3S3NA

Crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3nA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3nA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3nA03
3QIPA 4UC4A 4B9MA 4FW1A 4C8NA 2IOCA 2XY5A 1XHZA 3TAEA 4DSIA 4QAGA 2QQSA 4J2DA 3P5JA 3KK2A 2AJQA 1U48A 4ID1A 1L3TA 1KVBA 5JS1A 4O55A 2OYQA 3IRXA 3B6PA 1YT3A 2XDPA 3I8DA 4QOZB 3TABA 3CM5A 2GF7A 3SQ1A 3K57A 4DTPA 2BUDA 3WNHA 2XY7A 4N47A 1KVAA 1RBVA 2BIVA 5C25A 3NDKA 4F2RA 4W5RA 3AVFA 1BHLA 3MXMA 4DSKA 3PX0A 1WAFA 2VYTA 3VQBA 3P8DA 3ZSZA 1C1AA 4CFDA 2R57A 4Z4CA 3MEUA 4Z02A 2HNYA 4MQ3A 4EZ9A 3OYLA 1EETA 3TI0A 2DFEA 4CK3A 3MXJA 3LGFA 4IG3A 4HCBA 1HYZA 4FVMA 3F73A 4A4HA 4B9VA 4KHSA 3KK3A 3F9KA 5JS2A 3PMTA 3LH0A 4CK1A 2YRVA 4E7IA 3M8RA 3V1OA 1BIZA 1LWEA 5IAYA 3OS0A 3RWUA 3M8QA 4CHQA 4B9LA 4KB1A 2A1SA 4F3OA 1YTAA 2GUIA 3SZ2A 3BDLA 3E9GA 2M16A 1Z25A 4CHNA 2YNIA 4WE1A 3ZSWA 1IKWA 4FJKA 4B9SA 5I3UA 4CJTA 3OJUA 3S6WA 3LZJA 4FK0A 4Z4GA 4CJFA 4E19A 3ZSVA 1NK5A 3CQ8A 2DY4A 4QQ6A 5KGWA 1RTDA 2OPPA 2MWPA 4N4GA 3OYDA 4CGIA 3MEWA 1L5UA 3NF7A 1C1BA 1TKXA 3LLRA 5HRRA 2G8KA 1HMVA 4CEEA 4AHRA 3OYFA 4NCAA 1TKTA 3MXIA 4K8ZA 4KO0A 1RT1A 3NF6A 1QSSA 4FM1A 4FM0A 4O0IA 4W5QA 4RG2A 1RT2A 3AVKA 2LSNA 5I42A 4H8KA 3KLIA 1CZ9A 3DRRA 3ASKA 3QJ6A 5M9OA 4KAZA 4KHWA 3LALA 1RDAA 3NF9A 4AHCA 2XO7A 3FDRA 1UA0A 1SSFA 4DQQA 4E7LA 4HUFA 1BI4B 3S3NA 3E01A 3VQDA 4DQSA 4I9QA 2LVMA 1S5JA 5CIUA 2O4XA 2G8UA 2RN2A 3DMJA 2GFAA 1IG9A 3AO4A 3OYKA 1ZBUA 4Y1DA 3VQPA 4M3RA 1D5AA 3NGZA 1Q9XA 1ASVA 4DSLA 4QQDA 2RJDA 4FLXA 2D0BA 2NUBA 3MP1A 3D45A 2B8AA 1QQCA 2DTUA 4IUTA 1HYSA 3DYAA 3ISNC 4CF1A 4O5BA 3V1QA 5C6SA 2K3YA 1T03A 1F21A 1A5XA 1SKSA 4JS4A 1LW2A 2VWKA 3HPOA 1TVRA 2HNDA 3SV3A 1C0TA 2CKKA 1JL2A 4A4FA 2E5QA 1J5OA 4DTSA 2L8DA 1U45A 2M0OA 4C8MA 3K5NA 1RNHA 2X4XA 4DF4A 1TL1A 4DTOA 4KFBA 2JZ2A 1RI0A 1HJRA 1HPZA 2DIQA 4F4KA 1NK6A 3MAQA 4IUPA 1C0UA 1HQEA 3NF8A 2IGIA 5FROA 1QE1A 4AHSA 1EP4A 2EFIA 3OB9A 1U49A 3QEVA 2B6AA 3SYZA 4FCYA 4FJLA 3DLBA 3ZSYA 3TR8A 4CCHA 1Y97A 2WACA 4BE1A 1RBTA 2VG6A 2HVHA 2HHTA 1Q8IA 3HPHA 4FJ8A 3NGIA 4QW2A 4II1A 3T19A 1NOZA 1NJYA 4LD6A 3OYAA 3V9WA 1BQMA 3HL8A 4I2QA 5J1EA 3M8PA 3OYHA 3EY1A 4W5TA 4BE0A 1ASWA 1TK5A 4ELTA 5HLFA 1S9EA 2F8SA 2F5KA 4N4IA 2VG5A 2HHSA 4PWDA 1RDCA 2VG7A 1WAJA 2RF2A 4M3ZA 3AV9A 1SV5A 3MP6A 3I0RA 4AHVA 4Z4HA 4IBNA 4CEAA 3V4IA 4B9TA 2RJCA 4DTUA 1L3VA 4N76A 2EQUA 3HJFA 3HXMA 4F2SA 1Z26A 1ASUA 5KCOA 3TAMA 2F8TA 1DTTA 2FHDA 4KRFA 4FL6A 3LPUA 4AH9A 2YNGA 1L3UA 3LYIA 1KFDA 2EX3A 4CFCA 5KE3A 1REVA 1MHNA 5SZTA 4L8RB 2YHBA 1SKRA 4EP4A 3SUNA 1JLFA 3SPZA 2XRIA 5D6XA 2OPSA 1U4BA 3AVJA 4E1MA 3EYZA 1KLMA 4CJPA 2HVIA 1QSYA 1VRUA 3PY8A 4CEZA 1TKZA 4A4GA 4DS5A 1RTIA 3QEIA 4R5PA 2KW4A 4M42A 2GBZA 3ZSOA 3QERA 1VRTA 3NH0A 2G3RA 1BCMA 3OS2A 5C0MA 3SUOA 1HNIA 4LY7A 3NBPA 4CGJA 3RRHA 2X6SA 1VSFA 5E41A 3ZT3A 2X6NA 4JRPA 5HP1A 4CJLA 3RRGA 4CEDA 3EZ5A 3OY9A 1LAWA 1I3AA 4IFVA 1BCOA 1KFSA 4AILC 1J54A 1T05A 3QESA 2L3RA 4OGCA 1S1WA 4ZHRA 1LWCA 4CFAA 1A5WA 5KGXA 4IUUA 3AVMA 1TK8A 4GMJB 1FK9A 3I0SA 3K59A 1VSJA 2QK9A 4RG8A 1Q9YA 4DSEA 2R7YA 3TAGA 1WJQA 1JXEA 3H6ZA 1OZ3A 3HSTB 1DTQA 4NYFA 4M3XA 1TL3A 2HW3A 1S1XA 4B9XA 1HRHA 3A2FA 4YNQA 2X74A 4DU4A 2PQWA 3QBYA 3PO5A 3HP6A 2R5MA 3KLFA 2IG0A 5D3GA 1JKHA 4KHQA 2OPRA 4J2EA 4XIUA 4CESA 3C4SA 5KH6A 4M3UA 4KHUA 3HT3A 2KZMA 4CERA 4DSJA 1VSMA 3VQ4A 1W0HA 1FKPA 3NCIA 4FJHA 1RBRA 5CYQA 4KB0A 4ZTJA 3L3VA 1GOBA 4M45A 4E7JA 4OVAA 4KKOA 3OS1A 1T8EA 3NAEA 2JGUA 2ZE2A 4J2BA 3L3UA 3OJSA 4KTWA 1S9GA 3V9XA 4RW8A 2LRQA 3HVRA 4IDKA 4HCCA 4Q5WA 4H4MA 4OPJA 2D5RA 3L2QA 3P83D 3V9SA 1SL1A 1FKOA 1JL1A 1TK0A 2BANA 3L8BA 4FJNA 3O4QA 4ZTFA 4OGEA 2WONA 5J2NA 4PY5A 4CEFA 4NYNA 1RBSA 4BACA 4CHYA 4HUEA 2OZSA 1GOCA 3RMBA 1XNIA 3ZSRA 3QIOA 4CGDA 3DRSA 3V1RA 3OYMA 2RKIA 3AA4A 3VA3A 3NTIA 4ELUA 1RTJA 4KHYA 4CJWA 3RR7A 3LAMA 3ALYA 4CJ3A 1UWBA 3UT1A 1X1PA 3ME9A 5CZ1A 1WSFA 2M1HA 3TAQA 3MP8A 4O44A 2G8VA 3LP1A 3MEVA 1CXUA 1D8YA 2FC0A 4I9LA 4DLEA 3L42A 3S9HA 2Q3SA 4DFKA 3DLRA 4O4GA 4KPYA 3SUQA 4TSXA 1WNSA 4Q0BA 3KK1A 1LAVA 4OKEA 3KD1E 1NJXA 4DTNA 4F8RA 4B8CA 3OVNA 4DQRA 3PUFA 3K5MA 2O4XB 2HHVA 4CIEA 1VK0A 3B6OA 4W5OA 5HRPA 3KLGA 2NLUA 3ZSXA 3K2PA 4E7KA 4IG0A 4X34A 2O4IA 3S3MA 1TAQA 1S6PA 2RHYA 3MECA 4DTMA 1KSPA 4CF8A 4B9UA 3WNFA 2EKOA 3THVA 3SCXA 3TARA 4YFUA 3AA5X 2B4JA 5D6YA 1U04A 4AHTA 3HVTA 3HM9A 4HVJA 4FLZA 1ZBHA 3PO4A 5KE2A 3DLMA 1QS4A 2BKDN 3TAPA 4E0DA 3DLEA 3VN5A 2LTOA 3DOKA 4PUOA 2Z1IA 4IUVA 4FLVA 1S1VA 2RHUA 4NZGA 2WOMA 5J2MA 1EXQA 4CJVA 1EKEA 3V9ZA 1VSDA 4CEBA 3K5OA 1IKYA 4OLAA 1UAXA 3DLHA 4CJKA 4E89A 3VQ6A 4DTXA 3Q1JA 5HBMA 1KVCA 3AVGA 3MEEA 3ZT4A 1J53A 2ITGA 2HQXA 4HTUA 3E9FA 1JLAA 1WJSA 3CFRA 4CEQA 4OPKA 3PX4A 2IDOA 3KUFA 4AHUA 4FJ9A 1NKCA 4B08A 3IAYA 4DG1A 2W42A 4OJRA 5T7BA 5SWMA 4M41A 5CY4A 4CF0A 4EDUA 3VQQA 1BIUA 3SD4A 4GY5A 3D0PA 4K8XA 4CRIA 2LCCA 2E6LA 4E1NA 5J2QA 3NE6A 3TAFA 3VQ7A 4C5HA 2G8HA 2JLEA 2D0AA 1ITGA 2YNHA 2X4WA 3O3FA 1JLBA 3AVNA 2BGGA 1G15A 3HO1A 4Y1CA 4ELVA 1CXQA 4CK2A 1KTQA 2GFUA 1JLEA 4CHOA 1HQUA 4CJ4A 