3S3NA

Crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3nA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3nA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3nA03
2ITGA 2YNGA 3HPHA 3V1OA 1IG9A 4B9LA 1MHNA 2E5QA 2G8IA 2MWPA 2IOCA 2RN2A 3MEEA 3T1AA 1S6QA 3TAEA 5FRNA 4DU4A 5E41A 2G8WA 1OYXA 2HHTA 2Y1IA 1QS4A 5J2PA 4CFAA 3AVKA 1HPZA 3I0SA 4NS5A 3MAQA 3PMIA 3AV9A 1U49A 3ZT3A 2RKIA 2BDPA 1RDBA 4IKFA 3OS0A 2LRQA 1Q8IA 2QK9A 3HK2A 4KI4A 3NTHA 1J54A 4QQGA 4MFBA 4I7FA 3VQCA 2Y1JA 3OYKA 2EQMA 2NLUA 4IUQA 2LTOA 2YNHA 4CJVA 1RBTA 4CIFA 3K5LA 3K5MA 3D45A 4CECA 2JLEA 1WJRA 4PA1A 1RDAA 1S9EA 4B9VA 3EY1A 5KTQA 5HBMA 4C8LA 2YKMA 4CJ4A 4CJ3A 5IN1A 4AILC 1TV6A 3TWHA 3F9KA 1B9DA 4O55A 3AVAA 2IS3A 1N6QA 2O4IA 3LGLA 1J5OA 2QQSA 2KW4A 3O4NA 2F8TA 2M16A 1KFSA 3QEWA 4H4MA 3HP6A 5KCOA 4RW7A 4M3TA 4QQ6A 3MO8A 1QSSA 3RRHA 3C95A 4FJ7A 4FU6A 3V9UA 3SUOA 3GOXA 3QNNA 3CG7A 3VQBA 4W5OA 2YNFA 5KH6A 3EAEA 2GFAA 3HVRA 2QXFA 3AVJA 3MXIA 2EQUA 1LAVA 3ZT2A 5CIUA 3LWMA 1NK7A 1IO2A 4FXDA 3HPGA 4HTUA 3QJ6A 4FLUA 1X9MA 2L3RA 3OYDA 5D6XA 3DLKA 4KPYA 3ZT1A 3MP6A 1BISA 4KKOA 4WE1A 3QEXA 4B9TA 3M8SA 4HUFA 4FJGA 3NGIA 1QSYA 5KE2A 4NYNA 3OJUA 4CHOA 2WACA 1BL3A 3VQ8A 4FM1A 1VSFA 4DSFA 2HNYA 4GVMA 3F73A 4F3TA 1NKCA 3Q1JA 2RPIA 1HNIA 3WNGA 3ZSRA 4CHYA 3KLFA 2XY5A 3S3MA 1C0TA 4IDKA 4I2QA 3K58A 4CE9A 4BD3A 1JKHA 2OA8A 1FK9A 2DIQA 3ZSZA 3NHGA 4PUOA 3OYNA 3MEUA 1TKDA 4CEFA 3VQAA 1TKZA 4M3RA 3S3NA 5CZ1A 2R57A 3L42A 1C1AA 3AO1A 4Y1CA 4YNQA 4DS4A 4EZ6A 3AA4A 1TK0A 4FK0A 1CZ9A 3SPZA 2LSNA 4CGDA 3QEVA 4KFBA 4LSLA 2G8HA 1LW2A 3K57A 2X4WA 3SCXA 2KZZA 1Q9XA 1RBVA 5I3UA 1TGOA 4CJSA 5KGXA 2OZSA 4J2EA 2EQJA 4E7JA 1GOCA 1I39A 1Z26A 2VWKA 3LP1A 3V9WA 3K5OA 4DG1A 3M8RA 3LP3A 4FL6A 4IUVA 3KLEA 3RR7A 1X1PA 1TAUA 3V4IA 1NK6A 3NTIA 2XO7A 3RTVA 3OA6A 1W9HA 2ZQBA 2YHAA 2X35A 2JGUA 2ZD1A 1YTUA 1UWBA 3P8HA 3L3UA 4GW6A 4FLXA 3V9SA 4B9NA 3P1GA 1JLAA 2XDPA 1L3TA 3FEOA 1IKXA 4FJNA 4KHNA 1O1WA 1G5VA 3VA0A 2P0KA 2X78A 1WN7A 4RW8A 3L2UA 4BWMA 3FFIA 3L8BA 1Q9YA 2FBYA 2QKKA 3DOKA 4XIUA 3BGRA 2XY6A 3AA5X 3PUFA 4CEEA 2R5AA 1ZBIA 3LAMA 1FXXA 1WGSA 1HNVA 1VSMA 4AHCA 4DS5A 1KLNA 4PL6A 3QNOA 4DTXA 2M1HA 4DSEA 4J2DA 4O0JA 2KQ2A 2F8SA 2R5MA 3HYFA 2KFNA 4DQPA 3MEDA 1JLQA 1NJYA 4J2AA 1YT3A 3OYMA 4F2RA 1EKEA 4C8KA 4I2PA 3SPYA 1KRPA 3KLGA 2HVIA 1C1BA 5C6SA 1A5WA 2ATQA 4CFCA 5FDLA 5HRPA 1LWCA 3ALYA 3ZT0A 3NCIA 1JLBA 1S1WA 4FZZA 2FBTA 3L3VA 4JRQA 1SKWA 3MEAA 3OMCA 2EX3A 3DB3A 1JLEA 2WONA 3NDKA 1SUQA 4PLLA 3WNEA 4CJ5A 3MEGA 3PX6A 2DAQA 3KTQA 2EHGA 4DSKA 3HT3A 4FJJA 2XK0A 3PY8A 3PX4A 3SQ0A 1U47A 2IG0A 2E6MA 2HQEA 3UT1A 3AVLA 4CF8A 4FM0A 1I3AA 4JS5A 2BGGA 1QQCA 4NCAA 1IKVA 4Q5WA 1WSJA 1NJZA 2I5JA 3B6OA 4DQSA 4KTZA 2O4XA 1UAXA 3LP0A 3C6TA 3SZ2A 3QERA 2DTUA 3OYBA 3G0ZA 5HROA 4K8ZA 3OMGA 1J53A 2L89A 2X4XA 4CJWA 1XNIA 2RHZA 3LLRA 3D0PA 4DFMA 3SJJA 3RRGA 3KJVA 2D5RA 1S1UA 2FBXA 3ASMA 4AH9A 1XI1A 2KFZA 4BDZA 2QQRA 3FC3A 2BANA 1ZBLA 4O5BA 4DSLA 3DLRA 4OPJA 1SV5A 4RW9A 3TAFA 1NKBA 1WAJA 2F5KA 2KTQA 4DQIA 4RG2A 1RDDA 2VG5A 4KHYA 3O3GA 3RMAA 3DOLA 3KLIA 4IFYA 4ICLA 4JS4A 4F3OA 4AHRA 1NK8A 4FYDA 4DTRA 1X9WA 1JLFA 4OPKA 2DIGA 1TKTA 4FJXA 2G8UA 1XWLA 2D0AA 2X74A 4UC4A 1CZBA 5CYMA 1GOAA 5HRNA 4J2BA 2HHXA 1N27A 3RWUA 2AJQA 4CEBA 4DTSA 1NJWA 4CHNA 3QIOA 3K5NA 4LD0A 3U6FA 2K3YA 4ELVA 1BGXT 4W5TA 4Z4EA 3OYCA 2RJFA 4QW2A 3UIQA 4AHVA 5SWMA 2B8AA 2Z1IA 1ZBFA 3M8PA 1OZ3A 3LGFA 4DTMA 4DF8A 1RDCA 2EFIA 3HSTB 5KGWA 3PFSA 3OJSA 4DU3A 4CGFA 4DFJA 4FJIA 4DF4A 4FJ8A 4FW2A 5KI6A 3QO9A 1IKYA 2YRVA 1C0MA 3I0RA 3KK1A 4IUPA 3QIIA 1BI4A 4DLGA 3M8QA 1S1TA 4C8NA 4C5HA 2DFEA 3V1QA 3IS9A 1VSLA 3DI6A 3U3YA 1WSGA 4KB1A 2GUIA 3SNNA 3CM6A 4OGCA 1LV5A 3DLBA 3VQQA 4DU1A 5DK5A 4ELTA 1WNSA 1BIUA 1D8YA 4E3SA 3NTKA 4CGIA 4R5PA 3ZSYA 1H3ZA 4NYFA 4DMNA 2BKDN 3PO4A 1TKXA 5J39A 3DYAA 3NH2A 3NF6A 1BCOA 1XC9A 1DTQA 1KVCA 4IG0A 3DLHA 2RI3A 2HHUA 1KFDA 4O0IA 3HL8A 1NK5A 3CEYA 3MP8A 2DFFA 4H8KA 4FJMA 3ZSQA 5J1EA 3OYIA 2O4XB 3IG1A 3WNFA 2HMIA 1S1VA 2LDMA 3OS2A 4M3ZA 3FDRA 1WSIA 1SKSA 4QQDA 4KAZA 1YVUA 4OKJA 4DSJA 2YV0X 3QBYA 4Z4FA 4CF2A 2CKKA 4JLHA 1C1CA 4FJ5A 4II1A 2RI2A 3MP1A 2YHBA 1LWEA 4I9LA 4FLTA 4B3OA 3OVNA 1JXBA 3DRPA 3ZSWA 2IAJA 4HCZA 3AO4A 3VQ5A 1VSJA 3C6UA 3HVTA 4NCGA 3V6DA 3SUQA 1U4BA 2YKNA 1NK4A 2PYLA 4M3YA 1SKRA 3QINA 4N5SA 4N4GA 4CEAA 4CGGA 3RMBA 3S9HA 2RI5A 3KIOA 2FHDA 4CJPA 3PMTA 2YNIA 3BDPA 2R7YA 2QKBA 1HYZA 1IKWA 2ZE2A 4IBNA 3DRSA 1TAQA 1KTQA 1YTAA 4DLEA 3RMDA 2HHWA 4FJLA 3TAMA 1T7PA 4L8RB 3THVA 3JYTA 4JRPA 3H6ZA 4M45A 2E4LA 3ISNC 3LX7A 4Y1DA 4M3UA 4PLIA 1HYVA 4PY5A 2IDOA 4C5EA 1W0HA 4HUEA 1B9FA 2R58A 3IRXA 1NKEA 1U45A 3B6PA 4CJFA 3L2QA 4CFBA 4KB0A 3DLGA 4B9SA 2OPRA 3K59A 1SL1A 4I9QA 3OYAA 2W42A 1TK5A 1RTIA 2RHYA 3AVCA 4LH5A 4OVLA 3OYJA 3ZEHA 1KLMA 4OKKA 5I42A 1GOBA 3TAPA 4FJ9A 2B6AA 4ZTJA 5D6YA 3ULDA 3TI0A 4FW1A 4A4HA 3OYFA 1HRHA 2A1RA 1BCMA 2G3RA 3AVHA 1XHZA 4QAGA 1Z25A 3TAQA 4B9UA 3A2FA 2K3XA 5KRTA 5DMRA 1TL1A 5KCHA 4Q5VA 5HRRA 1WJQA 4N47A 4KTQA 3LANA 3NE6A 1NJXA 3HM9A 4X34A 2DY4A 5FROA 3CFPA 