3S3BB

Structure of thermus thermophilus cytochrome ba3 oxidase 240s after xe depressurization
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
source organism Thermus thermophilus
publication title Mobility of Xe atoms within the oxygen diffusion channel of cytochrome ba(3) oxidase.
pubmed doi rcsb
total genus 45
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s3bB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s3bB02
2J4YA 2PPCA 4BK5C 2GC4C 1L9SA 3AG2B 4DPAX 1CC3A 1AACA 5B1BB 2CBPA 5B7EA 4F7KA 9PCYA 3HARA 3PBLA 3AG4B 4AZUA 3T45A 2HXAA 1E5YA 3C75A 1Q5JA 1ET5A 3FS9A 1TN0A 1KBWA 5FJGA 1KDIA 1A65A 4E9TA 1AG6A 3FT0A 2CALA 3X3CA 5JJEA 2XWZA 4P5SA 1L9PA 1KCWA 1JGJA 2WO2B 4X32A 5AX0A 1NTDA 4UG2A 1S54A 2VW7A 4A2HA 2I20A 3VW7A 3L45A 4JHUA 2FQGA 3JTBA 5TGZA 2R7EB 1PY0A 1BEXA 3NJLA 2J5WA 5BR2A 3FU7A 5ANHA 1QKPA 2WSDA 2YAQA 3BQVA 2YQBA 3AG3B 3TA4D 3V9EA 1KG8A 2CUAA 3VI0A 1QM8A 2J57A 1OCZB 1EHKB 1LN6A 2XUWA 2QPEB 1ZDSA 5G36A 5H2KA 2GSMB 3DIVA 4DP2X 3CAPA 1TN5A 1WS7A 2FQFA 2JFCA 1UAZA 2QDVA 2VM4A 2XV0A 3QJQB 4AI7A 3ABLB 1KG9A 3WKQA 1M0KA 3DQBA 3FSAA 2M3GA 4FPDA 4G7QB 4JR8A 2HZHA 3HANA 4LDOA 2ZXWB 5AKRA 3FQ2A 3WG7B 2MRYA 4QIDA 1NINA 3QQXA 2VMJA 3RZEA 4KOCA 5ETZA 5G2AA 4X4KA 5TK2A 4DP8X 4TL3A 1X9UA 1H2SA 3NYKA 2HLEB 2EI4A 2EILB 2ZWNA 5LWEA 1GW0A 4X1HA 3ERXA 5B1JC 3REYA 4Q8BA 1ASOA 1KGBA 1SHXA 1NIDA 4DJHA 3OQRA 2UXTA 1PNCA 1JZGA 3SBQA 3ZDWA 3FYEB 1GUEA 5D4HA 3T6WA 3IN2A 3PAVA 3P0GA 1ZIAA 3UTYA 2PP9A 2XVBA 5F7AA 1HAWA 1N68A 1XB3A 1T5KA 2YAHA 5B6WA 1MG3C 4QI1A 1MGYA 2BZCA 4KNFA 2UXVA 1AOZA 4K5YA 3NY9A 5AHYA 5I6OA 2FQEA 3ZX1A 3ABWA 4IARA 2HX9A 7PCYA 2GI0A 2EIJB 2N0MA 1PNDA 3X3BA 2JXMA 1GY2A 1NIAA 1AZBA 3NSFA 1AQ8A 1NDTA 1I53A 3X1EA 3V2WA 3NSCA 2YAFA 1U19A 2YCZA 2DWSA 2IWFA 1DYZA 2FTAA 4BWTA 3EH3B 3TBCA 3OD3A 1X0K1 3QJUB 1ZPUA 2WJLA 2I7OA 4OV0A 2IDSA 4GP8B 1X0I1 4YSPA 4HIPA 4FA7B 3ZPRA 4P5RA 1URIA 5JJJA 2XV3A 2AT9A 1JV7A 5G54A 1OE3A 1RZQA 3FPXA 1EZLA 2KSYA 1SJMA 1L0MA 4BXVA 2RACA 5I6PA 2HX7A 3PXOA 3PPSA 1AIZA 1NWPA 2ZOOA 2BWDA 1IXFA 3RYMA 2GB2A 3UACA 1GU8A 1S8LA 4BUOA 1IUZA 3WKPA 1PXSA 3QDCA 4BV0A 3VGAA 3T71A 5I6LA 4WTQA 5D4IA 1BXAA 1FFTB 2DV6A 3X1BA 1OCOB 1S8JA 1O0AA 1TEFA 1OCRB 1TKWA 4L6RA 3NJJA 2PP7A 3NYAA 4JKVA 3NSYA 4HCGA 1J9SA 3OE8A 2NTUA 6PCYA 3MBVA 1E67A 5F8UA 3FSVA 4YSQA 3TBBA 4DP1X 3KJ6A 5B6VA 3QBKA 2XXFA 1SNRA 2YDOA 1QHJA 2BP0A 4DP7X 3QBLA 2BO0A 4A2EA 1XMEB 3ZBMA 4A2GA 4QLWA 3PCYA 3NJMA 5G2CA 2Y03A 4LDLA 2VW4A 1X0SA 5C1MA 4HZ1A 2CCWA 4YSEA 2A3TA 4BVNA 3HEIB 4YL4A 4L0PB 4N4YB 5I6KA 5J7AA 1HAUA 1PAZA 2Y00A 1M57B 3KW7A 4PXKA 5H2JA 3NJNA 4HAKA 4YSRA 1R84A 2IDUA 4JHVA 3QBIA 1PCSA 2IH8A 3MX0B 2W8CA 3ZPQA 3IBOA 4M3HA 5EHFA 1M0MA 3PAZA 2JKWA 3X1GA 1AAJA 1NZRA 5F7BA 2I85A 2R7EA 3A7KA 2YAMA 2IDTA 4YSOA 2RH1A 5DHHA 2TSBA 1PLBA 1BAWA 3FQ1A 4HCIA 5DYSA 1H68A 2FQDA 3CODA 3SQRA 5AFAA 1AZNA 2AZAA 3ABGA 2GC7C 1IKOP 2FT7A 2PPAA 4W9ZA 3QBGA 3ASNB 4M4RB 1X9RA 3WI9A 4DP6X 3FU7B 4GYBA 3HASA 3UZCA 4KOBA 1IBZA 4A4MA 3QAPA 1MZYA 1BXUA 3NJHA 3X1FA 1Q5IA 5AZDA 4YSSA 4KO7A 1N70A 3C9MA 2XXGA 1C8RA 3IEAA 4KNUA 2Q5BA 2NTWA 2VW6A 1CURA 1RZPA 2JAFA 4GRVA 4NB7A 1OE1A 4MFHA 2E86A 4DPCX 3SN6R 1KGYE 2I21A 4YSDA 4YVUA 2F93A 1BYOA 3UTVA 1CWQA 3NP3A 1DZEA 1ILUA 1JERA 1FWXA 1NICA 2UX7A 2TSAA 3OMAB 5B6ZA 4CSZA 1J5DA 1J5CA 1XB8A 1MDAA 4YSCA 3AG1B 1QKOA 2H5UA 2L6XA 3OMNB 4N8UA 4A67A 4EA3A 1VGOA 4FAAB 1KV7A 1B3IA 2HRGA 3DKHA 1FBBA 4N4WA 2DYRB 3D12B 4AX3A 8PAZA 1NPNA 1KCBA 1XIOA 3VHZA 4PXFA 5G2DA 1JOIA 1WA2X 2EIKB 3NSBA 3VVKA 2XV2A 3CG8A 4F2FA 3S8FB 2OV0A 2LNLA 4GP5B 1M9WA 4DAJA 2B08A 5B1JA 5LDUA 3UTWA 2G87A 3COCA 4JQ6A 2KSBA 3WIAA 3QJSB 3BVDB 3PWHA 2IH9A 3CVCA 3T6ZA 2B3IA 5BR5A 4DKLA 1DZ0A 3FYIB 1TEGA 1GSKA 4IAQA 4BWWA 5I5MA 2OJ1A 2J55A 5IY5B 2KS9A 4KO5A 3D4SA 4G7RB 5H2LA 4HHGA 4W1TA 4DP0X 4XTLA 1JZJA 1BQ5A 1KYAA 4UANA 1PLCA 5B1KA 1V10A 2IWEA 4GPOA 1V55B 2X88A 4MQSA 3UAEA 2R4RA 1JXGA 2BP8A 5PCYA 3CVDA 2UX6A 5B35A 3NJGA 2PPDA 2YCYA 2LLNA 1NIBA 5B7MA 2FNWA 4YSUA 2DYSB 1AZCA 1AZUA 3AM6A 1CUOA 1ASQA 1BXVA 2VSKB 3N55A 1S51A 3NY8A 1E0PA 3OAXA 2EIMB 1ID2A 1PZBA 2DY2A 4A68A 4E9XA 3QAKA 1SDDA 3NP4A 1SF3A 4ENZA 4YVNA 5B7FA 3HAPA 3EF4A 4E9WA 3S3CB 4HYXA 3VG9A 4G70B 3WNJA 5H2NA 3OM3B 2GBAA 5D4JA 1ZIBA 1L9TA 5I28A 4E9QA 3UADA 1ASPA 2Y69B 1JV6A 2YAEA 3S8GB 1SHWA 2PPEA 4BXSV 5G53A 2PP8A 1HZXA 2I35A 2J56A 3AZUA 3RFMA 2QPDB 3U25A 3NT0A 3ABKB 3PAUA 1OF0A 4GYCA 1QHQA 4QRYA 2H3XC 2I7SA 1A4BA 2XU9A 3KW8A 1IBYA 3SBRA 2VM3A 3CVBA 4KO9A 1NWOA 2YCXA 3AYNA 1IW9A 1XJIA 1F50A 1OE2A 3TU6A 4YSTA 2ZFEA 3UG9A 1JZIA 3ASOB 3OE6A 3NS0A 2CAKA 3T6VA 1GS6X 1A4CA 5A44A 1AS6A 2PEDA 5H2PA 1SDDB 2YAOA 4DP5X 1AT9A 2BWIA 2BP0B 3OE9A 1BM1A 1L9OA 4KNTA 4ZK8A 2BZ7A 3AYMA 1PZCA 4GXFA 1RKRA 1KMEA 1S53A 1JZEA 5A45A 2GHZA 1ETJA 4F2EA 5I5IA 3HAQA 5JJNA 1AP9A 2PPFA 4UAHA 5B2NA 4KLYA 4IB4A 4X31A 2FT8A 4AKPA 4DPBX 3PQRA 1C3WA 1W8EA 3UTXA 2BP8B 2Y01A 3FSWA 3S3DB 4MBSA 2MTAA 4L35A 5TK4A 5H2MA 1CYXA 1F4ZA 2X87A 5DHGA 5AWZA 1OCCB 4HCFA 4Q89A 1AR1B 4A2FA 5ITCA 2HX8A 3T9WA 1WS8A 1JZHA 1JFPA 4GP4B 1KDJA 2Z55A 