3S3NA

Crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3nA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3nA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3nA03
2XDPA 3BGRA 1TL3A 4KPYA 1BCMA 1LW2A 2ZE2A 2RI2A 1RT1A 1TV6A 4JLHA 4FLZA 4EP5A 3NE6A 1OZ3A 3VQ4A 3KTQA 4ID5A 1C1BA 3K59A 1A5VA 4CF0A 3PX6A 3G0ZA 4N4GA 3EYZA 3OB9A 1VSFA 3MEWA 5KE2A 3TAEA 4HCZA 3FC3A 5HRPA 1KLNA 3EY1A 3PMTA 3CFPA 1RBVA 3NF9A 4FJ5A 1JL1A 3OYIA 5J2MA 3ZSRA 3DLHA 3UWNA 1N6QA 1XHZA 1VSKA 4B9LA 2Q3SA 3RWUA 3M8SA 1NK0A 1DLOA 3CG7A 3HPGA 4DTJA 4DF8A 4B8AB 3KK1A 4CEZA 3TAPA 1KVCA 4CJPA 2M0OA 4KTZA 2HHXA 4IUPA 3AVCA 1EX4A 4CEAA 5SZTA 3ZEHA 3SPZA 4DLGA 1JLCA 1ZBIA 3HVRA 4CJLA 2G8WA 4C8NA 1JLQA 2AJQA 2D0CA 3TAQA 4CHZA 1FK9A 4DQIA 3ZSYA 3MP6A 3HPOA 4BACA 2Z1HA 4CESA 3QNOA 5DMRA 4IUQA 3NNQA 4DU4A 3VQ8A 4QVZA 3VN5A 1U4BA 2LDMA 4ELVA 4OLAA 1REVA 1IKWA 1WSIA 2QXFA 4OVLA 1NK5A 2X4YA 3HYFA 4B9TA 1Z25A 3PO4A 4DWIA 3O3FA 1OI1A 4J2AA 5JS1A 4CIFA 4C8KA 3OYEA 4KTWA 3WNFA 2QKBA 4FW2A 3L2UA 5C25A 3I0RA 4HUEA 3L3UA 4L8RB 2RN2A 4CF1A 3O8VA 3MEAA 5T7BA 4DFJA 2F96A 5CYQA 3CFRA 3SV3A 4IG0A 3DI6A 4CJ4A 3TABA 3RRGA 4FJKA 4ELTA 4EP4A 3SCXA 2P51A 2HQXA 1SKSA 3SUOA 1YTUA 2EFIA 2ITGA 4AH9A 4CEDA 3TANA 1WJQA 5C42A 1T05A 2WONA 3QKJA 1QQCA 1BQNA 1SKWA 3LYIA 4OKEA 2G8IA 3HVTA 4EDUA 3LWMA 5FDLA 4DU1A 2RJCA 3UT1A 3OMCA 3TR8A 3S3MA 4AHTA 3NGYA 2HNYA 2D0AA 4IKFA 4CFCA 4CHPA 3UIQA 4DSFA 2QQSA 3SUNA 2HHWA 2EQUA 5D6WA 3TWHA 3KKSA 1L3VA 5KH6A 4Z02A 4FZZA 1U45A 4FZXC 1HQUA 1KLMA 3KD5E 1BI4A 1VSHA 4Q5VA 4FK0A 4FLVA 4KHSA 2X78A 3P83D 2R58A 1F21A 3ZCMA 4I2PA 4FJ8A 4CF2A 1U04A 4KHYA 3HXMA 1HQEA 3HM9A 3NHGA 2Y1IA 2QK9A 4CJTA 1U48A 2FBVA 4FJLA 3VQQA 4W5QA 3MP8A 2KQ2A 5IN1A 5CYMA 2IGIA 3LALA 4FM2A 2BUDA 3DYAA 1IH7A 4DSLA 1D5AA 4B08A 3OYNA 2OPQA 1I39A 2LCCA 1TAUA 2LTOA 2DAQA 4O0IA 4B9NA 3MEGA 4PQUA 5C6SA 4OPKA 4O55A 3LLRA 3ITHA 3TAGA 3SUQA 2JGUA 2RI5A 1Q8IA 4DMNA 4CGFA 1LWCA 1BQMA 4PY5A 4PWDA 3MEDA 1IKYA 2M1HA 1FKPA 2MWPA 4KI6A 4M3RA 