4EDUA 1KSPA 5K14A 3SUNA 3C4SA 1VSDA 4IFVA 3VQ6A 2E6LA 4CJEA 4CHQA 5HP1A 2G8KA 5JS1A 4CK1A 2JTFA 3ME9A 4C5GA 3PO5A 4NZGA 3DM2A 3ZCMA 4Q0BA 3LPUA 4W5QA 1ZBUA 5IAYA 3OYGA 2RJDA 1MU2A 2P51A 4CEOA 4CK2A 1WAFA 4CERA 5SZTA 1ZYQA 1TVRA 2VG7A 3LZIA 4DFPA 2D0CA 4KHSA 1C6VA 4KREA 3OS1A 2VG6A 2LVMA 3ZSXA 1BQMA 4DTPA 3MXMA 1L3VA 1S5JA 1ASVA 3DRRA 5CY4A 5JS2A 3NH0A 4DQRA 3E9GA 1L3SA 3F70A 1D9DA 1TK8A 2OZMA 1CLQA 4FLYA 3KUFA 1RT5A 2GF7A 3E01A 3L2WA 3L2RA 4E7IA 5HRSA 3V9XA 3UWNA 4CK3A 4PWDA 1UOCA 1CXQA 4N76A 1QSLA 4FJHA 1RTHA 4E0DA 1JLCA 1X9SA 3SV3A 4FCYA 1NOZA 3TANA 3ZT4A 1OZ2A 4KHQA 1LAWA 1RI0A 2RF2A 1QE1A 2GV9A 4FLZA 1SL0A 1J9AA 3HXMA 3AVFA 4HCCA 1VK0A 2XY8A 4OVAA 4CEDA 3LH0A 4QCLA 3MECA 1D9FA 3VN5A 1NK9A 3NGYA 3P8DA 1BHLA 1VSIA 3AO3A 3QESA 4IURA 4E7LA 2B5JA 5J26A 5C42A 2DFHA 2A1SA 3AO5A 5CYQA 4AHSA 1KVAA 1S6PA 5C0MA 2Z1JA 2HB5A 3TR8A 3QIPA 4N4IA 1WSFA 2X6SA 2X6NA 4F4KA 1NOYA 4FJKA 2HHQA 1HMVA 1D5AA 3VQDA 2Z1GA 4A4FA 4TSXA 1RT7A 4CJRA 1A5VA 1N5YA 3PV8A 3E9FA 4EP4A 3CFRA 2NUBA 2FC0A 1L5UA 4F8RA 5KE3A 2GBZA 3AVGA 1RBRA 3KK3A 2XHBA 4M3XA 4DTUA 3HP9A 3VA3A 1WJSA 3T19A 1R0AA 1RTDA 3NH1A 3ITHA 1UA0A 4LH4A 3KKRA 3C94A 4KO0A 4EP5A 4N56A 3JSMA 1KCFA 2PQWA 3NFAA 4OGEA 3FLGA 4O44A 3OYEA 3V81A 2PYJA 4FK4A 4M42A 4MQ3A 4FK2A 1LW0A 4CJQA 4QVZA 1S9GA 3SYZA 4DTOA 4A4EA 4CESA 1VSKA 3NGZA 3VQ9A 3DLEA 4RW6A 3M9QA 1EXQA 3PNWC 4B8CA 4CF9A 3ZSVA 2OPQA 1JLGA 3V9ZA 4DFKA 2RHXA 1T05A 3LZJA 2HHVA 1FKOA 3VQEA 4FZYA 4IUTA 1CXUA 3OYHA 1Y97A 1U48A 3SV4A 4C8OA 1F21A 4M41A 3NAEA 3RR8A 2RHUA 3IAYA 2G8VA 1IH7A 1KHCA 1BI4B 3O3HA 1RILA 3KLHA 2HHSA 3NF7A 4FLVA 1QHTA 3NF8A 3AVBA 2BE2A 5KRSA 3MXJA 2MWOA 4W5RA 4M3WA 2OPSA 2HW3A 3LWLA 4FLWA 1VRUA 3H08A 4B08A 3H8ZA 2HNZA 2RHIA 3KD5E 4CF0A 1U04A 4BACA 2O4GA 4UQGA 3RMCA 1T03A 3PX0A 1L3UA 4K8XA 4OLAA 4CRIA 3QEPA 4A4GA 1LWFA 1JXEA 1RT4A 2P1JA 4KTWA 4Z4CA 4HUGA 3CYMA 3SQ1A 4BE2A 2JZ2A 2BUDA 4CJTA 4E1NA 4ZHRA 4B9MA 4DSIA 2Z1HA 3MEVA 5D6WA 1VRTA 1WLJA 4OKEA 4C8MA 3NBPA 3O3FA 3TAGA 5M9OA 2GFUA 3SQ2A 2LCCA 2P5OA 4LSNA 3P83D 3U3GA 4N41A 3G10A 4Z0UA 2EQKA 3VQ4A 4B9WA 2BIVA 3NNQA 1DTTA 4BE1A 1HJRA 1RT3A 5EU7A 4E1MA 2XY7A 3TABA 4KHWA 3VQPA 4GY5A 4W5NA 3S6WA 3DLMA 1BQNA 4LY7A 1S1XA 4CGHA 3HPOA 2OPPA 4HHTA 1RBSA 4RG8A 4E7HA 2VYTA 1VSEA 2RJEA 1DLOA 4IG3A 4BWJA 1ASWA 4CEZA 3HO1A 3HJFA 2RJCA 1C0UA 4YFUA 4ELUA 4Z4IA 3SQ4A 4CJKA 1KVBA 4QOZB 5CZ2A 4BDYA 4AHTA 1TL3A 2Q3SA 1VSHA 3META 2L8DA 4EZ9A 1B92A 3OYLA 3SD4A 4CCHA 4KRFA 1JL2A 4GMJB 1G15A 2WOMA 3KD1E 4E19A 3T3FA 1WSEA 4DQQA 3TARA 3LDSA 1RT2A 4CF1A 1RBUA 1T8EA 4Z02A 2EKOA 4CGJA 4G1QA 3VQ7A 4NCBA 3SUPA 1SSFA 4CIGA 5HLFA 1UA1A 1HQUA 4Z4HA 1SL2A 3LPTA 3OQ5A 2ETJA 4ID5A 3LYIA 4CEQA 4CHZA 4CJLA 3EZ5A 4F2SA 4HCBA 2F96A 4E7KA 4LD6A 2FBVA 2KZMA 4DTNA 5J2NA 3KK2A 3O4QA 2HVHA 3I8DA 3ZSOA 1JL1A 3LAKA 1BIZA 1QTMA 3DB4A 1RT6A 5J2QA 3EYZA 3BDLA 3LP2A 4CHPA 2D9TA 1RCHA 3AVNA 3AA2A 2IGIA 3AVMA 4OJRA 3V1RA 1RTJA 4AHUA 3QETA 2PZSA 5FRMA 4CJUA 3CM5A 5C25A 2X4YA 2XRIA 3KKSA 1ASUA 3QKJA 4DWIA 4FM2A 2D0BA 4PQUA 3LALA 1HYSA 1RNHA 1WSHA 2E6NA 3OB9A 4BDPA 1EX4A 4BE0A 3QLHA 4RW4A 2HNDA 5T7BA 3O8VA 4ID1A 2P5GA 5J2MA 3OY9A 2HQXA 4H4OA 2G8FA 4C5IA 1REVA 3NF9A 1XHXA 3DMJA 1FKPA 3K2PA 3MEWA 4N4HA 4ZTFA 1K6YA 3P5JA 2PY5A 1RT1A 2B4JA 1EP4A 3CFOA 4B8AB 3AVIA 1ZBHA 4KHUA 5C24A 3L2VA 4E89A 3SI6A 4Z4GA 4CFDA 4FVMA 4IUUA 3WNHA 4DTJA 3QEIA 2OYQA 3AA3A 4O4GA 4KI6A 3ASKA 2VWJA 2IC3A 2RO0A 1ITGA 5D3GA 1OI1A 4KV8A 4OLBA 3CQ8A 2M0OA 1EETA 3AO2A 4FZXC 4CIEA 4L59A 4HVJA 1HQEA 4B9XA 3S3OA 1A5XA 1NK0A
chains in the Genus database with same CATH superfamily
4GO1A 1LE8B 3JCMh 2G8IA 1S6QA 1KG2A 2KLOA 2ED1A 1K73U 1I1JA 4KI4A 1ITYA 2VV5A 4CIFA 4CJVA 3JRDA 4M7YA 3N4QA 4ESRA 1U2WA 1D1AA 2OTJN 4R8HA 2AQEA 1WNLA 3H9QA 2W10A 3CERA 3M9AA 5GPAA 4ITVA 2EQUA 5J1YA 5M5WJ 1GLNA 2HI3A 1IO2A 4CC4B 3HPGA 1MMGA 4BRPA 3PIPA 4JI4K 4RAYA 3H0IA 1HX1A 1IO6A 2VKNA 4IDKA 2UUZA 2IA1A 4U7BA 1SC7A 2VOPA 4WF2A 1X6GA 4CEFA 3CCQN 2KMTA 4E9HA 1YI2Q 2L3DA 2IJLA 3GXOA 4DS4A 3DTEA 2K9QA 3JW4A 1HW5A 2LQ8A 4V19K 5GADP 2PMHA 4M9XA 4U67L 2LKXA 1GOCA 2QW9A 2K9GA 3WU1B 2PAVA 3V4IA 1VA7A 3RTVA 2RDPA 1X58A 5IT9K 3P1GA 2LSOA 5CVVA 4A53A 3FFIA 3Q7CA 2KNBB 1GLAG 3BGRA 2XY6A 2LJ1A 2HBLA 4DS5A 2CZ1B 5CK9A 4GYIA 4IXCA 3VRZA 1KYZA 2CZ6B 5F1XA 2BHYA 1JI8A 2HVIA 5FDLA 4R55A 1ZTRA 5AYFA 3S2DJ 3NCIA 2GXBA 4JRQA 1SKWA 3CLQA 5LJ5j 4A93J 3HT3A 4FJJA 1YJWN 1I3AA 2BGGA 4X9CA 1X4PA 4Y15A 1FLIA 1WWXA 2XB0X 2E2NA 3BLYA 2NRHA 2JVVA 5EEGA 3GBTA 5EZHA 4PHTX 3HC7A 2EZHA 1FYKA 1NK8A 2Z99A 1TKTA 2G8UA 1VQPN 2I0NA 3FB9A 4E2FB 1Q86C 3VUZA 3F21A 4IXAA 1MBEA 1JXOA 2GUIA 3M55A 4RCHA 4R5PA 3EZWA 3GYHX 2VT2A 2WBNA 4IG0A 1GDTA 1NKUA 3MMYB 4U0WA 4U88A 3D2FA 1VQMA 3HJEA 3WNFA 1IN4A 2WWYA 2V52B 4KULA 4Z4FA 2DFIA 4XRMA 2OC6A 2A6TA 1WHKA 2VOOA 1YX3A 2V1XA 3LSGA 1JJ2A 4M3YA 2P84A 3S9HA 4N4GA 1PCXA 3EQLF 2K02A 2DOAA 2HHWA 1D0XA 4LOCA 4AF1A 5IOYA 3A8LB 4Y1DA 3UE5A 4HUEA 1NKEA 1LFBA 3L2QA 3DLGA 3B02A 3CCQI 1NG7A 5KYUB 2LCSA 2HVQA 2R5YA 4EJZA 5D6YA 1WUAA 2QEXN 1JHFA 1R58A 4KMUX 