4C8OA 3FFIA 4HUGA 3QNNA 3AO5A 1I39A 3LANA 3NFAA 1VSKA 3V6DA 1NK7A 4QVZA 3PMIA 2XY6A 4FXDA 1H3ZA 1OZ2A 2IAJA 4KTQA 3MO8A 3QEXA 4W5NA 4JLHA 1TKDA 3UIQA 3O8VA 2LDMA 3OYIA 1NJWA 1B92A 4CFBA 2QQRA 1HNVA 2RPIA 4FZZA 1BGXT 2PY5A 4I2PA 1WJRA 4PA1A 2HQEA 1NK9A 4B9WA 3V81A 3SQ0A 3G10A 3QETA 4FJ7A 5HRNA 2R58A 4IUQA 4NCBA 4L59A 5KI6A 4DWIA 3NH2A 1YVUA 2DFHA 3SPYA 1NK0A 3LWLA 1ZBLA 2B5JA 2K3XA 2G8FA 2EQMA 2VWJA 3PV8A 2BE2A 3AVLA 3ZEHA 1D9DA 4CEOA 3DLKA 5J2PA 4CGGA 1VSEA 4E7HA 4NS5A 3IG1A 1JLGA 3AO3A 1NK4A 4FJJA 1JLCA 4CF2A 2X78A 1BISA 1C1CA 3OYCA 3G0ZA 3CYMA 3NGYA 1N6QA 3AO2A 2EQJA 4B9NA 4DFPA 3LAKA 5KRSA 4FJXA 4FLWA 2RHXA 3OYGA 3TANA 3NH1A 2E6NA 2ETJA 1SL2A 4M3TA 4DLGA 2Z1HA 1JLQA 4KI4A 4FK4A 3SQ2A 3M9QA 1WN7A 3RR8A 3T1AA 4FJIA 1RT3A 4Z4IA 1UA1A 4C5IA 4ID5A 3OQ5A 2KQ2A 2FBXA 2E4LA 4BD3A 3OYEA 3OYBA 3C6UA 1ZBIA 3MEAA 2YV0X 4CJUA 2X4YA 2OA8A 1TGOA 3L2VA 2DAQA 2BDPA 4M3YA 2D0CA 4LSLA 3U3GA 2PZSA 4N4HA 3OYNA 3S3OA 2RO0A 4CJEA 2IC3A 2RI2A 2HMIA 3P8HA 3WNGA 3OA6A 4PQUA 5K14A 3ZSQA 1CLQA 3QLHA 3GOXA 3KKRA 1J9AA 3BGRA 3MEGA 4HHTA 3LP0A 3CFPA 4FJMA 3QINA 1VSLA 4KHNA 1NKEA 4B8AB 1RCHA 4KREA 1UOCA 3RMAA 1KHCA 3U6FA 3EAEA 4Z4FA 5CYMA 1KLNA 3O3GA 4DS4A 4DSFA 3F70A 4FJGA 4IFYA 1WSEA 4BDYA 4RW9A 5FDLA 4FZXC 4CJ5A 1U47A 1T7PA 2P5OA 1QTMA 4CIFA 2L89A 3HP9A 4H4OA 4N5SA 3H08A 4E3SA 2HNZA 3AVAA 1S6QA 4FZYA 3ZT0A 1XC9A 4O0JA 3QO9A 3VQ8A 1RILA 5KRTA 4B3OA 2P51A 1IKXA 2G8WA 3AA3A 3DOLA 1NJZA 1A5VA 3KIOA 3NNQA 1XHXA 1S1TA 2IS3A 3VQ5A 4QCLA 3LP3A 1VSHA 3NTKA 3TWHA 2QXFA 3L2WA 2KZZA 4CJSA 1JXBA 1O1WA 1SL0A 5DMRA 2G8IA 1SUQA 2ZD1A 1BL3A 3HYFA 3L2UA 2DIGA 3OMGA 4JS5A 2RJFA 1X9WA 2ATQA 4I7FA 2F96A 4Z0UA 4FU6A 1D9FA 1RT7A 4BDZA 2HHXA 1WGSA 2P1JA 3MEDA 4EZ6A 3AVCA 2I5JA 4CECA 5KCHA 2FBYA 4Z4EA 3ASMA 3KLHA 1LW0A 1WSIA 3DM2A 3BDPA 2HHQA 5IN1A 5FRMA 1IKVA 1XI1A 1B9FA 4BWJA 4QQGA 3SI6A 4OKKA 3VQAA 2FBVA 5D6WA 2A1RA 4MFBA 3JYTA 3JSMA 4PL6A 2HHWA 2QKKA 3AVHA 4FLUA 3H8ZA 4CJRA 4FJ5A 3SUPA 3NHGA 1RT6A 3LZIA 5J26A 1G5VA 4F3TA 1XWLA 3NTHA 5EU7A 3ZCMA 1NK8A 4M3WA 3HPGA 1RT5A 3VQCA 3META 1LV5A 3IS9A 4PLIA 3O3HA 2XK0A 5HROA 2YNFA 4ICLA 2HB5A 4CHZA 3V9UA 4DFJA 3KD5E 3SQ4A 5KTQA 3PX6A 4LH5A 1VSIA 1FXXA 4DF8A 2D9TA 1KRPA 4G1QA 1BQNA 2RI5A 1KCFA 1YTUA 1RTHA 3ULDA 2YHAA 1SKWA 2RHIA 1ZYQA 3L2RA 2XHBA 2Y1IA 1BI4A 2RI3A 1WSHA 2RHZA 2FBTA 4HCZA 1K6YA 4N56A 3KLEA 1HYVA 5C42A 3VQEA 4Q5VA 2E6MA 3VQ9A 3KTQA 3T3FA 1NKBA 3HK2A 4DQPA 4PLLA 4RW4A 4DFMA 2EHGA 3FEOA 1R0AA 4EP5A 2XY8A 4DU3A 2ZQBA 4RW6A 4RW7A 4DQIA 4C8KA 4LD0A 4GVMA 4CF9A 2Y1JA 4J2AA 3AVIA 1GOAA 1EX4A 4IURA 4NCGA 3AVBA 4LH4A 3CEYA 4FW2A 1RDBA 3CM6A 3U3YA 4OKJA 1QSLA 2KTQA 2GV9A 1ZBFA 2R5AA 4GW6A 3CG7A 3RMDA 3QNOA 1C6VA 1RDDA 4C5EA 4CGFA 1OYXA 3C95A 2DFFA 2X35A 3OMCA 3FLGA 1RT4A 4BE2A 3CFOA 2JTFA 4DTJA 3DB3A 4FYDA 4CIGA 2HHUA 1IH7A 3ITHA 3ZT2A 3LGLA 3DLGA 3LP2A 3QEWA 1QHTA 5HRSA 2KFNA 1LWFA 3K5LA 2MWOA 3KKSA 4FLTA 3DRPA 4UQGA 2Z1JA 1RBUA 3VA0A 2YKMA 1TV6A 1N27A 3PNWC 3M8SA 5FRNA 4A4EA 2OZMA 3SV4A 5CZ2A 3LDSA 1WSGA 1N5YA 1X9SA 2EQKA 3UWNA 1WLJA 3OYJA 4IKFA 4KTZA 4N41A 3SNNA 1WSJA 1C0MA 2Z1GA 4CJQA 4FLYA 3C6TA 3ZT1A 3PFSA 4DTRA 1S1UA 1CZBA 5C24A 3DI6A 1OI1A 3AO1A 3QIIA 4C5GA 1W9HA 3AA2A 4CE9A 4OVLA 4LSNA 3WNEA 4KV8A 3QKJA 4DMNA 2YKNA 3RMCA 4FK2A 4JRQA 1TAUA 1L3SA 2QKBA 5J39A 3SJJA 4CHPA 4BDPA 3LX7A 4FM2A 4KI6A 2P0KA 4BWMA 4CGHA 2PYJA 2P5GA 1NOYA 3P1GA 1MU2A 2KFZA 4DU1A 1IO2A 1X9MA 1B9DA 4C8LA 2OPQA 3QEPA 4OLBA 3RTVA 3LWMA 3LPTA 2PYLA 3K58A 5DK5A 3C94A 3O4NA 3DB4A 2O4GA 2RJEA 1DLOA 3KJVA 3FC3A
chains in the Genus database with same CATH superfamily
2CGPA 1NGJA 4CUGA 3CQZJ 4KISA 1J0RA 4B9MA 2QCOA 3Q7BA 1M4ZA 3CCJI 1P90A 3QUIA 1FSEA 1VQOA 1YI2A 2W85A 2DL5A 2IOCA 3LSKA 1BC8C 4J2DA 2F2XA 4NB5A 2TRTA 2OTJI 1U48A 5GAMj 2X48A 2NVUB 2V1XA 1KVBA 1WHLA 3H9GA 3I53A 1ETQA 1ZYRF 1X2MA 2OYQA 2DETA 4YPHA 4A0XA 4IOAL 2IRFG 3I8DA 9ANTA 1ZAOA 1VQ8N 1EFNA 3M0UA 3EETA 2P8TA 3MX2A 3ZQGA 4EV0A 4IQJA 1VQ8Q 1KFZA 4FOEA 3HSBA 2MCNA 1OKRA 5GANg 3HDDA 1ZG1A 3DPUA 2Q8KA 2DDAA 4BQZA 3DLAA 4RAFA 3H3UA 5GAHP 1UGQB 1U5TC 1UHWA 5FLXO 2ELJA 4GKKK 4BROA 3UKRA 3ZSZA 5HKCA 5C12A 4CC2A 1E6HA 2AZSA 2DVEA 1RKWA 4J6YA 3MEUA 2CUEA 1VYUA 4EZ9A 4BQLA 2DFEA 2ZPGB 3MXJA 5KN9A 1V4RA 3LGFA 1A6QA 4M78G 1ZSGA 2WUSA 4JI3K 3F73A 1XQOA 1HSJA 2GQVA 3RERA 1NK3P 2OTJN 4NC8A 2XGCA 3KK3A 3F9KA 5JS2A 3VGMA 2G9WA 2EV6A 2UXXA 1W2BA 3FISA 2OTJQ 1X3WB 4HVUA 2YRVA 3EGUA 1XG7A 2NRZA 2P81A 3G71T 3RWUA 2PVGB 3NAUA 2FF4A 6AT1B 3EE8A 3J7ZI 1Q81U 4IHXA 3SZ2A 3N97A 4FWLA 2KK4A 3AGRA 4IXAA 3SHFA 1YLFA 4B48A 3M4OJ 1W7PD 3ZSWA 1K83J 1IKWA 3EFOB 3GCMA 3WXIA 1D09B 5I3UA 3CCQI 4CJTA 3S6WA 3LZJA 2VCPA 1U2VB 1SEMA 2ROTA 3VRZA 3ZQLA 2COWA 4A2AA 3SEZA 4BY6C 2QA4A 3DPLC 1G4DA 1FT9A 3LQRA 1WLPB 2RNAA 5GINA 2MWPA 4N4GA 3RTRA 4G7ZF 3EKSA 2I7PA 3HM8A 2KT8A 4OMNA 1ORNA 1AOJA 2LT1A 4BGBA 5A2QE 4DR5K 4DHYA 4BRQA 4AHRA 4NCAA 4B4CA 1QVGM 1RUWA 1TKTA 2WSEE 3MXIA 4OWRB 2VQCA 3W2VA 3N4PA 2QASA 2KZVA 3KZBA 2A40A 1Z7UA 1RT1A 3THXA 4RG2A 2ECBA 4ESJA 3CO6C 2Q1ZB 3H5NA 3AVKA 2KGTA 