4BWBA 1GY1A 1E12A 6PAZA 2ZONA 1F56A 3ZIYA 2BW4A 1AZRA 2PCYA 2XYBA 4A2DA 1M0LA 4E9VA 3QJRB 2JAGA 2W88A 4HYJA 4NAJA 4DP4X 1VLXA 1W6WA 4G7SB 4MD1A 2OCCB 3ODUA 2P80A 4LDEA 2KSAA 4PAZA 5I26A 1ET8A 5G28A 3V2YA 3EHBB 3DDLA 5B6XA 3V9CA 2QT6A 4KO6A 4FBZA 2FT6A 4DP9X 4G71B 2EINB 3NJKA 1PXRA 1IW6A 1GS7A 1VJMA 1J9RA 2WO3B 3N2JA 5EN0A 7PAZA 3UZAA 5A7EA 5H2OA 2NRDA 3UABA 5ITEA 3CDZB 1QNIA 1L9RA 3GDCA 5B0WA 1A3ZA 4HALA 1JVOA 3OMIB 3WNIA 2QDWA 2YARA 1MZZA 4EF3A 1BRRA 2UXGA 3IN0A 4UF7C 1JZFA 1BRXA 4QKTA 1E5ZA 2DWTA 3ZEVA 3PLYA 5FC9A 1E30A 3H4HA 2P80D 3PXLA 2IWKA 3TASA 4MQTA 3H4FA 2AZUA 5B6YA 1KBVA 1BYPA 1NIEA 2AANA 2AFNA 2YXWA 2H47C 2HPYA 4XXJA 3QJVB 1AG0A 1E65A 1SFDA 5AZUA 1JVLA 1P8HA 2YCWA 4WAVA 1PMYA 4E9RA 5KKHA 2Y02A 1WAEA 1PY6A 5AX1A 1A8ZA 1NPJA 1L9QA 5B3SB 1AS7A 1V54B 2BW5A 2FJSA 1S52A 1YLBB 4JKNA 1UATA 2WJKA 2Z73A 4E9YA 4RH4A 4EIYA 1QLEB 4A66A 4YSAA 4MD2A 3X2QB 3GXUB 2CJ3A 3PDSA 3NSDA 1P8UA 4AMIA 4HWLA 4Y9HA 2AVFA 2Q9OA 3IE9A 5E9NA 2Y04A 1P8IA 1SFHA 1F88A 1UCQA 3CZUB 3UONA 2VT4A 4WW3A 3FSZA 1CYWA 3FU8A 1XB6A 4AKOA 1A4AA 1AS8A 1ZV2A 4NC3A 1JXFA 4GY4A 3EH4B 2UXFA 3QPKA 2XX1A 1IC0A 3FPYA 1RCYA 2YDVA 3AY2A 4HHWA 1PZAA 2IAAC 4BWUA 1JXDA 4WKXA 4AMJA 3QJTB 2ZZLA 1WA1X 1NIFA 1R1CA 3UGEA 3HB3B 5B1AB 4J4QA 4BEZA 3MBWB 1GYCA 1GZMA 2XX0A 1ZDQA 3AW5A 3FU9A 4XTNA 1MG2C 4K9JA 1J9TA 4UHRA 4AKQA 1ET7A 2HRHA 3WQJA 3C9LA 1ADWA 2IDFA 5I6MA 3DTUB 5I5JA 1TU2A 1WA0X 4G72B 1PF3A 3NJIA 4E9SA 1AANA 2R4SA 4CSPA 3EMLA 4KNSA 1OV8A 1ILSA 3T6XA 1M56B 2VSMB 3SBPA 3OE0A 4GBRA 3FQYA 2I1XA 1GR7A 4XT1A 5B34A 5H2IA 1GS8A 3G5WA 1OOWA 5A8EA 3CDZA 2PLTA 4BEYA 2YAPA 3S3BB 3ABMB 2BHFA 3NJFA 1PLAA 3GYRA 4BDVA 2XLLA 1FA4A 2BRDA 2X72A 5H2HA 2VN3A 1HFUA 1BQRA 1C8SA 3JT2A 4XT3A 4PCYA 1R2NA 2FWLB 2GIMA 2F95A 2IDQA 1BRDA 1L9HA 4EJ4A 3H56A 4NERA 3X1NA 5I6NA 2PCFA 1SF5A 3HAOA 4BDVB 4N6HA 5PAZA 2YXVA 3EH5B 1BQKA 4XTOA 1W6LA 4TXVB 3UAAA 1FBKA 1J9QA 2ZIYA 5AHZA 2Y1AA
chains in the Genus database with same CATH superfamily
1DQQB 3RHWK 4G8EA 1JK9B 2AEWA 2FAUA 4JJ5B 3WIIH 2VMEA 4LLAA 4U0RC 1OGPA 4JO1H 4PGDB 3HFML 3KWXA 3WHXA 4CKVX 1G94A 1SZNA 4F1SA 2CZNA 1FH2A 5ALBH 2DYPA 1JHTB 1RJCA 5HY9A 1M6UA 3DHJA 5AB0A 3FONA 2YO3A 4YDKL 2YMOA 3HG3A 2CKBA 3P77A 1OSZB 2Y36H 1P0SE 3O11A 3MAWA 2ED8A 3DGCR 2NY5C 3IJEB 4ZAKD 5L9DH 4LE8A 1AQKL 3FN9A 3QO0B 2I20A 1Y6MR 4TQPA 2BS71 2NMSA 1I8LA 2Q8BH 3S98A 5IKCA 3TA4D 3D3VA 1CIDA 2IQAA 4NKDB 4BZ2A 2A9NL 2XSKA 3VI4A 3V5KB 3HKFA 4PV1C 5EOCH 1L4IA 4NZDA 3H2PA 2XN9A 2FGZA 3CAPA 2KLSA 4JRYB 2B1OA 4EZKA 5C97A 3UP1A 4N0FA 3SYAA 3APNA 4AEFA 2M3GA 4U0QB 4G7QB 2HYMA 4NWUL 3D9AH 2YS4A 1EDHA 4LEOA 2DM3A 2A6DB 5DFAA 4NIYE 5IVZB 3O9WD 3WNPA 3NACH 3D0LB 5F21B 4GRWH 5JW4Q 1IVLA 1R75A 3UOAB 1E9OA 4Q8BA 4PVMA 4DJHA 3WIHL 5E51A 4CDGC 4XNMB 5C70A 4GG8A 3CZFA 3MBXH 1DVZA 5ITFA 3ZY7A 3QEQE 4K15A 4NO2B 4TLSA 5SWZB 4AY0A 2AV1B 1MG3C 2D3JA 2IMMA 4J8QA 1S9YA 3M1CA 4JN1L 5IBUG 2CO2A 4QRTA 3LQAH 1QBAA 2F54D 5JYMA 1NIAA 5BZWA 5I1GL 5H4ZA 2BVOB 3BSZH 4BFBD 3JZ7A 3F6JA 1MRCH 4EO5A 1HIML 2LQRA 3WTXA 1QR1B 3ECWA 1DBAL 3UFIA 2R39A 1CLCA 2DJUA 4YSPA 1OAYL 2JCCF 3AAZB 5DT1H 3V9EA 1U8NB 3P0YL 1QWUA 2XG4B 1SJMA 1JFQL 3Q2LA 4LCCC 4ERSL 2RACA 4OAWB 2R1YA 5I6PA 3TT1H 3CDYA 5E2WH 1H0DB 1PKQA 2LVCA 3MUUA 2BSED 1IGFH 3P0VL 4IDJH 4TSCH 3MV7A 3HCVA 1E4WL 1BVKA 2F15A 2QQQA 4N2EA 3ZHKA 1E27B 1P4BL 3KZ8A 4M7JL 1EEZB 3S3JA 5DHMC 1H8OA 4NJ9H 2W0KA 1YEKL 2VDLH 1YAZA 4GRWB 4WKZA 2YWYA 2WQRA 5I9QB 1UOWA 1J9SA 3LRKA 3PHQA 1RULL 3DTXB 3HG5A 4FXTA 2XXFA 2VRKA 1F3JB 2B2XL 3QEHB 1MVUB 3C60D 1F45A 5JO5A 3B3BA 3J07A 1BGXH 3VFOA 4NXSA 5DEGA 1YEIL 1J1XL 3GMLA 1MHPL 5GRUH 1P4UA 5DD1H 1E9QB 1G5AA 1RH8A 5EU3A 4XBGB 3H3BC 3HEIB 1RP8A 4U1HB 1CFVH 1KELL 1PAZA 3AXHA 4PV9B 4HAKA 3NJNA 1NFDE 1IAIH 2DW5A 4IRSC 2E74C 2WLZA 2JJTA 4YSRA 1IFHL 1P7QB 2X2UA 3HAEB 3SDXA 3US9A 3V9FA 1T20A 3WN5C 5C0DB 1J8RA 3W2DH 1U8KB 4RA3A 4S1RH 5DHHA 4YLBA 1H68A 4PWIA 5D7HA 4FI8A 2H1LM 5IMLB 1TPXB 1P7QD 3GSWA 1F42A 4PREA 1OL0A 3L3GA 2RQEA 1QSFB 3KPRE 1IBFA 2OMXA 3SQBB 3HJ0A 3NFSL 4EOWL 4DP6X 1TVHA 3QG6A 4K5NA 1DVUA 3FCTB 3MJ6A 1Q9OB 1CFSB 4TL5A 2NY7L 1NAMA 3ARBA 4ZOEA 3W3BA 2YGQA 3VGAB 4YHLL 2X0VA 3NJHA 3RPBA 4Y2LA 4WUKL 1EVUA 2FJHA 3NIFF 4FX5A 4Z77B 4MMYA 1BFOA 1EHLL 1P84J 3WL9A 1T2JA 3ARRA 3FUKA 4HOZA 4YC2B 2DQUH 5L8JB 5LQBL 2CO4A 4NQUA 1WAAE 1G5GA 3VGEA 2R0LL 4G9FA 4KFMA 4OGQC 3NCYP 4Y5YC 3X12A 4U0RB 3GSUB 3PWUB 4KJQD 3OKEA 3D3VE 1MWOA 5CR1A 3ZGHA 5CBAB 4P9HC 1QYGL 4NZUH 1PX8A 4A67A 2WIIB 4UQ2A 3ZTDC 1K6QL 2K6YA 2NSMA 5K59E 5AEAA 5DR5H 4X6DA 3R06A 4RFEB 3LKPB 4LASL 2TRYA 3PHSA 1NSNH 3AS3A 1LO0H 1X44A 1E0OB 3SPJA 4UIMB 1NBYA 1IM9D 1S7QB 1K8IB 4MXVF 3JTTA 5BR5A 4HULB 4Q6IA 5EZJA 3TEYA 1EEYA 4KDTC 5ID0A 2A73A 1T80A 3TA3D 3AQYA 5F72S 5A2LH 5IY5B 5I1CL 2DD8H 1IE5A 2P45B 1YY8A 1R3JB 2GTWB 3FFOA 5JOPE 2AK4D 4F9LA 3O3AB 2OP4H 3D39A 1CFNB 1Z9SB 3QQ4B 4GQPH 4HS8L 2CO3A 2GAZB 1TETL 4WI7A 4MQSA 4NQVB 2Q3XA 4XWOD 4QJ5B 3HC3L 1AO7E 5B7MA 2XFGB 4HCRH 2DYSB 1AZCA 3ARTA 4LHUD 3S37X 2HJFB 2F7QA 5DMIH 3S35L 4EN3C 4Q6YA 4RGOL 4LHJB 1WLHA 5JMOC 1AQDB 4RCAA 4IOFD 