1BI2A 3VGLA 3DLLA 3HM9A 1BC8C 2EFOA 3WGGA 1UAAA 5LGNA 2J05A 1JJ8C 1TYQA 3K70D 3ME9A 3EL2A 4W5QA 1UG2A 3OL4A 2HL5C 4IF4A 2ZSIB 1I0CA 4HQEA 2P9LB 4XRSG 2IS4A 1MGQA 3E2UA 3L4IA 1T2KA 2P81A 2RQVA 5L3FA 4CK3A 1VQ9T 4ZGEB 2YUPA 2W0ZA 4C8QG 3DPTA 2ZC2A 2VC8A 3LH0A 1NK9A 3K0LA 3VFZA 3S1NJ 2TCTA 4JKGB 3TR8A 1E4FT 1MBFA 1ZELA 3VQDA 5L8RE 2BW3B 1I07A 2HKXA 3QYBA 4A4FA 1PDNC 4M77F 2FC0A 3KLNA 1VQLQ 2JTVA 5LHIA 2DA5A 4BQOA 3RJPA 2BVMA 2K9SA 1NJIC 1YQLA 1YQRA 4EP5A 3CWTA 2LQNA 4L9TA 4BGBA 2QASA 4B3XA 4A3DJ 1VQ6T 4CESA 4CF9A 2ADUA 2NUPA 1YYVA 2QQ9A 4CZJA 4BRNA 3E0JB 4A6DA 2HHSA 3MKDA 1ZN2A 2KHOA 4IEIA 2X1EA 4LE9A 2KKZA 2HW3A 3LWLA 2P5VA 2IS6A 1R49A 4JRKA 1YCYA 4CRIA 4M63C 4HDVA 2YUSA 3EHQA 2LCCA 2VXFA 3GLLA 4Q48A 4KN7X 1R7JA 3INZA 2AKLA 1I5LA 4AT1B 5E26A 2AA4A 2FOWA 5ICGA 2VYTA 1VSEA 2OTLT 1LWVA 1N75A 2L3PA 1YLFA 1Z67A 4CZIA 3H45C 3EKSA 2L8DA 1T98A 2O88A 3JRBA 1IXDA 3C6HA 5GAMf 1X43A 3PSFA 4EA5A 1F1ZA 1VQNN 4OIOF 3VEYA 1WLPB 1K73C 4EIKA 2BBYA 1JHHA 3QOEA 2P9IA 3M8EA 4CHPA 3BG5A 3EPZA 1IG8A 2DA2A 3KKSA 1ZLMA 1BG3A 1PRMC 3QDFA 3VS1A 1M1EB 3O8VA 4H4OA 3J81Z 3NF9A 4G9YA 3P5JA 1GRIA 3R6SA 3K2PA 3EO3A 3IC7A 5ICEA 2CZ7B 2M8GX 4R79A 9ATCB 2R7WA 3H0HA 4FVMA 5KPZA 2RO0A 4LF6K 4OLBA 1IRZA 2QKLB 5K5QA 1T56A 3MWTA 4YDUA 2KT0A 5I2SA 4B9LA 2KY9A 1HDPA 1G8XA 2EZIA 2F2VA 2RKIA 4K0KK 3H0GJ 3VQCA 1VQNA 2EAYA 1RBTA 4YORA 4CECA 2DYSH 2AXLA 3EY1A 1LPLA 3JCMg 4CJ3A 3RERA 3J7AF 4HXJA 1UDLA 2E65A 3T8RA 4M3TA 4FYWB 5AQGA 3PGGA 3V9UA 4M6VA 1NK7A 3HL2A 4RTXA 3B73A 3G3ZA 3OYDA 2E1CA 4KPYA 2V1DA 3M0QA 1ZA2B 4RB3C 1CQTA 4AWXB 4CHOA 1UECA 4RB0A 3O1WA 2XY5A 1C0TA 1QVGP 1SVMA 3ZQHA 2CUZA 3JXUA 1E7OA 3JRGA 2A36A 2P5KA 3C3WA 4EZ6A 4BVPA 2C0TA 5AQUA 2NLXA 5JLWA 2V8KA 1YITA 5FKLA 1BOBA 1GUUA 1MKMA 4J2EA 4ZDPA 3G6EI 2EQJA 4MEXF 5AQIA 4LF5K 4DV2K 5CJ9A 1QZ5A 3BPXA 4R56A 3FZKA 3TP0A 2ZQBA 3ID6A 1P9QC 3I56A 4DV1K 1L3TA 5AQWA 3BF1A 4C1NI 1KA8A 1R00A 3UR3C 2NRRA 4DYRA 3GF5A 2DILA 3RKWA 1R59O 4MMKA 4BHPA 3HOTA 3I35A 1YT3A 5IT9E 4KBMB 1OMIA 1YIJQ 3SEQA 4PK4A 1FOYA 1LWCA 2D2WA 1NH3A 5FPMA 1SAXA 1XPXA 2KEAA 2ZJRF 1WPKA 2LYCA 4WYBA 1RAFB 2DXUA 3AVLA 4BRDA 5CHZA 3SWNA 5JHUA 2CYYA 3A5ZB 2LD5A 5HROA 1NBWA 1WEIA 3FRNA 5E1XA 1XX5A 4RUGA 2I7PA 2D5RA 4X66K 1N78A 4B6MA 5AQLA 2D1KA 3DPUA 5C2DA 1KQSA 3DOLA 1Q95G 2F5VA 1NGAA 3A5LC 2OAUA 1LQ1A 3QIOA 1OH6A 4ELVA 4AVPA 1D1BA 3FSPA 1NJIO 1OX8A 2GEMA 3M8PA 4NCBA 1MMSA 1OZ3A 4IQ4A 4FW2A 5C4XJ 3AARA 3WODF 3QIIA 3M8QA 4C8NA 2R7FA 4FE7A 1SFEA 3P4IA 3DLBA 2FBIA 4XU2A 5AQHA 2OAZA 5GAMd 5JLXA 4NDLA 2E6ZA 3NF6A 2D6FA 5IXBA 2OV7A 3CF5L 1D8KA 1W4SA 4IOAF 2O4XB 2IGOA 3EFOB 3K4MA 3IH7A 5I11A 2DA4A 4CF2A 4OAZA 3P8BB 1VQPI 4ORZA 3ESWB 5D5UB 2DLPA 1XQOA 1P7JA 4RTWA 4CZHA 1P4WA 5FKOA 1KAZA 3THVA 2JMAA 2B63J 4JRPA 3JYTA 1UE9A 1HYVA 4CFBA 5TKYA 3F5TA 1ULYA 4I9QA 2XF5A 1W2BP 1YJWI 1PVSA 4OMMA 4GFBA 1ZSZA 2G3RA 1FP2A 3WTUC 1ZBSA 5C4JJ 3R61A 1STZA 3BF3A 1KSPA 4G7ZF 2HHHK 1YJ9N 4WXCA 1QVFM 1QZEA 2MD5A 2RJDA 4F17A 5KYYA 4CDGA 1EWRA 3CMAN 3HTSB 2G7HA 5AQTA 1LE8A 5CY4A 1OYIA 3HG9A 5GAMe 4UUTA 2QSGX 3LDNA 2R93J 4OB1B 3T0YA 1D1CA 2YX6A 1PD1A 1YJNT 1S8NA 3B6AA 4EVVA 3HXMA 3WXKA 1D9FA 3NGYA 6AT1B 2UZKA 5CYQA 2M1BA 2Z16A 5CAIA 4A62A 2XKOC 2X6NA 3HTRA 2HF3A 2Z1GA 1Q7YR 3G4SA 1V4RA 4LK0F 3CFRA 1KQSP 2LREA 4CXFA 3O8HA 5LGTA 1M1FA 4IFEA 1ON2A 5GAN2 1YJNQ 2VONA 3GX4X 5GJWB 2DTOA 2FRYA 5HS8A 5DTDA 2DL5A 3NGZA 3ID8A 3DLEA 2KT1A 4DBRA 2RHXA 4IUTA 3IAYA 4M41A 1EH7A 2QTDA 4PJNA 5DDGA 2JUFA 4J8FA 1OEBA 4MQVA 1QHTA 1PU8A 3F8NA 2O8BB 1MNMC 1XOVA 1CF7B 1JGSA 4EHUA 4RGUA 1TT0A 2PNIA 3I55A 3KHYA 1U04A 1W4MA 3RMCA 4PZJA 2BUDA 4KJZA 4F04B 4IRIA 3HK2A 3NBPA 5M1OA 4L5JA 4FO0A 2XAGA 3OBYA 2LBFA 3FJ5A 2R7VA 1OPKA 4W5NA 1S3XA 3DLMA 3IWZA 4QIWN 4OU0A 3KVGA 1FPQA 1DLOA 4AFSC 1XNRK 4AHTA 3ZX2A 1I6HJ 1B92A 4RBOA 2W48A 5DM7L 4DK9A 5KHDA 2OBPA 3JRCA 3QPSA 3ZMZA 1J6ZA 4BYYA 3CD6I 2MPXC 5J2NA 2K5IA 3I8DA 3ZSOA 3KETA 1RT6A 3ENHA 2VQLA 3EYZA 3Q9VA 3QKJA 2Y0SN 4B9QA 1IGUA 1EX4A 3F3XA 2P5GA 2P9UA 3BTJA 2NS7A 1IZ6A 4BHBA 4LDWA 3SI6A 4CFDA 3I8BA 4ELZC 2OYQA 4DJAA 3H46O 4HVJA 2FF3B 1T6CA 2HU9A 2ITGA 3DTIA 5GAHJ 3T1AA 3K0SA 2L7ZA 2LC2A 3I55N 1YS7A 1OQYA 2LRQA 3I3LA 2O8CA 1HKSA 3K7AJ 1J54A 2K57A 1QHHD 1D8JA 4AIAA 1NG6A 3CC4N 3VPRA 2YKMA 4AILC 4NQWB 3LGLA 4J9CA 4JJBA 4QQ6A 3G0QA 3OH9A 3VQBA 1HSTA 5KH6A 4L5IA 3ZT2A 3BR2A 4UVAA 4ZYHA 2J4RA 3DV8A 1LOJA 5CQXA 3HKSA 2L3RA 3MN6A 1WXTA 2HOAA 4NYNA 4DSFA 3FZHA 3BY7A 1VSFA 4IQJA 1VQ9A 4OAYA 3S3MA 2DF6A 2L3QA 1J75A 3RDIA 3JSOA 1KSWA 4AC0A 2KT8A 1Q86O 3IP4B 3CC7A 4Y1CA 1TK0A 1QKXA 2E34A 1QMCA 1YQKA 3K57A 3EGXB 3P7NA 5LJ3j 2MIOA 5K7FA 3F6VA 4M78B 4C8QE 5AQJA 1YTUA 3A5NC 3J7ZI 1L3LA 4V2SA 1JLAA 4UXNA 3JTHA 3MK6A 2I2LA 4RW8A 1T6SA 5LJ3d 1W6XA 3AA5X 4ETSA 2HXOA 1Y1WJ 4AHCA 1IXRC 4PL6A 2DMQA 2HBJA 3QODA 5F1RA 2DXIA 5GANh 2RM4A 3KLGA 3A0IX 3L3VA 3LSJA 3WNEA 4RAFA 3D5SC 1SEMA 4GV6A 4KT5C 3PX4A 3BT9A 1GCQC 1QQCA 1K4SA 1JUPA 1E6GA 1Z3XA 2X4XA 4J9EA 3VS7A 3RVCA 1MDUB 3JRFA 2JVGA 4JK7A 2CQQA 2KJBA 3ULEA 4EJOA 1O4XA 4HKEA 1KU2A 1ARKA 5AZJA 