5I6OA 4UANA 4ENZA 3PPSA 4PXKA 4KLYA 2ZOOA 4IB4A 3QJTB 2VW6A 6PAZA 3S3DB 2N0MA 3BQVA 1XB6A 3FPYA 2YAPA 1GY1A 1IW6A 1E12A 1BQRA 4YSSA 2GC4C 2JKWA 4KNFA 1AR1B 2XX1A 5AX0A 2VSMB 5H2JA 2MTAA 1RZPA 2XXFA 1XMEB 1SFHA 3NJGA 1AOZA 2TSAA 3PCYA 1KCWA 3OE9A 3V2WA 3UAAA 1R84A 1A8ZA 2UXVA 2RH1A 3UG9A 4F7KA 4LDOA 5B2NA 4AKQA 1JXFA 1GZMA 4AX3A 3X1BA 4HCFA 2YAQA 4AMIA 1GR7A 3ZEVA 2CCWA 1JVOA 3NSCA 1GY2A 4KO5A 2YDOA 3BVDB 2BW5A 1SNRA 2J57A 5I5JA 2X88A 1OCRB 1ZPUA 4JHVA 2BP8A 3WI9A 5AHZA 2WJLA 1OE3A 1BXUA 5D4IA 4YSUA 5H2OA 3UTWA 7PCYA 3DIVA 1MG3C 4QI1A 3NJMA 2DWTA 3VGAA 2BW4A 1X0SA 5BR5A 3OE6A 3U25A 2IH9A 2Y00A 4HALA 4PCYA 1GUEA 5B7EA 3OAXA 1WA2X 4YSOA 3X2QB 4EF3A 4YVUA 4G72B 2ZFEA 3T45A 4KO6A 1R2NA 1A4AA 4L0PB 5I6KA 3UACA 3A7KA 3JTBA 2YCWA 5G54A 5G2CA 4GYCA 1RKRA 1S53A 5F7BA 4DP2X 1HAWA 3V9CA 3UONA 3UADA 1BQKA 3TU6A 4LDEA 1SFDA 5I5MA 1ILSA 5DHGA 2KSBA 4N8UA 1KYAA 1E5ZA 5JJEA 1FBKA 1JZIA 5F8UA 3T6WA 2IDFA 3IN0A 1KMEA 1KDIA 4XT1A 1ASQA 3PAZA 1WS8A 2GHZA 4BK5C 2PPEA 2JXMA 3T71A 1C8RA 1Q5JA 2OV0A 2JFCA 3VG9A 4EIYA 2BP8B 4AKPA 1AS7A 1IC0A 4FA7B 5H2KA 1ZDQA 3X3BA 3QBLA 3NJKA 2I35A 1X9RA 3FT0A 2Y69B 5H2PA 3ERXA 1QHJA 4MD2A 4E9RA 2P80A 5H2IA 1F56A 1KGYE 1A4CA
chains in the Genus database with same CATH superfamily
1MCEA 4PLNC 2H1PL 3QAZC 4HOXA 2PCXA 1N12A 1JBJA 3GS0A 4LCYB 5DWUH 3ARDD 3NRQA 4JGNA 4Z7QE 4FFVC 3NJIA 5F2FA 2Q8AH 2ROXA 4XOAA 3II3A 2R2CA 3HS8A 1AXTH 3KHQA 2AQ1A 5L2KD 2X4QB 3IJHB 1JHLL 3QCTL 1H6TA 4N9OB 1BRXA 4HVBA 1WHPA 2DKSA 2RH0A 4O51B 3HJEA 2ETWA 2BVUA 4FX5A 4LLDA 3AT8A 1UH3A 1Y7VA 3GI8L 5LAXB 1TR7A 1TETL 3ZDXF 4NZUL 1S7RA 5CD3A 4BH8A 4ETQA 3TYFA 4WV1A 3ARGA 4BK5A 2O72A 1TQUA 2UXGA 3JWNC 4PSRA 4DEPB 2EVFA 1LEKB 3HC4H 4B53A 2P7TB 4UU9A 3D85A 4HT1L 4PY8J 4ZPTA 3ZIYA 5D8JL 2YBRA 4BV1A 3Q2WA 3LRGA 3QT2A 1MDAA 5BO0D 3ZW3A 4EQ3A 4HS3B 2NNFA 5DYFA 3VW7A 3TBCA 5E1HB 1IGJA 4N2HA 3TO2B 3FUFA 2CHZA 5HJ3A 4YDNA 2J56A 1I1FA 4NBYB 2Z8WC 3FB5A 1M71B 3RU8L 1I4FB 1ZSDA 1AR1D 4JVUA 2KI6A 3F6LA 1TPXB 3R7RA 3OGOE 5D1XE 4BFRA 2LE9A 3LS5L 1ET7A 2GI0A 5JDSA 3VWKC 4CSPA 4FXKB 1N0LB 2ZWYA 1QSEE 4GQZA 1XSJA 5TQ0L 3H7BA 4GLRI 4RMUA 4Z0BH 3QR2A 1YY9D 2WNWA 5C0RL 2P5EE 4YL4A 2HLEB 4YFDB 5AVQB 1X5JA 4XMLL 2SEBA 4JFHD 2L6XA 4LRIC 3T0BA 3VXUB 2BIQA 3QIWD 5CNHA 4ZW5A 4PWFA 3NJVA 4LEXH 3DGGB 1NCIA 2BPBA 3FU7A 3LNFA 3TZVD 4J4PD 2J1KA 4ISVB 1OT2A 4S2SA 2FQFA 3IGUA 4QKXB 5D2NE 2P8MB 1WF5A 1U8IB 3WY1A 1MRDH 1FYHB 1T1YA 2NMSA 2E4FA 4XVUD 1QR1B 4LSSH 4BZ2H 1UWXH 2VISA 5D7HA 4NN6C 1BQLH 4ZBJA 1PLAA 2X70A 1I85A 4KK9D 3RJQB 3UO1L 1CE1H 5GXBB 4OCLC 3SDCC 2X6VA 3HNVL 3QA3A 3HNSL 4JM2C 5KYYB 1GYVA 1JGLL 1FFNA 4UAOC 2K3HA 4ANUA 3FTSA 3U2SA 3RDTD 1AH1A 1TYEB 3HG1E 4TN9A 4TQIA 5KS9A 5I8OH 5JIHA 4AYSA 3IMRA 4E9SA 4XWOC 4Y7OC 3HI5H 4K7PX 1URZA 2ERJC 3O6KH 3UC0H 4G6AC 1KYDA 2A6DA 1I8AA 5CGYD 3O11B 4X6CA 4POZD 1JNHA 1DFBH 3QZWA 3QJHB 3D7PA 3GNMH 4XN5A 5IWLC 1OSPH 1MW2A 3BN3B 3R4DA 1IBYA 3FSVA 1D9KC 1SY6A 3UAFA 2Y9RT 4GFTB 4PJIA 2YWZA 2ZXQA 3ZKMD 4LAJH 1YNTB 5AD0B 4ZO9A 4HZLB 1PY4A 2XQBL 1INDH 5FLUA 3E6FB 4YAQB 4XMPH 4YSCA 2WSDA 5JQIB 3KYKL 2A74C 5DJCB 4PJXB 4OZGA 3WY2A 1OW0A 2E7BA 5DUMH 5C0AE 3H42L 5FUOL 3SQBA 4NXSA 1OCWH 4P8QA 1SEQH 2XBDA 3KS0J 3VFVB 5HHXL 4UQ3A 1EVTC 4F58L 1C08A 1L9NA 4QIDA 2P9RA 3FTUA 3G04A 3OJMB 1PSKH 3PDOA 1GZPB 4GRWE 4H1LB 3WFCL 1AD9B 3NAAH 1U8QB 4HQQL 3O2DA 2ZX6A 4D3CH 4HDIA 1P4IH 3ZR6A 2DJ4A 2P46B 1MRFL 5GIRA 1EAJA 4UB0L 4L9LC 5KJRL 4C54A 4I4WA 1DN2A 5HI5D 1QLFA 4ATTA 3VXRD 2PYEB 5CILL 1MLBB 1B88A 4KPHH 3ULVD 2XY2A 4PW4A 4G8GB 1UH4A 1T21A 4CADA 2EH8L 4I13B 2VOTA 2WYIA 1AJ7H 1J0KA 5JHLA 4BK4A 3VA2C 1C3WA 1P7BA 2VIRA 1ZD6A 1F88A 1V05A 3V5DB 3L5IA 2AJZA 3QUYA 1EMTH 3AS0A 2N3JA 4DWHA 3GJFK 4CSTA 1T7XA 4WSJA 2BX5A 1RZGB 1QW8A 3V4VA 2NUPB 5TD4A 4C55A 2O5ZH 1GGCH 4AG4L 4E68A 1WH0A 1UM4H 3HARA 5F9WB 3ASOB 5C08B 3RAJH 2C7UB 2X4UB 4D0DB 4HG4J 1MVFA 3UTSB 4AIEA 5ESVA 1CICD 4HLJA 4XNYH 1KCRH 1KG0A 5EBMA 4OFVA 3MV7B 4DPRA 1HXYB 2C1PB 2W8CA 2NY4B 4G8EB 3TYGH 1RZKC 2Z34A 3KPQB 2B9AA 3GRGA 4KRPC 1JERA 1W91A 1QG3A 5F89A 1H3VA 1J0ZA 1E4HA 2OMUA 2EAEA 2VQ1B 2OM5A 3A67L 4A63A 1MPAH 1HK6A 3RKDC 2X1XR 3Q44A 5GRXG 1JGVH 2EO1A 2HRLA 5IF0A 1RHFA 1CZ8L 1O6VA 1S7WB 3EJCA 5AKRA 1GA2A 4L4TE 4UQDA 3STZA 3V9FA 3WTWA 2RA1A 1LDSA 3WS3B 3U46B 1TIUA 4U1IB 1LQSR 5IMLA 3U30C 5K9QG 4PRIB 4WJG3 3DC0A 1GOFA 2V5MA 1BDYA 