5JHLH 5L2KB 2GJZB 3GIZH 4W4NA 4QHNB 1HESA 5TDNA 3GS4A 2L7EA 5K9OA 4XAWH 2EZ0C 2HG5B 3OAZK 4MYWB 1GGBL 2NY5H 4G70B 2ISDA 1YYLL 4BFIA 4CNIA 1OD9A 4PYHA 4WAFA 4ZOAA 5DFWH 3W9DB 3I84A 4K94L 4HT1H 4TSAH 1KN4L 4M7KL 2Y7OA 4P5TC 2CJUL 1BD2E 1KCVL 2VXUL 3E3QE 3PIQB 5AYQA 1VF5C 3CAFA 1UCBH 4X98A 3T4YB 3KS0H 4FTVD 3LIZL 2NR6D 3SD5A 2XPZA 3QRFM 1VGEH 3SDXF 1ZS8B 2C5DC 1DLHA 4L3EA 4OCSH 2XU9A 1A4BA 1ND0B 3ZE2B 1E2VA 3V0AC 3ZE0B 1CJYA 5IB4B 5IMKB 1HHHB 4YSTA 3HG2A 1O6SB 4JM0A 3REWB 3PHOA 3GSNH 2QVKA 3WSQH 5HYJB 3RVXD 2OK0H 1MCRA 1NKRA 4MWFB 3BVVA 1J8HB 4P2OA 3KBEA 4KVCL 4PW3A 1LE5B 3QNYA 3CBJB 3V4PA 4M1CC 1WPCA 3LEXB 1L5GB 4YGVB 5JJNA 5CU9A 4DPBX 4Q2ZB 4YGAB 4HK0B 4ZMAT 3HZVA 4OGYH 4UQ2B 5TH2B 2IGTA 4JKMA 2VDOH 1MNUL 3RNQB 3TN0C 4FRWA 5ISZA 3WKMH 4N3UA 1J10A 4RDQF 4FKKA 3VWJD 2ENJA 1CFQA 4AOFA 1KDJA 5CO1A 1BLNB 4NUJB 4K8RC 1SVBA 3LZPA 3TO2B 2QR0A 3FUIA 2P8PB 3IJSB 2XZAL 1OARL 1VLXA 1BV8A 1RHHB 2VDRL 4AVHA 2N59A 5DWUL 3RA7L 2VXTL 4PAZA 4PRHE 4AZ8B 2FL5B 3DDLA 1YUHA 3EYUL 2VCOA 4JBSA 4U3CA 5D6CB 5C0IA 4L9LC 1QI4A 3FO0L 5DJ0B 5DS8A 1VJMA 4X6FA 3QUZA 3I6KB 1S7SB 1F4XH 1ZEAL 1NC4A 5HHQB 5IM7A 1JNNH 2E6PA 4NZ8A 3VXUD 6FABL 5D7SH 1KPUA 2XETA 4XP6L 2EUWA 1TXKA 5GGRY 3L95B 4WWKC 3KLQA 5J7CC 3CLWA 5SWSE 1Q1JL 1DJWA 4LBEA 3BSGA 2P80D 2DH3A 2AV1A 3TASA 3QXAB 4GKOA 4UTAL 4L3CA 3OB0H 5HTSA 2ZP8A 3AS2A 1H3VA 2AJVL 1DSFL 3CVHH 1UXMA 3C5ZD 5AZUA 1SYSB 2E9BA 2EYRA 3IYLW 1P9MA 4Y19D 3FF7A 3IKCB 1K4CA 5CSZB 4J6RL 3SKUD 1X4YA 4YBQC 4G6FB 1A7NL 1ZKAA 1LO5B 4A66A 4G1MA 5L0QB 1HZLA 4I2XA 3RIFK 5D5ME 4AMIA 1JAEA 4HWLA 4Q56A 2Y04A 4DVBA 1B6UA 3X3GH 4G3YL 4QRRD 3BPOC 3B2PA 1KJ2L 4IU2A 1DE4A 5AWNH 1X5ZA 1XGYL 5BQ7B 2P1YA 3FSZA 2WD0A 3GB7B 2Y2WA 2YD3A 3D2UA 3EJPA 3U79A 3CN0A 5A1AA 3MV11 1MY5A 2VDKL 2ZE0A 1VADA 5IW1A 4OUUA 3ZDZB 1OAQH 3I9GL 2GITA 3B5HA 2PWDA 4JO1L 1NIFA 1UHVA 2WBJD 3GMPB 4FYTA 4IBVA 1MUJB 3MJGX 1M53A 5HDQH 4L23A 5L6YH 1YA5A 3V52H 4DZ8B 5A2CA 4M8UA 4R5TA 1JHLH 3WHE0 4GBXD 1NBQA 3BE1H 3KLAB 4S10A 1EHNA 1JK8A 4LLUB 5FYJU 1WA0X 4QOKA 5C0EB 2ARWA 2MPVA 1EXUA 5BVPH 1GCFA 4XXCA 1OP5K 2PCXA 2GK2A 1KLGA 4KRPB 3CSYA 2EE0A 1NAMH 1IZJA 1Z9NA 1YMHB 4PJDE 5BZWB 5D1ZA 2Q87A 2DS4A 1JYNA 5C0JB 1I7ZB 1W0VB 5MEPA 1DLFH 3NTCH 3RTQB 3WJLA 1VIWA 4PWKA 5I1IL 5HHME 4UM9D 4I85A 4LP4A 4KUCF 3X1NA 2WSPA 2A9ML 1I3GL 4JRXE 2ZUSA 1N0XH 4XN2A 3HZMA 3EFOA 2OS7A 2ICEA 3EH5B 1HQ4B 2AAVA 3ARDA 3GJFH 1KC5L 5T1KA 4FLRA 5HI4C 1IGMH 4Z8FL 1UYWL 1ZT1A 1TZIB 4MD5A 2GIYA 1R3HB 2Y3NA 3E8UH 4DK3A 4G8FA 2IF7A 3HUJF 1JJUA 1GAFL 4PJEF 5D7IA 1ZLSH 4O5LL 5DC9B 3CDCA 2VDPL 1L7IH 3MOQA 4IKNA 4QXGH 3TZVD 2J44A 3V0WL 1AG6A 1G7IA 3X3CA 4WZ9A 5F7LB 1XR9B 4JFSA 3LN5A 4P5SA 3CDGA 1RK1B 2QHLA 5TDPB 5E6IA 1IKNA 3N91A 2HFGH 5KS9E 3WXVH 2L7QA 3FHQA 3C87A 4Y19B 8FABA 4WK0B 2Q3AA 1PG7H 3BPCB 1AQDA 1FLRL 4WSJA 1T5XA 3QZNA 1VZHA 4G82A 2HJFA 3UTZA 1ECZA 1ZT4B 5MENE 5DRNA 2PUQT 3UYRL 3UJIL 4WI5A 1LEIA 4UT9L 4ERSH 3KXFA 1MCOH 2C9VA 1HJBC 3EGXA 2J12B 1T2QL 2VLKD 4HWEL 5TQ2H 4NCDA 5FW6A 2RMNA 3H85A 4XMPH 1I85C 5IHZA 5IB2A 2EI4A 3DSFL 1J5OH 4AQEA 3G6AA 4NHUA 1XH1A 3KLDA 1IGCL 2NNFA 1JG9A 5C2BL 3VQ1C 2XICA 3ULUD 3F85A 4QXVA 3BOVA 4Q6IB 4X6DE 5EZJB 3ULAB 1P53A 5D71L 1V05A 4A6YA 3VM7A 4BE5A 2J4WL 2VLLB 4RZCB 2PCFB 4LSDA 2YKKA 5D6CA 5E2UH 5DO2D 2Q2LA 4TQHA 2WXKA 2ORBH 5B22A 4PLJC 4IBLT 1FSKB 3UJJL 2V2XB 2MCG1 3KAAA 4Y5YA 2EVGA 3PU7A 2F19L 2MOGA 4NQEE 3HJEA 1P4IH 1T7ZA 2NNAB 4MNGB 4Q0XH 3T6QC 2JTDA 2WBXA 3EOYG 3NSCA 1TLMA 3QPXL 4FNLH 4G7YL 4JQXA 4APQB 1CGTA 3GMOA 4RMSA 4JANB 1TVBB 1TVBA 2AK1L 4PBDA 2X4TA 1TZ8A 5F9WB 3G5VA 5F0JB 2DQCL 5CINL 5GHWL 2D3LA 3U9PH 1ZANL 2J1KA 3UC2A 5I76B 3K8KA 1LO4H 2D7QA 3WFEL 1GU8A 5FGCE 5BXFB 4BV0A 2YGOA 4PJXE 3G5ZA 4K7FB 3ULVL 1E5AA 4MS8D 2CG9X 3F12B 3R06B 1S8JA 1O0AA 4LPWA 4BA0A 1UM6H 3MO1A 1X7QB 4YHLH 3MRNA 3PHOB 4U3HA 3BWSA 3PWLA 5KVGL 1GZPB 3SE8H 4AVKA 3LPPA 3APCA 3HBZA 3WDJA 2DOCA 2WQUA 5JHDB 4RMTA 3RI5K 2YDOA 2ITDB 3N1MC 1A5FL 1DVTA 1VGKB 1AZZC 1YCSA 4LLUA 2Q3ZA 1SOSA 2Y6SD 1E4KA 5G2CA 1OXYA 5GSVA 2EE2A 5GGTA 2VW4A 1WZKA 2JCWA 4GSQA 1QW8A 1RHFA 3CK0H 1BECA 5AG8A 4D9QE 3L7FB 5MHSD 1CI3M 4P99A 2PW1A 4ANVA 4FQIL 4NZUL 3ZVVA 1VPOH 2J5LC 1FO0H 5DRNB 1XF5A 3GSXA 1GZQB 2I07B 4IW4C 3FRPG 4MQ7A 3EJRA 3ZKND 1PG7X 3TH2T 4DZBA 1LVEA 2VC2H 4NHCL 5CSBA 4JM2F 1NZRA 5E5MA 2AEPH 4Y4KD 4HLJA 5C0BA 3VSQA 4M61A 4HCIA 4Q9QH 1NSNL 5DYSA 4AT6A 1ZMYA 1WAPA 4GAFB 1G7LB 4RFNB 5INDB 4WCYL 2WBJC 1FNSL 4O4YL 2DKSA 3MKGA 3V7AG 4DGIL 4NUGH 1QABA 3QWQB 4EUPA 2JV6A 1F4WH 3C8DA 4JY6A 2E9WA 1X7SA 2O5YL 4LB8A 3JV6A 1M7DB 2E6QA 1U8MB 1XZWA 2BP3A 2OR9H 1O6VA 5EBMB 1GGCL 3WENA 1CF1A 5T5FA 1ZHLB 3GRGA 1KSRA 4M6OL 1BVKB 3HCVB 2R51A 2W60A 5F7UA 3DBSA 4ESKA 5CILL 2XIDA 3ILEA 2WAQA 3QK0A 4ZD3H 3CZNA 2RQ8A 5J0BA 4OBSA 1XF3B 1ZVSA 2I21A 2FBOJ 1NBYB 2F93A 1DBJH 5C0FB 4HVBA 5GZOD 3PDOA 4HUXB 3P40A 1BHGA 2A6IA 3KDPB 3OMAB 1RK0A 4M62H 2Y5EA 3VXUB 5BOPA 1QKOA 2XZQL 5J6GB 1FZOA 4XAWL 4GUPB 1O7DE 1BJMA 4H0HB 1A7BA 2BVPB 4JRFA 5LGJA 1IFGA 4Q97A 4I1RA 1IC1A 3RY5A 1ZA3B 4AYDC 2V5TA 5CU5A 4PGCA 3HE7A 1YQ2A 2WOBA 4HIXH 3Q2WA 2XV2A 