5CY4A 4CK2A 4J2BA 2VG5A 1WAJA 1CXQA 4DTNA 1ASVA 1RDCA 1FXXA 1L3UA 2HB5A 3LZJA 4HUGA 5KTQA 1VSDA 2LSNA 2G8KA 1H3ZA 1RTIA 4FYDA 2JTFA 2JLEA 1C0TA 1UA0A 3T1AA 1TK0A 1CXUA 2HHQA 4M3XA 3ALYA 1KHCA 3PY8A 4ELUA 2D9TA 3QBYA 3QLHA 3OS2A 4CJWA 2XY8A 3HSTB 2P5OA 3OY9A 2Z1IA 4CEEA 5J2QA 1RNHA 3I8DA 4F3OA 4KV8A 4BD3A 5FRNA 3RR7A 4B3OA 3OYJA 3D0PA 1SL2A 3VQ7A 3O3HA 3L42A 1EETA 3QO9A 2GBZA 4Z4EA 1XC9A 4B9VA 2FBTA 3U6FA 3LAMA 3F70A 4CEOA 3G10A 4MQ3A 3PMIA 3L2RA 3NDKA 1KSPA 2RF2A 4CHNA 3VQ6A 4M3WA 3CYMA 1J54A 3QETA 1JXEA 4E1MA 2P1JA 1RTJA 2EKOA 4DSKA 5J39A 3KJVA 5SWMA 4DTUA 1Q9XA 4O5BA 1RBRA 3FDRA 4QCLA 4CJUA 4E7LA 4E7KA 2KFNA 3KLEA 3MP1A 4W5RA 3RMDA 4QW2A 5M9OA 4RG8A 4I9QA 3O4QA 2B4JA 1C0MA 4CERA 2R57A 3T19A 1RT4A 1Q9YA 3K2PA 1WJSA 4B9UA 2IS3A 3ZSZA 3I0SA 2O4XB 1D8YA 2L8DA 1NKCA 1BISA 2L89A 1J53A 2VYTA 3HT3A 3OMGA 3V1OA 3K5LA 3LP3A 3HP9A 2X35A 3MEEA 3PX0A 1NJWA 4C8MA 1R0AA 4QQGA 1QSYA 4PUOA 4NYFA 2OA8A 3OS1A 3P8DA 3LGFA 4RW4A 5HRRA 4CJ3A 4BE1A 3K57A 1W0HA 3PFSA 4DF4A 2RHYA 1RTDA 4FZYA 4FLXA 4OLBA 3JSMA 2HVIA 4IUUA 4CE9A 1S9EA 3Q1JA 2KFZA 3DRPA 1XNIA 1NKEA 4OGEA 1QHTA 3SZ2A 4MFBA 3SD4A 4CFDA 3PV8A 4OVAA 3QEWA 3T3FA 4I7FA 4HUFA 4K8ZA 1B9DA 1RT3A 2PY5A 5KRTA 1T03A 4E3SA 1JLEA 1GOAA 2RHXA 2G8VA 3MECA 1WSHA 1RT6A 3QJ6A 2E4LA 4HVJA 4CEQA 3OJSA 4KTQA 3V4IA 3AO1A 1NKBA 2YNGA 1HPZA 1WSJA 1UWBA 4CGJA 4FLWA 1XWLA 2RHZA 3CFOA 1HJRA 2EHGA 1JL2A 1TGOA 1WSGA 2R5MA 4GMJB 1JLAA 2E6MA 3DLEA 1ASUA 2DIGA 5I3UA 1ITGA 1ZBHA 2BANA 4IFVA 4A4FA 4A4GA 4N76A 4H4OA 4DTRA 4FU6A 3EAEA 4KFBA 4CIEA 4BDPA 5D6XA 2KZMA 4FJHA 1GOCA 3O3GA 3V9ZA 3V9SA 2RHIA 4FK2A 5I42A 4CJSA 3NTIA 5KE3A 4AHRA 1RBTA 1SL1A 4PL6A 3KIOA 3C95A 3OYDA 3TARA 4QAGA 1RDDA 3AVIA 2ATQA 1J5OA 4LD6A 3V9UA 2HNZA 2P5GA 3OYBA 4O4GA 4I9LA 1BGXT 3L2VA 4QOZB 4DQSA 1X1PA 4YFUA 1SV5A 1VK0A 1LWFA 3BDPA 2E6LA 1RT2A 1X9WA 4DTXA 1WN7A 1VSIA 1C1CA 1SUQA 1ZYQA 3SNNA 1TVRA 2ZD1A 3NTHA 4FJMA 4LSLA 2OPRA 4Z4IA 4A4EA 2XY6A 4KHWA 5DK5A 2KZZA 4CEFA 4RW9A 1S6PA 1YVUA 3WNHA 