4K5NA 4R4FL 4KHTH 3FH5A 3TBWB 1P4BH 4K3EL 4AVIA 1SDDB 4KTGA 4KXAA 4YLQT 4PJFE 1IGCH 1LP9A 3SPIA 2WM0A 3PWNA 5D7IE 3U1SH 2ZUWA 3KLSA 3APCA 4GQ9L 4H0LC 3SKMA 2IBZX 4BM7A 1E4KA 3P40A 5DZ9A 2G75A 2PXYB 4X5WA 4HMCA 1FZMA 2O30A 1V7ML 4LCUB 5ICYB 1DQJA 5BOJA 4MLIA 4WUUA 1J9TA 1ZE3H 1N9PA 3U1QA 3PWLA 3TPUA 1E9OA 4XCCH 1YYLH 4NHCH 5H35B 5EV7A 4MJIA 1RERA 1AC6A 3V52L 4FFYL 1RUKH 4ILDA 2JKXA 4NUJA 1U3HB 3IMWA 4N68A 3CFJB 4HD9A 2R2HA 2J88H 1DQQB 4OF8A 5IJCC 4Y5XB 3SY6A 2C7FA 1HH6B 4P46A 2PYFB 4UILL 1IZJA 3ME0A 1CGTA 4NQDA 5CIPA 3T08A 2XA8L 4X8JB 4O2CB 3OC8A 1LK2A 5I66B 3VNZA 1JV6A 2FX9H 2GEEA 5JW4N 4IAQA 3CDYA 1NMCB 2YPVH 4W81A 3VXTB 3W81A 4Q9QL 2GFBB 2C1OB 5EIIA 4BSWB 3GSXB 3G6JA 1YEDB 2HKFL 4PGCB 4XNMB 4GB9A 2UUDH 3QEGL 3UG3A 4TQPA 4M1DH 3FQTB 5DYOA 4GXVL 4N6HA 3P3RA 3TA3A 2QVMA 3S37L 4Z3IA 2IALB 4OD1H 3A5VA 4LP5A 4W1TA 5M95B 2Q8BH 4WFED 3BD4A 1HESA 2OI9C 4Y19E 1UWYA 2H0JA 1UUSA 4XPBH 2YAFA 2VXSH 4JRXD 4XMZA 4YXHL 1MREL 1NC4B 2DY2A 2PO6B 3D1MC 3OF6A 4YJZL 1M7DA 1RVFH 4R3SA 5L8LB 4PS7A 1XGZA 2A6IB 4X6DF 2X38A 3V7AE 3T1WA 1KB5A 4QXUL 1WPCA 2AMGA 3EJTA 2XN9D 2ZF9A 1K3IA 3KVPA 2E3VA 5SWZD 1HI6B 2VR7A 4N0UA 1GYUA 1PLCA 2EO7A 4MZ2A 4EUPA 1ADQA 1UCQA 2PP8A 3DTUB 5CZRA 5IROD 1OQOA 1VDGA 1RZJH 1HEJC 4GW4B 1YJDL 1O9ZA 3DRQA 4GAJL 3UZEA 1EAPA 2I25N 3RHWF 1OSYA 4Z7NE 5DS2A 4WU7B 4AQ1B 2NY2B 2X4SB 1D5BA 5F3FA 4A1RA 1A5FL 4ABQA 3ZBMA 4PR5B 4LHUA 4RCAA 4PJBA 5EU4B 1L7IL 4NKIL 1TVBA 4R26L 3LH2H 1T0OA 2N0KA 2X4NB 5L88L 3OR7B 1UASA 2N0MA 3BQVA 3C6SA 5DRNA 3BDYL 4KNFA 1S9VA 1LE9B 3QWRD 5CLYA 3AB0B 3ILDA 2C34A 4E5XG 1FNSH 3MLVH 3MC0A 2VSMB 3BFQG 4JM4H 3NCFB 4L3EB 4L5FH 1G5GA 3EF7A 4RMWA 1BAGA 2EVHA 1NCGA 1FVDB 1GZMA 3T3MF 3FU3A 3WO4C 5HGGS 3DHJA 3IPEA 5DQJA 2ZP8A 3WKMH 3DO7B 1ZVNA 4Z7UF 3RL1B 4ZD3H 4J1UB 2VN6A 1GY2A 1BMWA 2PN5A 3HBGA 1KTRL 4PJHB 4UT6H 4ODWB 1NUGA 4MVBC 3ZHKA 5FB8A 5AHZA 1TVHA 3NIGB 4IKLA 2WJLA 4OIBA 2DB8A 4YSUA 4ZPVA 43C9B 4YGAB 1JXKA 4FJZA 1NDMA 4QGTA 2FX8L 1UT9A 4Z3TA 4OV5B 4KVPA 4B60A 1ZA6A 3QUZC 5E4AA 3DX6B 4GI6A 2P4AB 1ORSA 5AVSB 1JN6B 3K8MA 1BQUA 3VI3A 3GZPA 4MJ2A 4HK0A 1J0HA 3UADA 4QTIL 3MODL 4XTRC 3RUGF 3O8XB 1XIWB 3O4LA 5E1AB 4AT6B 1YSOA 4KRNA 3S98A 2GJZB 4TVPH 5DRWB 3BPOB 3M1BA 1BIIB 4YXKL 2MQ0A 2ZAIA 1DFXA 4HUUA 3VM7A 2R0LL 2BRRH 1COBA 4G8AC 4DOHB 5INDA 3QHZL 1OT4A 3MBEA 2ZNXA 3QQ9D 4L37B 1RK0A 3IKCA 4IKJA 1AGCA 1NKRA 4YHPB 3PFUA 5H2KA 4Z5RB 1QLRB 4I18B 3ZKSD 2FATH 3MACH 4CU7A 2HSIA 2P80A 5H2IA 3QGVA 4IGBB 4TMPA 4WENB 5T1LD 4NPYA 4PBXA 5BV7H 4GUQA 4QHNA 1BYNA 3KWWB 5IB4A 4TLSA 4JQIL 3NYAA 3SPVB 3RL2B 2RR3A 1I9JL 1G9NC 2DWYA 3K2KA 4YDLB 4WWID 2WVTA 1MRCH 2NY3C 5D1QD 2B77A 1C7SA 2PABA 3OKDA 4FABL 3DOSB 4XBMA 3C60C 4DUVA 4WEBH 1VENA 4JRWA 1A7RH 2XWXA 1XZWA 1UEYA 2DQ6A 4OD2B 2YN3A 4A4MA 1YA5A 5DD5L 1TZIB 3VFUB 3ZTJG 3MLPA 3B7SA 3LDBB 4RFOL 1SOXA 5EU6A 2XWDA 2Z7WA 3BUPA 4YWGH 2WXKA 5K9JL 2FYYB 2GSGA 4QXTA 1DE4B 5ANMA 2BZCA 3PP3H 2AXHA 2WBXA 1G7HA 1DJXA 4X42A 4FLRA 4Q4EA 5J7AA 3K80A 4NO0A 3OR6B 2B2XL 5DEFB 5FW6A 5C0CE 3ZKXB 1A65A 5F8RC 3LKNA 4AQZA 4EKJA 5HYSB 2FEDC 2NUTB 2YO3A 4AM0Q 4NQEB 5DJ0B 1AI1H 4UYQA 3SYQA 1SOSA 3AREB 1XF2A 5B4MC 3BLPX 5JZ7C 4Y1AD 5TPWH 5EBGA 3BUYA 1J8HD 4NQSB 3WHE0 3ZMRA 1S78C 1KYUA 3EJYC 2Z0BA 3GSVA 1P6AB 2J8OA 5F0PB 3N85H 2V5TA 1Z9OA 2ZXGA 4ALAH 1J1PH 2DTML 4NQTA 3IBEA 4PJCA 3ZQXA 3BVTA 1M57B 2M3GA 4X2UA 5HBBA 5EC2B 4QOKA 4Y4HC 25C8L 2Z4QA 3P69A 1X5AA 2G4GA 4KOBA 2DDQH 3HN5A 5LAPA 5JIPA 4PXFA 5JW3L 4CGUB 1GS6X 3H2PA 1HEZA 3QCUL 1UJTA 2C3VA 4K5MA 1WP6A 4JFXB 2MCMA 1JZ8A 1QYGL 4M61A 3UTPD 1SMOA 1U8MA 4HU2A 1BF8A 4JO3H 2UX7A 4PD4J 3TJHC 3UO8B 5D5MF 4AEHH 1XHHA 3ABLB 1LE5B 4DJHA 2UY6B 2OP4L 3TIEA 1S3KL 4UG2A 4MD4B 5ISZA 4JANB 2DV6A 5KN5B 4D9RE 1OTSD 4HG4K 5H2HA 4PREA 1IBBA 2IDUA 4A2LA 3LQZB 1KJ3L 4M1GH 3SCMC 5C9JA 4ZAKD 2QHRH 4IRSB 2B4CH 3R0MA 3EYUL 4K5YA 1TG8A 5E4EC 4G42B 4Y2DC 2DMGA 2RBLA 2GBTA 2VAAB 4P3CL 3NS0A 1UD6A 4XNDA 1QA9B 3F83A 3WS6C 3G5YB 1FHGA 2FWOB 3W0WB 4G7RB 4ANKA 1N70A 2BP5M 4CMHB 4H1LH 1ZLUH 4CVZB 3QIBA 4OTXL 3E6HA 3MNWA 1X5LA 3L8QA 1OY3B 2LLLA 4G9FB 1BEYL 5ESQA 3UBHA 5MI0B 3CV5A 4Z3JA 3Q2CA 4XXWC 4HJSA 2EUXA 3MJ6A 2B1AL 7FABH 1ZANH 2EACA 1L9OA 1IEBA 1PFOA 1IGYB 2DQFB 3FSOA 3K0WA 2FEJA 4I0PD 4M6NH 4U6VH 1ZSHA 2R2EA 3IMTA 4ICXA 4JPKH 4P3DB 2WO3B 4H2CA 3IVKA 3EDEA 4DZ8A 1CLVA 4JKPH 3ZR5A 2EINB 5EN3A 1RZKL 