1OAJA 4OGAD 1RSYA 2ZP9A 1WFNA 4EN2A 1ZA6A 2GBVA 3MV01 1W0VA 2CGRH 2QSVA 1FVEA 3LH2H 1MCEA 1TEGA 4C55A 3D87B 3HPLA 2WYZA 3QW9A 4R3SB 3UDWA 5E1AB 4PRIA 5ERWA 2PMZA 5FKPB 3HG1B 4R8WH 3OWEA 4G6ML 2VJXA 4UQIM 1IBGL 2ZCZA 2EDJA 3KVQA 2G5RA 4P9HH 4ZBJA 3B7TA 1TVHB 3QG6B 2M83A 2R4RA 5AL8A 1WFUA 3BP7B 4D9RE 1MDTA 3BCDA 1LILA 3K6FA 2PPDA 2YKLL 4GW4B 2XTSA 2GUYA 1E4XL 1OAUH 4PLOB 4OKDA 4PRDB 4IKIA 4YSUA 3VWJC 3AM6A 1OAKL 3VQLA 1C08B 1FBIH 5JUEL 3POHA 2CLVB 4HH9B 4AIZB 1A6UH 1XH0A 1S51A 4S0TD 3TN0D 2MQ0A 3ZQ9A 5EU5B 4PVBA 5E95B 3FT1A 1SDDA 2DWEB 3DLQR 4QHMA 3TO4C 4OV5A 1BF5A 2CLZA 3MX0A 3D8MA 2YFNA 3WBDA 1OSPH 5I75B 1JZ4A 3AVEA 4LQFH 5BOZG 3VYPA 1WZ1H 3O11B 3UTTB 3UPRA 4M1CD 1IM3A 1L9TA 2AGJH 1UT9A 4X50A 1SDAB 3VTMA 5KYYA 2FBJL 1RERA 2X0UA 2YAEA 4LP8A 2IAMB 2DKMA 1XXDC 2H2PD 3OXRA 2W65B 2JIXA 4N1CA 1T83C 1AY1L 3JYBA 4X5QA 4S2SA 2GHWB 1CGUA 4HJ0C 4OCYH 1QRNA 4KHXL 3U1PA 4JCMA 4OZFG 1G7MA 2Y24A 2EC9U 2CRZA 3F5WB 3DSNB 3WTUA 2IPTH 4FTDA 1QPXA 1KYUA 5DD0L 1NGXB 2W81C 1KGCE 4NT6A 5ADPH 1UZ8A 1DFBL 4AUUA 1XSOA 4ZTEA 3DYMA 3NRQA 5DJ2B 3R7QA 1L9OA 4E41D 2FYVA 3S4SG 2BVUA 1T22A 1QFWH 1JPTL 3ZKXB 5AVYB 3VFVB 2OA9A 5IJBC 2FT8A 3FB5B 3BIBX 4PV8B 1FNFA 1NC4B 5IM7B 5HHQA 1AQKH 1JS4A 1CDYA 4WLCA 5KBPA 1W8OA 4BE6A 3KJ6H 4NQTA 4PY8I 5CJ5A 4NDMB 5F2FA 5AWZA 3AMKA 2WVUA 3V0JA 4JJ5A 2QQKL 4A2FA 3B7YA 5B39B 1XSJA 3SPGA 4M7ZB 5DFVC 4QTFA 2VZUA 2DF3A 2ZONA 4KQ0A 4AYGA 4A04A 3B83A 2BIPA 3ZE2E 4ZW8A 3WN5B 1BVNT 1U58A 2JAGA 3L81A 3L9YA 1X5XA 3LZNA 2ADJB 3KPMA 3F7VA 1Q4NX 3MBEC 4R2GD 1MJ8H 3MLYL 2NXYB 4MRBA 3VI3B 4U1LB 5I1LA 2WQWA 3KNBA 4QHLB 2APFA 4F92B 2DI8A 4PGJA 5D4QA 3N2JA 3CX5K 3OZ9H 1SBSH 3NZHH 3B8SA 4L37A 3MBXL 3M6DA 2Q76B 1H6UA 3VGHA 3QCTL 2FH6A 5FCUL 4QAMB 5E03A 5F71A 2QSCH 4JREB 1XEUA 2ZUVA 1T3FA 3R18A 2DQEH 4MJID 2N7AA 5FFGA 5IEKB 3IN0A 1KGXA 4QKTA 1E5ZA 4IIQB 1CGXA 5LO7A 2AQPA 2GJ6D 12E8H 4HJ0D 3PDOB 3Q3GA 2DL9A 3EYOB 4KUCD 1QG3A 3Q2VA 1ZSHA 1ZVSB 5I75C 5AZ2L 4XN4A 2HPYA 1G0XA 4XXJA 1CF8H 1IMHC 3H7LA 4O2FB 3IMWA 1LM8V 4DEPC 3A0OA 1NPJA 3MJ7B 3NAAH 5E1GA 5AB9A 2V4LA 3BMVA 2YBGA 3ZO0A 1YLBB 3NCYS 1SN5A 4E9YA 3MRLA 4KJPC 4ZYKB 2XHNA 5KSAD 1KEML 2JVUA 1BFTA 2J8UE 5E8OB 3TT1L 4GMSL 3BZEB 3QUHA 1QSEA 4L5FL 5E9NA 5KN5A 3T09A 4J3UA 1CXIA 4YXKL 3L5XH 3CZUB 3L7EA 4LNRA 4YHOH 5GGTH 1SOXA 1MLCA 4PW4A 4DGVH 5C2UB 4DNLA 3E8VA 4NN5B 4YWGH 5C0BB 1FHNA 1E40A 5HHMD 2BOCA 1P5VB 3CVHB 3CIAA 2VO5A 4XNQB 5G5DA 3S37L 5ESVA 1HEJC 1NCWH 2XN9D 4LCVA 5BMFH 1PZAA 3GKWH 4ZX6A 1IC7L 4AQOA 2CUHA 1LDPL 2B1AH 3HMWL 3WEMA 4HAGA 4I9WE 3P1VA 1CLYL 3C2AL 3GS7A 3M46A 4X5XA 1YC8A 4MJHA 1GYCA 1GCYA 1OKEA 4OJDH 3BAKA 5JOFB 3CE1A 4LDLB 1PCXA 4E9LA 4X4YB 5FEBA 4IOSD 5IWLC 1DZBA 4WHYH 4ZW5A 4XX1G 4F8PA 3L1OL 4H8WC 3GZOA 4BKTC 3PGDA 3CPLA 3D1MC 5J11B 2DKUA 4XRCB 1BZQK 1F1GA 5AKSA 5EPMB 3N1FC 3UIYA 4GAJH 4IRJB 1BBDH 1UKQA 3UPCA 4F9PC 4JDTH 3HVNA 3TJHD 3S2CA 4KRLB 2BHFA 3V0VA 4F7EA 3TIDB 3FUDA 2KC0A 2X4UA 4UT9H 1WD8A 1MF2H 2A6IB 5DVLA 1SF5A 3IVKA 1OOAA 1AGEB 4JFFA 4N6HA 1VACA 2ZSVB 5IROC 5LNGA 4G1EB 4AJYV 2WBWB 1M2OA 1BQKA 2DIBA 2F8OA 2EACA 3SGEH 2YPKB 3ZYJA 3WNKA 1KCUH 4XVOA 2ADGB 4HUVA 1AGCA 2Z7WA 1IC4H 2DMCA 1AACA 9PCYA 1ERNA 1WH0A 3DMMA 4CVXB 2HT2C 5C09D 1SJEB 4WW2F 3T45A 1E5YA 5IB3A 3QISA 4IMLA 4IRSB 3EDDA 4AE1A 1YEHL 3FTVA 3NRFA 3U1SH 1KDIA 2OMXB 4E9TA 2Y2TA 1I3RA 3MFFA 4Y2DD 5LQBH 1YSOA 3LB6C 4MNQA 4TPRH 5T1DL 4JVUA 3MLVH 3P4NB 4EIUA 1CE1L 5EUKB 1OGAB 5JHMA 4XX5A 1EGJL 1S54A 3JV0A 3QQDB 1HCFX 1MCPH 4FZEL 4GI9A 3EJCA 3SOTA 4Q0XL 4FNTA 3ULUF 3VE0A 3VE0B 2WSDA 4NO2A 4XVJL 3T2QA 1RIUH 5HI3D 1F6AA 4KROC 4UTCA 4WEMB 3K6SA 4GG8B 5JPMB 2QPEB 2D0FA 5H2KA 1XSIA 3L3GB 1TN5A 2XV0A 3O2VH 1S9WB 2HKHH 3CXHK 1FH5H 3OKMA 2D03L 1YNKL 2BNRD 5EU7E 3ARFC 5FO7A 1EMTL 5FS5A 1ZANH 2OI9C 4DFIA 4P4RB 2MRYA 3VH8B 2ICWB 3B9VA 5TK2A 1KEGH 15C8H 1HXMA 4WEBH 4BH8A 1KJMB 1KMGA 3TIEA 4W9EC 1GW0A 3RVUC 3GSOA 5F96L 3LNGA 4PS4L 1FNGA 1OSYA 1WUNT 1NIDA 1XL4A 4QAWA 4X4ME 5A2JH 1RY7B 1JZGA 4R83A 4YR6A 3WKYA 3QHFL 4L1LA 5F0MB 2X1QA 2P48B 2CHNA 3NUKA 3PL6A 1FYTE 3G08A 1DVSA 4I3SL 4X8JA 1ZHKB 3VFSB 3HC3H 2ZNWA 3D07A 4TQ8A 1TZOA 4QKXB 4LARH 2WK2A 2E9GA 3S35H 4LL9A 3V0VB 3HS0B 4QWWD 3QDGA 5EEUA 1S7WA 1KCLA 3TO4D 1RFDL 3ARGC 3SDDB 2ZXCA 1P1ZB 3DGGB 1IC5L 3WFBH 1FO0L 1KJVA 1ZAGA 4EVNB 4GRWE 3P3TA 1YYLH 5GS2D 2BCKB 2X6BA 1AKJD 2Y25A 4I0PB 3BWAB 4KJYB 5GPRA 7FABL 4F5CE 4U31A 4HOWA 4JFYA 1KCVH 4M5YH 3CZEA 3QZPA 2UVFA 5AOMA 2WN3A 1QKZL 2J25A 3DVGA 4ACTA 2D7MA 4GXVH 5DA4A 3X11A 1PXSA 2XRAH 4K3GA 5I6LA 5TE4L 2ATKB 4NNYB 1ZHBA 1JXJA 1YN7A 2H3NB 3H0TB 1BAFH 2OI9B 1SXNA 3WLWC 4OZGE 2APWA 3CC5A 3L9RA 4HFUL 4KHTL 4LAJH 3IJ8A 4J3XA 4NQEB 1HINH 4NHUB 3KJ6A 2WWOA 4WNQB 2X6VA 2A38A 2FK9A 2VXVL 4KROB 2K4AA 1AE6L 3FOMA 4WW2A 3V2AR 5GGUA 4JVWA 5HHVH 4G6FD 5L4MA 1G0YR 3N1PC 1P69B 2W07B 4JM2D 1J9CT 3DV4A 4HHAB 4N4YB 1LWHA 1YNTB 4XMUA 5T33L 2WTRA 3MLRH 3WKML 4ZZKA 4WI0A 2R0ZH 3HNSL 3MC0A 2G4EA 3GIVB 1JSYA 3S36X 5SX5K 3ZPQA 4CAGA 5M94B 2OL3B 3P2BA 5DTFB 3AU1B 4QHMB 3DC0A 5EBLB 4YSOA 1DN0B 4HAFA 3FQ1A 1AHKA 1NFIA 4UWQB 2EXWC 1G7HA 2F58H 3ECBB 