2LMDA 1SRMA 4QTRA 1VQ9Q 4C0ZA 2DBBA 4BRFA 2EINH 5HNFA 5EVZA 2K3YA 1QQOA 4M77A 3GZNB 3LGFA 3ERED 3PFYA 3PFSA 5FWCA 5I9EB 4ZN3A 2VJIA 1Z6RA 3V1QA 1GT0C 2F7TA 1LV5A 5GAOm 1B34A 5DK5A 1VQ6A 2ZXWH 1GBQA 3VKIA 3NTKA 3BOQA 4C3IJ 4O0IA 2DL7A 2KE9A 1EFNA 1TSFA 2HBMA 1ZC6A 4M3ZA 1SKSA 4BVOA 4C92A 5DEQA 1GCPA 1YUWA 1RR7A 2JUGA 2Y30A 2BTFA 5KYWA 1T0FA 4NCGA 4PKGA 3SUQA 2Y9ZA 1NG2A 1SKRA 2KRMA 3CUQC 4BG8A 1ZX6A 4M77E 3PNVA 3TTFA 2Z33A 4LUEA 2E4LA 1NHAA 4C30A 4J8OA 4C5EA 1EV7A 1AZGB 1FSEA 3EG2A 5F08A 3OYAA 1WFXA 4ZYEA 1W0UA 1FTTA 3UNGC 3QO3A 1XHZA 3DEWA 2L7MP 5KCHA 4KISA 1W70A 1KYWA 3MN2A 4KTQA 2R5ZA 4I6MB 2GIZA 3VS4A 5L3BA 5FROA 3CFPA 3JAMZ 1OLTA 3VQ6A 1K61A 2DK8A 3BFMA 3VRYA 4CEOA 2BHZA 2ESNA 1AA7A 4AYBN 2LVMA 4DTPA 3PIOL 3LNQA 5IP7J 3ZETA 3N5NX 3H36A 4D9JA 3RKQA 2I8DA 5FO5A 1RT5A 2HOTA 5HRSA 4CZMA 1YTYA 1QSLA 3WT0A 2FRWA 3CC2A 2F5FA 2PMZN 2VPRA 2CT3A 1D3BA 3DAWA 5HODA 4E7LA 2H8WA 4AHSA 2HYJA 2YLCA 1NOYA 4LDUA 3JCUC 1OISA 3E9FA 4D0PA 1RTDA 1WQ2A 2DL3A 1ORKA 1R1UA 1YW7A 1JKRC 2W84A 4M42A 4KA4A 3D4VA 2JN0A 1MV3A 5J4VA 3WG9A 4DFKA 5FKNA 2HHVA 1CXUA 1U48A 4AIHA 3WTVC 3QSUA 2YS9A 3TO9A 3GIBA 3J8AA 2AZSA 2OPSA 3H08A 1M2VB 2O4GA 4BACA 4UQGA 4OLAA 3MZYA 1RT4A 1LWWA 2JZ2A 2DAOA 2I7NA 4C8MA 2E19A 4BKXA 2PI0A 4E9FA 2OQGA 5CKTA 2K5FA 3VQ4A 3OW2A 4EMKB 3KEQA 4LFAK 1FOKA 1DTTA 2FU4A 4FWNA 5F0XA 2H8RA 5AQZA 2JZYA 4CGHA 2OPPA 3N5BB 2UU9K 3HO1A 4N4NB 1HSJA 3GTGJ 2JM9A 1JL2A 2HR3A 2EFNA 4E19A 4LDVA 2E60A 4CF1A 4N9HA 4G1QA 3THYB 1VAZA 3FXLA 4M7AE 1D5VA 1YIJA 1I1GA 4E7KA 3EHRA 1YHQQ 3DWLE 3KK2A 1PC0A 4B23A 2M4KA 2QSHX 5A2QO 3I54A 2GOMA 3AVMA 1U3EM 4A3LJ 2Z1DA 1WSHA 1TUGB 4NL3A 4RW4A 4MQ9F 4AFQC 2G8FA 4DR4K 4ZTFA 5CVJA 2H6CA 3GW2A 5GAN8 1QQIA 3AHUA 2CRGA 4A5BA 2RQWA 1NGFA 3KTUA 4DTJA 2X3XD 4N9IA 3BR6A 4ZZLA 4CUGA 2P4TA 2RMOA 3AO2A 4R1HA 1MUNA 1MHNA 4ZN1A 4HX7A 3KZIC 2GBQA 2DTHA 3MCPA 3MAQA 4XLFA 3G73A 3FHZA 3KZBA 5BRFA 3U9DA 1XJWB 3K5MA 1P4AA 1SD4A 4M7DD 3D45A 4NLBA 2JLEA 2JTEA 4CJ4A 1E0EA 5IN1A 4XONA 1GLEG 2COWA 3ABKH 4UVBA 2QQSA 2L7FP 5FD5A 5HS9A 5IH2A 1X3ZB 1A31A 1WXBA 3HVRA 2V6CA 2GFAA 2WADA 2IRFG 4FSVA 2OFIA 3WVDB 1GXIE 2Z2SB 3RYRA 3J7YP 1ZYRF 3M8SA 3QYFA 1QSYA 5AQFA 1Q81R 1YO5C 1OQKA 1MDMA 1ZKGA 5F1JA 3BWGA 2G7UA 1R77A 3L1AA 3RPUA 1H8AC 2AXTC 3S3NA 3HFNA 2X1CA 4OB2B 4ANJA 2RQRA 1N9SA 4UVCA 1RBVA 4E7JA 2MG4A 2RV8A 2CGKA 4AVZA 5BPIA 3OA6A 3D1NI 2X35A 2JGUA 1UWBA 2PZ1A 3VSLA 1IKXA 1U84A 3ZMSA 5EF6A 3BTCA 3BY5A 4ILHA 4CEEA 5ICFA 4M72A 1KG6A 1S7OA 2DBMA 1ATRA 3MEDA 1JLQA 1VQMT 2GX9A 1PRLC 2ESWA 3DKXA 4XLHA 3O3KA 2ZXJA 2XAFA 3ALYA 3TSZA 3AGKA 5CVRA 3ZT0A 1JLBA 4KH1B 2EA2A 3S41A 4XN3A 3R3LA 3I59A 3PQKA 1U47A 2HDWA 2JA6J 2LX7A 3AG2H 2ID3A 5ILSA 1TC3C 4DQSA 1WI9A 1UAXA 3K1NA 3RBBB 4M78E 2XMFA 4C92B 1OU9A 1ORNA 2PBIA 1W0TA 2KGTA 2OANA 4B3AA 2K2MA 4DV4K 1JLFA 2HVRA 1QQMA 1D09B 3BY6A 4WQ4A 3D2EB 3GFIA 5MLCQ 4PQUA 1TWCJ 4XMYA 3E1YA 2L9RA 2QTVA 2VCPA 4IUPA 1S1TA 5D4SA 1VQNI 4M3GA 1Y1VJ 3KP3A 1UGPB 2LT4A 3CCEA 4CGIA 3GTQJ 2GXAA 2BKDN 5J39A 2MABA 4A5AA 1RRJA 3I55Q 4B09A 1H9GA 3J80E 2P9KA 2H3JA 4LFBK 4HPQA 4FETA 3QPTA 2NS0A 1YI2A 2YV0X 2GWJA 1FTZA 4HF0A 4X9DA 3G2BA 3ZSWA 5EY4A 1TZLA 4B1WB 3DKYA 3TEDA 2PYLA 4BRCA 2YX7A 4M75D 5J8CA 1HYZA 4MO5A 2M87A 4RAGA 3M5RA 3CCLN 1LVAA 1DU6A 3BR5A 1H89C 1W0HA 3JR9A 4JJCA 1OH7A 3KX2A 1N6AA 3H9GA 3ZEHA 4OKKA 2CMPA 2A1RA 1BCMA 1XB4A 2O8BA 5E3MA 1Y96A 3EYYA 2EGCA 3MN5A 3I9V2 3BZKA 1KG3A 3V7CA 2DY4A 2E71A 5E20A 2BE7D 5KQDA 2GQIA 5IAYA 3OYGA 1AWOA 4WX9A 2YDLA 1SSHA 1KO9A 2F48A 5CVIA 1YBYA 4OPHA 3BUZB 5EDNA 3ZX3A 2QQ8A 3SDBA 3CWUA 3LFKA 4BR5A 3JAME 2O8FA 4IJAA 3A8MB 1LJ9A 4EJVA 1BN5A 3P9IA 4C92E 4QLCU 3QDRB 2ZJRL 2XGCA 1YITI 2D4WA 2B5JA 3HOSA 3CCVI 4BR0A 2Z1JA 2X48A 3MAJA 1DP3A 1MBGA 5DYMA 4FT2A 1N5YA 1A5VA 3PNYA 3PV8A 2R3SA 2RK2A 5KE3A 2XHBA 2ZPHB 3S14J 1ZUKA 1M27C 5D5WB 4IL6C 3U21A 2UXCK 2ZMEA 2R7QA 4QVZA 3SYZA 2LRDA 1VQ8Q 4A0XA 5GAN6 3GNFB 1R4MB 5LJ3g 5KYXB 4FZYA 1Y97A 4XLNF 1KHCA 4HF1A 1U6ZA 3MXJA 4FQGA 1J2XA 5D8LB 3AAQA 2X51A 2OD5A 1TLHB 3CYMA 1ILYA 4XOTA 1WLJA 3LMMA 1VQ8T 2KRNA 2DJQA 1O3TA 4RCBA 2FNPA 4C8QA 2O7OA 4HEA2 2L02A 4YFKF 4ISGA 4YFUA 2XGDA 3MZHA 2BZXA 1DIZA 3M53A 5F27A 5AQNA 4EZ9A 1O7LA 2RA2A 2WB1N 3GLXA 1NPRA 1GBRA 1VQ7I 1VQ8I 5K7HA 4ID5A 4JKBA 3CMAT 5FGMA 2NWMA 3LAKA 3ZGKA 3F2KA 3DXJF 3LP2A 2KL4A 1RAEB 2VPLA 2D0BA 1HJDA 3ZEUB 2LBFB 4DKWA 4CZEA 3GTLJ 2AJQA 1NJIR 4WWCA 3K2ZA 1N25A 2ABLA 3FMQA 4Q5SF 3LM9A 3CMMA 3HOWJ 1GLLO 3GNGA 4EMGA 3CF5F 3A1PA 2W40A 2V1UA 3M1EA 3EN9A 2G8WA 2LZ6B 2EGEA 4X64K 2BDPA 1DGWY 1BO5O 2HFHA 1K8AO 1RAAB 2NUTB 1VQ7Q 2HPMA 4KITB 3LSMA 2KDZA 2Y69H 4NHJA 1WJRA 3OS5A 5KYWB 3K4BA 2W4SA 4IWVA 1VYTA 3CF2A 4O6JA 2W6KA 1KQ0A 3MO8A 1NM1A 2V7ZA 2QYOA 1H1VA 5C3EJ 2CDTA 2QG9B 1W5SA 4C2MJ 3HXLA 4IOAL 2COBA 1BU6O 3VYRB 3A5OC 4FJGA 3TL4X 2E1NA 3SAHA 4ESFA 2MH9A 2Y75A 4PUOA 2ZWHA 2KXDA 3REBB 1GV5A 2L4MA 3VQAA 3ABUA 3L42A 5B5EC 1VQ7T 1IG7A 4N0AC 2ZPEB 2WC9A 2KZZA 1QBJA 2RNGA 1YJNI 2Q0UA 3VENA 1A36A 1Y96B 3OSVA 3W3CA 5GANe 4B3MK 2FPDA 4WFAL 2WUSA 1V1CA 3CC7Q 4Y17A 