5T1KD 1E4XH 2ISDA 3FUKA 5J6HB 3QXDA 3FU5A 2F5BH 3EJQA 3T2OA 5I17A 3OE0A 1F3JB 4XHQA 5I82A 1JV5A 1JZDC 4MMXC 1LO3L 1OGTB 1JNNL 4LNVA 4BDVA 3NIDB 4RX4A 2EILB 1TU2A 4XBGA 5C0FA 2A4CA 3WJJA 3C6LB 4TS6A 2P8LA 3FT9A 2BVTA 1SBSH 3IAGC 5JO5B 2X89D 1NCTA 3WE6A 4AWJC 1M7XA 4XRCA 4PJDF 5D70L 1WAPA 2L7UA 2WKOF 3QNYB 2HXAA 3R4RA 4B9CA 5J6GB 1JPTH 1L7TH 2WO4A 4Q97A 2X1PA 1X5FA 1MCWW 4EN2A 5D7LD 3L7EA 1I8LC 4JPIA 4Y5YB 3QJVB 1YHPA 1ANUA 2Y2TA 2C3GA 1SLXA 2CQVA 2QEJA 5JR1H 4JEGB 3WXWH 4MXWL 3NCWA 4NYLA 3GC3A 3AT9A 4P2CG 3CXHK 4UQBA 1F1DA 2ATPB 2XTJD 4GW1A 2HWZL 1BBJA 5JNYA 5KBNC 5DJDB 1QFWL 4FMVA 1DL7L 2K78A 5HVHC 2AFNA 3BKML 3KXFB 2IAAC 2N1KA 4MJ6B 5BNXD 1CD9B 4PV1C 5B38B 2OX5A 3MA9H 4MQTA 4LSVH 1A21A 1KB3A 3O0RL 4WO4B 3SKOB 1N68A 2R56H 1HHKA 2ZAHA 2AABL 3NCJH 1B9KA 3AXIA 2YD9A 2OL3B 3LIZA 3K72B 1U4EA 4YHYB 1LXMA 2E7CA 2Y5EA 4PPTA 2WYTA 2ORBL 1A8JH 2KLTA 4PVNA 1JDAA 4PIBA 3ILPA 4BH7B 4P2RD 3SE4C 3AWEA 2OBGA 3KGSA 4ZMWA 5L2JA 3VGFA 1T2QH 4M29A 4WNQA 2AJXH 4NDMB 3L5XL 2B20A 1R3JA 3BP4A 2RCSL 4AJYV 3CPUA 3RPKA 3V4UL 1G7LB 2YJQA 2J8UF 4GRMA 5I1HL 4N87A 2XJLA 2LT9A 1BRRA 3QCVL 4IBUA 5C0AA 5DJZA 2KS9A 5T5FH 3B9EA 4RNRB 3QYNA 1MFCL 7PAZA 1Q5IA 4NP4L 2Q6WB 1L0XA 2J1YA 4TPRL 2F54D 5BMFL 2XTLA 4YDJA 3HZVB 3P1VA 4WSKA 2GPZA 4W9ZA 3Q5OA 5FC9A 3KPMA 4FL4B 5EF1A 2NZIA 2CIKA 3SYCA 1JI2A 1OCCB 4G6FD 3CH8A 4JR9H 3WKPA 1JZ6A 3GKWH 2I26N 1A3LH 1YPZF 1LO0L 2H3KA 4GOSA 4P06A 4QHUB 2OS7A 3EOYG 3B6SB 2BNRE 4FQ1L 5F7AA 2YXFA 1INEH 1HKLH 1NL0H 4DPBX 5JOEA 4JQVC 2D31B 2OJZH 1EXHA 2ZOUA 4KTEH 1PZBA 2WC7A 3NZHL 2FB4H 1NGPH 4JN1H 3O3BB 1ETA1 1FFPB 1UVQA 3E8UL 3AVEA 4YLCA 3DROA 3FPXA 4OAWA 1KPVB 1ZHKB 2CBQA 3L3IA 3DXAE 5BUPA 1NC2D 4DQOH 1WSST 3UCRA 3REWA 3FU0A 3OKOB 4BRVA 2JK5A 1YEHH 3K0YA 4ZUUA 4F27A 3IF1A 3RWEB 1WGVA 4Y8DC 5FV1L 3WMSA 3T09A 1JHLH 5FCSH 1FN4A 5HYJB 1YECL 5LO7A 1JS4A 2ZSVA 1HL4A 2I69A 2QKIC 3IJ9A 3WOVA 3DX3A 2GJ6A 2YAOA 2NY5H 4FQJL 1GC1H 3SO5A 2FL5B 1KLUA 4L5FE 2BIMA 3RBSA 1E5UI 1FNFA 2BVQA 4KY2A 4ODUA 3GGWA 2FZ3B 2YPLB 2ADJA 1VAHA 2VLKE 3N44B 1CDYA 4JR8A 2DL2A 3EF4A 3KAAA 3QHTC 4HT1H 4Q58C 4DTGL 3N55A 1KXQA 3GM8A 3C9MA 4WNSA 4DEWA 4W9FC 2V7HB 4UT9A 1FBIH 2AJSH 4IM8A 1BAFL 4MZRA 3B7YA 2YJLA 2OR9L 2BS9A 2F74A 3M88A 4JY4B 1PZSA 5AYQA 1UXSA 4J28A 5E8NA 1EZLA 4BE6A 2HN7A 2YXMA 3WDIA 3KPSB 4PBWD 3LQAC 3T6VA 5DZPA 1DJGA 3I6LE 3NZUA 4L4TA 4U1MB 4IBVA 1KNOA 1WWWX 4DIXA 1RIVL 3EBHA 5K93A 5TQ0H 1E6JL 5ITFA 1DQDL 4B9YA 5C0RH 3MRPA 4P2QB 2F68X 5A2AA 4PS8A 5DRXA 3FTXA 1JPGB 3CFKA 4IDJL 3MOQA 4HCRL 4MWFA 2H5UA 4L4VB 4EI5D 5E8OA 4DKEH 2IPKA 5KG9B 4Y4FA 1JGJA 2D8KA 4TVPE 3FQ2A 4TVSa 4WI5A 4WAFA 1SXZA 2I24N 1GJUA 1O6SB 3SBQA 2FIKA 3TESA 1D5IH 5EC1B 2NY1C 5AAMC 3ISRA 2F53D 5I75C 4B5ZA 2JELL 5DI8B 3FRUB 5HGHA 43CAB 4MD5B 3BLKA 1ZGLB 4X6EB 3K71A 3DJ9A 2VJXA 5HYEA 1QNZL 4IK6A 4MSWB 4OT1H 3UBXA 3P0VL 4NUGH 3QUKB 5MHSD 1G7IB 1A0QL 4X4ZA 4LU5L 9CGTA 4KUZL 4LIQH 4H25A 1AQDA 1KCUL 1FO0A 4M8QA 2VZTA 3L5WA 5T8IA 1X44A 3UO1H 1GW6A 4QAWA 5MEPB 3VXMA 1I3RB 4OIAA 3QJFA 2VLRA 4ZTPH 1QRKA 3VXSB 3HNVH 3I6KB 1QSVA 3HNSH 4IRJD 1ZLWK 3TLRA 3KPNB 1JGLH 2YAPA 3ALXA 2KHAA 2PR9A 4GUOA 2HT2C 3L9EA 4GSXA 4ZUWA 4MNQE 4F3FB 3MRHA 3CFQA 3FO9A 1G9NL 2PO6C 1JK9B 4APQC 4U3CA 2XV6B 5KSVA 2PTVA 3HZMA 1AOZA 2OLDA 3CDGB 4PV8B 3D39A 1WTGT 4P4KC 2XZZA 1A1NB 2L7QA 1BW8A 4PTTB 1GJWA 1R24B 1IBGL 2FK9A 2VLLB 2YMXL 4XCYB 5D9SB 3G6AA 4M62L 4LKCA 6FABL 5C8JB 5H8DA 3CCHA 3U4EB 1MG3C 2XFGB 3KYKH 3PHOB 3ECVA 2X40A 2IQ9L 1Q72L 2O5NA 1HZKA 2HFGH 3HFFA 3H42H 3P77A 4JO8A 5FUOH 3UAJC 1WA2X 5GGUB 1XXDC 2BNQB 3RWGA 2OZ4A 4AQ1C 2NY2C 2X2HA 4PD4K 5HHXH 5LKNA 1MFAL 3QDJB 4RBPH 4NGHL 3UACA 1NSNH 2PR4L 4FTVE 1LHZA 5GGSY 1FAKT 5G2CA 2Y36L 2VRAA 3ROOA 1EFXD 4UV4L 3WFCH 3MNZA 4HQQH 4J3OH 1K8IB 4K71C 5CBAA 4JN2A 1ILSA 1MRFH 3ECBA 4KK5C 5MEOB 2NX5A 3HC3L 3MV8D 4HWEL 4TQ8A 1WIPA 1QEWB 2XZQH 1FF5A 5B3NA 3RG1C 5DEGB 2DQGL 3AB0C 2P42B 4KAQH 5CILH 3AQXA 3MR9A 4JVPA 3SDDD 4CJ0A 2CZNA 1HL8A 4QO1A 4NPJA 1U42A 3KNBA 1QRNB 2EH8H 4NFCA 4KROD 3B9VA 3SGDI 1IGTA 2ZOLA 4XCEB 3VXQB 2RFXB 2P5WA 2J2ZA 4NS0A 4DGYL 1GZQB 3QIUC 3AXHA 3MGTA 4ZFZA 3L3OB 3Q8CA 3SY0A 3SDCA 3F7KA 1PX8A 4JM2A 3S48A 1KJ2L 3UIYA 2ICCA 1MJ7H 5EFIB 1UA3A 4JRYE 4WK2B 4NBZB 3ZE2E 1ZS8B 4JHAH 1FC1A 3RURA 1BRDA 2VO5A 2OK0L 1F86A 4X7TB 5TH2A 5A6LA 5K59F 1X5YA 1ETZA 3LZQA 4HIIA 1RUML 1CUOA 3BUDA 5I76B 