3IRXA 3SPYA 2EQMA 4L59A 3M8PA 3TAMA 4FJ7A 1VSMA 1S1TA 3DLMA 4E19A 4FJNA 1WGSA 2ETJA 4E89A 4X34A 4PA1A 1KVBA 2A1SA 2IG0A 2R5AA 3C6UA 2RHUA 4N4IA 3VQ9A 1EKEA 3ZSXA 3LZIA 1HRHA 3LP0A 1HYSA 4C5GA 3DB4A 1ZBFA 2D0BA 3META 4QQDA 3HL8A 2YV0X 5HP1A 5D6YA 3O4NA 3SQ4A 3KUFA 5KI6A 3LGLA 4C8OA 3LH0A 3M9QA 3DOLA 4DSIA 2IDOA 4IUTA 4DQPA 2XRIA 3AO3A 3DLKA 2RI3A 4Q0BA 3KD1E 5CZ2A 4IG3A 2DTUA 4E7HA 4J2DA 3WNEA 2WOMA 4Z0UA 3LDSA 3AVAA 4CHOA 1DTQA 4KB1A 2X6NA 1BHLA 2HMIA 3ZT3A 1NK8A 5C0MA 3AVKA 4DSJA 1DTTA 5FRMA 4CCHA 3FEOA 1UAXA 4OKJA 1KFDA 1QSSA 1WJRA 4C5IA 4NS5A 1QSLA 1IKVA 4B9WA 4Z4GA 2GUIA 1ASWA 1S9GA 2G8FA 4Q5WA 3V6DA 2YKNA 2PYJA 3A2FA 4I2QA 1NOZA 4KRFA 4N41A 2P0KA 4N5SA 4FJJA 4W5NA 4W5OA 3RMBA 4B9SA 4LD0A 4DSEA 3NGZA 1YT3A 1LAVA 4BWJA 4FJ9A 1S5JA 1CLQA 2KTQA 3ULDA 3H8ZA 4H4MA 1QE1A 1Y97A 1C0UA 3L8BA 3C4SA 4AHUA 4M3TA 5KGWA 1TKZA 1S6QA 4B9MA 4HCCA 3OYMA 4M41A 1BIUA 3ZT2A 4FW1A 3RR8A 4DQQA 3QNNA 3EZ5A 3NF7A 1VRTA 4FLUA 2NUBA 2A1RA 3E9FA 4KHNA 3LANA 2G8UA 2HHVA 2HHUA 2XK0A 2XHBA 4FLYA 3K58A 3NTKA 4E7IA 4CGDA 3PUFA 1FKOA 2E5QA 4DU3A 1BCOA 3U3GA 3ME9A 3D45A 1XI1A 1NJZA 2G8HA 3DB3A 3VA0A 4F2SA 1JXBA 2HNDA 4FK4A 4JRQA 1SL0A 4CFAA 3K5MA 3WNGA 3NBPA 3LX7A 3MEVA 4DFMA 4F4KA 4C8LA 3AVMA 1N5YA 4CJKA 3LPUA 3V1QA 1WNSA 4RW8A 2Y1JA 2DFFA 4E1NA 3CEYA 1OYXA 3LPTA 5J2PA 3ZT0A 5HROA 4CJRA 2RJDA 3KLHA 3ZT1A 4GY5A 3FFIA 4E0DA 2BIVA 3L2WA 5K14A 3K5OA 3LP2A 1VRUA 2QKKA 3LP1A 1RDAA 1QTMA 3B6OA 4LH5A 3DOKA 1RTHA 3OA6A 1HYZA 2DY4A 3AA3A 4GVMA 4KHQA 2OYQA 3OJUA 4A4HA 3NCIA 3HPHA 1B9FA 2GFAA 3AVGA 2XY7A 2O4XA 2D5RA 4H8KA 3NF8A 4UQGA 3OYFA 3PNWC 1J9AA 5J1EA 3S3OA 3DMJA 2OZMA 4OPJA 4OJRA 4LY7A 4Z4CA 4BDYA 2F5KA 2L3RA 4WE1A 4ZTJA 4M42A 3AO4A 4G1QA 4RW7A 4Z4HA 2XY5A 1TKXA 4DTMA 4BE2A 4R5PA 4DLEA 4DFPA 4NCGA 1JKHA 1HNIA 2OZSA 4FXDA 3MEUA 3F73A 3AVHA 2HW3A 3E01A 1U47A 3B6PA 5EU7A 4FJGA 2QQRA 3VQCA 4II1A 1O1WA 4N47A 4IBNA 2HQEA 2EX3A 4N4HA 1KVAA 4TSXA 1KFSA 3ZSOA 3AA4A 3BDLA 2HHTA 3LAKA 1HMVA 3NH1A 3QIPA 3AO2A 3MXMA 4EZ6A 