1AZNA 2VLKB 2PABA 4L29A 2Z6FA 4PJAA 5I16B 1BX2B 1KB5H 2NX5E 3RA7H 2VXTH 1IKOP 1T0OA 2CGRL 2VLMD 3IU4H 1DQJB 3ARUA 3EYUH 4M4RB 3S5LB 3D3VB 4WO0A 4HZLB 4L0ZA 2UV3A 4YJZL 1S7XA 1KLFA 5J13C 2ZCHL 1TUPA 4A4MA 3HB3C 3WEAA 4KK9C 5D7IB 4GSXA 4JUSA 2Q7YA 4YSSA 4QXTA 1TZIA 4MD5B 2Z8SA 2NZIA 1RZPA 4HIEA 3RX8A 4FABL 3HNVH 4JZOB 3SN6R 1KGYE 1NGWA 2E9IA 4QNPF 2EDMA 3UTVA 1U8HB 2Z31C 5I5RA 1NICA 4PRBB 5HVFB 3HG1A 2KLRA 5B6ZA 1J5CA 2F08A 1VRSA 2IGLA 3RWJA 1MDAA 3KPTA 2X3CA 1U3HA 4AGOA 4JFHD 2CCLA 3BH8A 4ZTOL 4X9HA 5K1NA 4BKLB 5EZIH 2KYIA 2W91A 3OPZH 3B2DC 5DJDA 4OF5A 5A40E 1FBBA 1J8KA 5HYSA 5SX4H 2BJMH 2K9FB 4A7UA 1WZ1L 1BMWA 2WXQA 2YWZA 4EI5C 2ID5A 3D4GA 3FRUA 3RWGB 2ATKA 4NNYA 4QD2E 4C56D 4JFUA 1JMXA 1DEEA 3NOIA 3RL1B 3V4PL 5F9AC 3D08A 4PGBB 5HI5D 5E99H 2JKRM 3US1A 1JDCA 4ZX4A 3PXHA 5HPMB 3QC6X 2IMNA 4IAQA 2ZT9C 5KSVA 2J8UA 3TO4B 5ACMA 3AU0A 3HOGA 3WIHH 3VD1A 1K5NB 3SCMC 3DVNB 4MJIA 3IMSA 4P59H 2Z34A 3RNQA 1MFEL 1GOGA 4JY6B 1H3WM 2BP8A 4F24A 1QSVA 4B0MM 2V9TA 2HLAB 3WAJA 2FD6H 3II2A 3RDJA 1UWEH 4MJ4A 2W60B 1CUOA 4YXHL 5EBLA 1CDGA 3A21A 3IDNB 2FX9H 4WFGD 4W93A 5I17A 4EBQH 1OTSC 1O6SA 1K3IA 4EI0A 2CKBB 1QNZL 5BPPA 5DT1L 3SYCA 1AJ7H 1MFDH 4JGUA 5DA0B 4AGPA 4CMMA 4E9QA 3VFUB 3FQRA 3I6LD 3C5ZC 5I28A 4C58B 3AQXA 3ZLQC 1KPRB 5FA4A 4Y9BA 2XBTA 2PP8A 1UZ6E 1AD9B 2VIRB 3OBAA 2GIXA 1MFNA 5HGHB 4LBEB 1QHQA 3BW9B 4U6HB 1XF5B 3GSXB 5IHUH 5TF1H 4FF9A 2WNGA 4WWKD 3HLAA 3N44B 1GKOA 3ZL4L 3QNZB 4LAQL 1IW9A 3EOAA 2VDLL 4H0IA 4YDMA 1SBSL 3O0LA 2HWZH 3KDMA 3WLWD 4HMCA 5D1ZD 1I3UA 4J7RA 4TS6A 4PRPB 4ISVA 2APBA 5TDNB 1AT9A 3HN5A 3QWRD 2ITDA 1W16A 4ZMPA 1YEJL 2C1OB 2NW2B 3K2IA 4UNTA 3HAQA 4XVTL 3RY6C 2AJYL 1AP9A 2W92A 4HJTA 1I3RB 3JWOC 3HBPA 1W8EA 1W0YT 1R34A 3DJZA 5SWSB 4OZ4A 2MTAA 4OIAA 4QYOB 1XGQA 1JPFA 4HOXA 2X4QA 5FB8A 4TUOA 1XGUB 1FLRH 1OCCB 4IHBA 4P2RB 5KYUA 3UZVA 5ITCA 3N0AA 1KG0A 3DX7A 3TEUA 3OLDA 2QGBA 2C7FA 3S7GA 3SO3B 1CICA 3GGWA 3V7MA 4LRIA 4Z6AT 1AO7A 5E7BA 5B8CC 5IFAL 3WFCL 5J1AA 5J1AB 2OKMA 5EG6C 2VMFA 2YOCA 4APXB 1ITCA 3BWAA 2YQ3A 4MD1A 5DMKB 1WHOA 3AXLA 5C6TL 5I19H 5JW3L 3HZYB 4LHQB 4LZKA 4DVRH 3RILA 4FBZA 4MA3A 4DP9X 3U30B 2UY7B 5C0ND 2X4UB 2R69H 3FB7A 1HSAB 2DMGA 4EUPB 5A7EA 4M7LL 1IT9L 3GBML 4M1GH 2FIKB 3FFCA 3RZCD 3GDCA 4K5MA 1UA6H 1M2VB 2QFRA 5K9JH 1QSFD 3MV9B 3S3SA 5ES4B 5KUKA 1J88A 2X4RB 3UAJD 4EF3A 1CBVH 3GO1L 1JZFA 2D0GA 3OV6A 4PJ5A 5IB2B 1RIHH 3W9EA 4FXGC 3H4HA 5EO9B 4NGHL 5JPNB 4EQ2A 4MQTA 4NLHA 1ZGLA 5JHBA 3LIUA 5AB1A 1NCBH 4QTIH 3EGXB 1E7VA 1B0IA 2CR6A 1B9ZA 3FU3A 3U7WL 1HWGB 4N8CH 3B5GA 4TTGA 4OLVL 4GAJL 1N64H 3AT0A 3W9DA 2FJSA 1DO6A 1S52A 3NIFE 4PJ8A 3L4YA 4UT7L 2VIRA 3DDGA 5HI3C 1WF5A 2WXOA 4WGVB 3B9AA 4AMKL 1T7YA 5GHWH 4NQCA 2AVFA 2BX5A 1CG9A 4V2BA 4EN3D 4F2MB 4EI6A 3RDTD 2VO8A 3K6SB 2WKOA 2VT4A 1B0RA 2EDXA 3M7OA 4MRCA 3TONA 2R2BB 4B6ZA 2ZUWA 4LT7A 1S9VA 2DD8L 1IGIL 1YJDL 3ZKMD 3CN3A 1RCYA 1S7TB 1XGRB 2GPZA 3ZYOA 4BWUA 3VD4A 3QCVH 3SDAA 5EBWB 2ZKXA 4AWJC 1WGVA 4EI5B 4FFYL 1NDGB 3QUYA 4O2CA 4XZUB 1CXLA 3BT0A 5C08B 2NT1A 1JD9A 5KSVB 1RP9A 2WO4A 2YPKA 2ERJC 2KZBA 4HCRL 3OF6D 4JFFB 5H8DA 3TP4A 5IROD 4YBQD 5DMIL 1E8XA 5DF0A 3S9DB 3W5NA 3GDBA 1XGUA 1BFVL 5JHLL 4M6NL 4NC1E 4JE4B 4RX4D 2BSSB 1R24B 3EYSH 2D7OA 5CIPH 3FOLB 5FPIA 1P2CB 5LG6A 2WJ7A 3P4MB 5BUPA 4W6WB 1RPQA 4FQ1H 3GYRA 4OIIH 3LXBA 2NT0A 3CHPA 4BDVA 3MA7A 4TNWF 4KK6D 3S5ZA 1S5HB 2BRDA 2X72A 4MZ2A 1EO8L 3L1EA 1LMIA 4N24A 5DD5L 3POCA 1YNKH 4MD0A 4Q4EA 5CWSB 5FV2A 1IGJB 5I15L 4PRBA 4KJQC 3FRUB 3Q43A 3RWGA 5I6NA 2FIRT 2PCFA 3IFPB 3JWNE 1MN4A 2Z4TA 5AG9A 4M3KB 4NUGL 3RWFB 4F7PA 4WEBL 3F58L 4P04A 3TBTA 5D1QB 2IVFC 5IEHB 4H26A 3BAEL 4MJ6A 1GGCH 1UOKA 3QHFH 3HUJB 1U6AL 2H6PB 5MERA 5FF6B 2BVOA 3FS9A 3U83A 1FV1B 5D2LA 4YE4H 5F7FA 1KGUA 4NRXA 5DC4B 2N0KA 1IFRA 1FYHB 1QSZA 1UFGA 1ZLEA 3HI1A 3H9SB 3GZKA 3GSWB 4JQVA 4AG4L 2A2QT 3STZA 2WUCH 1G9MH 3W38A 1DVXA 3OKOA 1E6JH 2CDEB 3L4CA 4AEEA 2OSLA 2CHZA 1IC5H 4NRZB 4Z7OB 1RMFL 1LO5A 3L3DB 1YHPA 5HGAA 1KG8A 2AQ2A 3TVMA 2F1AA 4K5LA 1TCRB 1JPGA 4ZFOA 4H1LA 2XQBH 1MHCA 1UAZA 4XR8C 3Q6GH 4R97C 3TH3T 1VEOA 4Y5XA 5EUOB 4D0BB 3BGFB 4M5YL 4JFDD 1OARH 2B59B 1FO0A 3DI2B 3B56A 2AERT 3QQXA 4EDXA 2J8OA 5DZNA 3DOHA 5I1AB 4KITB 2YUZA 1X9UA 1H2SA 2YD5A 5KYYB 4L8CB 1T1XB 1UD8A 4LFHG 4AQ1C 5LCVA 3QJHB 4ILDA 3TV3H 1IM3B 1LP9E 2P5WD 4XPHH 2HP4A 2VE6B 4PJXF 1H3XA 3DRQA 2F7OA 2WMPB 5HPMA 2Q76A 2C4XA 4M4PA 2NR6C 2WVVA 4PJEA 2HTLD 4JAMA 1UEYA 2VDOB 1N2RA 3A6CH 3GTNA 4IBZA 1D5ZA 5I6XB 2R8SH 1MGYA 2EE6A 5FUZH 1PKOA 4IKLA 1CLVA 3NIDE 4I0CC 1MCCA 3UBXA 1AE6H 3QO1A 2GI0A 2R2HB 2B8OT 1YMHA 3EGSB 1F18A 3BH8B 4I87A 4J39A 1B3JA 2VZ3A 4IRJD 2ESVB 1Z32X 1ZPUA 2L4OA 4XGZA 5E1AA 4CW1B 1L3WA 2WYTA 4MA8L 3GNML 5HHOE 1HKFA 5AW3B 5AUMA 4FJ6A 4PJAF 4XO3A 5I66A 4N2HA 1C16A 2F1BA 3APDA 4JDZB 3UACA 4Z76A 5AWNL 1T03L 3QDCA 1S9YB 3RX5A 5B39A 2OFQA 2XJLA 3V4VL 1A6AB 4F93B 3LRSA 4G6KH 4JQIH 2ZCHH 4AYFA 4NSKA 4LFHD 2BFVL 1AHWA 4P46D 3OE8A 1L9NA 4MQXC 1TT6A 5AZEH 5I16A 1F3DJ 1TFHA 3GSOB 2WLHA 4LRIC 2XY1A 5DEFA 1QRNB 5CLZA 4HWZB 2DZEA 4FMVA 4JN1H 5GS1B 3HZ3A 1XGTB 1QFWL 2W65A 4XP5H 