4H8KA 4X6AJ 3KYLA 3AKZA 2COMA 1PU7A 3CUQB 2F5FA 2B7EA 1PU8A 1V55H 2QK0A 4KAZA 5DD4A 2AIRB 1K9MR 4QKUA 1NMDA 2H6BA 2VIXA 3IFRA 3C65A 3QODA 1R1TA 1T3LA 4PJNA 4A3MJ 2L5QA 4I6MB 1D1CA 2GLOA 1SSFA 4Y17A 2JNGA 4RTYA 4E7LA 4HUFA 5CKFA 4YFKF 3CCQN 1ETWA 4I9QA 1O57A 2XG8D 1IN6A 4BQAA 1S5JA 5CIUA 2G8UA 1XG1A 3CCQQ 1U8BA 3CUQA 1BU6O 2YHTA 4M7AE 4CI0C 1IG9A 2JJ9A 1KJWA 4II3A 5E3OA 2M5WA 3OYKA 2PMHA 2J7IA 2VGMA 3A5LC 3VQPA 4M3RA 5ICGA 3NGZA 3MCPA 3QU6A 1Q9XA 2R7UA 3ZPLA 4M75C 5D5VB 3FHNA 4X62K 2FZKB 2Z99A 3DTEA 2QGFB 2NUBA 5K5OA 1VQ8A 4M6XA 1MJBA 1QQCA 1KQ9A 4OFHA 4R79A 5M1NA 2HKXA 1D3BB 3DYAA 1F1BB 4CF1A 3HM5A 3V1QA 2K3YA 2IT0A 1VQMI 3NWTA 5JMVA 2P4TA 2YX6A 4BI8B 4BR5A 1JCEA 2IVPA 4O8UA 2VWKA 4LF7K 2EH3A 1TVRA 2HNDA 3WEEB 4FE4A 3AG2H 1C0TA 1O3QA 3HI0A 2E5QA 1GCPA 3BR6A 3E6BA 1OCOH 1EO1A 2RQVA 5ILSA 3OGDA 2M0OA 4C8MA 4OPAA 2VE9A 2LOOA 4BKXA 3E5XA 4N0AC 1QBJA 2FU4A 1RI0A 4KH6A 1LQ1A 1FIAA 3TSZA 3H36A 4RTTA 4X1EA 1VA7A 1KSWA 5EGOB 4CC7A 4M3GA 2YG8A 3A5ZB 3MZHA 2H1KA 4B9QA 2BZTA 1U49A 1LCKA 2B6AA 2JVHA 3ID6A 4WQ4A 5LJ3h 3SJMA 1X27A 3MKDA 2I2LA 2LG4A 4CZKA 3ZSYA 1QP3A 3TR8A 4CCHA 1RBTA 3G71A 2EYWA 4AIHA 2Q0RA 1Q18A 5E1XA 1OR7A 1BG3A 2G7HA 5EGOA 1QVPA 3VEVA 2HL3A 3V9WA 2F9TA 3PUBA 3HL8A 1L3LA 4JK7A 1VQMN 1JTYA 3OYHA 4XKBA 2VXFA 3EG0A 3BWGA 5HLFA 4GYIA 1VQMQ 1UGSB 1S9EA 2Q0UA 2F5KA 2JTMA 1N25A 4MEYF 4XLCA 2HSTA 1R9TJ 1GLNA 4N4IA 1BWFO 5CQXA 4WFBL 2HHSA 4LK1F 1W4SA 1T0JA 2NS7A 1HW5A 2CZ7B 3N05A 5EEHA 4O8KA 1XSDA 2EJ9A 4M3ZA 3GFJA 1K9AA 5GJWB 4Q48A 1K76A 1YO5C 1Y0UA 3W2AA 2CSOA 1TL8A 1XB4A 3MP6A 3I0RA 3H3ZA 1TC3C 1JUMA 3K1NA 1QGPA 1PU6A 4B9TA 4M75G 2JJ7A 3BW1A 2DK3A 3M0QA 4BUGA 3JCMb 3O2PE 4FX4A 1HOMA 2RJCA 5F1XA 4DTUA 5KYWB 2IXSA 2DCEA 3TSUA 1KU9A 4DV2K 5C15A 2DJZA 4HTLA 2EQUA 4LITA 4G6DA 1OQKA 3WVEB 2DA9A 4BY7J 4II2A 1Z26A 4J8OA 4XSXF 5KCOA 3TAMA 1TT0A 3CMEA 2DA5A 3RCOA 2R7SA 5IT9Z 3QWLA 4Z89A 3LPUA 4AM6A 3PNYA 1KZHA 1BIAA 2JS2A 1ZUUA 3LYIA 1KFDA 5SZTA 2Y69H 4GLMA 1U6GA 2O8BA 5IOYA 4DV4K 2DTZA 3VDXA 4R1HA 1U4BA 3AVJA 3E9PA 4CJPA 1VRUA 3SJHA 5BPNA 2OA4A 3B8AX 1XGOA 1TH7A 1PKTA 2SEMA 3J80K 1IO6A 1R5ID 5J40A 4DS5A 3EDPA 3ENOA 3IV5A 1QWEA 2UU9K 4R5PA 2KW4A 3GTKJ 3ZSOA 2OZUA 5C44J 5AQHA 1R59O 3TQ7P 3D2FA 1BCMA 3CPWP 1Z91A 5H2FC 3OSSC 2KP6A 4B24A 1HNIA 5J47A 1X1DA 2XAQA 2CGKA 1LFPA 2H3EB 2R5YA 4ZNXA 3SFZA 2MA3A 3DLLL 4JRPA 4HLXA 2XKPA 4ENNA 3ZBDA 3CCRN 1NGAA 5C2FA 1JCFA 1YITI 3O8MA 2XD0A 3ZXSA 4CYDA 1QPMA 2YS9A 2MC4A 1KFSA 1NMNA 4J01A 4EM2A 3CCRQ 1J54A 3V8KA 3OSGA 2FX0A 3TCJA 1YJ9T 1V4SA 2QUFA 4JKAA 2E41A 1FOXA 1MNEA 2L0KA 3LA7A 5EC7A 4CFAA 3F9MA 3TMOA 1XQPA 1TSFA 2W40A 4A3JJ 2QEXT 4BR0A 4EAHD 3FZMA 1O7LA 2GQQA 4L9NA 3G4SI 4CCOA 4L0YB 1W2BS 1Q9YA 5K7HA 5AQPA 1PP8F 2GAUA 3KP6A 5L23A 1R8OB 4C2UA 1OZ3A 2GWJA 1W70A 1XMOK 3K4JA 4UB8C 3IHOA 1WEGA 4M3XA 2HW3A 2RQTA 4ZDOA 1MNDA 2M3AA 4J9GA 1MWMA 2X74A 1IG7A 4DU4A 5BR9A 4PK4A 2DTRA 3W3DA 2CZ1B 1CGPA 3QBYA 2E3HA 1A35A 2D6FA 2MW8A 3P31A 2IG0A 2A3LA 3HBTA 3E2UA 5D3GA 1WBDA 4KHQA 2OPRA 3C18A 5GTHC 4A54A 2DVJA 2VUMJ 4AFSC 2AQEA 1WH7A 3I64A 4ENMA 4KHUA 2KZMA 4M3DA 2KRMA 3I56I 2Y9YA 3M6GA 1ETYA 1NEBA 1RBRA 4KB0A 3IKMA 2CUFA 4M73A 3L3VA 1K8AU 2DBKA 3HRTA 2HVRA 4M45A 1YITN 2LY2A 5LEJA 5AQJA 1WYXA 3OS1A 1T8EA 2NS8A 2UXNA 3NAEA 1ETXA 2JGUA 4X65K 2CH5A 1YITQ 3L3UA 3OJSA 1NYFA 2HS5A 2XB5A 1SD5A 1TWGJ 4HCCA 2O9VA 2CV1A 3P83D 2ID3A 2O9SA 3M55A 1SL1A 1HU0A 1XMAA 4JP0A 5J8FA 3ZX2A 1PG5B 1DPUA 3QJYA 3G4SN 4OGEA 5J2NA 4J7FA 4M7DG 3UA6A 1S29A 4A3EJ 2XAGA 4BACA 3UKUB 3G4SQ 4H0VB 2FRWA 1GOCA 3WXKA 2JA6J 1OCRH 2OD5A 4CGDA 4XOPA 1SEUA 4B3XA 4PJMA 4AC0A 4WCEL 3V1RA 2EJRA 3OYMA 1YE9A 3GBGA 5E26A 1GXQA 4OP0A 4KHYA 1GXPA 3CC7T 3RR7A 1VQ4I 3ALYA 5IHIA 4FT2A 1QZZA 2R7OA 4FQGA 3ME9A 5CZ1A 2DXBA 3DCFA 2OAWA 4JI6K 5KYXA 1CXUA 4DW6A 2FC0A 4DLEA 3O3KA 3A0IX 2AO9A 4IJAA 1E2XA 2JMAA 1T6DA 2UXBK 4J00A 1Z7LA 4I09A 4KPYA 1VQLI 2WWYA 1HUXA 4KMUX 1M2VB 4XLAA 1RABB 1OPCA 4JHDB 2JXBA 4OKEA 2XAFA 1FMVA 3KD1E 5LL6Z 1NJXA 1JRIA 4DTNA 3G73A 3QYGB 2DXTA 3CCUA 3DXMB 1H1VA 3BZKA 2IVNA 3FZHA 3HFNA 2OCEA 2MLGA 1HD3A 3JAMZ 3R0AA 1BC7C 2V79A 3D5SC 1JJ2A 3ML6A 2ACJA 3KLGA 4B21A 1P59A 2K86A 3QP5A 2F5TX 3SZTA 4IG0A 3KFWX 1R77A 2GX9A 4OMQA 4AWXB 3HTRA 3T1BA 4BHBA 2RHYA 3MECA 2ME6A 5CR4A 4NQWA 5HLTA 3CCRA 3M57A 3QP6A 2X4HA 2EKOA 1UCRA 1LKXA 3G1MA 4JZ3A 1YJ9A 1YW9A 4C8QA 2B4JA 2CP6A 1VQ7T 5FU7C 4IDHA 5D6YA 2O8FB 1U04A 1J5EK 1BYMA 2X3WD 4WX9A 2HPMA 4ZYHA 3WXJA 2QEXA 3DLMA 1XPXA 1QU3A 2GM4A 3FJ5A 5FKOA 3ZLJA 4BRKA 1KG5A 2LTOA 4RBOA 1J5YA 4EMSA 1VQLN 4CI6A 2RHUA 4JK9A 3Q9SA 4I0BA 4PKCC 4F7UG 3B6AA 2KISA 5ICEA 2KYBA 4UNOA 1FBQA 1VQLQ 1WH5A 2WOMA 3JRFA 2RQPA 4PNOA 3ZMDA 4AIAA 1EKEA 3V9ZA 3HIFA 1VSDA 3JCUC 3A5NC 1GVDA 4OLAA 3R4KA 1UAXA 1MMGA 2HVSA 2XF7A 4HVWA 3VSKA 1GVJA 4CJKA 5JVGL 1YP5A 1AWJA 3BUZB 3V7SA 5CO7A 5F6FA 5ILVA 4P5OA 4UV9A 3I55I 2ITGA 4PKGA 4HTUA 3E9FA 1WJSA 3QYBA 2DEUA 4FYVB 4FWMA 2YI1A 1MJ9A 5LGUA 2Z3YA 4LDUA 3KUFA 4AHUA 3F3XA 3D7EO 3J7AP 4DG1A 2F5DA 5B1BH 2EV0A 2W42A 4OJRA 5T7BA 4I01A 2DMOA 4HF2A 4CF0A 