4FLXA 4KHNA 3DQVC 2X78A 1ESVA 3TOAA 3HPWA 4CZKA 4IVNA 2K27A 1N8RC 3D2EA 4LMYA 2E1HA 1BI3A 1NJYA 3EE8A 5A2QK 2CP5A 1YITN 2LY2A 5EYRA 1UTIA 3K10A 5H20A 1ZHIA 1DKGD 3OMCA 4JEPA 4CJ5A 4G7OF 2DAQA 1JTYA 4A12A 2O3FA 3F0CA 1UCRA 4JS5A 1VQLI 2D0OA 2KIQA 4XU0A 3RRGA 1RRSA 2CV0A 2F69A 2KPMA 4O5BA 1YAGA 2NYSA 4RG2A 1PU6A 2ELHA 4DTRA 3C0BA 2DIGA 2WC2A 1K8KA 5CYMA 4DTSA 1NJWA 1MIJA 4Z4EA 1W7PD 3OYCA 1ZGAA 3CD6Q 1SAZA 2Z1IA 2AZVA 2YWWA 2O6GE 4DF4A 3I0RA 2JS0A 1BI4A 1S72Q 4DV7K 3CCQA 1UMQA 2RGVA 2O2OA 2EBIA 3CCLI 1M3BA 1BIBA 1DTQA 1UGVA 4JZ4A 2DZCA 3CJQB 1JE8A 1BYMA 3LL3A 1KU3A 3IG1A 3K6GA 3CCJN 3DBLB 1S1VA 1JCEA 2XRNA 5HLTA 3SBGA 3FISA 4FJ5A 1X75C 4CH7A 4ILJA 4ZGJB 5CHIA 3HTUA 1T3SA 1SS6A 5J3BA 1YOVB 1VQMI 4CGGA 1RL2A 2R7YA 3DRSA 3VWBA 4IOXA 4JUVA 3R0AA 3TTCA 1T44A 1HCRA 2CG4A 4A3BJ 3R1XA 2EYZA 4CJFA 2OX7A 2VYPA 1TQPA 2WV0A 2VODA 2LJ3A 3WEEB 3O1BA 3OYJA 2HKNA 4EJTA 2RN8A 3ULDA 3CJNA 2MD0A 5FLXO 3OYFA 2TDXA 1LCUA 5JLHA 3I64A 4K2EA 5DMRA 3ELKA 2HVSA 3HHTB 4JK1X 2FMYA 3F22A 2NOZA 4JDSA 4CJEA 4MEYF 3VGKA 4M7XA 4RGRA 2GCXA 2JTFA 4HLXA 2BE9B 4LC9B 1ZBUA 1MU2A 2FZGB 5LJVA 1BQMA 2NVXJ 1X1CA 4XOPA 1JKQC 3CP8A 4B24A 1WHLA 2CH5A 2ACJA 1IN5A 2E4HA 3L2RA 1UG1A 3URGA 2VQHA 3TSWA 1Y64A 5J1RA 5HLHA 2QEXA 2QDLA 2HEOA 5GAOl 2X6XA 3TO6A 2XG8D 2A5XA 2ASMA 2I10A 4YDUC 1KVAA 5BN9A 4YHHK 2HB5A 4FJKA 3E9OA 4BRGA 4F4KA 2DK3A 3EGDA 4EP4A 3HSBA 3LAJA 1Z1DA 3HP9A 1WJSA 1FYMA 3CCVT 2CQNA 3ITHA 1D5YA 2ME0A 5LHHA 2PQWA 2E8AA 5CKDA 4CZLA 4FK4A 4KRTA 2DPNA 4JK9A 1KQJA 5KQ8A 3PNWC 4IHYA 3ZSVA 5H6QA 2QA4T 3G6ET 1RILA 1AWJA 2BE2A 3ECHA 4FWLA 3K1MA 1FMVA 2KYMA 4IO9L 4BEHB 3NFCA 4CF0A 3IH2A 4CYDA 3G6EQ 4FVUA 4F92B 2P1JA 3KYCB 2BZ8A 3R6MA 5D6WA 4OKEA 4LF8K 4PDKA 1RUNA 5LEKA 3M59A 3UKRB 1RNLA 2QAZA 2P0PA 3J80Z 1D0YA 3FGUA 3W6JB 5AQMA 3NAUA 3SZTA 3A5MC 1KC8C 1SD5A 3PIOA 2LC4A 1C0UA 2RK1A 5GMKh 2AO9A 1OR7C 4WQ5A 2KDOA 2X6WA 3IKMA 4Z02A 3SUPA 2FQ3A 2ETJA 1FY7A 3EZ5A 1VHXA 4IJNA 3D6RA 1RIOH 2FSNA 1RKWA 3FZVA 4D1QA 4FSXA 2DEUA 3BDLA 3O3HA 3PLAA 2V1NA 3THXA 4CJUA 3RTRA 2WB1A 2O8EA 2EYQA 1RNHA 2FVUA 3H41A 4MNUA 4BBRJ 4MDBA 4JV5K 2UYTA 3I55T 3GBQA 1A6IA 1FKPA 5C44J 1SRLA 4G94A 4Z4GA 5BRHA 2JRMA 5FLMJ 3ZQIA 4FIBA 3SHWA 3QEIA 4KI6A 1MMAA 2L9SA 4TV7A 4O4GA 2VWJA 2W1OA 1UFMA 4K41A 4GV3A 1YFHA 4XH4A 1G99A 1HQEA 3DPLC 3HIFA 3OIOA 3BQYA 4DU4A 2HNHA 1O7FA 4BJ5C 4E47A 4H0EA 1QVFS 4YTLA 2DODA 3BEXA 1OPCA 2NLUA 2E5LK 2COYA 1C0FA 2C0OA 2JQ7A 3W3DA 1Q86U 3OBWA 2YRDA 4YRVA 3MJXA 5FU7C 4QS7A 1F36A 4M7AG 2VL8A 4O55A 1KFSA 3VPZA 3THWA 2F5EA 1UB4A 3CCSA 4BNCA 1T6DA 2XGXA 2YNFA 4RLFA 3EAEA 2UUAK 1NM7A 4LLNA 2D5VA 4D6WA 1Y7XA 2EQRA 3UKRA 4L18B 2JHJA 2QGUA 1X9JA 1K9MU 1RACB 1WQ7A 2O9SA 3ZN1A 1FK9A 3ZSZA 3OYNA 3H6EA 5CQGA 1UUEA 1LOTB 5GAGJ 2G8HA 1LW2A 3WXMB 4JI7K 1Q9XA 4OFHA 5KGXA 1WIEA 1H8KA 4BC3A 1B7TA 3A2KA 3RR7A 1NTCA 1ERDA 2O8KA 1YQAA 3CQYA 1NJIU 1E17A 2ZD1A 4J9HA 5LBQA 2QTXA 2X3WD 1YJWT 3OIPA 3FEOA 4CCMA 1G6NA 4E9GA 1G5VA 2DQRA 2Q31A 2CFOA 1SZ2A 3KPHA 2A3LA 1HNVA 3FBIB 3B8AX 1KQ1A 3JRAA 4LB6B 2ZKZA 2PFBA 3F8CA 3VJPA 1C1BA 1YWOA 1EQYA 3R2XC 3DB3A 2IVWA 1ZG3A 5FU6C 3KTQA 3EGUA 1SAUA 3TU4K 2K9LA 1M5Q1 3CCUQ 2QVOA 1X3NA 2VQGA 2Q2EB 2DTUA 2DN0A 2L5QA 1RDDA 4M71A 4JS4A 2JG6A 4OPKA 2N8GA 1E2XA 4DOZA 2OTLQ 1QKWA 1XWLA 1IJWC 1E3MA 2A05A 1G3SA 4LD0A 4LK1F 3BG6A 4JNEA 2IEKA 5FFZA 3LSHA 1XG1A 2HQAA 2OTJI 2NRWA 3AFHA 5JFRA 1U45A 1RDCA 2EFIA 4DU3A 1LJOA 4C92F 5KI6A 3QO9A 2YRVA 2CS7A 1Q7YO 3ABTA 4JQFA 5DUKA 3FKIJ 5M3FJ 3VEXA 1QCOA 4U87A 4B48A 3JB9G 4PL7A 3M3ZA 2JSCA 3VSKA 1XC9A 3LAPA 2JWKA 3TP3A 4OFEA 3A8GB 4JKDA 1IV6A 2DXTA 3FXQA 2ISYA 3RZOJ 3GL1A 1LWEA 5E8IA 3VQ5A 1W5CC 4HCZA 2XDBA 2DTIA 3C6UA 3E3VA 2ZM6K 3DF8A 5LRRA 4YOWA 4YOTA 1NK4A 2ZJQF 3KIOA 3PMTA 4BQNA 3M0SA 4B47A 3VS0A 2XB5A 2M7BA 2QI2A 1VQ9I 5HLIA 2R58A 4RMNA 1SL1A 2XRLA 2HDCA 2OTJQ 5FKMA 5CE3A 1KD1U 3TAPA 4ZTJA 3EGDB 1Z25A 4B9UA 3A2FA 5KRTA 4Q5VA 4ENNA 5CQYA 1QVGM 4G6TB 3EH1A 1VSDA 3LDLA 5JS1A 1IN6A 4QS9A 4ZZDA 5GAMh 3I0WA 4IRHA 3EETA 3OS1A 1P6RA 1L3VA 2R7UA 2MMPA 1L3SA 2K40A 1D9DA 2XIGA 2E2PA 2CGLA 2VC0A 1ZUUA 1N34K 4IHXA 4P9FA 4QCLA 3VV0A 5AQXA 3P8DA 4OMFB 2HZTA 4B3RK 1NPPA 4IURA 3VYHB 2ENMA 2A1SA 3P9CA 2UWMA 3CCST 2STWA 1ETWA 4EJYA 3EFOA 2F6CA 5M1FA 1YHQN 3OR1C 1W5TA 1A35A 1X3MA 4KBOA 4RAZA 5AQQA 3O80A 1R5GA 4WQ4C 1AOJA 1BL0A 1LW0A 3J80K 3M9QA 3RQIA 1K9MR 5EGOA 5E3OA 4FE4A 1ETKA 2OTLA 4CC2A 3HTVA 2A3ZA 2A6AA 5BR9A 4FLWA 1S3JA 3VDXA 1QP3A 4DR5K 1U5TB 4XRFA 2VXDA 4RDUA 3E6CC 4PKCC 4G9ZA 5AJ3K 3SQ2A 4M75E 5FPDA 1WJDA 3P83D 3FXMA 3VEWA 3CCUA 5BS6A 1JO8A 1RI7A 1M8VA 5B1BH 4BXUA 3I58A 1MW7A 1VQ7A 5FLXZ 4HVWA 4N4OB 3G1LA 4UV8A 4Z4IA 2OTLN 4JBAA 2KMUA 4JN4A 3ZQLA 4Y13A 4U7DA 1JU5C 2E10A 1OPLA 2QA4N 4HYEA 2XSDC 4JKGA 1PVEA 4Y91A 4EHTA 5HOOA 1WSEA 2DPUA 3DTKA 2M51A 2M34A 2A68F 1SFUA 4AFUC 2K86A 2VGMA 5ADXA 1M3CA 3VS5A 4F2SA 2BH1A 3VEPA 2C6YA 3AG4H 4BRQA 2M2EA 3SQNA 4CCKA 1Q7YU 2D9TA 2CYZB 3IMXA 8ATCB 2FX0A 2X4YA 3CIPA 2AP1A 2O9LA 3OV8A 4E6RA 1B59A 2BTTA 4IEEA 1XMAA 4JD2A 5BMZA 3IFRA 3O9UA 4N4HA 1BB9A 4IHSA 