2F5BL 2SODB 4NYLB 3Q5YA 4X9GA 4WFHD 4FQXB 5EWIH 2H2PC 2WZPD 2EDOA 1ID5I 2JQMA 4F15B 3EZ8A 4Q9RH 2FB4L 5C7ZA 1NCCH 1OB1A 2J1YA 4NCC2 1HXKA 2CCWA 2O1AA 3KJ6L 4ZMTA 1AD0A 3GJEA 2ZX6A 2D8KA 4GI8A 1PY9A 3L4TA 4RMQA 1ZHLA 2K8QA 3EYQC 2F8IA 5I1AA 2W8CA 1ZHNA 3VJ6A 3HC4H 4Z7WB 2CRYA 1U2YA 2B59A 4ZX5A 4J3OH 1HHIA 1OT1A 2GFBB 1F6LL 1OAXL 3S48A 3TEXA 3VI4F 1IGFL 3P0VH 2A9MH 3NPSC 1U8IB 1JPSL 4ICXA 4KKRA 1HYRC 1R17A 2JMRA 5HD8C 1UEMA 2X89A 3HR6A 1BM7A 3KPSE 3ASNB 5FYKH 1BIIA 4H5SA 3U4AA 2I32A 5DZ9A 3VNZA 2GJZA 5DFTA 2ARJB 3L3JA 2MNUA 3E8UL 2DTMH 3HR5B 3LPFA 4MJ6B 4K71B 2PW1B 1X5YA 1THAA 5E4OA 1KCRH 4NB7A 5TJWK 5KJ7E 4ZFZB 5HHPB 2GBTA 2EEXA 1E28A 4Y2NA 1JZ7A 1KXQA 3NMEA 4X6CB 3ZT7A 3SBWA 1U36A 4KRPC 1TZGL 1TO4A 4IRSD 4NBZB 2OMWB 4PRIB 4I48A 1XB8A 1RD6A 4OY9A 3QJZA 3OMNB 4FCHA 1VGOA 5EU4A 2CBMA 1B3IA 2XKNB 4G7VH 5A2KH 1YMMD 3KBPA 5C07A 4AX3A 4MB4A 4S1RL 4I88A 2BP5M 5J56B 5K39A 5JIPA 4GP5B 5EC2B 3A3YB 2IANA 4U4BA 3TIDA 2FR4B 1OW0C 1UD2A 2W9LA 1XZ0A 4NKOB 4UQEA 5D7IE 2IH9A 4YXKH 3VU2A 2L04A 2KPNA 3MXWH 2XIIA 5JNYA 2FSDA 4P2OC 5TF1L 4OM0H 3QCUH 3BZ4A 5IVXE 1AO7B 4F9PA 3C9NB 1S7VA 2KS9A 1R19A 4LAQH 4MYPA 1KJMA 5T5NG 3LNIA 4HEME 4QYAA 2V2WA 2WZ0A 3GKWL 4FE9A 4XE0A 4MTMA 5F3FA 5FGBA 4UANA 1PLCA 5SWSD 2YD2A 1S9VB 2YZ8A 3BKCL 5DUBA 1E4JA 4JFEB 1AGFB 1PFCA 2NLJB 4KDVA 1JXGA 5E2UL 3JUYA 3NDZE 5B35A 3MROB 4GSRA 3K2KA 4PWJA 4CMHC 1PX4A 2AJYH 2JI3A 3GTTA 1QSEB 3K6IA 5KN5B 3LCYA 4F58H 3L6FB 2FBRA 4ODUA 5DD3H 5IW6B 2NNRA 2GEEA 2DY2A 4BELD 4YHYC 4QHNA 2YK1H 1OP9A 3R7RA 4XNXH 2JE8A 3EF4A 4NPKA 4PJ8B 4XCCL 2AXWA 5J9PB 2YRLA 3TBYB 4WWKB 1NDMA 3BCFA 2OSXA 3S35X 5JLZB 2CJTA 4MMXA 1BF2A 1HOCA 1KBGL 4MXQC 3QA3B 5J8OA 1DO5A 4FTVA 2N7SA 3NFPB 5JA9A 4S0HA 1SHWA 5LNDA 1W72B 4S1QH 1M4KA 4BSVB 3GSVB 1UZ6F 3WMQA 5C6TH 3RFMA 2HJKB 4NUPA 4NCC1 4XCEB 1CGSH 3HZKB 2IH3A 4JHWH 4N2DA 2R69L 3MCLH 1X5KA 4DAGL 4RAUB 2I25N 2BOBB 3WAKA 5C0RL 4LMQI 4N85A 5L2KD 1AS6A 2PEDA 3EOBB 5DQJB 3ULSB 4DK5A 4C57C 4DP5X 1CBVL 2BWIA 4BFOA 3OE9A 2PCPA 4NKQB 3QNXB 1TQCB 4YX2L 4JFDE 3HLKA 4AENB 4GXFA 1KMEA 1S53A 1JZEA 1KNOA 3CN4A 1AR1C 5I5IA 4HV8B 3DHPA 3F7VB 1INEH 1PSKH 5FHAH 3NIGB 4QTIL 4RGOH 2R0WH 5CUSH 2BP8B 3GIZL 3G5VB 4FD0A 4JM4L 4GFTB 2BRRH 3B8YA 3TX4A 2C3XA 4Q89A 4NLAA 1AR1B 1UM5H 1W9XA 2Y1VA 1E27A 1U9KA 3BHBB 1T04B 3U6XA 4RGMC 3NIGE 4YHNA 4CSSA 1MFVA 4G80B 4X6BB 5B3JE 5LGHL 4AMKH 2OYMA 3CMOL 2EECA 5IBTL 3ZN6A 3CQQA 5KAQG 4ZMLA 3TXAA 4X5XB 1FNEA 4TF4A 2E8YA 3O4OC 3ODUA 4P48A 1QFWM 3DX8A 2A6KA 4XCNA 3J7HA 2Z64C 3QJXA 1INDL 3EADA 3GM0A 1D6VH 5H4YA 2RHEA 5DURD 1QRKA 3CQFA 3D7PA 3TWYA 1HZHL 1J18A 3D48R 4N5UA 3VRJA 2E7DA 2V3FA 5H35B 4GRWF 3TCTA 3HE6C 4RETB 4N0CC 5JOEA 1SHSA 3HLAB 1H5BC 2LW3A 4R7XA 4RNRB 4NKMB 3ARED 2RBLA 4OFYD 5FC9A 3I9IA 2BMKA 2IWKA 3C6SA 1EZVX 2AANA 1QW9A 4ZMYA 2QADB 3FDWA 1F3DH 3TFKD 1K85A 5DS2A 3IDMB 5CD5C 4UZSA 4M6ML 3H3PH 4MX7A 1HOEA 5E6UB 3WFBL 3MREB 3UPRB 3ZDYF 1L9QA 3EYSL 3LYRA 4NM4H 5C09A 1LYQA 2B3RA 3OSKA 4JKNA 3U0TB 3BH9A 4OIIL 1UT1A 5JZ7D 1JI2A 5GS1A 3IPFA 4OLYL 4HWBL 1RUAL 4G8GA 1E8WA 3BKYL 2QADC 5I1DB 3RWCB 1RZGA 2MQ3A 3FONB 4GKZA 2EXTA 2ICES 4ODVL 4XMLL 4B9FA 2C34A 2JF1A 2A99A 1ADQA 1JXFA 5EOQH 5FX3A 1A6AA 3GIVA 1F4XL 3B6SA 1ZEAH 3DVNA 3PABB 1WRFA 4KUZL 3QWOB 4QR7A 4R8WL 3H6AA 1MH5A 3ARBD 2O30A 5DDHA 3RZCB 3QJTB 4PJ9D 1U6AH 5ISZD 4G8IA 1XR9A 4P9HL 5ETUB 1S8DA 3K71B 3HC0B 4XTNA 1ADWA 3SGDI 3EZJB 3HG1D 2P5EA 4GS7B 5EIIB 1H3PL 4PTUA 3STLB 3OLGA 2VUYA 3RY6A 4CSPA 2R4SA 1DSFH 3T0WA 1DSWA 2HT4C 3HE7B 4H26B 2VLME 4NZRH 2VKXA 1DQTA 3CDZA 3I6SA 4A55A 4BEYA 4J6RH 3N1GC 1MCSA 4TNEA 4HJSA 1N5YH 3NJFA 1A7QH 1ANUA 1EJOL 2VXQH 3KYKL 5SWZE 2XQBL 5BRQA 4KJWC 5H2HA 1SXZA 3JT2A 3V6OE 5DQDL 3DX8B 3UTPE 3DX2A 4OI8A 5H94A 4FOMA 1JZ3A 2G2RA 1OGAE 5DJDB 4LLDB 4P07A 3UAAA 1GTFA 5EFIA 2ATPA 1N10A 1PX3A 1ETZA 3FO9A 1VFOA 1BZOA 1TPXC 4NRYA 1NOLA 2FYYA 5ADPL 3PWVA 1JK8B 5IK3B 3MNVA 5KS9B 3EDKA 4X5RA 2DQHH 5EF0A 2AQ1A 4QRQB 1J8HD 1HH6A 3JXAA 5HDQL 2VDQH 3L2LA 5GQBA 2CALA 1T1ZA 4O2EB 4ZUVA 4IBUA 2G5UA 3G5YB 1KCWA 2EIZA 4X32A 4U6YB 1NFIB 5EO0A 4A7TA 5T3ZL 5DRXA 4MNHA 2LLGA 2MHAB 3UTPD 4LLYA 4F33B 4N6QA 1DQJA 1HSBA 5D70L 4Z5RB 5TFSL 1WP6A 2EDWA 2C4FU 3DIVA 2IAMC 1AHWC 4GSDL 3N9GL 4FFVC 3LQMA 1U8QA 2L7UA 3DQBA 1QASA 2YRPA 4JQVC 1LMKA 2ZXWB 1ORSA 4OD3H 1KTJA 1I3GH 3UZEA 4PFEA 2VZOA 4IBTA 2X3AA 1T6VN 1OEZW 3FH7A 3QH3A 3WJMA 5CNHA 1B9KA 1UWFA 1C8PA 5JLZA 2Z35B 3HE6A 3ERXA 3REYA 1Q0XL 3FQUA 1ASOA 2J8UF 4PJIE 3TBYA 3RWEA 1GUEA 3PGFL 2PP9A 3IS1X 4V1DE 2XPGB 1IGYB 2WPGA 4X6FB 5CF3A 3TT3H 1N68A 1I9EA 1X5MA 4FTVE 4JB9H 1CVRA 2UYLB 2XQYA 3QZWB 5I2IA 3SGEI 2JCCE 3T5WA 3KCPB 2X4RA 4DGYL 3ABWA 3GJFB 5IVOA 4DO5A 2HX9A 3CC5B 1QSFE 4QO1B 4OZFB 2R83A 3MROA 4Q9RL 1CF8L 1M7IA 3EJQA 3V2WA 4PRAA 5FAAA 1R3LB 4MZ3A 1IQDA 3AUWB 5MI0B 4PJCF 1R9FA 2ED6A 2ATAA 4JANA 3SDCD 3PGCB 3L3HB 4ZFQA 4LSQL 1XGQB 1H5BB 3VXSD 5JXAL 1J48A 1JV7A 1KEMH 1RZQA 1OPGL 3SKNB 3SKNA 2K45A 5L0QC 1J5IA 5JIQA 5GGVH 4Q6KA 2D7PA 4E41B 2TRHA 4MCYA 1A3LH 1UXSB 3C6EA 3MRBA 1KG0B 4GEIA 4Z3GA 5IR1B 4N20A 1J5OL 3B9KC 2AAAA 1ZHKA 3ROLA 1F90H 3V5HB 