4OB2B 2IS2A 2F4MB 3DKXA 3SD4A 4GY5A 1QVGP 2NYSA 3CLOA 4C92F 2XIGA 4NXNK 4KMFA 4FO0A 3MZYA 3VQ7A 1W5TA 1R71A 3CCVT 4FASD 5IXFA 5DCMB 2D0AA 2YNHA 3KHYA 3AVNA 1AVZC 4UXNA 2RV8A 4PJLA 3HO1A 2ADUA 2K4JA 3NGPA 4ELVA 3VGKA 1KTQA 2EA4A 4KJZA 4ASNA 5GAN3 1XDSA 1D0YA 1XC5A 4CJ4A 1YIOA 3EG2A 1GRIA 3AO5A 4Y15A 2NRWA 2OC6A 1WEIA 1J75A 3H1VX 2NNWA 2V1QA 4DKWA 1W36D 3PMIA 3CC7A 3NWSA 2L9NA 2PBDA 2E2IJ 3I55N 5GPAA 1TKDA 2LJ0A 3BROA 3X26B 2LDMA 2OF7A 1TTHB 1B92A 2M0MA 3I55Q 2XGDA 5F04A 1FY7A 3RVCA 5F0HA 1K7AA 1K9MU 1HSTA 2HBLA 4H03B 4I2PA 2DQLA 4AYBA 4PA1A 2I10A 3TSWA 3EG9B 5HNHA 4BL0B 1BU1A 5AN4A 2KBTA 3WHCA 4LJZF 2HBKA 3SBTA 4E6RA 2FXAA 4L59A 4DWIA 1XD7A 1ZHIA 2E71A 3SAHA 1YVUA 4RGUA 4XONA 5LJ3d 4FT8A 2ASOA 2P9NB 1NK0A 1JXSA 3FM5A 1ZBLA 4BRIA 1JJ8C 1KU3A 2G8FA 1ZQ1A 1WPKA 2XHIA 2QSGX 2BE2A 3MVPA 3GW2A 1ZLJA 3BOQA 4E7SA 4RDUA 2L9RA 2PFBA 3HSFA 3KLNA 2KQRA 3SZPA 1ETOA 4GKJK 1Y57A 1ZKGA 1PUEE 4I0AA 3ABLH 3H6EA 4M6VA 4LB5A 5DV5A 3CPWA 4FJJA 4CF2A 4EGYA 2X78A 1VFCA 1W97L 4KH5A 3H92A 2QWLA 1C1CA 5E3NA 1XS9A 3VERA 2YRDA 4AFUC 1I0CA 3A8GB 3FDYA 2W82A 2R5ZB 1VQ7A 4RM3A 3AO2A 2EQJA 5L3CA 2COYA 5BRHA 4KFCA 4OOIA 2VYPA 3OYGA 2IPOB 1NLOC 1RGIA 4JKGA 5B8HA 5IT9E 3CF2A 1SL2A 2VPRA 2Q36A 4AQYK 3K0LA 4PJOA 1HPMA 1JLQA 2DILA 4FWRA 4FM4B 2HQHA 1ZSZB 4XBFA 1NH3A 1GLBG 3J7AF 4ID5A 2QQ8A 1NGHA 2FBXA 2E4LA 1VQPI 1YNZA 2V1NA 4WQ4C 5DTDA 1SFUA 3FR0A 1OCCH 1LPLA 2X4YA 1BA0A 2E1HA 2DYIA 1WSUA 1KGSA 2Y0SN 3T7ZA 5HVQC 1TW2A 4LDVA 1RDUA 2LP0A 5KPZA 4JD2A 5IYBJ 1MDMA 5L3FA 4LSLA 1ZN2A 2M45A 4KNYA 3X20B 2PZSA 1IGUA 1YW7A 3KLOA 2WC9A 2F1LA 2FYKA 5CR2A 3COAC 2GTOA 2IC3A 2CFXA 1HDPA 1FJLA 3OA6A 4PQUA 1KK7A 1Z6RA 3FHZA 3PFYA 2ZSIB 1LFBA 3JRHA 3FIFA 1XTAA 4XAXB 5FPDA 4BGAA 1J9AA 2XKOA 2LK2A 3K4BA 5AT1B 4HHTA 3QINA 3QAHA 3O9QA 2XUBA 4KREA 1RCHA 3CP2A 1YWOA 3U6FA 3EAEA 1PCXA 4XLPF 2K9GA 1XOVA 4M3FA 1KG7A 2JS0A 4C92B 3F70A 1XCBA 5E17F 3HRMA 4RW9A 1LEBA 2HKOA 1FMKA 3NRVA 5I9EB 1VQPN 2FO0A 3A03A 4M7DD 4N5SA 2J6OA 3H08A 2WTEA 1NBEB 5BPLA 2FSWA 1M90R 1VQPQ 2DJNA 4MZTA 4B23A 1XSVA 5KAFC 1KAZA 3ZT0A 4E9FA 3VQ8A 1FOKA 3FBIB 2QWNA 2K40A 3F8NA 3FXMA 1U78A 3MWTA 4AD9A 1OH6A 1Q95G 1BR2A 3DOLA 1BKBA 1LWWA 1IXSB 2LSOA 4D5FA 1XHXA 1V76A 3CI5A 3JRDA 2E1NA 1Q86R 3K9KA 3LP3A 2Y4XA 1FMWA 3KZZA 2F4OB 3OIQA 2A05A 1K8AC 1ZG5A 1JJ2S 1SUQA 2ZD1A 3HYFA 3L2UA 2V6CA 3N5BB 3OMGA 3ZYYX 2RJFA 3ECOA 2F96A 4FETA 1RUOA 4Z0UA 3L0QA 3K70D 5DM7R 1UE9A 1JTXA 4BDZA 1PD0A 2COBA 2ZGYA 2CZ0B 2NOIA 2VC1A 2X0LA 3VW4A 2HHQA 3CCLA 1QQNA 5GIPA 3VODA 3PE0A 5F08A 4DR6K 4XN3A 5GAMh 5HK0A 5GANe 1B9FA 2FL7A 4M7AF 4DR1K 3E19A 3TDZC 5JICA 1RAHB 2VJJA 2QYOA 4F92B 3GDQA 4IRIA 2A1RA 3JRAA 4PL6A 2E12A 3JCMQ 2QKKA 1PKSA 1GCQA 4GFBA 1EH6A 3KX2A 5BPDA 1Y64A 5AQSA 3H8ZA 2VV5A 2DPPB 2K9QA 3JB9I 4WWCA 2MFZA 2D1HA 1YTYA 1YHQI 2AK5A 4BRDA 3LW5E 2R7DA 3LZIA 1XWLA 3ZCMA 4M3WA 5IHNA 2A6AA 2VBWA 1RT5A 2E2JJ 3M9AA 5M1OA 1LV5A 1HKBA 4PLIA 2ZM6K 2HCKA 2YNFA 2E35A 5CYVA 1RIOH 2VWFA 3PIOF 4ON0A 3V9UA 3T8RA 2JQ7A 2XRLA 1QVFM 1LJOA 3OBWA 1R23A 3SQ4A 3CQYA 4UHTA 2JN6A 1FXXA 2KMUA 2XHCA 5HLGA 2M9HA 4EJUA 1IUYA 4DF8A 1V4TA 1DT9A 1JEGA 1KRPA 4ORZA 3WU1B 1KCFA 2ZSHB 3HOSA 2RREA 2CRGA 3ULDA 1M1KR 3JAME 1YAGA 3HTUA 4Y0WA 3O9UA 1PWTA 3HYIA 1ZYQA 1G3WA 4BJTA 2NOFA 4W1UA 2BV6A 2O61A 1BI4A 3M0RA 3HG9A 4OU0A 2RHZA 2QLZA 1VUBA 3DBLB 5C42A 4Q5VA 1CKAA 5CJ9A 3VQ9A 4ISFA 2DD4A 1VTNC 3SWNC 4XU3A 3A98A 1BA1A 5LEKA 4B1ZA 1YHQN 4HVVA 3HK2A 1M9SA 4DQPA 4PLLA 1VIEA 1YHQQ 4PCQA 2W48A 3JCMV 2ZQBA 3A8OB 4DQIA 5LGTA 4LD0A 3HOUJ 5M1QA 2XRNA 4DK9A 4AIJA 5CCAA 4RGXA 4J2AA 5GIOA 2RB6A 3AVIA 1P92A 1GOAA 4M72A 1EX4A 2EYYA 3MEXA 3AVBA 1MIJA 2ABLA 4RCHA 4RMOA 5B3SH 2QDLA 4FW2A 3V4GA 2DL7A 8AT1B 1RDBA 3ZEUA 1ABOA 3MKWB 4A3DJ 2HR3A 1X01A 3E3VA 2R5AA 3J80Z 2RGVA 2JPCA 1APLC 3TVTA 3QNOA 1C6VA 4MLOA 1RDDA 5C3EJ 1WI7A 3C95A 3GL1A 2GGRA 4RTWA 2X35A 5LJ3g 4LGWA 2ZXHA 5K5QA 4BE2A 3CFOA 2D5VA 3DLLF 2RK2A 2HBJA 1B9MA 1NG9A 2QSFX 5DUIA 1W7PA 4CIGA 2ZMEA 2E65A 2LVSA 1NPPA 1KA8A 2XB0X 3CWTA 1MDUB 2E1OA 2QWRA 4DA4A 3QEWA 2VBXA 2HQ5A 4UNFA 2GELA 3WVDB 4X66K 3R6MA 2BW3B 2W7NA 3M0TA 3K4KA 2MWOA 2E1YA 1QNTA 2KDZA 2VJ4A 3CQXA 4FLTA 1ATSA 3DRPA 2Z1JA 2QGGA 1TV6A 1OH8A 5GAN6 3M8SA 1GLDG 4A4EA 1BBZA 2J06A 3BTJA 2EAYA 4L9JA 1N5YA 3GBQA 1AEYA 5M5WJ 1DUXC 3FXUA 1OU8A 1YS7A 2XPUA 3LFUA 3RMSA 4C8QC 4HA8A 1WSJA 1K1ZA 3ZT1A 4DTRA 1WVRA 2LBFA 2HF3A 4CD3A 3AO1A 2XU8A 3QIIA 2RC4A 4M7AB 3W3CA 2HOSA 5L3DA 4CO8A 1ZR2A 4AFQC 4LSNA 4KV8A 1VI0A 2CGLA 1FLIA 4FSXA 1NGBA 4YEJA 2QTXA 1A04A 2JW4A 1OLTA 2G6FX 3H5AA 2BE5F 4BDPA 4QS9A 1I4K1 1K9MC 4I2OA 4D9JA 4BHCA 3TEDA 4GV3A 2E2HJ 2P9KA 1IF1A 4KI6A 1U9NA 4JKDA 4BWMA 4CGHA 1TWAJ 2D8HA 1MU2A 5D8KB 1QCOA 2CS3A 2P9IA 5KN8A 2A36A 2VBYA 2X6XA 3QEPA 1QRYA 5IY5H 1G3SA 1DGWY 2IS1A 1GL5A 1PUFB 1X1CA 4OLBA 1HNWK 1HKGA 3LWMA 4RB1A 2VUBA 3FZVA 2VL8A 3BCAA 2LREA 4J6WA 1ACIA 3A02A 3C94A 4ZC3A 1P7JA 2NUPA 4L5IA 1NLVA 1B6AA 3RSNA 2ZJQL 4DUZK 1XCVA 4GYGA 3Q7CA 4BC3A 4CH7A 3N4MA 4EMKA 1LVKA 4FW1A 4LLLA 1OPKA 4JKBA 2P5VA 4BRGA 5CHZA 3RIRA 5AZJB 