5IUSA 2ZWNA 1MWAL 5D7JD 5DK2B 1YYCA 1KEGL 3QFDB 5IWLA 4M5TA 1QFPA 2J6WA 1B2WH 3ARBC 1D9KA 5BOZG 2Z8RA 4J23A 2H0FA 4MDIA 3B5TA 2PYEE 3A24A 5FYJU 5B6XA 1KFAL 1I7UA 3N40F 3VFOA 3ZTEA 5KBDA 4G8GE 4Y9CA 4YHKL 3WL9B 3RPIB 3ZTDC 1N7ML 4C4KO 2WQXA 4LVHC 1GSMA 3PBLA 3SJVE 3A67H 4HAKA 4DS7E 5HGAA 2R1XB 3TBYB 3CPLA 3ZTNH 4FQXB 4PJFF 2IANE 3PWPE 5D7IF 1EJOL 1CZ8H 5IJKC 1BVOA 3CAPA 2BO0A 5DJ6A 1F3DJ 3BVXA 4X7SH 3SODB 4HWBL 4HIJA 4WJKB 5H94B 4RFNC 4IGBC 5I1AA 1X3DA 2HKAA 2VH5H 4G70B 2EDNA 2V9TA 5ENWB 1R5VB 3PLYA 2IOIA 4L9LA 1SN2A 3GTNA 3K5SA 4R4FH 4FA6A 4PEEA 1Z9MA 1ZHLA 4X0KA 1J9RA 3MUGB 4K3EH 2BP0B 1U21A 1Q1JH 5GGTL 5L6YH 5C08E 3JUZA 3DV4A 4X5QA 1NFIB 5T3XH 2QPDB 2A9NL 3UTSE 2Q5BA 2XG5B 5E6UB 4DERA 4KXCA 4ADIA 4GQ9H 1S7UA 2VERN 5EF0A 3MV7E 5FDYA 1CGWA 3VFPA 1HXMB 3VFWA 1Q94B 1PLGL 2Y1YA 3LDBC 5T5NF 1T7WA 1BD2B 4AYFB 2YQ2A 1V7MH 3BUBA 1A9EB 5G2DA 1HYSC 3U9UB 4J6IA 3WEBA 5C92A 1FNLA 2HJLA 5EU5A 4MHHG 3OLIA 2R39A 3VW3H 4FFYH 1YN6B 2B08A 1FNEB 3DJTA 3RTQD 3N41F 1D7BA 1E90A 3OZ9H 3ELQA 1OTUD 5HJBA 4MMYB 4R7VA 4I3SH 3S36X 3U2JA 4UILH 2ALWA 2XA8H 3GM0A 4NN7C 3QYMA 5A45A 4ZFOL 3S96B 1GZHA 3SGJA 2WQWA 4Z7VF 2JB6B 4PRIE 2DYRB 3LKRB 2WPGA 3MNVB 1LWRA 3QEQA 4WW1B 4OBSA 1V27A 3C08H 4Q9QH 2RACA 4N8CH 5DSCA 1C1EL 4I8DA 2OULB 4WK0B 4LKXA 2HKFH 2G60H 5FUCC 1EGJA 3KDMA 1IKNA 3P73A 1PJ9A 4GXVH 4WFHE 5DC4B 2ED9A 3UZCA 2BINA 2K6YA 2VDOB 3GSNB 5FFGA 5FYLD 4NQXA 3S37H 3GBDA 3VE0B 3U7AA 4OZ4A 3F64A 4R2GD 3MXVH 1VPOL 4XOBA 5C6WH 4YXHH 3MRQB 4GRLA 4UQEA 4YSPA 4OZFA 3TZVC 1TZ8A 4J4PC 3BDXA 4BKLA 2Z31D 2CLRA 2YEZA 5FUZL 2V2TA 4QXUH 4HFUL 4ELMA 2DF3A 1UC6A 2Q3AA 3ZSSA 4P57A 2GIXA 5EUOB 4Z77A 4XVUC 1PKQB 4PRDB 4GEIA 4WI3A 5JHDD 1UHVA 3HZ3A 1JOIA 4D7BA 1OK8A 4UUJA 5TE6L 1G6RL 3K4DA 3U7WL 2VDRL 4GFXA 5BRZD 1FL3B 1NBQA 1PG7X 1YJDH 2N7SA 3RX5A 4PGDB 2WQUA 4HZAA 4GAJH 4YBQD 5EPMA 4X32A 1VGKA 2DD8L 3F7PC 3RDTC 5MI0C 4OUUA 4HS6B 5DT1L 1A5FH 4HGWB 5JIMA 1BA9A 4PLKC 5F71A 1MNUL 4YVNA 2YD1A 1RJLA 4B95C 2LV4A 2VSDA 3DX0A 4LARH 1L7IH 4FLSA 5CGYC 4RWYL 2IADB 2H7WA 1RZ8B 2Z3FA 4GKSA 4POZC 4KU1A 4QRFA 2A6JA 2LABA 1E4JA 3D4ZA 1YO4A 1NKOA 4BV0A 4X9HA 5TK2A 2FD6L 2KT6A 4P5MB 4PW9A 3NJNA 1L9PA 4QEGA 4P2OB 4K23L 5MEND 4QRTB 2DRUA 1EHXA 3VFSB 2HYMA 5BW7A 3OLDA 3DETC 3IMSA 1TLKA 5IGXL 2YSTA 2QHLA 1II4E 2LR4A 4N0FB 2AV1B 4PJAE 3C6LC 2ZWSA 1UKSA 1ZT4B 1ZJBA 5T3ZL 2OTWB 1AZUA 1R3IL 1X7QA 2Q2LA 3P2DA 4IS6A 2EEFA 4R7DA 1A4KB 1RJZA 3M45A 1T6WA 4JS7A 2YEVB 1ZLSH 4QF1A 4CAGA 3R06A 4AEFA 5JXAL 1GGIL 3P0GA 1MI5D 1PF3A 5EOTB 4G7QB 4UTCA 3KLDA 4O9HH 2E9WA 4KKQA 1TQBC 2C5DC 1G94A 1UXMA 4M6OH 3UIZA 1T3FB 2EXYD 4FCAA 4NJAL 4BUOA 1RCYA 3AG1B 1F4YL 3TCLB 3A4DA 4RA0C 4OCYH 2HFFB 3C2SA 1NAKH 4I2XB 1T5KA 1ROCA 3LQAL 4FQQB 4ZDHB 5JXED 3SSGA 2CGRH 3L95B 4QTIH 1FV1B 3IDJA 3DIFA 3LAFA 4FLOA 5D7SL 4WGVB 5F7KC 1VGEL 1K2DA 2I60L 4YXKH 4OLUH 3OHMB 1KZYA 3WGVB 5D1ZB 4ZI8A 4FBZA 2PTTA 1CYWA 4PLJD 4TM9A 5KSBB 1MJUH 3NESA 5DJ2A 3MLSH 1WC7A 4M7KL 5I1LA 4N4YB 3QHZH 4QY8A 4FAAB 4WO4C 2R69L 1AO7E 2V3FA 2X5PA 4PJHE 3Q6FA 3B8SA 5CF3A 5DF0A 3CMOL 1INQB 3NIGE 3ZDWA 1OAZH 4IYKA 3WNMA 1BGXH 1SBBA 1OP5K 3N1FC 4QR7A 1EA9C 3OGCB 4LIQE 4YHLL 1CYXA 4JQIH 3SE6A 3LD8B 4AJVA 1FIEA 4Y9GA 2JI2A 5KSAD 2O5YL 1AG0A 1NAMA 3O3AB 4LCIL 3ZZSA 3CQPA 4AC2A 3HE6B 3MRGB 4GUPA 2VDQB 1QNIA 2JIXA 2CJ3A 2X10A 4KQ4L 3DYMA 1AQKL 5DMGD 1BZ9A 2Z55A 1G7MB 1KT2B 2IQAA 1W8OA 4WZ9A 2AK4B 2NPLX 5K9JH 3ARFC 4YFLI 3D87B 2C9VA 4U1GC 2EZ0D 1TZGH 3EGSA 3HAEA 2LAAA 3ZE1F 1M7IA 1UD2A 1JAEA 4DOHE 3KCPB 5FK9A 2W38A 4IU3A 4KKZA 3VFMB 5I6NA 2YS4A 5E94A 4MMZC 2VDNB 2CMRL 1JPST 5AVUB 3ARWA 4EMZA 3WN5B 4CN1A 3X1GA 2XPZA 3K6IA 5GS1B 2D7QA 5B35A 3D33A 4YGVB 3FSZA 4JAMB 1SYVB 1P1ZA 2B7DT 2P5PA 2F08A 1YZZA 5FA4A 1KV7A 5K39B 1CBVH 1T1WB 2GHWB 1AGDB 1J9SA 2EIMB 3EO1B 5MP6L 5INCB 8PAZA 3TN0D 3FB6B 4F2FA 5DWPA 5JW3H 1UXWB 4PS3A 2WN3A 4P48A 4H8PA 2X4TA 4U7MA 4MRCA 1T0MA 1NGXA 2IH3B 1QYGH 5KVMC 1LN6A 2NNCA 3VTTA 4WTZG 1J0JA 1F4XL 3F5WA 4HJIA 3BGFB 5HHMB 3MN8A 4NRZA 3MLYL 1Z6JT 1YAIA 5GPRA 1IXFA 2OP4H 5ICUA 4X98B 3HPLB 4F2EA 4ZMYA 3RVUD 5DS8A 2ZG3A 4OVVA 4L6RA 4HIHB 2BSSB 1O5PA 4M4PA 4Z8FL 4AMWA 1NUDA 2FBRA 4NQEE 2R4SA 3SB3A 5I6OA 1RMFL 3BMWA 3LYRA 3MHZA 3X3GH 5FO8B 1A6UL 1RP8A 2ICEA 1BLNB 5LBSH 4ENZA 2HFEA 3EUUA 4NRYA 4P3CH 4U1NA 1MY7A 4O2FA 4FNPA 4N2OA 1TF4A 1XQ4A 1JTPA 3NZ8B 3WAKA 4G59C 2DJUA 3OKEA 