3Q1EA 2DV6A 5K9QI 1EA9C 1OCOB 1IGCH 1WHPA 5C0BE 3QORA 4M5ZL 5F7NC 4DGUA 3UTSB 3CJJA 4L6RA 2NY4D 1I7TB 1RXLA 4QDGA 3QDGB 3QEUA 4ELDA 4JHAH 1DBBH 2X0WA 3IDUA 1AH1A 4YPGB 2CR3A 3P4OB 5B6VA 2VR5A 2VT0A 1SVZA 3PNWB 1RQ5A 5E9DA 5CEYA 4R4FH 4R96A 3WNLA 3G04A 4UBDD 2OYPA 1OCWL 2WWKO 5JPMC 1ZS2A 3KDMB 1S5IH 1ZTXE 4A2MA 1GZQA 2P5WB 4F8NA 4P5TD 3NGBC 1EERB 3C2SA 1UACL 2VRAA 5EA0H 2OSYA 4G7VL 5KVFH 3UIZA 1BDYA 4D2NA 4DK6A 5CEZH 4YDNA 5C0BD 4ABVA 3NABL 3UZEC 4PU2A 3A7KA 4B9GA 1ZVNA 5BO1L 1HOCB 3IAPA 1N8ZA 5D7LB 1XL6A 3SQRA 1OGAA 1NDMB 1NMBL 4JCWA 3O8XD 1U8OA 3RPKA 3CFKA 1JZ8A 5AOJA 3P69A 1Q1PA 3WS3B 3ZE0F 3ZHLA 4GB9A 4NQVA 2X7LB 1E90A 1ZTMA 1HYSC 4L1DA 5FGBC 1JMZA 3O3AA 1T2XA 5IK3A 1ZTXH 3FQTA 3GSRA 5GIRB 3X1FA 1JZ2A 2RFXB 3I9PA 2BSCA 4RBPH 3CZLA 1CURA 1F6FB 4AM0A 1ACXA 2H45A 2BIHA 1AO7D 5JNYB 4G8AC 5DVMA 4XPAH 2IBZY 1NKOA 4YSDA 1FFRA 3QDGD 5I18L 4P9ML 4WWID 1ILUA 4K2UL 1RUQH 5JO5B 4RMBA 4CSZA 3W37A 3VWJB 4R7DA 3TYGL 4KTYA 2R9HC 4H20L 5CJ8A 4X6EA 3THML 2V9QA 4XI5C 1VPOL 3PHQB 4DF9A 4YBHA 2CM5A 3QUYC 2ZSVA 3BQUB 4MNQE 1HKLL 3MI6A 8PAZA 1J8HE 4AEIH 5G2DA 3O2VL 1FNLA 2HKHL 2YIHA 5HJDA 1WBXB 3MA9L 1FF5A 2OV0A 3KVDD 3CPLB 5IBLD 5TGBB 1EMTH 3LKPA 3BPNB 1JGUL 4JQ6A 3JV4B 2KSBA 4S1QL 3WIAA 1FNSH 2NX5A 2LVEA 1GC1H 3IXAA 1D5MA 1J0YA 1KY6A 3N04A 1FVCA 3BPOB 1PZ2A 2Y7QB 3KXFE 3ZE2F 2V2TB 3TYFA 1T1YB 5IJVB 4ONFL 3G6AB 1IGIH 4HHGA 4BH7A 4DP0X 3QWOA 5BCAA 2JLPA 4IMKA 3CXHJ 4XTLA 2PXYD 4KI5C 5DZLA 1XCQA 3QUKA 2RJMA 4M7LT 1GPOL 2E27L 5BV7L 4QJ3B 3TJEL 5F93C 4IBQA 3UAEA 4G9DA 5DJYA 1M71B 1S7RB 4JHZA 2CWRA 2XKSA 4RFOH 3L7EB 3VFUA 2H0FA 3MNMA 1NIBA 4YHML 4KXAA 5F7WC 2H41A 3UPAA 1S9XA 3C5ZA 3A24A 2P52A 1OWWA 4L05A 4K5PA 3DIFA 3Q1SH 3BGFC 2C9RA 5FWRA 4EPSA 2VR7A 1A4KA 5JW4N 2MHAA 3O9WB 3PY9A 4Z7AA 5IHWA 1QBBA 1MAJA 4LNRB 2ED9A 5AVQB 1ZLWK 3VFTB 4BBWA 1QVOB 4Z0XA 2JWYA 2K78A 4U1KB 1HILA 4Y4FC 1YUKB 4EUPG 3MREA 1T6BX 3RBSA 4KZEH 1G7HB 3ECBA 4L29B 7FABH 2P49B 5KSBF 4G6JL 3VCLA 2ZX5A 1LHZA 3EYVB 1F8TH 4BXSV 3PQYB 1HZXA 4IS6A 5JZ7C 5LUMA 4HMDA 4JPIB 3U25A 4OD1H 4JCLA 3LKQB 3U0WL 3C60C 2GYSA 5E4EC 1D9KB 3C6LB 4I5BB 4ZDHB 1D6VL 1NCOA 4ZMZA 4HBCL 3AYNA 5TE6L 3ESUF 3NPSB 1V7ML 4H1LB 1X6LA 2ZZUT 3OMZA 4ZMNA 4G6MH 3IDIB 1C12A 3DO3A 2BK8A 4HFUH 4UM8B 2F8XC 5J5EA 3TEWA 2H2SC 4WO4D 5I82A 1D9KC 3FRPB 5IB5B 4NQCD 32C2A 1E4HA 1CFBA 4IIQA 1CE6B 4KKQA 5ICXB 1SLWA 2I27N 2DQFA 1ETJA 1HTYA 3Q9PA 1QQDB 1TO5A 1CGWA 3SD2A 1OAKH 1T5WB 1KB5B 5FDWA 3VW3H 4AG4H 4X31A 2HT3C 3GBNL 5LN4A 4CBPA 3RIAF 1CI5A 3UTXA 2EKSA 1WC7A 3FT4A 1FDLL 1YQVL 5D9SB 4W70A 5FF6A 1CYXA 1IE4A 3MLRL 3EYFB 3GT6A 4L9LA 3ZDZE 4RSYA 1ADQH 3GPSA 4C59B 3T0DA 3RUGB 4DCQA 4EDWH 4GP4B 3WNNA 3VB8A 2C9PA 5T3XD 4PJIA 3ZXAC 3EGSA 2ZUXA 5FECA 1V3MA 1I1YA 5LXGH 4N6RB 3GMPA 4DP4X 2OBGA 1W6WA 2F58L 5L4FA 4CW1A 1KJ2A 4POYA 2OJZL 2A6JA 4BCZA 3O4LA 3IU4L 4RWYH 2B5IB 2H1PL 1NCUA 1WBYA 1MHHB 4HIQA 2A1WL 1GS7A 1U8PB 4W9CC 1J9RA 4XTRD 5EORH 3FBKA 4P2RD 1YPZE 3UABA 3VB9A 3W11D 1BREA 2NY3B 1HHHA 2WZ6A 4PJCE 5CGYD 2YARA 2ZNXA 1TTAA 2IH3B 3P2TA 1OZUA 1RZFH 1MJJB 1A7RL 2XFXA 4MMZA 3LZFH 1HXMB 3U9UB 1J8HA 3HS0C 2PKDA 1FZKB 3BD4A 4BCXA 1T0NA 3BPNC 4L1BA 4P4RA 4F2ME 3BLBA 4W4OC 1SFDA 2G3NA 3FL7A 4I9XA 5EUOA 5FA3A 4E9RA 2AXJA 4KVPA 3QUYB 4U1KA 1T1XA 4B5EA 3CNKA 4L0YA 3SDYL 1DANU 2WM0A 2X12A 5FGSA 2WJKA 4WNSA 4EDXB 2BJML 2JIXB 1CTMA 4EIYA 2CIKB 4Z9KB 4XTRC 4MAUL 1I4FA 2JCCA 3CFJA 5GRJL 3X2QB 3NCXA 3OGCA 3NSDA 3RX9A 3WU1A 3LKOA 3VU1A 1OP4A 3PQYD 4JLRB 1KGCD 4MB3A 5CJXC 4ZAKA 1U8CB 1NCJA 4U1MB 5DJXB 4JFFE 4AC2A 5DMYA 1ZLDA 4GT0A 3H9SD 3RBGA 1EBPA 1A4AA 2NY4B 4G6KL 3C8HA 4YUEH 4E5XA 4NC3A 5IB3B 2X9XA 4QTHA 4AL8L 4HHWA 2YDVA 2B0SH 4TUJB 1TMCB 1R3JA 4K71C 4CVXA 4AMJA 4S11A 3UGEA 4A7GA 2D9QB 1PFOA 35C8H 2YD0A 3BVNB 4KKAC 2HTKD 12E8L 3SGKC 4AKQA 1FCGA 3OC8A 5SX4I 2GAZA 2F5BH 2VL5A 4HPOH 2ZKHH 4LPTA 4O9HH 4ANUA 2A4CA 5F9JA 1NLDH 3QNFA 4QXUL 5E9DB 1JK9A 1M56B 4ORZC 5IP4A 3KPSD 3QIUA 3SBPA 3GRWH 3MUY1 3L5IA 3BD5A 5IEHA 2F53B 4XT1A 2H2SD 5D2NC 3CFIC 5B8CB 1IM9B 4B60A 3O45B 5EOCL 1A1NB 2DLGA 3ALXA 3TA3B 4BZ1H 3QFJB 5E9DE 5F7EH 4C56B 4WFFE 1V7NH 3Q7JA 4CC1A 4I48B 4ZZFA 2J8HA 3NPZB 3IJHA 4TRPH 1IARB 3HZYA 3MHZA 3TJPA 3HI6L 1V3KA 4NERA 2F53E 3TS8A 2QBWA 3QDJE 3KL5A 4ZMVA 1KENL 2XWXA 2XNAB 3ARPA 4ONHA 4M56A 4XOCA 3QFJE 4IBYA 2PTTA 3FAWA 1DN2A 4WV1C 4PWFA 4YEFA 3MSPA 2YA2A 3SKOA 4GRMA 1DLHB 4AIXA 5B7EA 2DTML 2ZWKA 3I6GA 3TC9A 5KVMC 3SPIA 3PBLA 1HH9A 3AG4B 3HMWH 2VDNL 4ENEC 1KBBA 5AAMC 3BFQG 4PJDF 4JB9L 3TPUA 4F7TA 4JRYE 3RGHA 1DJGA 3NESA 4DO4A 5FHBH 3RY4A 3NEOA 1M05B 3FT0A 4FP8L 1XH3B 3SJVB 1U4EA 1T21B 2A9CA 3HI5H 5HDBE 4YDVB 5E4AA 5T1LB 3ARFA 1FFQA 4P3CL 3BH4A 4CVUA 1F6AB 3DX1A 3T1FA 1EXHA 1GRWA 3VXMA 4JZNB 3VI0A 4N25A 3TCXA 2I07A 3BKMH 4FLSA 3WELA 4G5ZL 3PHAA 3EOAB 4X6DF 4NQDE 1CG9B 2E76C 4L3FA 4XBGA 1KG9A 4TVPD 1TTBA 1KB9J 5AW0B 1YO4A 2F0CA 2H26A 1U8KA 1EHAA 2C1PB 5E2WL 3FQ2A 3ZYIA 2VMJA 2A77L 1A3LL 2CHXA 3QXWA 3NYKA 3ZDYB 3RGVD 1P4BH 3OR6A 3V6OC 4NS0A 3IAGC 1F90L 3QAZB 2VDQB 3DX9A 3W0WE 4M5ZH 1PNCA 1OP3H 2D3NA 4FL4C 3MRIB 1NM4A 4CMHB 4WFED 1MCFA 