3OHRA 3IAM2 3WGHA 2VJ5A 1Z1DA 4G6TB 3SFIA 2DA4A 5DLQE 5EVZA 5EF6A 1YCYA 2AP1A 2RE2A 2F4IA 1VYVA 4ID1A 2IP2A 3TDUC 1SMTA 1I6XA 2NRRA 2OJ2A 3B6PA 2V4JC 5DM6L 5C0YA 1YT3A 4PKHA 3DKWA 3OL4A 2MH9A 1WHJA 4QOZB 3S14J 5AZJA 2ZXJA 1VZ0A 2GF7A 3SQ1A 1UMQA 2CREA 1SAUA 3K57A 1RESA 2ZFUA 4DTPA 2BUDA 4JJBA 1IXDA 4N47A 4GO1A 1KVAA 4LIVA 2P5LC 2BIVA 3A1YA 3FXOA 5C25A 3NDKA 4F2RA 3K6GA 4WF2A 2LMJA 4IWVA 3MXMA 3GP8A 2HYGD 4ZGJB 1YWPA 3IKTA 1WNLA 2FSNA 4C8QG 2W41A 4CA0A 3F8BA 3CCST 1T2KA 4BBRJ 1NGCA 1TZLA 4MQ3A 4M9XA 1E4FT 1LDKB 1X3NA 1HKTA 4Y7NJ 2LD5A 1EETA 1T0FC 2JVGA 4HCBA 5GADJ 3CPEA 3DJCA 4JZ4A 2OUMA 3CJ7A 1MGQA 4A4HA 3IH4A 2WB1N 2DNUA 5ADXA 4B9VA 1SZ2A 4ELYC 2CP7A 3HKSA 3PMTA 3LH0A 5DCFA 1T98A 3GG4A 4E7IA 3V1OA 1YJNI 1BIZA 2DA6A 3T0YA 1LWEA 3L00A 3OS0A 2KKOA 2MMPA 2NOJB 1YIJI 3M8QA 1VQKT 4J9IA 2PLYA 3M0SA 3O08A 1Q86O 1Y6IA 3QQAA 1V5EA 3E9GA 2M7AA 2J5PA 1MUYA 3RDIA 5GAN2 2K2VA 2FNAA 4WE1A 5JVGF 3SLCA 4OAYA 3K4CA 3M1CA 4B9SA 2FPFA 3EGXA 3VF6A 1OX9A 3I59B 4YOTA 5HCKA 4XKVA 4Z4GA 5AQXA 3FFKB 4E19A 1C0GA 4HAMA 3CQ8A 2DY4A 4JYAK 3QG1A 2VONA 4PJOC 5H6RA 2X6YA 1N75A 5KGWA 2UUAK 2E20A 3MN7A 4J9CA 3GFMA 2KRHA 1L5UA 3NF7A 3CXCM 4PUSA 5HRRA 3ZETB 4IPAA 1Q1HA 2Y75A 4M77C 1KAYA 5J3LA 3H9NA 5GAEJ 4XH5A 4MFEA 5GAN7 1S7AA 3L1AA 3CMAT 3BZCA 3NF6A 4LDXA 3FRNA 2MI6A 2FZGB 2XMFA 3WTXC 1YJNN 5E8GA 1P8ZA 2LSNA 5I42A 1CQTA 3L4IA 4DGWB 1LCUA 1YIJN 1YJNQ 1CZ9A 1SF9A 3ASKA 1MBEA 3KETA 2Z5UA 2M0CA 4OMYA 3JCMJ 1YIJQ 5J1RA 2YU9J 1UTIA 1Q7YR 3CVSA 3L9FA 1UAAA 2PBIA 3NF9A 1BO5O 2XKOC 2YPRA 2EFPA 1TBXA 2E5LK 3S3NA 1KO9A 2O5RA 3CCVI 1X1AA 3G1OA 1ZG3A 2B63J 2P4WA 4LF9K 2DRKA 2XSDC 4V2FA 2QBYA 4C2MJ 2RN2A 1MSEC 3FHGA 4QIWN 3KEOA 3AO4A 2YUQA 5HDGA 1ZBUA 2DJQA 2HWVA 1M1KO 2LFBA 4FSSA 2W4SA 2W6KA 3G6EA 2CUBA 4MZMA 1T0HA 1TUDA 2DRMA 1VQ6A 1NJIC 4XTZA 2B8AA 1XNRK 2VC8A 3VEYA 1UHCA 3HOWJ 1YF5L 3CDHA 2DMTA 3NHNA 2H3GX 1Z0XA 3E0JB 4EIKA 5IT3A 5GMKi 1YX3A 1M90U 1S1NA 4OB0B 2BHYA 3IQLA 3OW2P 1LW2A 2ETHA 4BHPA 1MBJA 1B59A 3LL3A 2NRAC 3I9QA 4LXCA 1JL2A 3J81K 4FWOA 4A4FA 5GANf 4U0YA 1KEAA 1J5OA 1FBSA 4ZZLA 2V7FA 1WHUA 3HBLA 4DTSA 2LLKA 2ISZA 3UA7A 3VEOA 1HF0A 1FZPB 1I5OB 2V9KA 1W6XA 5KYUB 1QCFA 3BQYA 3UKGA 1MNMC 4PJOG 3JB9J 3CCVN 1I1SA 1XNQK 1GLAG 2L9SA 4F4KA 2CW8A 4ANJA 1NK6A 4IUPA 2JTEA 3NF8A 3GFLA 3KEQA 2E19A 3H1CA 3CCVQ 3I35A 1SRLA 1M2OA 1XGNA 2PJRB 3LOCA 2PN6A 2EQRA 2A68F 1JBMA 3NFCA 3UATA 3SYZA 2Z2SB 3DLBA 3HOVJ 4BRHA 2R7TA 1Y97A 2E5NA 2WACA 2HHTA 1Y96A 2ZNYA 3W6VA 3M5RA 3W6JB 2AZVA 1L0OC 4BU2A 2OTLI 2O3FA 1KQSA 1NOZA 2IS4A 3RDVA 2DBMA 4AM3A 5BS6A 3FBNB 2ED0A 4A3IJ 1GCQC 3ER0A 1E3OC 1SKUB 5J1EA 1GLEG 3R8EA 2DFIA 2L7ZA 4JJCA 1QVFP 3E6CC 4W5TA 2E8AA 4BE0A 1ASWA 1TK5A 3UPUA 1DGKN 2ZBKA 2F8SA 3BEXA 1K61A 4XK8E 3J80E 4HZFA 2FOWA 2NUZA 4ENJA 2KI7A 3KP3A 2HBMA 1RDCA 2PTKA 4G9YA 4DUYK 3MKYB 4ILHA 3DXKA 2CQQA 1VQNT 2D1KA 2MOXA 4MQ9F 1ZBSA 1ZK8A 1S6LA 1PD1A 3AV9A 5BRDA 4OIQF 1SV5A 4CCLA 3GF5A 4JX4A 5LHGA 1K4TA 4IBNA 4CEAA 3P38A 1LDDA 4MFDA 1JKOC 3CETA 4J7IA 3C7NB 1PRMC 3CMAA 2QGUA 2XROA 4C0DC 5E1ZB 2RN8A 2WAQA 1FYLA 4EJVA 2KEAA 3HJFA 2K5CA 4KULA 3HXMA 3TP0A 3GX4X 5FU6B 2FHDA 5FD5A 4C92G 1M1KU 2LP5A 4CDGA 2OTLN 4AH9A 1L3UA 2EX3A 4CFCA 4DNCA 1G8XA 3PIPA 1N3CA 3B02A 2AKLA 2OTLQ 1SKRA 3PM1A 4EHTA 4B43A 3GLXA 2XRIA 5D6XA 4A57A 4WFAL 2CSQA 4IO9F 2HDWA 3EYZA 1RAGB 4KIFA 1GLLO 4B1VA 1KLMA 1QSYA 3CC4A 4CEZA 3LSMA 1TKZA 3REOA 3M1EA 2A42A 4IEJA 1WA7A 2DOEA 4IFEA 5GAOq 1DPRA 4DBQA 4NB4A 3S8PA 1IXRC 1K4US 1ON1A 1N33K 1MW7A 4NHJA 1YQRA 5GMKe 2OI3A 1HX1A 3VPRA 3LSRA 4XRSA 1PVSA 3RYRA 3SUOA 2IAIA 3A1PA 1IV8A 4CGJA 2EYZA 5FWBA 3NARA 1PNJA 2P9SA 3KXTA 3BF1A 2K4BA 1RL2A 3WTSC 2CQNA 1FP1D 1BN5A 4FYYB 3T9NA 2L0AA 4H5NA 4M9ZA 2HU9A 3EKUA 3KNTA 1T05A 2P9PA 4XNFA 3BY5A 3DU5A 1LWCA 2F5EA 3N0UA 2MK5A 3LSTA 2L4MA 2ZMEC 1A5WA 3EEQA 5KGXA 3I8BA 4YFNF 1QPIA 3AVMA 1TK8A 2JSCA 3LCNA 4GMJB 4M71A 3K59A 1GUUA 4OF1A 2QK9A 4MDXA 4RG8A 3QPHA 3C6AA 3BF3A 4DSEA 1HR0K 3EE9A 4H0XB 3GMEA 2Q31A 3H6ZA 2O9LA 3J80O 3KP2A 2LYCA 2YHXA 3KYDB 1DTQA 4BY9C 4GDFA 3LSIA 1S1XA 2HQNA 2V9PA 2NRXA 3EUHA 4L5GA 1KONA 4YNQA 1OV3A 1LUJB 2K57A 3PO5A 3HP6A 2R5MA 3KLFA 4MEXF 2VOPA 3VESA 3C2HA 3TBIA 4J2EA 3G7ZA 2O7OA 3D2EB 4XIUA 1XGSA 4CESA 1G83A 2IVWA 3VYGA 1XJWB 3GTOJ 2JWTA 1FSHA 3SAFA 1MJAA 4XIDA 2FE3A 2BE9B 1ETVA 4M3UA 2E4HA 3HT3A 4EFHA 4YOWA 3EH2A 1K8KA 3VQ4A 2H6CA 2V9VA 5GAN8 1S72N 4E7JA 3DEEA 2F2VA 4GGGA 4HSBA 1XC3A 1B9NA 2X1DA 3IH2A 1S72Q 3ABUA 1S9GA 3R6OA 4ABZA 3V9XA 3HVRA 1AKHB 4IDKA 4Q5WA 3BG6A 3D2EA 3IUCA 4H4MA 4OPJA 3V9SA 3T69A 1MMAA 5H20A 4JYKA 1UGVA 1O75A 2BANA 2VASA 2EGCA 1QZEA 1OH5A 1X2NA 4CEFA 2EIJH 4NYNA 1N3AA 1RBSA 4CHYA 2XDVA 2L9VA 1S8NA 1XNIA 2KE9A 5AQVA 4XTYA 3ZSRA 1CZAN 3QIOA 1WEFA 4CW7B 2FB7A 2J05A 4CZGA 1X75C 3CTAA 1F43A 4F52A 4AIDA 3VA3A 1RTJA 1KQ8A 4CJWA 2OFKA 2NWMA 2ID6A 4JK8A 1UWBA 1TYQA 1X1PA 3UT1A 4BB7A 2M34A 3CWSA 1X6BA 1WSFA 3TAQA 1M5Q1 4O44A 3LP1A 1B34B 2BHZA 2XGEA 4EMKC 2ZXWH 5AQZA 1D8YA 5D5WB 2RK1A 4KICA 2Y9ZA 4I9LA 1RACB 1QW1A 3L6QA 2HEQA 5CAIA 2UXCK 2P5KA 3CCMA 