1I75A 3ARGD 3ZQWA 4YSSA 4HHAB 4LASL 5E5RB 1OAUL 4D9LH 8FABA 3D85D 3CUPA 2XXFA 3P4OB 4A6YH 1DSFH 1ZT1B 3BH9B 4BGLA 3OE9A 2FO4B 4OR1A 2O5XL 2B1AH 1H3XA 4PVMA 2QTVA 2NCMA 4AMIA 2VXVL 4WW2B 5I15L 4KGLA 5JDJA 2J20A 3HBPA 3HE7C 3NSCA 3SDXB 4X4YB 4KO5A 4HH9B 2BW5A 2J57A 2XTSA 4UT6A 2X88A 1NM9A 1IGFL 3GMLB 1XF3B 5EOQL 5IFHL 1O5DT 3WHXA 5SX4I 4HKJB 4PJ8A 5IROC 3HG3A 1X0SA 5EN2B 5FKAA 2CUHA 4I5BA 4HIEB 2XDHA 5BS0B 1S7TB 3LS4L 1LO3H 1JNNH 4LCYA 3F7VB 5FYKU 2AQ3A 3T45A 1VEPA 2A1WH 3T0EB 3GLEA 3O41B 3T0DA 2AITA 1UYWL 3JTBA 1JP5A 1YEGH 3HZYB 1JHKL 2HPOA 4OVUA 4K15A 3WUWA 2X4QA 1RSYA 3IJHA 1PZUB 5CM1A 5A3ID 4S1DC 3BN9D 1DVTA 4LQFH 4O51A 1KGWA 5DHGA 5E4IA 3FMGL 3T6WA 1EHAA 1S5HB 5LAXA 2VZ3A 4W70A 5D2LB 5J6SA 5T3XE 1MJJB 3Q01A 1L3WA 3BAIA 2ESVE 4N1EA 4PM1A 1UB5B 2HH0L 2CBTA 4ZMLA 3Q0HA 1CR9L 2XKSA 3SCMA 5BXFB 1KTBA 1R34A 1FUNA 3BUTA 1BVNP 4HS3A 2XIBA 4FA7B 3SBWA 1OWRM 2R59A 3NSJA 3O45A 3TO2A 5HI3D 2J6EL 2WSPA 2Z91A 3KJ4B 5EZLB 4FQIH 1UOVA 1TTGA 1M71A 2HWZH 3AJ7A 1I4FA 5C6PB 4LCCB 5JIDA 2AI0H 3ZTJH 2A4ZA 4TRPH 1TSRA 1DL7H 3H0TB 5MERB 4WI0B 3BKMH 3EDDA 4F80A 1P7QB 2BVOB 5D6DC 3ESUF 1N0LA 2EIJB 4FXKA 4KQ3H 3FBQA 4GW5A 3ZYOA 5FOJA 2N7AA 4PRPB 4P5SA 5EUKB 3PDGA 4JLRB 3UPRB 3SPHA 3V0JA 5GJSL 3KL0A 1JZ2A 1I8KB 3VQMA 3VXUA 1CFMA 35C8L 3V4PL 1KPUB 4HPHA 3VSVA 3W39B 2JXMB 5KYUB 3HI6L 2HT3D 3QSKB 3TWYA 3MLRL 1FGNL 4HWBA 4KVCL 3Q05A 5D4HA 1HQ4B 1IE4A 2BOLA 4RMRA 4ISVA 1P53A 1X5KA 5GRYA 1NKGA 4ZMTA 1GW0A 2OZNA 2RCSH 1FLTX 2P8MA 5I1HH 3WYRA 1U8IA 5I24A 3JVGC 4UDUB 1ASOA 3QCVH 3QRGL 3MZGB 4Z7WE 4QPEA 1QR1A 4K7PL 3AUVA 1SVZA 3G9AB 2XACC 3MJ9L 4GXUM 3DX1A 4E9TA 5HDQH 5BMFH 4PJ6A 4P49A 3KXFE 4KZ0A 5KYYA 1YC7A 3ZHLA 4G71B 3TEXA 2WXQA 2XY1A 3IRPX 4EOWL 4QHPA 3UTTB 4AMXA 1LO0H 2A9BA 4K8RD 2QQKL 3VWJB 4FQ1H 5ICZA 3IDNB 1UD8A 3IDUA 2WXLA 4EIBA 3O11A 3H9HB 2O61B 1HCYA 1CVSC 3DMMD 4XX1G 4YDKH 3QUYD 3GSNH 1UENA 3T0AA 1CT8B 4L8CB 1YNTA 1I8UA 5AD0A 4HZLA 1KBKA 3IFOB 3E6FA 4YAQA 2A99A 2VZVA 4G1EB 5DHEA 5FEBA 2W65B 4WHCA 5DJCA 2IH1B 5I0WA 4PJXA 2NZ1A 5GS0D 5F96H 4UDTB 4AK2A 1YECH 4GI9A 1SLUA 2YD0A 3FO0H 1IBHA 2NXYB 1MWOA 1CS6A 2VLME 3JWDC 4FQJH 4ZX6A 1GZPA 4OJEH 4H1LA 4X6CF 1EZUA 1EQWA 1U8QA 5C07B 5E6IB 3S4SG 3ALPA 3V9EA 4ZO8A 1CL7I 3CVHB 2IGLA 2MJWA 2DWEB 1JHTB 2W60B 4DTGH 1GHFL 2V0AA 3H3KA 4FHKA 4PJIF 4J2XA 5DEZA 2D3VA 4M5YL 2QELA 3T2QA 3U79A 2X09A 4DUXA 1UOLA 2CLZB 5C6TH 2PYEA 1MLBA 1B0WA 1QPKA 1ULVA 3DBXB 1D7CA 1K72A 4K9EC 4AM0B 4QLWA 4XXDB 1IAKB 4NPKA 3RZCB 3CVDA 1TJMA 1IC5H 5FGSA 3KPLB 5IV2B 2MTPA 3UH8A 1MCPL 3C5ZB 1IEHA 5AZDA 4E2OA 4HOZA 4DAJA 4DZBB 1KJMB 3V5DA 4ECNA 2NY7L 1QHPA 4TTDC 1TMCB 5CAYB 4XMUA 1RIVH 2DH3A 2KKQA 1RPUA 4UMGA 3VFGH 1DQDH 1XD1A 1UT1A 5CCJA 2XSKA 3FFOA 1RZGA 5HYJE 4IDJH 4HCRH 1U8OB 4TL5A 1GOGA 4ODXB 2NUPA 1TCMA 4IIQB 4ZAKC 4ZUTA 4A2HA 4HCIA 4AYMC 2MMXA 3BZEB 2AS5M 1G4MA 1KCBA 4L29B 4M8UA 4WY7L 4BD4A 1CI5A 3CE1A 5FS5A 3VGBA 1NOFA 4A7VA 5C08A 4ZMOA 3PP4L 3P9MB 2C7UA 5SX5K 2X4UA 4D0DA 3H85A 1L0MA 2EDTA 5KEZA 4HGMA 4QDGA 4J4QA 4QRPB 3U0TB 1QPPA 2AV7B 2JELH 1X9LA 4WUUD 1HXYA 3CFBB 2C1PA 4G8EA 2E6QA 1QNZH 2YZ8A 3KPQA 1CE6B 1Q9OB 3FONB 2DPKA 3P0VH 3RA7H 1T1XB 3PL6B 5E00B 4I89A 4HX1B 2IH8A 1A0QH 3TFKC 4LU5H 2R83A 3BP5B 2MQ3A 1KBBA 1KCUH 1KB9J 4YLBA 1IGMH 1TTAA 3GFUA 2QPEB 2Z8SA 2ZTBA 2GW5A 4P46D 4CGTA 2VQ1A 5FM8A 4KZDL 4NQDD 2CO6B 2QKIA 3KBFA 2KSYA 3KPSE 2NSMA 4BWWA 1E0PA 4HEPG 1S7WA 4M1CC 2HX8A 3U82B 1OEZW 3WS3A 3U46A 1WUNT 2ITEA 2HUEA 4U1IA 3B56A 4UOW1 4P2QE 2IDSA 2B16A 4PRIA 4ZMZA 1BREA 3D4SA 1SJMA 1P6WA 3L3JB 1ACZA 1M6OB 2CNZA 3VMOA 4DO4A 1XSOA 3AYNA 3UYPB 1YNKL 3TBWA 1H3PL 3TA3D 4AK1A 4BWBA 3ABGA 1IBGH 3H6AA 4ZMXA 2ZWLT 2K1MA 1U8KB 5GSVB 2YMXH 4IU2A 2PPDA 4IBZA 1OP9A 2NYYD 4FXTA 6FABH 2ZF8A 2N56A 3ZMNA 2PXYA 4UM9B 3OF6D 4RZKA 5JIIA 1K4DB 1RU9L 4W6XB 2IQ9H 1BG1A 2G0LA 1Y18B 3ZDXB 3WTXA 1W16A 3JBG7 5H35A 1QHOA 2XFXA 4J2QA 1D3CA 3QS2A 1L6XA 3IU3B 4NGHH 4TSAH 4A37A 2PR4H 1UCBL 4UT7L 4Q2ZB 2YAMA 3CFJA 4UV4H 3VXSE 3WJMB 4AGMA 4OM0L 1DQQA 3KBPA 4BZ1A 3SE8L 4DH2A 2RGSA 4Y5XA 5TK4A 1FH5L 1NANI 3ZY7A 3NDYE 4LL1A 2PYFA 2BCKA 3IDMB 2LLNA 2XTJC 3P4LA 4X8JA 4MZIA 5F7MC 4O2CA 2BHUA 4RGND 5I66A 3AROA 2WWOA 4ZNCD 4ERSH 1J1XL 3C09C 3ZE2F 4P2OC 2DQGH 3EXJA 2F8IA 3BSGA 3VXTA 2GFBA 2C1OA 2PP9A 1YEIL 5JOPE 1K85A 1BJ1H 3GSXA 5E8DL 1BJMA 4BSWA 4K73A 4LHUD 1YEDA 4XPAL 3E9TA 4PGCA 4XNMA 