2HHSA 1WSFA 2EQKA 4CGHA 1CZBA 1OZ2A 1RT5A 2X6SA 4IUVA 1MU2A 3VQ5A 2FBYA 1VSLA 3OYCA 2LVMA 4CK1A 2RKIA 1KCFA 4C5HA 4EZ9A 4FCYA 4YNQA 1JLBA 4CJQA 1B92A 3NAEA 4BWMA 4CK3A 2K3XA 2YNFA 3HO1A 4K8XA 1SKRA 1CZ9A 1XHXA 3DM2A 4NZGA 1TKDA 2B8AA 3QIIA 5HLFA 2Z1JA 4KKOA 2VWKA 4IURA 3CM5A 3AVLA 5KRSA 2O4IA 3IG1A 1WSEA 4KO0A 1L3TA 3CM6A 3HK2A 4CF8A 3MXIA 3F9KA 3HJFA 1ZBUA 1NJXA 4C5EA 4FJIA 4J2EA 4KAZA 2EQJA 4JS5A 3QEIA 4CGIA 3FLGA 2VG6A 1EXQA 2BGGA 2YNHA 1D9DA 5KCOA 4XIUA 5J26A 3QESA 2OPPA 3NF6A 4AHVA 4FM0A 1RT7A 3KLGA 2JZ2A 4AHCA 4CECA 2M16A 1RILA 1LV5A 1LW0A 4CFBA 3V9XA 2FHDA 5KCHA 1MHNA 3VQEA 3JYTA 1UOCA 4E7JA 2I5JA 3QIOA 4Y1DA 4FM1A 2B6AA 3DLGA 2VG7A 5CIUA 1D9FA 1NK9A 3OQ5A 4W5TA 3NFAA 1X9MA 4BDZA 1RI0A 2W42A 2BDPA 4B9XA 1JLGA 4KB0A 1EP4A 1U49A 3DLRA 3AVBA 4PLIA 1VSJA 1L5UA 3S9HA 2YRVA 4LSNA 2E6NA 4F2RA 4AILC 1ZBLA 3CQ8A 3PO5A 2KW4A 1C1AA 2X4WA 4PLLA 1NK6A 2R7YA 3OYHA 3DRRA 4KI4A 4UC4A 4CGGA 4Y1CA 2DFHA 1T7PA 1TAQA 4DS5A 2G3RA 2K3YA 1RBSA 1W9HA 1TKTA 1NK4A 4ICLA 3ZSQA 3V9WA 4QQ6A 4FVMA 4CHYA 3ZT4A 1YTAA 3RMCA 3AA2A 2GFUA 2X4XA 3SI6A 3S3NA 1IKXA 3ZSVA 4RG2A 3SV4A 4M3ZA 1BI4B 1IO2A 4RW6A 2XO7A 4N56A 1X9SA 3NGIA 4O44A 3OYAA 3OVNA 4NCBA 1RBUA 4CJVA 4ZTFA 3NH2A 4CHQA 2DFEA 3VQBA 4CJFA 1I3AA 3GOXA 3RRHA 2FC0A 4M45A 3OYLA 3IS9A 1SSFA 2DIQA 1WAFA 2O4GA 1L3SA 3H08A 1HYVA 3TAFA 1C6VA 3AVNA 3SQ2A 2Z1GA 2BKDN 1Z26A 1G5VA 3VA3A 2PYLA 3MAQA 4O0JA 2HVHA 3P1GA 2B5JA 5CZ1A 2PQWA 5HBMA 2GF7A 3KLIA 4FL6A 3V81A 4HTUA 3TI0A 4OKKA 1S1UA 1GOBA 1KTQA 4KHUA 4IDKA 1WLJA 1S1XA 4FLTA 3VQAA 2X74A 3KK2A 4OGCA 4DTSA 3NH0A 4M3UA 2MWOA 3RMAA 1IG9A 3OYKA 3KLFA 4GW6A 3AVFA 2YHAA 3KKRA 4Z4FA 3THVA 3V1RA 3S6WA 2WACA 2RJEA 3AO5A 4AHSA 4FJXA 4NYNA 4IFYA 4DTPA 3M8RA 3HP6A 2YKMA 3MO8A 1LAWA 2LRQA 3C94A 1NJYA 3ISNC 3SYZA 2OPSA 1UA1A 1NOYA 2VWJA 3DLBA 4DTOA 4HHTA 4JRPA 5JS2A 3L3VA 2RJFA 2NLUA 5C24A 3SQ1A 3AVJA 3OS0A 2IOCA 5J2NA 2RPIA 4M3YA 1BL3A 4ID1A 1QS4A 5IAYA 4DG1A 2PZSA 2FBXA 1TK5A 3L2QA 1RCHA 4CEBA 2YHBA 4CJEA 4CRIA 