2V1RA 3CIPA 4O4GA 3K7AJ 3U8XA 5GAMg 4DR4K 1WNSA 2RPNA 1W5SA 3KK1A 3G1JA 3J8AA 5IYDJ 4R8HA 5K7ZA 3SK3A 4EHUA 2K9MA 4FVUA 5LJ5j 5LRSA 3PUFA 3RQIA 2O4XB 1FIPA 1IAWA 1UUEA 2B0LA 2V8KA 2L4AA 1D1BA 1WHMA 1VK0A 1Y1WJ 3CCET 5EY4A 2LH9A 3B6OA 2E88A 4W5OA 5DUKA 4BQNA 3CC2I 1EIFA 3M58A 4ME7A 2MC3A 2A69F 4E7KA 4X34A 2KIMA 2O4IA 1TAQA 1MKMA 1RI9A 2WAEA 1S6PA 3CWUA 3VEXA 2GUPA 1DIZA 4M6YA 2HDDA 4B9UA 4XQFA 2KRNA 2HQAA 1YJWT 3C0BA 4KIGA 3ZP5A 3PVLA 3AA5X 1FP2A 2FUG2 3LA3A 1HQCA 3VJPA 4A4KA 2FVUA 2KJCA 3C7JA 3KCCA 2EBPA 4LD9K 3HVTA 4AT1B 4FLZA 2KRCA 2VQGA 1QCNA 5A2QK 1JU5C 4L5EA 1UHSA 1JT0A 1ATRA 1WUAA 3SEQA 1KHIA 1QHHD 4LFAK 3DLEA 4F3QA 3GTJJ 3QDFA 3VF2A 3EUKL 4FLVA 4HV5A 3JTGA 3ZQIA 1O13A 4JKHA 1E17A 1TLHB 1FTZA 1A6IA 3GZNB 4HNTA 2JM9A 4CJ7A 3OSVA 4CEBA 1ONVA 3EG3A 3DV8A 2HOTA 3VYUB 2X51A 3QO3A 4M7AG 2UXDK 2YR2A 1KQSS 3DTKA 4OMZA 1P4WA 2O8KA 4E89A 2EZIA 4DTXA 4Y13A 3ZT4A 3ZN0A 3CC2N 4B1RA 2H3JA 3CFRA 2R7XA 3CD6Q 4M7DA 2GIVA 3CC2Q 1RI7A 1NKCA 4LN2A 4BYYA 3CXCP 3TL4X 3RPQA 1R5HA 3ZMTA 1KYZA 4EDUA 2ELKA 1G6NA 1KYWA 2PMZA 3D0PA 4GBQA 4BRNA 3AARA 1M90C 3P9CA 2LCCA 5J2QA 2I5UA 3HRGA 4B1WB 3O3FA 1JLBA 2ZJQF 3HOXJ 2Y4YA 1G15A 1RFQA 2ASPA 3JB9H 3TP3A 4CHOA 4J9HA 2FBHA 5AYFA 4RB0A 4OIOF 2ZO4A 3DBHB 4PHTX 3TW7A 2ELHA 4E70A 3HB9A 1N5ZA 3IH3A 1IJWC 4HUGA 3KWIA 5LLQA 1WJFA 3NFAA 1PDNC 1I3QJ 2AKKA 4IHTA 1XMXA 1Y0NA 1VHXA 1W1WE 3MCZA 3JSOA 1BL0A 5F1JA 4A5MA 3L09A 3VUBA 3O8VA 4HF1A 1NJWA 3GO5A 1PC0A 2A3ZA 2D0OA 2JWKA 3ULEA 4CFBA 2BYVE 2IA0A 1YW8A 2HNIA 1IJJA 1BGXT 2AHQA 1WJRA 4BBSJ 4C92D 4D5CA 2VQEK 1G2BA 1Q7YU 4M7XA 3SDBA 3VEZA 2JOYA 1X69A 1M30A 5EG2A 5FLXE 4XTVA 2YJEA 1KD1R 5HRNA 2R58A 1R49A 1K8AR 4IUQA 3FXRA 4NCBA 1LWYA 1VAZA 2E1MB 3KZYA 1N9SA 2KT0A 3S2WA 5DLOA 5AR0A 5DM7F 1NKUA 3FWEA 3K2ZA 4J6XA 2EQMA 2JUGA 3GPLA 1YQKA 1A36A 3PJRA 3AVLA 3G3ZA 2DXUA 4M78C 3RSEA 3TREA 2QA4T 2CUJA 1D9DA 4CEOA 3GIBA 3S1NJ 1F5TA 4KH1B 2DA3A 2HKNA 1JLGA 1QKXA 2KROA 3AO3A 4JI4K 1JLCA 1E4GT 4CD1A 1N8RR 4B3MK 1WPYA 3FKIJ 1Y1VJ 1Y07A 3OYCA 3G0ZA 3ABTA 4EA5A 1WOQA 3CYMA 3AL0C 5LJ3e 5FGMA 1TNTA 1SAZA 1N6QA 3CCSI 3H3NO 4KUMA 1ZRDA 3QPSA 2R7QA 5BN8A 1NNEA 4FLWA 2ZNZA 2KHMA 1MSFC 3TANA 2FEIA 1KG6A 2QWOA 5GAOr 1M1KC 2HF4A 3TTFA 4PSWA 1LVAA 2X3XD 4YRVA 4DLGA 1W2BM 2Z1HA 2LQKA 1TTYA 4FWSA 4YOVA 3SQ2A 4LFBK 3SB2A 3M9QA 3DPTA 3RR8A 4OAZA 3LWFA 4FJIA 2K9NA 2OBPA 2EGAA 1D3YA 1USTA 3S2HJ 4HT8A 1BR4A 3EG1A 2I0NA 1K0SA 1AZGB 2CP2A 2VN2A 2KSSA 4CJUA 1KQ2A 2P9UB 3CESA 1SQKA 5HS8A 1TGOA 3VPZA 3L2VA 4LG0B 1VQKI 3CD6A 4M3YA 4A3BJ 4O6JA 2D0CA 3S93A 4CZLA 2HAXA 4Y4RA 3OYNA 1WDXA 2RO0A 4CJEA 2JN0A 1VQ8T 2RI2A 3CJNA 4DEXA 3RKQA 1IRXA 5K14A 3CBOA 3ZMVA 1LWVA 3K9JA 4M63C 4ILJA 2J4RA 2FLOA 3IRQA 1QQMA 3KKRA 3K0SA 2VODA 4LG0A 1IC8A 3CCSN 1QLYA 3HUGB 1X43A 4R56A 1NKEA 1BJZA 1UOCA 1IZ6A 4CCKA 5M1PA 5HS9A 2JA2A 4GXOA 4UVBA 5CYMA 2QKLB 1KLNA 3FK7A 5KQ8A 3O3GA 2HGCA 3OH9A 1W1FA 4FE7A 4DS4A 4DSFA 1MUNA 3M53A 4IFYA 4ZDLA 2V1DA 2HXOA 4EA4A 1SVOA 1C0FA 4FZXC 3LDOA 2DMPA 5K1YA 1GBQA 1NM7A 2Z0WA 3E5QA 3CCJN 3FMQA 4LB6B 4KYWA 1SANA 3JCMf 5DY9A 2E7XA 2HNZA 5M5XJ 3CCJQ 3AVAA 3A8LB 1H89C 4XICA 5H6QA 1R6RA 4KGZB 5ECAA 2JUCA 3QO9A 4O0JA 2X85A 2OTJT 5LJ5f 1VQKN 2O8CB 3W6KB 1U2WA 2L01A 5AQUA 3TOBA 2GQIA 1IKXA 5KVRA 2VKNA 1VQKQ 1U9OA 2YT6A 1BK2A 1A5VA 2W24A 3NNQA 1XSXA 4X1VA 4CGZA 2RMOA 1CSKA 4PFOA 3NTKA 1F9NA 2QXFA 3AG3H 1JXBA 2QWQA 4NUBA 1O1WA 3WGGA 1SL0A 3JCMc 2ZGZA 2O8CA 4Q4ZF 1BL3A 3A5MC 2DZ9A 3K4MA 4J9DA 2Z33A 2LQWA 3J81Z 1RT7A 2HHXA 1VQ9I 4MMKA 1UEBA 1VYTA 1J6ZA 5BPIA 1SMYF 2I5JA 1EJ9A 2KY9A 2NXNB 2YLBA 5JLWA 2HFHA 3JRGA 5C4JJ 4AVZA 3G2BA 5GTIC 1Z6TA 2JT1A 1IKVA 4XH1A 3CW7A 5D5UB 2XDDA 2MPXC 3JSPA 4H5WA 4ZYDA 1S7OA 4QQGA 2BGCA 4LDWA 3EFOA 4I98B 3HFOA 1HJDA 2FBVA 3QU3A 5D6WA 2LNHB 1U2VA 1MZBA 4MFBA 3JYTA 4WXDA 2QQ9A 2FF3B 3FXQA 3F6VA 4A3KJ 4FJ5A 2X9DA 3SUPA 3F10A 2SRCA 2QWMA 3H41A 5J26A 1X58A 4DZPA 5EU7A 1NK8A 3HPGA 3DQVC 2CYYA 3ZQCA 3CMET 3C3WA 3LM9A 4BRCA 3IS9A 1SD6A 3O3HA 5HROA 1RKTA 2EYXA 1WXUA 2YX4A 1BB9A 1T08B 1WQ2A 3ZFJA 5GAN4 3VV0A 4WFNL 3KD5E 4BEHB 3UNGC 4A6DA 3DWLE 5HS7A 5KTQA 2K9LA 3CCQT 3EGDB 4ELZC 2F9WA 5AFUA 4GLKA 5AQRA 3QYEA 2D9TA 1VQ9N 4G1QA 1X6GA 4H0OA 2RI5A 3LM2A 2EZLA 4M7AD 4JI7K 4J8FA 1VQ9Q 1YTUA 1RTHA 2EIKH 1W36C 3HOYJ 4C0GA 1ZA2B 2IBDA 3GTGJ 1IRGA 2Y1IA 4I6MA 5J1UA 1BOAA 1RPWA 3GWZA 5DD8A 4N56A 5GAN5 3X24B 1HYVA 2QWPA 5CLSA 2D1VA 1XMQK 3KTQA 4HXJA 3CXCA 4QPQA 1NK2P 4B1YB 2NOGA 4E9EA 1ZUKA 5F2RA 4JV5K 3HC7A 1VQNI 5H1SQ 4M75F 3MPUB 4EP5A 4BR9A 4DU3A 4FL9A 1Z77A 1W0UA 3ULRB 4RW7A 3HOZJ 3IKVA 3QB0A 5EJCA 4C9YA 4IZ9A 4CF9A 2Y1JA 1D3BA 2JZYA 3QMLA 3BT9A 4LFUA 4C2TA 4OPHA 4A53A 5FKLA 4EATA 4XRSG 4IURA 1FTTA 2XC7A 3CCJA 3HKZN 2NOHA 3UB5A 1IBLK 4KN4X 2KTQA 4KBOA 3WEEA 1K6OA 4GW6A 2OTJA 1NLPC 4C5EA 4YIFA 3WU0A 2BZYA 4K0KK 1RAFB 3RI4A 3FXKA 1TNSA 4O5VA 1HC8A 5IXBA 3JRBA 4FYDA 4K42A 3BPXA 2DQRA 1B7TA 1U5TB 3CP8A 2KJBA 4NXMK 2GNCA 2CFOA 4PGHA 1FEXA 4B3TK 2HTJA 4YFXF 1WQ7A 2NOEA 3JS6A 2KFNA 4M7YA 1ZQ3P 1T38A 3K5LA 4A3FJ 2ESNA 1VQMT 3KP5A 2MYSA 1GLCG 4S04A 