2I07B 1CTNA 3FU8A 1T83C 3FQTA 2NR6A 4RRPG 2EUWA 2A83B 2VDNH 3L45A 1E7VA 3GJEB 4G3YH 4NJ9H 2IALA 1KJ2H 1WBXB 4MAUL 1CLOL 3F8UB 1I8IB 3UYRL 5KZCB 1JWUB 1NC4A 4FHBD 2PO6A 3QPQD 3BSZL 4NEHB 5KYWB 4FJ6A 5CU5A 2A6IA 5I73B 2JKTM 2X7LB 2Z73A 3MV9A 4HKXB 3KPRB 5DUJA 3G6DH 1HHJB 4UTAH 2ZKXA 4FMKA 4MD1A 5KAQG 4FULA 3P3YA 3WIFB 1MWAH 3MKGA 1HI6A 3D05A 3V0VB 1KEGH 3WENA 1ZLVK 2GBUA 3LRHA 4MRBA 3QWOB 1K8DB 3QBKA 3ARDB 3NCEB 3OC5A 4YEEA 5EO1B 3CDZB 2DEWX 2P49B 2Y7QA 2JAFA 5CJQH 2VZSA 3GSQB 1KFAH 4P9HC 4WI6A 5T1DH 1I9IH 1QRNE 1HL9A 1S9YB 3BWAB 3GHEH 4YHKH 3VQ2C 5ADOH 3W9DA 2NTFB 3UAJA 1V7NL 2CM6A 5DQ9A 4HC1H 4WU7A 5DD0L 4AQ1A 5BUAA 1I3GL 2X4SA 5E0QA 5E2TH 1EJOH 4U7SA 2XN1A 3HB3B 3PUUA 5CN1A 5LGHH 4PBVC 5EU4A 3O4LD 4I85A 5KYXB 2X4NA 3L4VA 5HVGB 3OR7A 3TCTA 1NUFA 4UM8B 4PY8I 2WUBL 1TEYA 1N6UA 3HJ0A 1L5GB 4YDIH 1LE9A 3JTTB 3PDSA 4E9LA 1Y6NR 3MBED 5I6LA 4L3EA 1T7ZA 5GGTH 4C56E 1AR1B 1OGAB 1RURL 5H2MA 1NIBA 2W88A 3OAZK 3BFOA 3JV6B 5IMKB 3WAJA 1FVDA 2FQGA 4KX8A 5HYFA 2O6EA 3W2DH 1DDTA 2P80D 3UTXA 3RL1A 1LO4H 4J1UA 1AIFB 1RP9A 3QIUA 3CJJA 2BOBB 4XVSL 1BMGA 4PJHA 4ODWA 2AP2A 5L8KB 4F7EB 43C9A 3HMXH 4UIKH 4UHRA 2P52A 2F61A 5FR3A 3QIWB 2ADFL 2W59A 5I71C 4OV5A 2GAZB 2VYRE 15C8L 2VR5A 2QQLH 3VNYA 1R0AL 1ZA3B 4O02L 3DX6A 4MJ5A 4L18A 4M93C 4HETA 5EU6D 1JN6A 5GS1C 5I16B 4FADA 4LOEA 3RY6A 2OMTB 4MAYB 3L3HB 5HDRA 2DLGA 1XIWA 2EE9A 3K6OA 3QK0A 5E1AA 4AT6A 5JA9A 4R0LC 2OSYA 4NO0D 2GJZA 2F7RA 5DRWA 3O4OB 2KH2B 1A8ZA 1BIIA 1C1EH 2APFA 1MF2L 1RFDH 3O6LL 1JPEA 1PBYA 4LZKA 3G08B 4PWHA 4AX3A 1DR9A 1N8ZB 4P23B 3KJ6L 2NY0B 1MEXL 3LNDA 2ZPKH 3IGFA 3EGXB 1MQ8A 3OLGA 4PMFA 3U6XA 5BVPH 4J3UA 1FE8L 4LEEA 1YEEL 4EI5C 4YHPA 1BD2E 5D96B 3SGKC 3MU3A 5D4IA 5IJKA 4Z5RA 3QUXC 1QLRA 1UURA 5DHYB 3BGFC 4I18A 1VPOH 3HTLX 5E9DB 4BQBA 3GO1L 2QVKA 1QWNA 4IGBA 3CFNA 2FCBA 3OAYK 1HIML 3KWWA 4QOKD 5FUZH 2WCPA 3SPVA 2YRPA 3RL2A 4AL8H 1EHNA 4LSUL 2JJWA 5F7BA 1PD6A 1OAKL 1GPOL 4FKEA 1KYAA 4CUCA 2QR0B 4OD2A 5BOPA 3ETBF 4W9LC 4HJ1A 5F8UA 1G6RH 1TZIA 5TE6H 3NCYS 3RVWD 3VFUA 2VDRH 2EQDA 4XO4A 4F37F 4IJ3C 5ISZD 2OPCA 3MRMB 2MPVA 1ML0A 4S1RL 5EZOL 1SQMA 4XP1L 2FYYA 3F7RA 3ULSB 1DE4A 4XO8A 3WKNA 2R0WL 1I8MB 1KIPB 1IJNA 4EIYA 2LU4A 4KH2A 3RRQA 3G5VB 3EBAA 5DEFA 2PMZA 3VSUA 4PJAF 1ZVSA 3X3BA 3NK3A 3DTDA 3L3DB 2NUTA 5HYSA 5DJ0A 1Z3GL 3WKYA 2NY6B 1ZV5A 4RWYH 2IXQB 3AREA 4DHLA 3GSRB 3UGEA 3QIBD 2WQRA 5CUSL 4XAWL 1PMYA 5BQ7B 5EOCH 3DBSA 3EHBD 3QDGA 5AW7B 4OI9A 1YUHB 3EJRA 2AZAA 1TNNA 2MCPH 3AG4B 3ROLB 3SQOL 2J3SA 3DYPA 4Y4KB 3UP1A 5LUMA 2EE6A 2VL5B 5T3ZH 3JWDL 2LQRA 1R3IH 4V2BA 4HIPA 2QSVA 3K74B 4RAUB 5CLXA 4PRAB 1E4WL 2D2CC 2WXJA 4JFXA 5F7EL 4NAMA 4FJYA 4R5VA 3THML 5JXAH 4XVJH 1LE5A 2WWMD 1NMAL 3AITA 4RVBA 2UY6A 2PCYA 4MD4A 3TBSA 3OV6A 4JANA 1XV8A 3CFIC 1B0GB 2AQSA 4P2YA 4PJ7F 4RX4D 4XPHH 5KN5A 4K9EL 2X05A 5DVPA 4UAHA 3LQZA 1KBGH 2YK1H 4NJAH 1SHSA 3FT3A 1CICB 1AP9A 5AHYA 1F4YH 2XXMB 1PAMA 1EV2E 3GS7A 3ZJAA 4G42A 1DUZB 1QLEL 3FTGA 1CG9A 3LQAH 2VAAA 2CKBB 4QMEA 4TOYL 5AZEL 5D7SH 2FWOA 3W0WA 1KB9K 1OD7A 2I60H 4IMKA 3MROA 4LSRL 5EIVA 3RGVB 4GKNB 4CVZA 1HSBA 3ECUA 4PB9L 2A9CA 5JJJA 3R18A 4FG6D 4G9FA 4JQXC 4N5ED 2ZKMX 2RMNA 3I3DA 3VDBA 2CAKA 2OMNA 2FE0A 2M1KA 2R69H 1KTJA 2P24B 1UM6H 3QQDA 1F8TL 1T4WA 4RBPK 2WV3A 1IGYA 2GTWA 4X6DB 3RVVD 4AV5A 4P3DA 2IWKA 3I9IA 3BKJH 2J4YA 2XI9A 2K8QA 1U6AL 1TXKA 5CZKA 1VEOA 4A2MA 3IYLW 2VDPB 1FVEB 5BVJB 4NZTL 3MKKA 5IQ7L 4KX9A 2O5YH 5GZNC 1ITBB 3E3QC 1F3JA 2Y02A 4MZ3A 1U3YA 4K2UL 5A2CA 2VUKA 3C75A 4RAVB 4LCWE 2CDFB 3CFEB 3C87A 1SF3A 4KQ4H 3C6LA 4I2XE 1AQKH 2NLJB 3PXHA 3FCGA 3BW9B 5AQ0A 5JO5A 2IFFL 3ZPQA 5C0GB 2XQYG 1LMKA 4X4MA 1NEUA 4N0RA 3UDWA 3NH7H 1WAEA 2C9PA 3FFCA 4GIPD 2V5RA 1C9SA 4LBAA 3QNYA 2QMKA 1U8PA 3VRIA 2ZUQC 4FYQA 5I19L 4XMXA 4AC4A 1BZOA 3Q8AA 3OWRA 4LLQB 3ZL1A 1ILUA 2CKNA 4J3OF 4Y5YA 5KKHA 3FSWA 1ZTMA 5EEYA 2AC0A 3VWJC 1CGVA 3T2LA 2DMHA 3OB8A 4KOCA 5GQBA 3QP3A 3PWVB 5K69A 1EBPA 2EC8A 5I8CB 4K5LA 1XCTB 3T3MB 3UX9B 2ATPA 4AQOA 1CLZH 5DJDA 5EO9B 4A7UA 4H7VA 2G5RA 1AE6L 5B1BB 1JDDA 5MP6H 4MJ6A 5DD6B 4EIGB 4YX2L 3FBKA 4CNIB 5B38A 4KK6D 2ZUUA 1XCWA 1UA7A 4WO4A 3SKOA 4HV8A 2W95A 3QUHA 4CKQA 1RLBA 2XRAL 1T1ZA 1IAMA 2NXYC 2F19L 2OL3A 3K72A 3ZX1A 4G6JH 1HJCA 2BS8A 2XVKA 5G5DB 1PY9A 3MLYH 4AYDC 4NQQA 5IIEB 3F04A 5DLML 4JY6B 5IZ7A 3HZKA 4HULB 1RZIA 3D30A 4FE9A 4JX0A 4MXQD 4Z8FH 2CXKA 4XI5D 