3AV9A 3MXJA 3OYGA 1RDBA 2BE2A 3AA5X 1A5WA 3SJJA 2IAJA 1TL1A 3C6TA 4DFKA 3QEPA 2YNIA 3LWLA 4HCBA 4F3TA 1N27A 3SUPA 3VQPA 4CJ5A 3ASMA 5HRNA 5D3GA 4CIGA 1S1WA 3QERA 5E41A 4NCAA 4BE0A 2CKKA 1KRPA 3VQDA 3K5NA 2IC3A 3DRSA 1NK7A 3QINA 3RTVA 4DQRA 1BIZA 3U3YA 5FROA 1K6YA 3M8QA 1A5XA 3ZSWA 3QEVA 3QEXA 2F8TA 4LH4A 1HNVA 4JS4A 1G15A 3P5JA 3P8HA 4DS4A 3PX4A 4ZHRA 3IAYA 5KGXA 4F8RA 3SQ0A 3ASKA 4CF9A 1JLFA 3E9GA 2GV9A 5HRSA 2F8SA 4B8CA 3H6ZA 4KREA 3KK3A 1S1VA 1T8EA 2RO0A 2ZQBA 1LWEA 1TK8A 1VSEA
chains in the Genus database with same CATH superfamily
1ZG1A 3FXRA 1ZK8A 4KPYA 4AG1C 2DD4A 2NUTB 2RI2A 2IJLA 1TV6A 4B4CA 1UG1A 2P9UA 4EP5A 3G1MA 2R7VA 4PJOF 2M9UA 3S2DJ 4JKDA 1ZQ1A 1RGIA 3VQ4A 3KTQA 1X2NA 2F4MB 1A5VA 3DLLL 5GANj 2JT1A 3OW2P 1GHCA 2JTEA 1EBMA 1Q81O 1S22A 3G0ZA 2ABKA 2JPBA 4H5WA 2DA4A 3EYZA 1YO5C 3VODA 1JT6A 4XICA 2X4HA 3MZ8A 3FXKA 5KE2A 3H45C 3TAEA 3HPWA 4D8DA 5B1BH 4M7DE 4AF1A 1IV0A 1ARKA 4OAZA 2FMLA 5D6EA 3DPUA 3X28B 3CCVT 3DLHA 2LLKA 3M8EA 3RDVA 3CCVI 4ENJA 2JTMA 4ZN1A 3GZ5A 2NVTJ 3P8BB 1Y39A 1OOTA 1TWAJ 3JCMW 3CG7A 1E4FT 1XNRK 1NNEA 4DTJA 2K6DA 3KK1A 1S1NA 2H8WA 3DBLB 1U2VA 3DCFA 5LEKA 2B0LA 1QVFP 3HOZJ 1IF1A 3CCLT 2W6KA 3CCLI 3U9ZA 4RDUA 4RTVA 1SRLA 2D6FA 4CJLA 3HIFA 4KISA 5CCAA 3CC2N 2B86A 2GTOA 4CC3A 3D2EA 1A35A 4B48A 2JPCA 5HS8A 3FGUA 3C6HA 3CCMA 1XC5A 3TAQA 3LW5E 1WJEA 1YJ9N 4PJOA 1MWKA 2OBPA 3LSHA 1S7OA 1RESA 5IOYA 2KEAA 4G7HF 3M0SA 4JYAK 2HVRA 4CESA 4AM7A 5DMRA 2DYSH 4IUQA 4M7DC 1NEGA 2OCCH 4FQGA 2O03A 3WTVC 5J1UA 3TO6A 3L4QA 2P6TA 2LDMA 4GV6A 2OTJA 4DHYA 3ZQQA 3BY7A 5LEJA 3TU4K 3IQLA 2CZ1B 5JS1A 4P9UA 4CIFA 3OYEA 1WFXA 3QU6A 2LYCA 4B1VA 5GAMg 4FM4B 5C25A 5LJ5f 4WXCA 1Y96A 1VQ7A 3I0RA 5J3BA 2KKZA 2JWTA 1WNLA 2LZ6B 4L8RB 2RN2A 3RVCA 3W6VA 2B7EA 1K6OA 1D0XA 5ADXH 1OVQA 3UR3C 3WXKA 5CYQA 3CFRA 1UB9A 3ECOA 3DI6A 4CJ4A 1EH7A 4CCKA 4DCHA 4AFZC 3OOPA 3GNFB 1QPIA 1M2OA 2C6YA 5IH2A 4M3BA 3PT9A 4CCJA 4M78G 2DW4A 3I59A 2JA7J 1FOWA 3ZQFA 5GAGJ 1DKGD 3ZN0A 4Q48A 2IBDA 4IDHA 5C42A 