1WBBA 5TKWA 1VQNN 4BXUA 2PMUA 2ENMA 2BTFA 4IIOA 1OMIA 3PIOL 4UQGA 3GFIA 5I2SA 1RBUA 2XHKA 3LDLA 4NDLA 3U4LA 1VQNQ 3HTSB 2V6EA 1N27A 2DPNA 3R6SA 3MDQA 2R0QC 2HDAA 2VGNA 3SV4A 5CZ2A 2E34A 2BTTA 3NPFA 4JRKA 4XH4A 1DQUA 3BDDA 1X9SA 4WF9L 4KDPA 4PSXA 3QZ5B 4H5VA 1KD1O 1KC8R 4IKFA 4N41A 1K8AO 3SNNA 1C0MA 2Z1GA 2Q0OA 3PFSA 1CZBA 5C24A 3RPUD 3HZ6A 3HGYA 4KH4A 2CP5A 1W9HA 4CE9A 2G0EA 2BVLA 4JAXA 2M02A 2PUOB 3VUZA 1YFNA 3KBGA 4E47A 2EYQA 1KXPA 1NBWA 1SD7A 4BI4A 4DMNA 4KA4A 3GOIA 1ORKA 1VQ5I 4YHHK 2YKNA 4H5RA 2X6OA 2P0QA 4JRQA 1TAUA 2H56A 2QKBA 3L1PA 4DOWA 4CHPA 3CPFA 4C3HJ 2GEMA 4FM2A 4IEIA 4DYQA 2FSJA 4BY6B 1XMKA 2QQBA 3LSGA 1Q7YC 2EBIA 3P1GA 5KYWA 2Y0MA 1N8RO 4HX4A 3ZQHA 1IO2A 3DFGA 4AG1C 1B9DA 3VS6A 5J6XA 3CCQA 4S05A 1D5YA 1GLJO 2ZF5O 2YHWA 4KUDK 2HTSA 4L5JA 3CCUT 3RTVA 4M7DC 5K5RA 4J5YA 1I8FA 2XSJC 5DK5A 3O4NA 2W57A 2O4GA 2JMCA 1WI9A 1NHAA 1WKMA 2LZ6B 1C6VX 1DLOA 3U9DA 2FJ1A 3TOAA 2D8JA 1WFWA 2HXIA 4BR4A 3PQJA 2DXIA 3REBB 3TAEA 1Y71A 3RESA 3QWYA 3KK2A 3CCRT 5JLFA 2AJQA 4XLFA 2DOFA 1LJ9A 4F17A 1L3TA 2E2PA 2A7YA 5JS1A 1VQ5N 1JXMA 1D0ZA 3HTVA 5D5XB 2QENA 3IRXA 3HRSA 2ZPHB 4JPBW 4MGRA 1VQ5Q 2MD0A 1POGA 3AFHA 3BFMA 1C0WA 2EPDA 4RMNA 2QTDA 3BY6A 2FQ3A 3K70C 1NJIR 3AY9A 4M75B 3WNHA 2GBQA 2XY7A 3X2QH 4MZPA 3K1MA 3MK6A 4XQ3A 1OCZH 4J9EA 1TP4A 3AVFA 1BHLA 1JKRC 2I5WA 5DEQA 2LKXA 3HGGA 2VXDA 4C1NI 3S17J 3IAS2 4RLQA 2R57A 2Y31A 2WSFE 3C6HA 1FYKA 5L8RE 2HNYA 3O6WA 4C0FA 2M51A 2JPSA 5JI6A 4KITB 3TI0A 3R3LA 4CK3A 2TDXA 4CBUA 5E20A 3WGIA 1KD1U 1JJ2M 2KLAA 3IP4B 4A2UA 1EQYA 2EIFA 1YITT 3LWHA 3BG9A 5HDKA 4KHSA 1VQMA 2IW5A 1BI3A 3CCEI 4G7OF 2ESHA 3DXJF 3PNVA 2HYFA 3ABMH 3R9PA 4C0ZA 2LCSA 2Q97A 3R61A 4QTRA 3TW6A 4RCCA 4BR2A 5A2QZ 1D1AA 2OU2A 1LE8B 2P4RA 4CHQA 4KB1A 2C0TA 4F3OA 2VBZA 1PSFA 4JI8K 1W2BP 3G4ST 3Q3SA 4FYXB 2QSHX 2V8JA 5LD2C 1Z25A 1KQ1A 1QZYA 3F72A 1OCPA 1HKCA 4CHNA 3SMSA 2YNIA 1YJWI 4K25A 5IP6A 4FJKA 1N8RU 1NU0A 4BC5A 5BR8K 4CZZA 3OJUA 4CZJA 4RGSA 1T56A 2E5ZA 3KEYA 2A6TA 3VGLA 3BJ6A 4E1JA 2OX7A 3ZSVA 4F7UF 2RQRA 4QQ6A 1RTDA 5A0LA 4HT9A 3OYDA 3UKUA 3S6IA 4EMGA 3MEWA 1OYIA 1LPQA 3IWFA 1P7MA 1GFDA 1IN8A 2NUTB 3I56N 1C1BA 3LQQA 1DGRM 3LLRA 1S5LC 2FA5A 2G8KA 2KDOA 1VQOI 1YI2I 3RZOJ 2GWKA 5KYYB 3I56Q 2L02A 3GTMJ 4GRIA 3I9V2 2ZJRF 3CCEN 4KO0A 4RB3C 1RUNA 2DPUA 1IV0A 1QSSA 1GV2A 4P9FA 4O0IA 4W5QA 4CVNE 3CCEQ 2ZZDA 3KLIA 3BP8A 4J9FA 3A4CA 4PFZA 3EL2A 2XAJA 3PO3J 2DYBA 3BJOA 4LG3A 1S3JA 2EWNA 5J4YA 1XGMA 3QJ6A 2E1CA 2DMUA 4KHWA 3F8FA 1ZX6A 2Y90A 3LALA 3QPTA 1M2VA 1RDAA 1K9MO 5ILUA 1U5SA 1YYVA 4JHDA 2KKZA 5AQQA 4QVDA 1RRQA 1P6RA 5ICFA 3U2RA 4DQSA 1B72B 2LVMA 4LLGF 3DXMA 5F64A 2H8RA 3MWPA 2QXLA 1UGRB 3DMJA 2GFAA 5B66C 1VQ4N 2X1CA 1LFUP 1FNNA 2QM1A 2PUKB 1VQ4Q 1JT6A 4DSLA 1FOYA 4QQDA 3UF4A 4C1NK 3GEZA 2AT1B 2D0BA 4IZZA 2L3QA 1TWBA 5FPNA 3HL2A 2CW7A 4JRIA 1U8RA 1VQON 1YI2N 5ELZA 1U1TA 4A3GJ 2P9LB 3DF8A 4IUTA 3OH6A 1VQLT 1T6CA 1HYSA 2BY2A 3ISNC 2CG4A 1VQOQ 1YI2Q 1UHFA 2KR3A 5C6SA 1T03A 1NGDA 1ETKA 2E10A 4A61A 4X64K 5L3GA 2P0PA 2GBYA 1HJOA 1M8MA 2O8FA 3GNFB 1N77A 1QP2A 5B5EC 4M77E 1RR7A 3E66A 2ITMA 5FLVA 3KP4A 4C23A 4CZMA 2L8DA 3SYTA 2QTVA 2QAZA 2VOOA 2CP0A 1U45A 1X19A 2QVOA 3D7SB 5GAMe 3K5NA 2X4XA 3M5AA 4DF4A 1TL1A 4DTOA 3WT0A 2DEQA 2V7ZA 1HJRA 1HPZA 4BG9A 2M2EA 2DIQA 3DP7A 3THWB 5GAOm 2B9SA 3MAQA 1HQEA 4HEA2 4XORA 5FROA 2W25A 2IGIA 4M74A 3PSIA 1YITA 2IA1A 5GADP 4AHSA 1YG2A 2DI3A 3INZA 3I71A 5K7FA 2KXCA 3OWTA 2UUBK 3QEVA 5CPRB 3JCMh 4FCYA 2QA4I 4UUVA 1YN8A 2VI6A 1AHDP 1V29B 2ROLA 4DV7K 4BE1A 4E7ZA 3OOUA 2VG6A 1W0TA 4MDAA 4K41A 1JJ6C 3HPHA 3Q0WA 1K73C 5LJ5h 3T19A 1RC9A 1QZ6A 3G4SA 4KGXB 3BR1A 1NJYA 3O5ZA 4FOIA 1BQMA 4I2QA 1ZGAA 1CF7B 3M8PA 2J6KA 3UDCA 1KAXA 2STWA 2QG9B 3J81O 3EY1A 3CLQA 2FMLA 5DCMA 4A5NA 4ELTA 4BRPA 5E84A 3CJ9A 2QW9A 2CT4A 4LK0F 1N36K 4YIRX 3I5RA 2Q2RA 3PSFA 5FPEA 3U9ZA 4HDVA 5BREA 3BE3A 5AQYA 3I55T 5KAIC 2YUPA 3BG3A 4MO4A 1ZXOA 4NLBA 3CJRB 4BRFA 4F7UB 3I56A 3ZMUA 5LHIA 4AHVA 1KC8O 4V2GA 9ATCB 1SFKA 2EPFA 3VFZA 1L3VA 3CUQC 4N76A 3D1NI 5ADXH 3P8BB 4U7DA 2QA4N 3S1RJ 2C6YA 5GAEP 2PZ1A 2DT6A 2BZXA 2XPWA 1ASUA 5CKDA 4KRFA 1JQQA 4FL6A 3T1HK 1VQ8I 4YPRA 1JHFA 2UZKA 2E1ZA 1MHNA 1WHGA 3EG9A 3G1LA 4L8RB 5CKBA 3JCMP 1ZTRA 3CCLT 4EP4A 3SPZA 3PLAA 2OAUA 5EEGA 4I76A 1YX5A 4XRMA 3O9TA 2HVIA 1WI3A 1NG2A 2E70A 4CBWA 2P9NA 4Z2YA 3ISPA 5FPMA 2XASA 3FM3A 3AG1H 4IVNA 1RTIA 3QEIA 2YX7A 4HDUA 2GBZA 3SZGA 2R7ZJ 4B47A 1PRLC 1VRTA 4EJYA 1JUPA 3NH0A 1M3QA 5AONA 2DL8A 2K3FA 3A5OC 5IYCJ 5CKEA 4A12A 1WHHA 4QS7A 1BOBA 3RZDJ 3OS2A 2DXCA 2MIOA 5C0MA 1NE8A 2LDUA 2X6SA 5AQNA 4X0GA 2X6NA 1VQLA 5HP1A 4CJLA 3RRGA 1J09A 1UJ0A 5HY6A 2D0QB 4M3EA 2O8EB 1LAWA 2RF0A 1I3AA 3RUXA 2DYSH 2EB7A 1FX7A 3ENHA 2R7VA 2R5ZA 1KU7A 4AILC 3DEWA 4CCJA 3QESA 1HYOA 4OGCA 3SFMA 4M3BA 4C30A 1F1ZA 2VKHA 4RAGA 3G71I 4IUUA 4N4OB 3UKRB 4P55A 1FK9A 3F0ZA 3I0SA 4HSTA 5AZIB 3KFVA 1OR7C 3MAJA 3GF2A 5JLHA 3JTHA 1ZBJA 1NJIO 5FU7B 2M4GA 1ZSZA 2O8EA 4HRIA 2LNVA 4QWQA 1WJQA 1JXEA 1NGEA 1JE8A 3I54A 2IPQX 3ZQFA 1OVYA 5HOOA 4B9XA 3OV8A 1M3AA 3EHRA 1HRHA 3A2FA 