3AVIA 4E89A 4BRLA 4A4KA 3M1CA 3G71A 2JSPA 3AA3A 2IC3A 1OI1A 1FX7A 3FF5A 3ER0A 1EETA 1OKRA 3QZ5B 2YX4A 1WHHA 3MEEA 3KLOA 4AG2C 3N4PA 3TAEA 3KK7A 4EATA 5E41A 1HKCA 4F7UG 3I0SA 4PJMA 2PJRA 1VQ9N 4IKFA 1Q8IA 1C6VX 1Z6TA 2PTKA 4DBQA 1FBQA 1GVDA 2OPTA 2X85A 2R0QC 1RDAA 5KTQA 3S1MJ 4YELA 2UXBK 1KAYA 2KW4A 3S93A 5IOZA 4FU6A 1UHWA 3IDHA 1IXSB 2IGNA 5CO7A 2PUKB 3NHNA 2FEIA 3JB9D 1Y57A 3T9NA 2ZXHA 2J6KA 5D6EA 2DTRA 1XS9A 1T3VA 1IV0A 2IIMA 3HYIA 5IP6A 4CE9A 1FC3A 4G7HF 3JCMX 3JCMf 3UKGA 4YNQA 2CW7A 1TP4A 4J01A 1IN7A 2LNVA 4JZ3A 2OZ6A 1ZXOA 5C10A 3V42A 1HR0K 2QGGA 4DG1A 3M8RA 1ZH5A 1TAUA 4JLIA 2YCHA 4JKFA 4BR7A 2BY3A 3UKUA 3L3UA 2A28A 3UB5A 2DZ9A 3I4PA 3VA0A 2O01E 1M4ZA 3F8MA 3Q3SA 4C2UA 3PUFA 3COAC 2M1HA 3DBHB 2JA8J 3VGMA 1TU0B 2LF8A 4J2AA 4I2PA 3VYUB 4PKHA 3JAMO 4E70A 4PJOG 3OTOK 1TTYA 1XTAA 2H3EB 2EYYA 3NVMA 2LVSA 4XK8E 3MEAA 1TUUA 2K6DA 1QWFA 2GTDA 4FWOA 2OTJT 2PMUA 1WSJA 1O13A 1QNTA 3OYBA 1T0FC 3WEEA 4NO7A 3RPQA 5DM6F 3CVTA 1HW1A 4AH9A 5L3EA 2BANA 3CMAI 3HOZJ 4DSLA 3AY9A 2CJJA 4X6AJ 1VQ5A 1VQ5T 4EJUA 4LGWA 2M9HA 2DL4A 3MKLA 5GAOq 5FWBA 3RMSA 5GINA 5AR0A 3RI4A 2DLLA 1C0MA 4W1UA 3IS9A 5J1UA 4H5TA 4OGCA 1QO0D 4M6YA 3VMFB 2EA4A 4M7DA 1NZ9A 3NH2A 5BQTA 3JB9J 1IUYA 2ZFWA 2DFFA 4JX4A 1HUXA 1ZK8A 3A01A 3IH3A 1Z9QA 3CO6C 3IAS2 1JXBA 1JCFA 3QB0A 1EBMA 2E2JJ 1YJWA 1K6OA 3RMBA 4JI3K 2VQFK 2XGEA 2LFBA 3M07A 4M45A 1ZSGA 2KZGA 3KWGA 1B9FA 4LN2A 2V9VA 2VKHA 2DERA 2RB6A 2YUQA 1RTIA 1IGNA 4NBQA 1OOTA 3GCMA 1V4SA 4UUSA 2IA0A 1HRHA 3KXTA 5IXFA 3Q0VA 4DUZK 5IT3A 2DK5A 1NJXA 2H27A 2VT3A 4L9JA 2Z9OA 1MWKA 3KYDB 1Q1HA 5ILVA 1FZPB 5HP1A 4CK1A 3QWXX 3DM2A 2VE8A 4PJOD 2HL3A 3GFJA 2VG7A 4DGWB 2D8JA 3P39A 4C92D 3EG0A 4DQRA 2KXCA 2WAEA 4OPAA 3LSKA 2PN6A 4H0XB 3V9XA 3M8FA 4LLLA 3SDGA 3CVSA 3GMEA 4OF1A 1M1KU 4WFNL 4CEDA 2CREA 1YIJN 4FWKA 5GMKe 5C42A 2P9IB 3CC7I 2HOEA 2KP6A 2ZF5O 1VYUA 2M0MA 1SF9A 2P9LA 4CYCB 3OR2C 1UA0A 5TKWA 3F0ZA 3LDPA 1BA5A 1Y56A 2QQAA 4XLAA 3TW6A 2G9WA 1G3YA 5EZGA 2FB7A 4UB8C 4ELYC 2VBWA 3CJAA 2YLBA 2OPQA 3LZJA 3BQZA 2P9UB 4M75C 3QZ9B 1JBMA 4A2AA 2PJPA 2V9KA 1HNZK 3IUOA 1FIAA 1I6XA 4I09A 1V54H 1QWEA 1S72T 1NGJA 5ELZA 1DQUA 1FOXA 7AT1B 1HC8A 4JP0A 1ACIA 3GF2A 4PSXA 3QEPA 2L4AA 2G0EA 4A4GA 3C65A 3SZGA 2WY7Q 2K85A 1YJ9Q 4Z0UA 3I71A 1XGMA 4TVRA 5DCMB 1MD0A 2CP3A 3TREA 3S6WA 3RUXA 3TKYA 1S1XA 3HPOA 4DR2K 4E7HA 4A2BA 2JS2A 1S72I 3H1QA 3RSEB 1AVZC 1KVBA 2OQRA 4WXDA 2Q3SA 1XNQK 2E20A 4NC6A 3T3FA 1R9TJ 4Z8AA 3JCMe 1BOAA 4OOIA 2ZPGB 1K83J 1S22A 5JVGF 1DEJA 1W36C 3NRVA 3E5XA 2LQWA 4O5FA 5GAN5 1PP7U 3VYSB 5J2QA 1VQPQ 4OJRA 1OCRH 5D6FA 4BI4A 3J7AO 1E3HA 1VQMQ 4LF4K 3OA9A 4M7AC 1PJRA 3OY9A 4MLEA 4JHDB 1I94K 4CZGA 3TQNA 1Y8QB 4XN0A 1YE9A 1YIOA 3EUHA 1EJ9A 1BR1A 2EZLA 3C7NB 1YJWQ 4FZXC 2NVYJ 2Y2ZA 4QPQA 2VC1A 2VIXA 1WJEA 2RN7A 3HFOA 2MC4A 9ANTA 4CFAA 3RSNA 1REPC 1M3AA 2HYGD 3ZT3A 3OSSC 1QVGS 3I55I 5JICA 3NTHA 2HVHA 2Y1JA 2J06A 3OYKA 1IRFA 4IEJA 3HM5A 1U8BA 2P6SA 5HY6A 2E5NA 3CBOA 4L9NA 2V9PA 1N3CA 3T69A 2CH6A 1XGNA 2RQTA 2L7KA 3AG1H 1CZAN 4KUDK 4EMKA 3OW2M 4M7AD 4RM2A 4W5OA 3CCUT 2L9VA 2QXFA 1W1WE 3EG1A 4HZFA 3ENOA 4M7DG 4HTUA 4IPAA 3TCJA 1JKPC 4L3QA 2OF7A 1ETXA 2DO3A 1VQ4A 5F64A 2AHJB 5FU7B 2HNYA 1U2VB 1EH6A 2DDBA 4BUGA 3MN9A 4Y28E 1YP5A 4KT0E 4HTLA 4IZ9A 3BR1A 2ZO4A 1ZRDA 3N97A 3W2VA 3CD6N 1KG1A 1HLUA 2I5WA 4FL6A 3NTIA 1J09A 3JCMJ 3J7AP 4C3JJ 3V9SA 3C0CA 1VQ4I 4JX5A 2XDPA 4H0PA 1V5FA 1U3OA 3L2UA 2D0PA 1MGTA 5HLGA 4Y33A 2ZBKA 4I2OA 1OYYA 4H4KC 3QNOA 2IVNA 5L23A 4HT9A 3R60A 4CW7B 5FLXK 1Q1VA 4A5MA 1MJBA 3CPFA 1AHJB 2DOFA 1FJGK 4FYVB 1I27A 1VQNT 1VRLA 3RYPA 1K78B 4C0DB 4PLLA 2CW8A 3P9KA 2QENA 1WPYA 4MFEA 3W2AA 2DMPA 4M77G 2DKGA 4DZJA 2FJ1A 4BJTA 1APLC 3I5SA 1XNIA 4FOEA 3D0PA 3D7SB 1NMDA 4XR6A 2QQRA 2XPWA 3GVAA 3DLRA 4DQIA 2YG9A 4BHCA 3O3GA 2PU9B 4ICLA 4ZGDB 2R7ZJ 4AHRA 1YITT 2DRMA 3REAB 3RWUA 2OJED 1WI7A 5F2RA 4W97A 2QEXI 3F72A 2IIRA 3UIQA 2VGNA 3KYLA 1R22A 1FOWA 3SK3A 4GLKA 4DLGA 1GLBG 5E3NA 2JHNA 3FHNA 1SHFA 1SEUA 2FPEA 1JGGA 4GY2B 2D8HA 3MEXA 1PYVA 2V1QA 1OR7A 3LCNA 1IRXA 4F14A 3R6OA 1TKXA 4E4HA 2RI3A 1EH8A 4HOBA 4MZMA 4B1VA 2YXYA 3PFIA 2SEMA 4X1EA 1K8KB 1O9SA 3FDRA 3SB2A 3DXKA 2ESHA 4PJOC 4B3TK 2DMNA 4JKEA 3OVNA 3AO4A 2VI6A 3PJRA 2E1MB 1N33K 4RWTA 3HSFA 3MPUB 1IZ1A 5DPKA 3QINA 4CJPA 4DV3K 2F2EA 5D7UA 1YTAA 2NRVA 3EG3A 3CC4A 4UB6C 5LRSA 1K7AA 1CF7A 2NRZA 2VWBA 1LNWA 3B6PA 1MUYA 2KSSA 2PQ8A 1TT5B 2K7AA 1A5JA 2E5KA 5H1SQ 3GG4A 5I42A 1PU7A 3UATA 3VTIA 2MF2A 1YFNA 4F93B 3I56N 2EPFA 1WZOA 4C1NK 1EF4A 1RFQA 2O03A 2OAWA 4EDUA 3HKZA 5K14A 1BU1A 1YS6A 4F7UE 1M90U 5J47A 4Q0BA 5SZTA 4UNOA 5J40A 2CUEA 3ZSXA 2PVOB 4MZPA 5JS2A 1Z0XA 4XTWA 3WHBA 1KAXA 4G6DA 4FPBA 4QKUA 3AGRA 5GAOp 4FJHA 3FKJA 4LUDA 4PJLA 3SDZA 5FB2A 2LX9A 3CMAQ 2HQNA 4B21A 3MECA 3R4KA 2JWLA 1BHLA 1VSIA 3AO3A 3CI5A 4OO1J 4ESBA 1ORPA 2YUNA 1Q81U 5GJVB 4EMSA 1WSFA 4PJOE 2JW4A 3HBTA 2NAZA 1RT7A 4Z6YA 2W6LA 2VB6A 3KK3A 1VQLT 3KBGA 2GTJA 3P38A 3VA3A 4E7ZA 4HNUA 3M4GA 4LIVA 1UJYA 3WTTC 2M7AA 1VQNQ 4KO0A 1WJ5A 1JJ6C 3VEVA 1RLPC 2NNNA 3KEOA 4AUXA 1IUFA 2MLGA 2P9SA 