1T05A 2K3FA 3QKJA 5LJ5h 5HY6A 4ME7A 4LK0F 1X2KA 1NJIO 4EDUA 2K27A 5FDLA 2Q1ZB 5GANg 2UXBK 3CBMA 2OC6A 4DU1A 1R1UA 3VERA 1M1EB 3EKUA 1BA0A 1W36D 3CI5A 5IXFA 6AT1B 4AHTA 1YI2Q 4F93B 1VQKT 3VS0A 1QHHD 3EFOB 5EGOA 3WEEA 1VQKI 4G7ZF 2FF4A 4IKFA 3EGUA 3DLAA 2WAQA 3H3ZA 1U5TB 2PTKA 1GLJO 3UIQA 1NG7A 4XOTA 3SUNA 2HHWA 1GT0C 1M1FA 1Z7LA 2MLGA 5AQHA 3CPWA 3KKSA 3R1XA 5C4XJ 5KH6A 5ILUA 3H35A 3QPSA 3KP5A 4ITVA 4KMFA 4FZZA 1MIJA 2E7WA 5LJ5j 4HT8A 1BI4A 4U0WA 3CJNA 1VQMQ 3H92A 3DP7A 4FK0A 4FLVA 4KHSA 3CZ6A 4Y4RA 5DDGA 4MMLA 4ZC3A 3ZXSA 3CP8A 1W5SA 4NBQA 4I2PA 2E1NA 4JKBA 2XSDC 3M1EA 1GL5A 1UHFA 3N5BB 5ICCA 2V9VA 3HXMA 1DU0A 3E0JB 4M72A 3WXJA 3HM9A 4F7UB 2QK9A 4M78D 4Y15A 1ZLMA 2XC7A 2FBVA 4FJLA 2V51B 3MP8A 2EYWA 4HCKA 4MTEA 3DYAA 1IH7A 3O3KA 1D5AA 2E19A 4MDWA 4OWRB 4B08A 2CS3A 3K4KA 2A40A 1B9NA 2L7FP 1F1BB 1T0FA 1ZAOA 2CH4W 2GLOA 1PRMC 2M8GX 5L3CA 3FJPA 1YQLA 2MC3A 4PQUA 1MJBA 5C6SA 2HXOA 3Q0VA 1YTYA 3TAGA 1STZA 2MK5A 3THXB 5F64A 4JK8A 2P4WA 1YFNA 4CGFA 4C92F 1S9HA 3KYDB 2NVUB 1AU7A 3TDZC 3GX4X 1KG1A 3V7SA 4XONA 3HKSA 1UG2A 4I01A 4KI6A 2GELA 3PUBA 4M3RA 4J6YA 5LJ3g 2XAHA 2VG5A 4Q4ZF 3RESA 2NXNB 1ASVA 4FSSA 1UGRB 1L3UA 2R93J 2I0NA 5GPAA 2L7ZA 3T7ZA 5L3GA 4YELA 3ZQCA 3EPZA 4ZZDA 3NPFA 5KTQA 4B1ZA 4BBRJ 4PSWA 5GJVB 2HZDA 1YW7A 1RRQA 3O5BA 2LRDA 1CXUA 2GUPA 3PJRA 2VKDA 3ALYA 4M77B 3O6WA 3RZOJ 3CLQA 1Y8RB 2L3PA 4KH5A 4IJNA 4OFEA 4ELUA 5H1SQ 2D8JA 2D9TA 2LCLA 4FASD 1XJWB 4AIKA 2NS7A 4I0BA 5F0FA 1E0EA 2XY8A 4B22A 5BPMA 1Y0MA 4BI8B 1NMDA 1RNHA 4BY6C 3GFLA 4Y13A 1AZGB 3I8DA 2EA2A 1YX3A 3BR3A 2COYA 4KV8A 4ZJZA 1SMYF 1ZSZC 4A3BJ 1NGFA 1VQOT 1UHMA 1NHAA 4WFAL 1FNNA 1VQOI 1UGPB 1M90U 4A5AA 2ZPHB 1EIFA 2MAMA 3AL0C 3SJHA 2FZGB 1M30A 3L42A 3TSQA 2LY1A 3QO9A 2DF6A 2GBZA 1MMDA 1QZEA 3LAMA 2HZYA 4C92A 3G10A 2CSOA 2QEXQ 4U7DA 3TVTA 1OMIA 1IUFA 3NRVA 8AT1B 4UOBA 5LJ5g 3DAWA 3ZQ7A 4CHNA 3QOEA 1M3AA 2MSYA 3GXOA 1JXEA 2O8BA 2P1JA 4GRIA 5JLWA 4C2TA 1P59A 3HC7A 4A3CJ 1Z6TA 2MIOA 5SWMA 2W4SA 4G9ZA 4J9EA 3TTFA 