2H0EA 3P9MA 4ODXA 5AW9B 2AS5M 1L7TL 4GUCA 3ZDYE 1DEDA 4OLZH 5K39B 3U1SL 2Z91B 1J11A 3LN4B 1UB5B 4H88H 4DW2H 2EVFA 5DK0A 5F9WC 5CGYC 1BJ8A 3S0PA 4J3OG 2ITCA 4B96A 2N0MA 4LLMB 3WY2A 3X3BA 2PF6A 1GY2A 2GSIA 3ARGB 3DVFA 4F58L 3PAYA 5B8CA 2WLMA 3D33A 4D94A 4PLKC 1RVFH 3WJJC 3BSHA 4HWNA 4FQHA 3KWVA 3KNBB 4HKJB 3FT3B 4I8DA 1K5NA 1KXHA 3ESVF 4L4VE 2XACC 4XO8A 5HYQA 5LKNA 1R4XA 1LGVA 2UUDK 3OKYA 4OGXH 1FL5A 3EIFA 2R2EA 4WNJA 2R1YB 1NGPH 1HYSD 1VFMA 2HX7A 2B5IC 5EIVA 3IETA 5C8JB 5IV2A 3LEYL 5CBEA 4AQZA 4LDCA 3SYQA 3U36A 3KR3L 2IPUG 3VFGL 4LCWB 4Y5VB 3TFBA 2O5XH 1A9VA 1BXAA 5ICZB 3CZKA 4DN3H 1CDUA 3L4WA 4PRID 4QT5A 3SDCB 3NA9H 1THCA 3GXTA 1QUPA 3P11H 5HHMB 1JVKA 3DVIA 3QYCA 4LP5A 3JWOH 5DVNA 3IDGB 2GUOA 3X17A 6PCYA 3MBVA 2OTUA 1EHLH 5IMLA 1F4HA 2CMRL 2P9RA 3BVWA 4UILL 2DQMA 1D9KD 2P28B 5D96C 2Z7UA 1A9BB 4M48L 5DK2A 1XMEB 2HTLC 3KJ4C 5SWZA 3U7AA 1P6WA 1U8HA 4WRLA 3ZBMA 4QLWA 1IGYA 4ZYKA 4K2UH 3KH3A 2Y03A 4DZ8A 4R26L 5D1ZI 1TR7A 2R0WL 3BUBA 2A3TA 2QMJA 2IFFL 4N2CA 2V7NB 4OZIB 2VTFA 3QHTC 4ANWA 5I6KA 5J7AA 4PXKA 4WW1B 3V8CA 2UUDH 1R84A 5HGHA 1R5IB 2P7TA 1K6QH 2BNQA 4RDBA 4Y9FA 4PRIE 3BFOA 2JKWA 1FO0B 3QYMA 4JFDA 1PLBA 2R4RH 3BX7C 1LO0L 3B9KD 4WV1A 3QEQD 2UZYB 4WU7A 1FZMB 3CODA 5IG7B 4LHUA 3T3MB 2MPAL 4FGMA 3UTSE 3QZBA 4ZUUA 1W72H 2G75B 1GC1L 2WLNA 4RAHA 1II4E 2A5UA 1PKQE 3F58H 5KYWB 3QBGA 1M9SA 5FK9A 3TH4T 4F7CB 5IKCB 1DJYA 1FGVL 2C9XA 5FFLA 1ETB1 3D5OF 4FKHA 3QO0A 5SV3A 4PJGE 3RUGF 3U0TA 2FYYB 3K6OA 4U3SB 2WBJA 3KPRD 4HLZG 2XOTA 1N70A 2WTRB 3IEAA 4U6VH 2QVMA 1CBJA 1EFQA 2H32B 3LNHA 2W07A 3S96A 3UBGA 3FQNA 4I1NB 3TURA 4NQDA 4KI5E 1F2QA 5IMMA 2VXVH 4IHOB 3P30L 5DHVA 4PJGB 2IADB 5DLMH 5MEQA 4PUBL 4PP2B 3NH7L 3L9BA 3OX8A 1YEGL 1WFJA 2CKNA 5CXPA 1A7OH 2XTLA 4PGCB 4QRBA 3AS1A 4LEXH 2EYSB 3I75B 1CDBA 4N8UA 1KV7A 1E4KC 2L7JA 4K23L 4YPJA 3VRJB 3HNSH 2D73A 1IBBA 3ZW3A 1NC4D 1QQDA 2CXGA 5DUML 3QP3A 2Y0SA 4Z7QB 4HT1L 4TSAL 2EIKB 5ICZA 3QT2A 4WFGE 2TAAA 2Y06H 1T0MB 4Y4HA 3M8OH 2WSKA 3X11B 3CBRA 3COCA 3MRMB 5EIIA 1O0VA 4YK4C 4JPVL 2KLTA 1XQ4A 1ZA3A 4K5OA 2XZCH 2AW2A 1TJGL 4XPGL 1DZ0A 3SQOH 2QR0B 1UVQA 3VMOA 3LKNB 5CJXA 3NDYE 4YHNB 2B1HL 2DWXA 4KO5A 1BVZA 2KZKA 4N8VG 1FLTX 5H2LA 3MLZL 2ZCKH 2FJFA 3KYNB 2ZG1A 4J1UB 5JXEA 5EBMA 2IWEA 1R3IL 5DHEA 2VITA 5TE7H 2CDFA 1N6UA 3BIAX 4LGRB 5C92A 2QQNH 1IM3D 2NXZB 3P3SA 5E23A 5I1DA 4W6YB 1BWMA 3OKDA 3WHE1 4F2MA 1SEQH 4B9PA 3ZKMC 3FQWB 4K3DH 4WO4B 3IDXH 3QNXA 4JFDB 1ID2A 3CU1A 4E9XA 3RGVB 1F4YH 1CR9L 1ZXQA 4ENZA 5B7FA 3N40P 4QOKE 5E5UB 3WNJA 1A7QL 1RZGB 2DYPD 1U8JB 5EO1A 2DRUA 4CU8A 2D7TH 5HYJE 1FNGB 5IG7A 4LQ1A 1E5CA 1HWHB 1OZTG 2N7BA 3AGVA 4QRFA 5EN2A 2YPVA 3QBTB 1C5CH 5TQ0H 3VUAA 2J56A 4TL4A 2X6MA 2C1PA 3QI9A 3RJOA 5KTEL 5JW5B 3LSOB 4L8BA 1YEWA 4HUCA 2CR0A 3QDAA 4FEMA 3T8XB 1NWOA 4DH2A 4HX1A 5IESH 3MV9A 3JWNC 3ARZA 2W0FB 3VGGA 1I9IH 3FCBA 1E3FA 3PWLB 1D5MB 3WIIL 3ZTCC 4AGMA 3D06A 3D4YA 4HG4J 1NEZA 3H0TA 3NCMA 5A44A 1RZIB 5DYFA 3EBIA 2XTJE 4MQTB 5ALBL 1CL7I 2X05A 4XP6H 4MJJA 2BIIA 2BZ7A 5KJRH 3LH9A 3FTZA 4ZUWB 1NCDH 3BWUF 3EKCA 5ALCH 4ACPA 2Y36L 3COOA 3ETBF 2OL3H 3P4NA 5ENWB 4AL8C 2BSEA 2OSWA 4FI6A 4ZO6A 4UAHA 3BZFA 3KPQA 4AW7A 4U2YA 2DLTA 1BZ9B 1NCCL 1RUKH 1C3WA 3ULVF 3FUHA 4YHKH 1M6OB 1IU1A 2MKLC 5F1KC 4PJ9A 1ESOA 5DURB 4FMFA 4NO5A 4U1SA 2Z55A 3UC0L 1N59A 3HBGA 4Z3TA 5IJKC 4UTBH 2IQ9H 1G7JB 4LLMA 4HYJA 5FYKU 3WMSA 5D7KD 1I8MB 3K91A 5A16A 1AFVL 2F54A 2YGPA 1NDGA 4XZUA 2JQAA 1JPSH 4XHJD 3S97C 1ET8A 3SDCC 1P5UA 5IHBA 3EHBB 3TWCL 3IJHB 1S7TA 4TVSa 3V9CA 5FYKL 1NEZG 1JF6A 2FT6A 2HVKB 3N5AA 4KKNA 4ZPVA 5FYKD 4Z1PA 3P3YA 1VEPA 3ZL4H 3G08B 4FQQB 4GW1A 1F86A 5FK9B 2NY6D 2GJPA 5E8EA 4F7CA 2VDKH 4CC4A 1A2YB 4OJFL 2B0SL 3L1GA 1MRDH 4PLNC 5A7BA 2LE9A 3BKJL 4Y1AA 4Y4FA 3WGUB 5MI0C 3R8BB 2WLLA 3VFRB 3OMIB 5ICYA 5IB4A 5IMKA 4KK8D 4HFWB 1EO7A 1BRRA 3LXAA 3T2NH 2Z91A 35C8L 4AEHL 1E30A 5CHNA 1QEXA 3HS9A 1KTKE 3X13A 4UCFA 2X4SB 2AJXL 5D1ZC 4PJ7A 4NX0A 3WOVA 3CH8A 1YRKA 3REVA 3G5XB 1MY7A 1PZ5A 5LJYH 5TD4A 3S36L 5D2LF 3OB0K 5KSBA 4WWKA 5AX1A 5HSFA 3F64A 2MOVA 4PIBA 4ATTA 2ZOWA 4EN3B 4KY1H 4KXBA 1AD9A 1HK6A 1CFSA 3VXMB 3RWDB 1TSHA 2O93L 3P0YH 4QMEA 4H5SB 4N2FA 3EDFA 5C0CB 4OLUH 2ZJSH 1U8LA 5GGVL 2Y4SA 2HLFC 2IAMD 2WQAA 2YC1B 1MCJA 1ZE3H 2F54E 2WKGA 5DMGD 3UTTE 4M7JH 1I1FB 2OMYB 3HG0A 4IRSA 3FW6A 5HHNA 2VMDA 4Z7WA 3D18A 1ZVYA 3HAEA 4BSWB 3EH4B 3QPKA 5C0CE 2XX1A 1DQVA 3D2UD 5DRXB 4IEFA 3QEGL 1QBML 2IAAC 1V3LA 2QHRH 3H42L 4R97B 4KPHL 3VD0A 4JHAL 2WUBL 4GG6B 3V95A 5F6HI 3RB5A 5C86A 3CFBB 3KXFD 4QRRE 5E4IA 3HB3B 3QUML 3E6FB 3O3DA 2XX0A 4QXGL 1KFGA 5BUGA 1RIHL 4XMTA 3AB0B 3AS0A 1KCSH 2VZ1A 4H2AA 4L4JA 1EO5A 3GEWB 3BEVA 3K4AA 5E6RB 4NO5B 1FL6B 4YOKA 3BLKA 1SM3H 2XWBA 3C5SA 4KNSA 4UYQA 4X7SH 1I8LC 1ZLUH 2VSMB 2X4QB 2XFXB 5TDOA 3MLTA 3RZWA 1A9EA 2WXHA 3BD3A 3UTSD 5C0JA 5IQOA 3ABMB 5ID1B 4NSKB 1IFHH 4WKZB 1KWGA 2OCJA 3IFOA 2YPLB 1HFUA 4BGDA 4ZPVB 5EDSA 3VWKB 4XWGL 5EU6A 3SZKC 1CO1A 1R2NA 5TQ2L 4PJ5D 2G60H 2ADYA 3PWJB 5GRVK 3DUUA 1PYWB 2G3ZA 4GO9A 2DIAA 4XC3L 4LESA 1JFHA 3F8UB 4E36A 5JYLA 4POZD 4MXQD 1GYAA 3NFSH 1FBKA 3RTLA 5FLUA