2OU2A 4LITA 2OCEA 4L0YB 3CC2T 4DW6A 2EWSA 1FSHA 4J9GA 2HSTA 1U1TA 4CJ7A 5JVTA 4F91B 3PQJA 1KC8O 3CQTA 4FLVA 1J3TA 4YIRX 4UY8O 5H6RA 4C9YA 2FQ4A 5A0DA 2P9NA 1TL8A 2HSEB 4IIOA 1WCMJ 2GGRA 1VQ5N 2MBFA 3FMSA 4YOQA 2VWFA 1HJRA 1MZBA 3S6IA 3MWPA 4M75F 4LY7A 2KRSA 3FM3A 2V6EA 1ASWA 2NRXA 4PSWA 4ELUA 3CJ9A 2J5OA 3META 4M78F 2A3SA 2E41A 1Q82U 2NYXA 1SFOJ 4C8QD 2EQIA 1NU0A 1HU0A 1RT2A 5E17F 2ZGYA 3H1VX 3K4NA 1NG9A 3MKZA 2XIDA 3G4ST 1DU0A 1ZSZB 5IT9Z 4M73A 2Q1ZB 2IGIA 3AA2A 3I4MJ 4LXCA 5C25A 1V5GA 4XQFA 5GAGP 2F2WA 4BU2A 4D5CA 3PIPF 3QLHA 2K2VA 5KVRA 2FZKB 3CZ6A 1QGPA 3LQQA 1RT1A 4C2TA 2IVPA 4A6EA 4QWQA 2DBKA 3BCAA 4RMOA 2EV5A 3WE3A 5KYXA 2ZFUA 3HEFA 1RZ4A 3HGGA 3H92A 1K9MO 1QS4A 1QRYA 1HPZA 5LJ5f 1RDBA 3RCOA 4FT4A 2A6EF 2CQXA 1S7AA 3I53A 3QHSA 1TV6A 2IS3A 1J5OA 4EPCA 3EUHC 3U1KA 4CC7A 4B1UB 1PM3A 4BQQA 3FE1A 1BBYA 1RDWX 1AU7A 3CXCM 4IHWA 1OULA 2HBWA 3CC2Q 3S32A 4AIDA 4HSRA 2K3BA 3I0XA 2KIMA 2JA5J 1PP8F 5JMVA 2W57A 1MPGA 3IHOA 1BISA 2RNAA 2M0YA 2TRTA 3VU3C 4FISA 2ROLA 1BL3A 2LNBA 3F73A 1KQSM 3KLFA 3K58A 2Q8KA 3CMEN 2OA8A 3CCMQ 1HDDC 3WTXC 4F7UF 1QVGA 4M3RA 5CZ1A 3DKWA 4NQWA 1MSEC 4ZH4F 4RGXA 1B9MA 1OFCX 3RKYA 3RMQA 2NUZA 3LP3A 4EAHD 4QVDA 2PBDA 1GL5A 3P8HA 2FXUA 4ZDLA 4NL2A 2FBYA 2R5AA 2HQHA 3LSIA 4HSTA 4WCGA 1TG0A 4J6YA 2O0YA 3O8GA 1S7EA 4D8KA 4N0BA 3FLCO 4LG0B 4K42A 1HF0A 4DHYA 3W6KB 5IYBJ 3CCJI 3FHGA 1IXCA 2KQRA 3UF4A 4J7IA 3LWIA 3KCCA 3R0JA 1SUQA 4EEFG 2DO7A 3PY8A 3MD2A 2CSQA 2HQEA 3UT1A 3FWEA 4FM0A 2RNJA 2X0LA 1UGQB 4Q5WA 2XKPA 1U0JA 1TBXA 4IHTA 5AQYA 1R1TA 5DCFA 1J53A 2O8DB 1UHCA 4JJNK 2KVQG 2IP2A 4OMQA 3JV3A 2X1DA 3DLLL 2F4MB 4JKAA 2WSEE 1EZZB 3FXUA 4CZCA 3K5NA 4EFHA 3U6FA 1BGXT 4W5TA 4IRGA 4M9ZA 3L2ZA 4DFJA 5KGWA 1X4OA 5AQKA 4KICA 2ED0A 5EG0A 1WZ2A 3DI6A 4OWRB 3VESA 5DY9A 5FD6A 1M1GA 3HRUA 2KFZA 2O8FB 3ML6A 5HDGA 5M3MJ 2CUDA 5GAMj 4Y92A 3MP8A 4FJMA 3NVKA 4DYQA 1KD1O 5CKFA 3ZRGA 4P1WA 2MW8A 1KD1C 4B3OA 3IHUA 3DRPA 1IC8A 1VSJA 1HK9A 2V4JC 4N5SA 4CEAA 1ZARA 2QUFA 1SD6A 4CA0A 3H6ZA 3C12A 1YCSB 2HKQB 2HZYA 2IDOA 3GZ6A 1X3UA 3QP6A 3KZZA 3TDZC 3MWMA 4B9SA 2Q2RA 1NBEB 4FOIA 4KYWA 3Q7BA 3ZEUA 1A04A 2R7DA 1VUBA 5EX5A 2XF6A 3TAQA 4ESJA 3QFPA 1XMOK 5HRRA 4GDFA 1NGGA 4S05A 5GAN3 1SKUB 4UUVA 3CCRQ 4BAYA 5ICCA 1V29B 3DXMA 4G12A 1R36A 4BY9C 4CERA 1I1SA 5B8HA 3NH0A 1GXQA 5ERIA 3A4CA 3F70A 2H3GX 2A6HF 4GVEA 3OWTA 4YY3K 2P4WA 3L9FA 4N76A 2EYXA 5TISC 3CMEA 1N8RR 1AWCA 5IHNA 2AQFA 1USTA 4FLZA 1M90C 4OVAA 1ZBXA 2P8TA 4KH5A 4FL9A 1S6PA 4XU1A 5TGTA 3IWFA 5AQPA 3KE2A 4N4IA 5LMNK 1WBDA 1L5UA 1TUCA 3AVGA 1XG7A 4F7UB 3VETA 4LF7K 4LH4A 4N56A 2O8XA 1B72B 3FLGA 3V81A 3V7SA 1X69A 3CCLQ 4M78D 5JVGL 1AOYA 1VI0A 2A0FB 4N0AA 1HNXK 2H1KA 4O8KA 1F21A 3NAEA 1VTNC 1RDUA 3GDQA 3NF7A 3A98A 3CW7A 2COMA 5GADJ 1S29A 2XAUA 3HSEA 4YFXF 2ZPIB 2BUPA 5LJ3h 2K5CA 1JXEA 2VVKA 1W2BM 2BEOA 2Z1HA 2VQEK 3O3FA 1BA0A 4LF9K 5IYDJ 1WHGA 5FLXE 4PJOA 4RA2A 3G4SI 1SVLA 3OOPA 4J5YA 4KHWA 3KEYA 1BQNA 3VS6A 1RAGB 4RG8A 4IG3A 4NB5A 3SQ4A 3M1FA 2FBHA 3F8BA 5CZ2A 4UOBA 1LNXA 1TL3A 3RDVA 4BR2A 4CCHA 2D0NA 4GMJB 2J7IA 1SPKA 3WXIA 4BRAA 4PJJA 2WAFA 1POGA 1VQ5I 3SWNB 1ZBJA 4CGJA 2EKOA 1T8EA 2HQ5A 2BW3A 1M30A 5HLFA 3LPTA 3IAM2 4GLMA 2OFKA 4YIFA 2KZMA 3ATVA 1NGIA 1BIZA 4HVUA 4P5NA 4H5VA 3E5QA 3VODA 4X0GA 2QKMB 3AVNA 4XAXB 1KIKA 1O3RA 1QQNA 2DU9A 3OMYA 2A41A 3M54A 4CVNE 2KLAA 2HZDA 1GVJA 3F8FA 2F8TA 1IHVA 4BR9A 1XQSC 5LJ5h 2X6YA 2FBKA 3LH5A 5K7ZA 2VJJA 3RIRA 2P7VB 4BY6C 2QM3A 1ENHA 5D3GA 2W00A 1X1BA 2M0OA 2DI3A 3BROA 2DYIA 1T0HA 4A3EJ 1IBKK 1VQ6I 3RKXA 1R71A 2R7XA 3R6NA 1OYXA 3AAPA 4NS5A 1V76A 3CCVN 4P55A 1ATSA 3A02A 1XSDA 1NGCA 4QQGA 4I7HA 4DLEA 3BC8A 4I76A 3CXCA 1LDKB 3ZOBA 4V2FA 3G71I 3F9KA 2BZYA 3O4NA 4H4MA 4XLEA 1QSSA 1RR8C 4FJ7A 3SUOA 2P9PB 1H88C 3O8MA 3VB2A 4BGDA 2GWRA 3LWMA 1F4KA 2M4GA 2L3SA 3O6WA 3WGHA 2DDAA 1M90R 4FM1A 3CCVQ 5LMUK 3MKYB 2K4YA 4L0ZB 2CT4A 1RESA 3IKTA 3LA2A 1OV3A 1J7KA 3MEUA 1M2VA 2DD4A 1TKZA 4HQMA 4FK0A 2LSNA 2DFUA 1PNJA 5AFUH 2HXIA 3C2HA 2XHKA 3SBTA 5DD8A 2M02A 4BUPA 2JT1A 3D2FB 4M6XA 4EM0B 4B9NA 3SXYA 2NXNB 1EO1A 1O1WA 2BZTA 2BXZA 4XBFA 3T5XA 4M7AA 4CBWA 1ZBIA 2ZZDA 1B8IB 4XTZA 2ZJPL 4DTXA 4DSEA 4J2DA 2E3HA 1WGXA 3HYFA 3F23A 2F9WA 3V8LA 3SPYA 2HEQA 5C6SA 4GNIA 3OOUA 4FZZA 3DBRB 5DD4A 4KIBA 4II2A 5JVHL 2YG8A 3ZQQA 3E19A 3I4NJ 3SEZA 2DT5A 2IG0A 3CCJT 2IBDA 3QPHA 3V4GA 1IKVA 1XMKA 1NJZA 4KTZA 1ACMB 1PUEE 5EEAA 4CJWA 2L89A 1O3QA 4JI8K 1SV5A 1RUWA 4KH6A 2CO5A 3RMAA 3CESA 2NOIA 3D7EO 2HTSA 1TXQA 1U8RA 1ABQA 4F3OA 4AD9A 2HMPA 2D0AA 5HRNA 1CZBA 1GOAA 3H5RA 4XLCA 3S15J 4LIUA 5SWMA 4DF8A 4OMOA 3WU0A 5JR3A 1WQWA 1KQ2A 1IRGA 3WQTA 2D45A 2R7RA 3LM2A 3EGXA 4E3SA 5IPAA 1PUFA 1H3ZA 3I33A 2FSKA 2HHUA 2NS8A 1KFDA 2DA3A 1U5SA 1AKHB 2K4JA 1UHFA 1Z77A 4OKJA 4MDWA 2CKKA 2EGAA 3LA3A 2RI2A 3MP1A 2ROTA 4I9LA 4FTHA 1VQ4N 2IAJA 1Q18A 1RGIA 5KPRA 2OTJA 3ASNH 1T7PA 4WTOB 1K73R 4Z2YA 2ELKA 3IRXA 3OYYA 5BPNA 2NOGA 2W42A 1MNDA 3AVCA 5IWAK 3K4KA 5E1WA 3KWIA 3GO5A 1X2QA 1P59A 1W7PA 4DQ8A 2GTOA 4KN4X 2L2PA 2ABKA 2QEXT 3NE6A 4XEIA 4XORA 3VF2A 2G8KA 2LTPA 