2LQNA 2J5PA 3IWFA 1MBEA 4E7LA 4NL3A 1GBRA 2YG9A 4XQFA 3OH9A 4V2GA 4HT9A 1Z3XA 3KLEA 1SFUA 5LGNA 3HOSA 3RMDA 4QW2A 5M9OA 4I9QA 4L3QA 4BGBA 1YAGA 2ASMA 1SFEA 1C0MA 2ZJPL 2QSHX 3V8JA 1XG1A 3WGGA 2HBMA 1NGHA 3CMET 1VQ5N 2HS5A 2Z3YA 3CMEI 4X62K 1OCCH 1V55H 2M45A 3T19A 3VTHA 1RT4A 2VQCA 3K2PA 1WJSA 3LL7A 5JVGF 3I0SA 3OSVA 1H3HA 4UUSB 2CQ7A 3WHBA 1BISA 3L7WA 4A3EJ 3L1PA 3AFHA 2W82A 3CD6Q 3K5LA 1UFMA 4RUGA 5GMKm 2AHQA 2V75A 2E2IJ 3RNJA 4K25A 1JJ2P 1NJWA 1N9SA 5TISC 5AIQA 2FEIA 1KG4A 4FYWB 1IDYA 1R0AA 1VQMA 2DXUA 1MNDA 4QQGA 2NUTA 1T39A 4FWOA 4YDUA 4NYFA 1QSYA 3D2FB 3G6EI 4FX0A 1WEFA 2Y48A 2RK2A 1Z67A 5HRRA 5LGTA 3I8BA 1YW9A 4LFCK 2RHYA 1RTDA 3RQIA 3PFIA 4FZYA 1JCEA 4IUUA 4CE9A 1NGCA 5DUKA 3DRPA 1XNIA 1BI0A 2CUFA 2RE2A 1RKWA 4ZYGA 2CT4A 1T44A 3S1NJ 1PNJA 2X4JA 3SD4A 2CYYA 4CFDA 3OL3A 1CQTA 3CCJQ 4OVAA 1M1KC 1G4DA 2E1MC 5IOZA 3O2PE 1OX9A 3M6GA 4O8UA 5L3BA 2M1BA 2XDBA 1B9DA 1FBQA 2I10A 1R6RA 1W2BA 4IPAA 3TOBA 1FX7A 3CCQQ 4B43A 3PO3J 1JLEA 1OQYA 3I33A 5KAFC 3HI0A 2KZVA 1U1SA 1IZ1A 2LNVA 2E2HJ 1RT6A 2Z2SB 5BRHA 4HSBA 5E3NA 3OL4A 4CGZA 3OJSA 1B72B 1G2HA 3Q5FA 3V4IA 2F5TX 3REBB 2UZKA 5C2FA 4XN0A 1OU8A 1U3OA 1IBLK 2RVCA 4FO0A 3IWZA 1JTXA 1W5CC 4JI6K 3EHQA 1W4MA 4PJOC 1WDXA 1TSFA 1WGXA 1G8XA 2KHMA 3QWYA 3MQ0A 3DLEA 4BRHA 3I71A 1ASUA 2O9SA 4A5NA 3T0YA 1G3TA 4RTWA 4B1RA 4LG3A 4QWQA 3KWIA 1KA8A 4Q47A 2R92J 3E6BA 3CESA 5B1AH 3G1LA 4L5JA 4DTRA 2FBKA 4N9IA 4FU6A 2FXUA 1FLIA 3J8AA 3MK6A 3TTCA 4XU3A 5HLIA 1N34K 2A3LA 4CC4B 4YFNF 4A2AA 1HNXK 3V9ZA 2OAZA 1SVLA 2KGTA 4CJSA 2DZ9A 4PJMA 4AHRA 3WTWC 1X1BA 5ED4A 2CREA 3SAGA 3OYDA 1KG5A 3CO7C 2HDDA 2Y0MA 1KU9A 2P5GA 3SBGA 3LA7A 2FNAA 2GQIA 2FPEA 4JD2B 3CMMA 1FMWA 3L2VA 4QOZB 4DQSA 5M1NA 1K7AA 4YFUA 4C8QB 2M0CA 1LWFA 1X9WA 2Y4XA 2RQUA 4DTXA 1WN7A 3ZMZA 2H1LA 5ERIA 4F7UF 2XKPA 4BGDA 3A0HC 3AARA 4OINF 2ZD1A 3NTHA 4Z88A 2A68F 2QEXA 4PKCC 4IIMA 1R4MB 5F1JA 1W70A 3W3DA 3M9AA 4CEFA 2YJFA 2VCPA 4KGXB 1ODDA 4M7AE 2DBBA 2Z33A 1ZUKA 3WNHA 1YJWQ 3SPYA 3OOUA 3TAMA 