3ZQ7A 3AHUA 2PQWA 2EKHA 3VKIA 4Y52J 1M8VA 3O80A 5AZIA 1O3SA 1ODDA 5F0XA 4D7NA 2F5CA 1TW3A 1JKHA 2UWMA 1OCTC 1ZLMA 2CV0A 2XICA 1YS6A 2QWWA 1BI0A 1BR1A 5CQEA 1OEBA 1FPQA 5HLHA 2A41A 1G3TA 3BR0A 2XAHA 5KH6A 4NC6A 5EEAA 2DMQA 1W0HA 4FJHA 5CYQA 4P96A 2PFUA 1GOBA 1UGPB 1AWCA 4OVAA 1KC8U 4HYEA 4ITVA 2K5LA 3SHWA 4JLIA 3H3OB 1DU6A 1J9IA 3QICA 2VXEA 2A37A 2ZE2A 2E5KA 1VQPT 1NGFA 2M87A 1YUWA 4H0TB 4KTWA 3A0BC 4BVOA 3L2QA 5FO5A 3G71N 3CMEI 4IO9L 3ZMZA 1AU7A 5C10A 1SC7A 3PGGA 4C92A 1FKOA 4ZN3A 2YSQA 3VMFB 2O01E 5LJVA 3I55A 1TK0A 3G71Q 2NZTA 4FJNA 4O3MA 3I0TA 4LUEA 1H92A 3O4QA 1ORPA 4ZTFA 2WONA 3ATVA 4C3JJ 4HUEA 2OZSA 3ZGKA 2F6CA 1SRMA 2KL4A 4JQFA 3ZX0A 1X3MA 1SS6A 1KD1C 3DRSA 5C4XJ 4BREA 1HLVA 2RKIA 1ZH5A 4ELUA 3NTIA 1Z3YA 4BUPA 4N9HA 3U1DA 3OW2M 3RYPA 3THXB 4CJ3A 1BIBA 1I27A 5CVUA 3MP8A 2G8VA 4OINF 2HEOA 3MEVA 1YXQA 1O3TA 1K0XA 4NC7A 3S9HA 2LY9A 1S9HA 4LD5A 1OU9A 4ZGEB 4IX7A 4FISA 3SUQA 4TSXA 4CXFA 2ZJPL 3OA9A 1MBKA 3HXLA 4JBAA 5ERIA 3HHTB 3O1BA 3R2XC 1F36A 1DDNA 1LAVA 1JXOA 3OL3A 1N8RC 4UVCA 3RKXA 3OVNA 4DQRA 3CMEN 3K5MA 2HHVA 4PFPA 4I02A 2NNNA 1EH8A 1Q82C 3CBMA 3BZ6A 3CMEQ 1U3OA 4XR6A 2WFBA 5HRPA 3QSUA 2CUZA 2NLUA 3ZSXA 3TTCA 3K2PA 5IHKA 1NJIU 3S3MA 3H3VK 1WCMJ 3J7AO 3ATUA 1J3TA 5JVHL 4DTMA 1KSPA 2ECCA 1JJ2P 5IP9J 2NAZA 4NL2A 1WJEA 3TARA 5HNFA 3N5NX 4KGVB 3JB9F 1B3QA 1K78B 4AHTA 1W4MA 1LOTB 2DERA 2DN0A 3HM9A 5EOYA 4HVJA 2VE8A 4BXFA 2ZPIB 4NNJA 2QF7A 2Y0SA 3PO4A 2LCLA 5KE2A 2P6SA 5HODA 2BKDN 3TAPA 4E0DA 1UELB 4AU7A 3WTWC 4PUOA 3QZ9B 2Z1IA 3MKLA 4IUVA 1Z21A 2NVTJ 4NZGA 2YLCA 4N0BA 3GTPJ 3EFRA 1EXQA 1K78A 4CJVA 4G12A 2ICWG 4JDSA 2JM8A 4HKEA 3MMVA 3LL7A 3K5OA 5GAGJ 2CJJA 4QPOA 1SG5A 1ON2A 4HLYA 4JKEA 1ZGJA 1TS9A 1GDTA 2FXUA 3Q1JA 1YHQT 4A6EA 4AM7A 3MEEA 4A5AA 1J53A 1Q1VA 3LMMA 2FPEA 1JLAA 2OCCH 4O5FA 1QVGA 4CEQA 5HL7L 3SXYA 2A5YB 1IGNA 2M8EA 2IDOA 3G0QA 3QRFF 1U1SA 4XTWA 3VWBA 3VOEA 2OQRA 2CGHA 4F93B 4M41A 5CY4A 3FGUA 3RKYA 1RLPC 4CYCB 1BIUA 3ONQA 1VQPA 2CT3A 2ZCFB 3THYB 4D7MA 4E1NA 2E6LA 1S22A 4KBMB 3PQKA 3TAFA 2LMDA 3CJQB 5A2QO 2G8HA 1NTCA 1ABQA 5IOZA 1RDWX 5DYMA 1BW5A 4U88A 3KK7A 2BGGA 1W5CC 3BLYA 1HCRA 1ZUYA 2HBWA 4CK2A 1RAAB 1OKJA 2GFUA 2BXYA 2DW4A 1JLEA 3DKMA 2MD5A 1HQUA 4CYCA 4E9GA 4EGZA 4CC4B 2FBIA 3ZR8X 4OB3B 3THYA 2BZ8A 3FFIA 3K10A 1D4XA 2DJIA 2EZHA 3NMUA 1MMNA 3CERA 1UG0A 3LANA 4ZGDB 1XQSC 2MBFA 4HQMA 5LMNK 2BY3A 4RTUA 3CCUI 1N32K 1OULA 1X3UA 1TQMA 5AQOA 3BDUA 2IAJA 2KIUA 1B8IB 4EM0B 3VS0A 3QEXA 4ENKA 4JLHA 2DA2A 2XGXA 1UG1A 1IG8A 5GANj 1ACMB 5AQTA 1STZA 4RWTA 2CZ6B 4MNUA 1IDYA 4AMCA 2HOAA 3C1DA 3CPWS 2X9HA 3S15J 4FZZA 5HK3A 2PY5A 3D0SA 2HQEA 1ERDA 3JW4A 2R4GA 2HD0A 5LHHA 3V81A 5I2MA 2DTIA 3G10A 3AAPA 4B6MA 5CK9A 2BW3A 3CCRI 2O8BB 4BY1J 2O0YA 1B8IA 3K69A 1NGGA 3OMYA 2K7AA 1MPGA 2JTVA 4I7HA 3NH2A 1YJ9I 1MV0B 2DFHA 5GAMf 3JCMd 5F1RA 1ZARA 2FF6A 2AA4A 4ESFA 2KMTA 2B5JA 3QYHB 2E64A 2QEXI 3H9QA 4EJOA 1P2FA 3VS7A 3ZEHA 2XV4S 5LJ5d 3D2FB 4IXCA 5AQLA 3DWLA 1VSEA 3ZN1A 1WZ2A 4NS5A 3IG1A 4HQEA 2R5YB 2JT4A 4C8QF 1NK4A 2M7BA 4MTEA 3CCUN 2PVDB 4EW0A 2CMPA 4M7AA 5CKTA 3CCUQ 3J7YP 3BJAA 2VPLA 1ZLKA 4Z8AA 3TO6A 4EJZA 1IB8A 1WRJA 2JA5J 3H1QA 4A69C 4B9NA 3GXOA 4BRAA 1FYMA 5CQYA 4FJXA 2EZKA 2RHXA 2FNPA 2WTUA 2EK5A 3NH1A 3ZQQA 2E6NA 2ETJA 2GA1A 2Z16A 5E3LA 2OPTA 4M3TA 3FIWA 2LTPA 2L2PA 4KI4A 2DT7B 4LUDA 1WN7A 2DAOA 4LC9B 1O4XA 3T1AA 2L3SA 2F2EA 2W6LA 4Z4IA 1UA1A 4NO7A 2P7VB 4LLNA 1BM9A 4YOUA 3WTZA 5ED4A 1MBGA 2WA0A 1YJ9N 3OYEA 6PAXA 3C6UA 2RH2A 3K2AA 3MEAA 3PIOA 2YV0X 1W7AA 1PUFA 2D0PA 1YJ9Q 4BRLA 2DE0X 2FBKA 3IHUA 4W97A 4E4HA 3MKZA 3CMMA 1BW6A 1YHQA 2QEXN 5IP7J 3G25A 2DAQA 2K3BA 3I4NJ 3VTIA 3PT9A 4IIMA 3OIOA 4CICA 3ZMSA 2QEXQ 1NWKA 3U3GA 1TWHJ 3G6ET 1JKQC 2ZB9A 4TV7A 3FK6A 5M5YJ 4RM2A 1VQ6T 2DO7A 5JLXA 3P8HA 3WNGA 3CBPA 5CVIA 4M78E 4FWPA 2GIZA 5FW9A 4M78D 3ZSQA 1CLQA 3QLHA 1VIFA 2AXLA 3QYFA 2QKMB 4XKCA 3MHXA 3BGRA 3MEGA 3CC7I 5EG0B 4MMLA 2XF5A 2EVRA 1MWKA 1RLQC 3VS1A 1KHCA 1M1FA 3GLLA 4Z4FA 3QPLA 1G99A 1HNXK 1RAEB 3SWNB 3QDRB 1IV6A 4FJGA 3FXJA 1G2HA 2N8GA 1WSEA 5DM7L 3BG5A 4HNVA 4CCNA 4CJ5A 1QTMA 3ZL7C 1FWZA 2L89A 3TU5A 3HP9A 1U0JA 4IRHA 1LOJA 5EG0A 2DM1A 3M3YJ 5CQGA 2L3PA 1MGTA 3LA2A 4LMYA 4OMLA 4X9CA 1S6QA 2YCHA 1M90O 1SPKA 2LF7A 4LIUA 1QVTA 1CKBA 4FZYA 3VS5A 2CO5A 2LKSA 2YHYA 1H9GA 3SWNA 4RCBA 3I0XA 1RILA 1PJRA 1N9RA 5KRTA 1N34K 4B3OA 2P51A 3FB9A 2G8WA 3Q0UA 4PJJA 2H94A 5BMZA 4MDBA 3FLCO 2KIQA 5KYXB 3HZJA 3H0IA 1N39A 4QCLA 1HA8A 3RPUA 3DLLA 1VSHA 3VTHA 4JI1K 2X1EA 3O1WA 3L2WA 2KZZA 4CJSA 2GA2A 1KC8C 3OR2C 3CC7N 2HDCA 2BVMA 5DMRA 3R1XA 3F0CA 4OMPA 4JS5A 2EJGA 3CC7Q 2ATQA 1VQ7I 5IPAA 4XEIA 4FU6A 5HLIA 4K43A 1U6ZA 5KPTA 1WGSA 4DBFA 3AVCA 4OFAA 1ZELA 5FWCA 1UECA 2KRFA 3L7WA 2FBYA 4Z4EA 3ASMA 4AYBN 3KLHA 1WSIA 1GV5A 1T8IA 1AWOA 2WBNA 4R55A 2W84A 5I21A 3HSEA 5IN1A 4WYBA 2EFQA 3CJTB 1LB2A 1RETA 1Q81C 2DODA 1H3HA 4BWJA 4RTXA 3ESWB 3SI6A 4OKKA 4LF5K 4DJAA 1B1BA 1R0CB 3VQAA 2WY8Q 3I59A 4BGDA 4H0PA 4UY8O 4Y92A 3VRYA 3BTCA 2HHWA 4NQWB 3MZ8A 1NZ9A 2DX1A 3RNJA 1QQIA 2Y2ZA 4CJRA 5B1AH 4JX5A 3I58A 2A3SA