3ECOA 4JI1K 3PO5A 2NVTJ 2DMOA 1R4NB 1C6VA 2E5ZA 4J7FA 2XF7A 3MXMA 2J6OA 4Y4RA 4F9OA 5CYVA 2FE3A 4XKBA 2GF7A 4BG9A 4LD9K 1QZZA 3DLAA 2DA7A 3ZT4A 2V79A 1ZQ3P 1W1FA 1X6OA 2LK2A 8AT1B 2YU3A 2FZCB 1Y0MA 3PM1A 3J81K 2X6SA 2DETA 1AWWA 2DPDA 1KJWA 3R9PA 4M7DE 3CMEI 1RBRA 4CCOA 4M3XA 1OCZH 2IAIA 2EVRA 1FN7A 2K3FA 2ZPBB 1R0AA 3FK7A 1YRNB 4BC5A 4OMLA 3THXB 3H3OB 5KPTA 2P9KB 4DTOA 4HV5A 2DNUA 3BP8A 2VBZA 4FYXB 2LY9A 4ZNXA 4E6KG 4CBXA 5LY3A 4GXOA 2M30A 3KLHA 3AVBA 3GTPJ 2F4IA 2YI1A 3JB9F 1NK2P 2HNZA 1Y0NA 3KD5E 1LVKA 3WXJA 1LWFA 1VQKT 3EUKL 5AZIA 4BE2A 4DZPA 4A69C 2QDYB 1X01A 2BIVA 4HCKA 2R5YB 1K8AR 3ULRB 3TABA 1ZR4A 3VQPA 4GY5A 1P8ZA 3R8EA 4DR7K 2KIFA 3CQXA 4MO7A 1JT6A 2UXDK 3ZN0A 2QGFB 2GA2A 2BYVE 1VSHA 3FR0A 4KRFA 1M90O 1YQMA 1VQKI 3KD1E 2EV6A 2PG4A 3SEMA 5K1YA 3QWLA 1XMQK 3X2QH 2KBTA 3GWZA 3IUCA 1SSFA 2OJ2A 1DGKN 2JNGA 1HQUA 1SL2A 4CEQA 4HCBA 3WHCA 4DTNA 2RQPA 1BDGA 1RTJA 3CM5A 1J0RA 2XRIA 1TYQB 5AQVA 1X2NA 4H0TB 4BDPA 2V26A 1I5ZA 3O9SA 3PTAA 1REVA 4JI6K 1O57A 2DMUA 5CPRB 4IUUA 3JCMV 2NRTA 3GE1A 4NXNK 5LJWA 2F1LA 4CIEA 3CC7N 2V8JA 1A5XA 4M78C 4RTUA 2ZCFB 2AS5F 1U5TA 5CKEA 4M74A 3ASOH 5J2PA 1LMZA 3AV9A 1HJOA 2KK4A 3OS0A 3T7ZA 1N36K 3VEZA 1U06A 2XV4S 1WRJA 3U4LA 1PUFB 2ID6A 2DM1A 4K43A 4CZZA 4CD3A 5BREA 1SD7A 5L3DA 5CKHA 4C0FA 1DJ7B 5EEHA 5AZIB 4M7AB 3GOXA 3QNNA 3HZ6A 1I3QJ 4HX4A 3FIFA 1BJAA 2QQBA 2KI7A 2E2HJ 3MP6A 4ILGB 1ETQA 4HUFA 3NGIA 5KE2A 3RESA 3FX3A 2QYZA 4GVMA 1NKCA 3LDOA 1ZAOA 4HDUA 2X4HA 1HXDA 4WCIA 1TKDA 5IP9J 4C0DC 2GXGA 3K1PA 2R57A 1C1AA 3AO1A 1CZ9A 4CGDA 5F04A 3CCEN 1Y39A 2OZSA 2BVLA 2LH9A 1I39A 3LP1A 2FA5A 2EYWA 3M6GA 4BQAA 1HLVA 3O5BA 1M8MA 5FPNA 2PVGB 4JK8A 2HWVA 1S1NA 3S2WA 3TGNA 1CKAA 4HA8A 2ITMA 2BGCA 3BJAA 2BY1A 4JX6A 4KH0B 4J6XA 1KD1R 4GBQA 1BIAA 5GAN7 3QFUA 4C0GA 1TWGJ 2HSPA 1TUDA 2R5MA 2KFNA 2EW3A 3G6EA 4LFUA 3QQAA 2ATQA 4CFCA 4NOYA 2JVHA 2QK0A 4S0HB 3NDKA 3PX6A 4QS8A 3QPLA 3J7ZO 4DSKA 2NOHA 2CU7A 1RETA 2HKOA 3QBWA 5HCKA 4XICA 3B6OA 3CUQB 3G0ZA 2FSWA 4K8ZA 1KG4A 3NMUA 4DFMA 3THKA 4P96A 1BBZA 2KTQA 4RW9A 3I5UA 1WSUA 5HNHA 1L0OC 4FJXA 2ECCA 1HKBA 3ZQ7A 1N27A 2JJ9A 4OP0A 2R92J 2RJFA 2ZJ2A 1PG5B 5BNGA 4QW2A 3OW2S 4DTMA 3HSTB 3N05A 4BI8B 4FJIA 3RR6A 2PEXA 1ZG1A 1H92A 5H2FC 3VTHA 4UNFA 4A3JJ 2E1YA 2DOEA 2Y4XA 2JN6A 3GFMA 4FT8A 4ZYDA 1YVNA 1WJAA 4DMNA 1VQKN 4PGHA 5HK0A 3QYEA 2F9TA 3A1YA 3X26B 3ABMH 2LKSA 2HYFA 5KYUA 1J5EK 3A8HB 3GTMJ 3HB9A 3H3UA 2O8CB 1LWYA 2MK5A 4I98B 3LQRA 1KQ8A 4EGYA 3W6VA 2P9SB 3PL8A 2DW4A 1R23A 5AZJB 4M4ZA 3G71T 3FBNB 2FHDA 5GMKl 4E7SA 4I02A 3UDCA 4FJLA 1FT9A 1U9OA 5FFXA 4PY5A 4PLIA 3ONQA 4F7ZA 2DQLA 3VF4A 1N9RA 2QXLA 4XTUA 1E3OC 1K76A 1BR2A 3K59A 2LKPA 4Q4ZF 4JRIA 4ATOA 4OVLA 1FW6A 2DX1A 5CR2A 1GOBA 1QPMA 3I9QA 3TI0A 1Z3YA 1FYNA 3VYTB 3EYIA 4H0OA 4FHTA 1ATNA 1TL1A 1XSVA 3GUDA 4N47A 3G7ZA 1TTHB 2XPUA 2HD0A 2LP5A 3ZQFA 4IFVA 4DUYK 4RCCA 1XGOA 5D8KB 2LCLA 3ABLH 4NUBA 4IO9F 4NZGA 4O3MA 4QVCA 4NXMK 4WXHA 1WAFA 2HBKA 3C2BA 4IDHA 3GEZA 5GAHP 2K4BA 2L0KA 3U9ZA 3L2WA 1KZHA 2RD1A 3MVPA 3L0QA 3VUBA 3CCLT 1V55H 5AFUA 3SV3A 5KCMA 3CC4I 2RF2A 1J9AA 1VK0A 2XY8A 3S1QJ 1Q81C 1G83A 1G59A 3OGDA 4PFPA 3BG9A 2YSRA 5C0MA 5DM7F 1XDUA 4YOVA 3CPWP 1PHTA 4XKVA 4M75B 3TEEA 1YI2I 4RS8A 1KXPA 3ZMUA 2A08A 3T19A 2DA6A 2VLAA 1WA7A 3SFZA 2QWWA 2QM1A 5LHGA 4UY8I 5GANj 3CCJQ 3CC4T 1U6GA 1XSXA 4AM3A 5IHIA 4RW6A 3DXKB 4F16A 2GIVA 4G8XA 4JD2B 3MMVA 4DEYA 2RHUA 4EQQA 1BI4B 1YI2N 4B1RA 3NF8A 1QHGA 3DEEA 4WK8F 2ECZA 3DKMA 3CCRT 3H8ZA 3JTGA 1O3SA 2RHIA 1T03A 2FD5A 4CICA 3SQ1A 4H0YB 2AIRB 1OX9A 3U3GA 4HX8A 3CCLA 2E3IA 4A3KJ 1X27A 3G25A 1EIFA 1AWXA 1RT3A 5EU7A 2H09A 1T3LA 3THWB 2JOYA 3ATUA 3HJFA 2RJCA 2ZMEC 4CJKA 1ZRFA 2FYKA 3CBPA 1G15A 1VOMA 3H3ZA 2HF4A 1RBUA 5LJ5d 1N32K 4A2UA 2EIFA 2PMZA 5FU6B 4FWMA 2JT4A 3C7NA 2LR8A 3HOXJ 3O4QA 1VQLA 1JL1A 3PUBA 2XDDA 2M3AA 4DCHA 3OL3A 4DWIA 4Z88A 3N4MA 3ZX0A 3WUHA 4FWQA 4BE0A 1KU9A 2HNDA 4HSBA 3CJBA 1QCFA 1DGRM 5HDKA 3HZJA 3X20B 1NYFA 4UHTA 2LJ0A 1XMXA 3CETA 3JCMd 1MNEA 4L59A 3S17J 1N3AA 4AI5A 2WTUA 3O4WA 3HPHA 1WEGA 1YJ9A 1SFKA 4AM7A 5KAFC 3PMIA 1P7IA 1BC7C 4M3DA 2CZ0B 1ZSZC 1KC8U 3SYTA 3CCRI 1XCVA 4DV0K 1YJNA 4V19S 4B9VA 4C8LA 5HBMA 4GCVA 2E64A 4PL8A 3K4LA 2F5CA 2XPVA 4CHUA 2YSQA 3MXIA 1LAVA 2CUJA 2RC4A 1X9MA 3DLKA 4EM2A 4KKOA 4WE1A 2W82A 1YJ9I 3VQ8A 4AU7A 4F3TA 2IS2A 3WNGA 1ZREA 2XU8A 4BD3A 2NOLA 5FJ8J 5LFAA 4DQ2A 3KP2A 1KK7A 3SPZA 5LEJA 2ZNYA 3U2RA 2VWKA 5LL6Z 2IW5A 5HVQC 1VQKQ 5HK3A 1UEBA 1HD3A 1TWAJ 3U9GA 2IXSA 2YT6A 1YJ9T 2ECBA 4DOWA 1Q86R 3T1YK 3KNTA 1WN7A 3L8BA 3T1HK 4BC4A 1I5OB 5GMKj 2MFZA 1VSMA 3G71N 3QRFF 1EWQA 4XSXF 4ABZA 1N39A 4C92G 1M1KO 2DJNA 3M57A 3OSGA 1KRPA 4EV0A 4YPHA 2QA4Q 5LD2C 3ZQGA 1ZUYA 2AKKA 1LDJA 2EX3A 2FLOA 2QBYB 1USSA 2HPIA 4WQ5C 1RADB 3HUGA 3U8XA 1PSEA 3SJJA 5KYNA 1ZRCA 3CCET 2VUMJ 1NKBA 2K7LA 1FBSA 3CWAA 1W7AA 3LFUA 1SG5A 4M75G 5LJ3e 1B4AA 4MIMA 1JTXA 4JYAK 5B66C 1Q7YC 3HI0A 1Y6IA 1BJZA 4KGXB 4CGFA 3CCJA 1BUPA 4A61A 3KK1A 5BRDA 3HRGA 2EPDA 4C5HA 2Q2EA 4M7DC 3U3YA 4KB1A 2XC7A 2D1VA 2Q0OA 2O31A 4GKKK 3PIPL 2WAQA 3H3VK