2N4IA 4NDMA 5JPNB 3HS9A 1P84J 2NSQA 4JFEB 1H5BB 3TWCL 1G7LA 1L0PA 4KNSA 2GJ6D 2G2NA 5KVFH 2DJMA 4FQCL 1WZMA 1GYAA 3HW7A 4RNRA 4GSQA 4GP4B 4RISL 1V54B 2Y5TB 4JHWL 4JZNB 4LASH 2EYTB 1BVKB 2BOCB 1OAUH 3F01A 1RPQA 3HZVA 1Z5YD 3ARFA 3BX7C 3G5ZB 4KKLD 2ZKWA 4R2GC 2O4EA 2G3NA 1IBZA 3P4NB 5DFVD 4LFHD 3GMPB 2Z31C 4QHUA 3QQ4B 1R5WB 1XJIA 2XUWA 3N5AA 4NO2B 4X6BB 1H9VA 3B6SA 4MMZA 4DK3A 4YDZA 1X7TA 2FO8A 4CDHA 4X80L 1O0AA 1IC4L 2D31A 5HHME 4EN3B 3OXRB 4KKRA 4M3JA 3SZ6A 2FGZA 5EOQH 2J5LC 5K9KB 2JJSA 5BR2A 4HOMA 2HLAB 2IDCA 4DGUA 3O3BA 4I87A 4P9HL 4JKVA 1FFPA 2EICA 2WB1A 2OSWA 1B4TA 2E56A 3GMNB 5G53A 1KPVA 1ZHKA 5CP3A 3VGEA 3LS4H 3STBA 4PY7B 4GO6B 3CN1A 4GG6A 4ZUSB 4F9LC 1QW9A 3OKOA 5CEXB 5JIQA 3C5SB 4Y4FD 1FA4A 1JHKH 3RWEA 4YC2C 4A2GA 2WKGA 4U1KA 2HTLD 5HYJA 3FF7A 2NNAB 3NJHA 4YMPA 4IOFD 5AZ2L 3Q8EA 3LEYL 4JY5H 1Q9KB 4JE4B 1Y6MR 3FMGH 4IBQA 2FL5A 2W1NA 3Q5YA 2XIDA 4ZO7A 5E1IA 4PUBH 1SLVA 1IT9H 4ORGB 3IMBA 5L7XH 1VFOA 2FZ3A 2YPLA 2XT1B 1I9RH 2E75C 4FFVD 4GYBA 1CR9H 4W6YB 4FHJA 3S7GA 3ILEA 3C8KB 3P3SA 4MKMA 4PJGB 1ZTXH 1WG3A 2EJ1A 3BSZA 2V7HA 3VXMD 4L35A 1FORH 1RUPL 2VLRD 2R4RA 3NOIA 5J1AB 4XO9A 1JZEA 3DHPA 4JY4A 1IGIL 3AQDA 4NN5B 4KXDA 4LSPL 3RGHA 4PQXA 3KPSA 5BS0E 4XN7A 1BWWA 1LWJA 5DZJA 2ICWI 4U1MA 4MQSB 5D5MB 3T0EE 3D39D 4N8VB 5LWYL 3OM3B 1KGJA 3ARTA 4MXVF 2EVIA 1J0IA 2VZOA 4P2QA 5C0JB 3OX8A 2WLJA 1CXKA 3HE7A 2YGOA 3NRFA 4L4VA 5GJSH 5T1LB 4MCZB 1OPGL 1U8NB 5KG9A 4CU6A 3AG2B 4PJ5B 2ILLA 1V3LA 1MVUB 4YIQB 1O6SA 2CRYA 4APXB 3MRKB 1M2OA 3HI6H 4LPTA 5D2LE 4L48A 5EC1A 3MLRH 5JXEC 1FGNH 4KVCH 3SQRA 2Y2WA 5D1QB 1ZKAA 1O7DC 2CGZA 2ENQA 3FRUA 5DI8A 4MD5A 1ZGLA 1ETJA 4X6EA 2MNWA 3BH8B 3CFTA 2DLTA 1GMIA 4MSWA 2MOGA 1E9QB 2H2SC 3QUKA 4URTB 3D5OF 1G7IA 1MAML 1SHWA 1BVLB 5A44A 5HHOB 4CBPA 5B6YA 1MCWM 4HSQA 3S3JA 4JFPA 3MJ9H 4IW4C 2AJVL 1KY6A 2PP7A 5MEPA 5G36A 1I3RA 2NX5D 2OXHB 3VXSA 5SWSE 3I6KA 4I9WE 3P2TA 3KPNA 2X6AA 3ATFA 2DWDB 2G3ZA 2HJFB 1DP0A 3P3UA 5I8KL 4ES8A 3T4AC 9PCYA 1JK9A 1A6TB 5KSAC 3NJLA 1GKEA 2Y7NA 3CDGA 4V11A 3PIQB 4PV8A 1AFVL 1I31A 1MHHB 1WZLA 3H4HA 3WCYA 1HINL 5E56A 2P5WD 1JGDB 1A1NA 3M6DA 2B59B 4O58L 1M1XB 3SDCD 4PTTA 2AEQH 1GYCA 5FM5O 1R3KB 1JRHH 1QSZA 2DL9A 2X44D 4JM2D 5DMGC 2R29L 3FQUB 4XCYA 1CIUA 1QATA 3IK2A 1OP4A 5C8JA 2IDQA 4PJDB 4PBDA 3U4EA 3QQ3B 1G7QB 3GMOA 5D93B 2EZ0C 5B8CB 1A6ZA 3FN0L 1G7JB 3PHOA 2EDHA 3HHSB 1MCHA 2NXZB 2X6CA 4G6AD 1CGYA 3O6FB 5GGUA 2BNQA 4FQ2L 4NM4L 4IB4A 3PHAA 2R23A 1YYML 2IOMA 3DX4A 3QDJA 4RDQF 2VMEA 1KELL 5KOVC 2CR0A 4JG1H 4NWTL 3VI4E 1IW6A 4QYOB 1JUFB 1ZCRA 1D9KD 1T0NB 2G0KA 1K8IA 4G8FB 3BAXA 2NDGA 3VVWA 2BMKB 5MEOA 1SFHA 5T3ZE 3UTTE 1OM3L 1GHFH 1QEWA 3UAAA 1GAFH 4JFDB 3H9SB 4F20A 2CIIB 3HFML 5DD1H 4Z3EA 5DEGA 1IB5A 5EO0B 1GYWA 4QUOA 1HU8A 4W9EC 1EEYB 3IE4A 3TN0C 1SNRA 1GIGL 3GZOA 4XCEA 3WSQL 3VXQA 2RFXA 4IHBA 1MCPH 4MS8C 3NJMA 3IDYC 4MDJB 4BGDA 2BCMA 3L3OA 2IH9A 2Y00A 2YN5A 3M1CA 4PTUB 5I6XC 2D0FA 1MW1A 3N04A 3TV3L 3BAEL 1K5NB 5EFIA 5F1KC 3JYCA 4WFFE 1ZS8A 2CLVB 4M7JL 1EX0A 4BBWA 1E5BA 2YCWA 4LK4A 3ULVH 4W9KC 4X7TA 4LB8A 3NFPB 5T1KB 1W72B 3LRSB 4MA1B 4Z1PA 5C07E 3RE0A 2FIRT 2VR3A 3PP4H 2J8UB 4ZQTA 5I76A 1JD9A 3TGXA 5E8EB 5DK2A 3TT3H 5AKSA 3MLXL 3QFDA 3OKMB 4HF5L 1KGCE 3RIFF 1TUPA 1ASQA 1T6VN 3BHBB 3BYYA 3D52A 3QDMA 3F85A 4EBQH 4D7PA 5JHBA 3ARGC 3R8QA 4BK5C 3U4KA 3WTVA 2DTSA 4JO1L 5CR8A 5I1EL 1QR4A 3GDBA 2BIPA 2BH0A 4JM2F 1JGUL 3M1OA 1QO3B 1IC0A 4W93A 3SGEI 5CO1A 1MH5B 2NY0C 3WL9A 4AMKH 2CU9A 2Y6TE 3HUJE 3WIIL 1BHGA 1YPZB 3TBYA 2R1XA 3MRCB 4FQXA 5CCHE 4YFEA 2APXA 3DGDA 3ARZA 1KTDB 7CGTA 5D7LB 3OE8A 1NFDE 1QBLL 3QEQD 4HOWA 4YZFF 3HVNA 1AGBB 4LVOC 4JCWA 4KI5E 4YH6A 2DJSA 4XE0A 5ENWA 4GH7B 1HJBC 5GRJL 1V3KA 2HFTA 3ZO9A 2AJ3B 4U33A 5ESAB 2WLIB 3QFJE 1PX4A 1ID2A 3F05A 1H3PH 4FNLL 3MUGA 2BP0A 4U2YA 3RKDD 2R9HC 4G43B 1NFIA 1TJGL 3SPJA 2XG5A 3R1GL 3BRGC 3L6FB 2MWCA 1FNHA 2WXNA 3GIZL 4N0CD 5A3IC 1HXMA 1MW0A 1Q94A 2H32B 4GRLD 4NUMA 1BD2A 1VFUA 4Y2OB 4KKAD 1BMZA 4IK7A 1DQML 3S36L 1A9EA 5L9DH 4GIOA 3U9UA 3K4ZA 3CBJB 4XZUA 5D1XB 5AUMB 4HUCA 1AMXA 2FR4B 1A3RL 3QS3A 5CEYB 1QSEB 5F6IB 4I1NB 4K3DL 2XETA 1JF1B 1YN7B 1YN6A 3FN9A 4BZYA 1FNEA 2NY6C 1NTDA 3SE8H 2P5EB 3NYKA 1ACYL 2V2WB 2ZP0T 3N1GC 4MMYA 2PF6A 5F88B 2EXTA 1P84K 2NTWA 3S96A 2X4OB 2JB6A 4UOZA 1F58L 4R90H 2X9ZA 3LKRA 4AGLA 3MNVA 4WW1A 1IRAY 2X2YA 4RSYA 2VW4A 5HXMA 1BM3H 5DGQA 1DJHA 1IIKA 1YEIH 4X83A 4ZT1A 4IJTA 3CX5J 2VR9A 2IGTA 1TSHA 2AQRA 5D2NB 1CCZA 2C9SA 4RAHA 4LSTH 2EEXA 2YDVA 1KIRA 1DZBA 5J0BA 3HAOA 1Z9PA 1BM1A 2ATKB 3VE0A 4P9ML 4L1LA 4LLAA 2LLGA 5EG6C 1QFHA 4CC1A 3ZDXE 1E6OH 1EXUB 1FGVL 2HT3C 4YE4L 5KVFE 4Z0XB 3SEPA 1PD0A 5CN3A 4ZX3A 2CBOA 4H8WC 3HG1B 3KYMB 3WFDH 1KEML 3OMNB 1JV7A 3PNWB 1AQ8A 3KEDA 1IJ9A 5FYLL 2BHYA 3Q5TA 4G7YH 5EUOA 2ICWB 4X0NA 2I7OA 1PKQA 4PRDA 3TPKA 3LN4A 3L4UA 5KBLA 4TQEL 3WNNA 2EIDA 1FL3A 4F8PA 3V6FB 4FQHB 4HJGB 3WO3B 4DVRL 1RK7A 4YK4C 3N43F 3MRJB 2H1LM 1KG9A 3BRFA 2V3DA 4PCTA 4HS6A 2VW7A 1I3GH 3VGDA 3IFNL 5EULV 1U8HB 2VM9A 2PPAA 4HGWA 4K8RC 3WHE1 5FECB 1PS3A 4AH2B 5LN4A 2VC2L 2R1YB 5BZXA 4FZEH 2FJUB 2WQVA 4ELMF 4XNZC 1RZ8A 4MCMA 4EDWL 4IQHA 1KBWA 5HDBF 4URKA 4PRNB 4LLMB 1M0LA 2WUBH 3QUYC 1G7PA 3B83A 1ZIAA 3ETSA 3GZQA 5TFSL 1CMOA 4P5MA 1A47A 2XYBA 3IJSB 1S51A 4P2OA 4BFOA 2WN2A 4QRTA 2XVGA 2WQAA 3VHZA 3VFSA 5IB5B 1RURH 3VH8A 2ZZLA 4N0FA 5KBKA 5GS0C 4IBTA 2G3XA 1ZT4A 1OZTG 2AXFB 5LWEA 3N91A 2OTWA 1T83A 2EDEA 1A4KA 1H0DB 3PREA 2O93L 5L2KE 1IAIM 1ZTXE 4KTYA 5J13B 1JXJA 5FOBB 1T7VA 5KYNA 5ACMA 1FQ9C 2QVIA 5EOTA 3RFZB 3GXMA 2G9HB 1HSAB 5I0YA 2EDWA 1BWMA 15C8H 2JIXD 1AZNA 5AVVB 4OBRA 1YNLL 1WZ1L 1R0AH 2NW3B 2DH2A 4O02H 1DUYB 1QFWM 3VFRB 4TNGA 4BUGA 1TFPA 3TCLA 3H9YA 2WBJB 2HFFA 3CFCL 3PWUB 4I2XA 2KZWA 2FJFB 3DTXB 3IJYB 3L95A 3A3YB 1FV1A 4ZK8A 3S3PA 1A9BB 1MF2H 2H3NB 5ALBL 5E6YA 5KSBA 1KULA 5FX3A 4WLCA 1AIZA 1FFOB 3QUML 4IRJB 3R8BB 1FE8H 4ZFGL 3DWTA 3WTTA 4OFIA 1HXKA 2HTKD 2KUTA 2IFGA 4GQQA 3Q2VA 4WI9A 4XTRD 1INQA 4OQTL 5KBPA 2OMVA 3JUYA 4OIIL 2CBPA 3Q7JA 4POYA 5IJBC 1JNLL 3IFLL 1IAII 4JFHE 2Y3AA 3P30L 1F45A 3OGCA 1KN2L 1HIMH 4H5SB 4WHTB 4Y2LA 1NIAA 2UYLB 2GI7A 4NERA 5C09B 3IAQA 1H5BC 2KS0A 4N2NA 4M4RB 3HE6A 3MRGA 1OAKH 2WP3O 3ARUA 4PP2B 5E7FA 1GPOH 4ZSOB 4MJHA 1CJYA 3WMPA 1KGIA 3WIHL 1MUJB 1G7MA 2MIZA 2W0FB 4PJFB 1KT2A 5D7IB 5DJAB 2AK4A 1DANU 5EZOH 4XP1H 5IT2H 1YY8B 3KGRA 2FBJH 1NIEA 4M03A 5AKVA 3TASA 1XBDA 4YHIB 3GUTB 3HR5B 2E7HA 4HYXA 2NY3D 1KIUB 2VR6A 4AV0A 1T5XA 3FAXA 4NUQA 1P4UA 4Q14A 3CBKB 3VFMA 3AACA 1Z3GH 2WWNA 4ZTOL 3TA3C 5AW8B 1Q0XL 1NGWB 2AF2A 3WN5A 4PI2A 1XO8A 1EZVY 4X7DC 4ETYA 2WLKA 1H15B 1U2HA 5GS1A 2DIJA 3VI0A 2BVPB 5CUSH 5AW1B 2ZG1A 4YGVA 2YQ3A 1XR9B 1SYVA 5IR1B 5F0MB 1BPVA 2DKMA 1CFTA 2W5PA 4PRHB 5EBLB 4KROB 4RIRB 4NM8H 2ZXEB 5K39A 4NKOB 1T1WA 3EO1A 4XCNB 5HD8D 2FEDD 3S2CA 3SQOH 2EDRA 3QJRB 1U8CB 5INCA 3W1ZA 5H2BB 2OA9A 5FHAH 5B4MD 1OM9A 3UTQB 1UXWA 4DEUA 4AY0A 5IESL 1IL1B 4N26A 1WV7T 3GXDA 2K8MA 4Q7DA 2IH3A 4BHUA 2M8XA 3MUUA 3N41B 3SGKA 4U3SA 3EJYD 2HVJB 4PJ8D 4DP0X 3HMWH 1NMAH 2OCJA 4PW3A 1A7PH 3HPLA 4TNVK 2XLLA 1EVUA 4NT6B 3I6LD 4Z7VB 3UZEC 4RGNC 1XH3B 1TZHA 5F72S 4DSYA 3BISA 4HC1A 4HIHA 4Y19B 2BSSA 4PVBA 1IVTA 4Y4HD 4QHLB 4TYUA 5BO1L 3BMVA 3CMGA 1E2VA 3VM5A 4QCIB 3KR3L 5FO8A 1CXLA 2CH8A 2W0PA 4NX0A 4E41B 2HT4C 5CBEB 3CK0L 4XTNA 4PVLA 3VXRE 1U93B 1U92B 5EU7C 1CU4L 1F6FB 5AZEH 2J55A 3NZ8A 4X4KA 1AYRA 2BWIA 3T65B 3ULVE 5KANI 4OCRL 4LSRH 4HHAA 5HPMB 3A6CH 2APWA 3O6MH 3VU2A 4D0BB 3HLKA 1UA6H 4QRBA 4PB9H 3SCMD 1VA9A 3P4OA 3OKNB 4EZLA 4BWTA 1ZT1A 3BH9A 3M8OL 2FO4A 4OGQC 5B3JE 3MRIB 2EDMA 3L3KB 5EEWA 1F8TH 2AEOA 3CIAA 4WW2A 3MV11 4GI8A 3QPKA 4Y5VB 3SDXA 4X4YA 3GIVB 2UZIH 4HH9A 5F44A 4YHNB 1FG2B 3WFEH 1GTNA 3ATAA 3GMLA 4FP8H 1U6AH 1XF3A 2X1QA 4A38A 1NDGB 5LNDA 2ZXDA 4OV6F 1JGEB 2DQCL 4HKJA 1OANA 3O0LA 4OLXL 4UTBH 4YO0B 5EN2A 3VFNB 1FG9C 4WUKL 3TH2T 3U9PL 4HIEA 5BS0A 1YDPA 1S7TA 3MV01 4L8DA 4XVTH 1UFUA 1F2QA 1W0YT 3F7VA 3T0EA 1QTSA 1CL7L 2P8PB 4ZG1A 5KTEH 3O41A 2HMID 3VXUD 3HZYA 2A6KB 3QRFM 4DN4H 1N3NB 2PTUA 5IVZB 3H53A 4AENB 3LMJH 5CGTA 5F9OH 5AX0A 1W72H 2GT9B 1TKWB 1AY1H 1QKZL 5I19H 4DO6A 2VXTL 1S5HA 3TJEL 2QADC 1DEDA 3CVIL 1FL5B 1Q8MA 3FOMB 1W15A 2HUHA 1JGIA 4LLUB 4IRZH 5D2LA 5DDHB 4OFKA 1MJJA 3JQOB 5AVYB 4F7MA 1JVOA 1C5DB 3OKLB 1TJIL 2DM7A 1HNYA 1UB5A 4MNHA 3NFSL 4X6DE 4B0MM 5BXFA 1OCRB 1ZPUA 3PRZA 4ODTH 1QZNA 3MBEC 5IJDC 4N5UA 1TQCC 4PJEF 5EZLA 4GMTH 3EZJB 1N5AB 3OE6A 2HVBA 4FKKA 4NQUA 4LCCA 3BWSA 3CX5K 3IU4L 1JF6A 2YMTA 5MERA 1AE6H 4XNQB 4WI0A 1B4RA 3LVTA 1C16B 5D93C 1P7QA 1P6FA 4OH2A 4YX2H 1U91B 1RKRA 3IDIB 3PAYA 5IBTL 5HGDB 4ONFL 1I1AC 3IDGB 4DP2X 1UZ6F 2G30A 3AM8C 4XX1E 2OAAA 3OKKB 4PRPA 5EUKA 1GRWA 3CSYB 3VDCA 4Z76B 2VQ4A 2RQEA 4JLRA 4WSGA 5GJTL 3FQXB 4QNPF 1NCBH 4ZXBB