3G71Q 2TCTA 2QKMB 3BJOA 4RLQA 4HSTA 3DLMA 1LDJA 1WHLA 2O5RA 2DK3A 5LLQA 4XU2A 2KIMA 2ETJA 4UUTA 1X6BA 2QTDA 2FA5A 3A0BC 2A1SA 4DV0K 1UGVA 3PLAA 2HMPA 1WJ5A 4LF5K 1OVYA 3EFOA 3ZSXA 1JT0A 1EH6A 2OCEA 3CXCP 4PHTX 1BW5A 3BE3A 2L7KA 3HRTA 1U5TA 3DB4A 1M27C 5E20A 2A69F 2BXZA 3PSIA 1REPC 2QK0A 2NNWA 4ZDPA 4A69C 3OSGA 4XIDA 3VEZA 1PCXA 1GFDA 2RC4A 4C8OA 1YHQQ 1X3UA 4CZKA 2H6BA 1RFQA 4K43A 3THYB 4MEYF 3BZKA 4DQPA 2EZHA 2XRIA 2DTRA 1Z6RA 1T2KA 2XHIA 2CGHA 3R6SA 4F7UA 2J4RA 1IXDA 3KD1E 3H3OB 2YI1A 4M77F 3WNEA 2WOMA 3DWLA 3GNGA 3KZBA 1T0FC 1YQRA 4KB1A 1CGPA 2HMIA 1WHKA 1NK8A 2CW8A 3GZ6A 5IYCJ 2B63J 4S05A 4CCHA 2O8FB 1MNEA 1DGWY 4IEEA 1SEUA 2QCOA 2PI0A 4ISGA 1UAXA 1VQNN 2EZKA 2ZPGB 1WJRA 2PBIA 3OMYA 4XRFA 4C5IA 4NS5A 3ENHA 3B02A 2Q1NA 2GWKA 3FZMA 3ATVA 5J1RA 2RV8A 1QSLA 4DZPA 2BY3A 3EH1A 3THXA 1TUUA 4EATA 1VRLA 3CCQA 4YIIA 3JREA 4OIRF 1F1ZA 2G8FA 1ON2A 1HW2A 1KC8C 4YIRX 3ULEB 3JRZA 1H1VA 1DPUA 1OULA 2HTSA 1VQLT 4DBFA 1V29B 4N41A 4ENMA 1VQLI 4N5SA 3AAPA 1ZR2A 4RTFD 3BG5A 1FOYA 1TW3A 4B9SA 4LD0A 4FX4A 2M7AA 3O1WA 3F5TA 2NOGA 2IW5A 2YHXA 1UJ8A 4EMGA 1CLQA 2KTQA 2ZM6K 3JSPA 2ESHA 3FE1A 4O3MA 3H8ZA 3IL2A 3SAFA 4AU7A 2E1ZA 2QA4Q 2DVEA 4JJCA 4PSXA 4M3TA 1FOXA 3BG3A 3IH2A 4M77A 2KPMA 2PUKB 5L3EA 4IRIA 1LDDA 4B9MA 4BI3A 4G6TB 5EVZA 4HF0A 3GBQA 2HQNA 3BY6A 4Y92A 4M41A 4KBOA 1KQ2A 2GXBA 1BKBA 4DYCA 3NF7A 1EF4A 1Q86O 3GBGA 1RNLA 2JRMA 1NGNA 1S3XA 1PD0A 3RMSA 3F8MA 2VYPA 1E4GT 4HNVA 4C92C 3HSRA 3E9FA 3LANA 2ZFUA 5TKYA 3BJAA 2CYZB 3NTKA 2KMUA 1LOJA 4D9JA 2CP5A 4ISFA 3S15J 1BI1A 1U1TA 5K5RA 2Q2RA 2DDBA 4IL6C 5CVUA 2ZB9A 4CFAA 3K5MA 1IGQA 1UUEA 4F52A 3CC7T 1JGGA 2M02A 2JA2A 3CC7I 4C8LA 1N5YA 2RQWA 3G4ST 4CJKA 3TO9A 4M3DA 5JR3A 4BB7A 3LPUA 3MWTA 2ELJA 3G4SI 1WVRA 2WY8Q 5BS6A 1MGQA 1OH7A 5IHKA 4XLEA 3CEYA 4E9EA 5J2PA 2ZFWA 2DBMA 2NAZA 1ZLKA 2DPPB 1FJGK 4GY5A 4E0DA 1JJ8C 3QBXA 3R6OA 2MYSA 2OJ2A 3L2WA 1YJWA 1XUPO 3H3NO 2VONA 2CW7A 5EJCA 3G71A 2HSTA 2D2WA 3IHUA 4XBFA 3SQNA 3B6OA 3FX3A 1HLUA 1W2BM 2GBQA 3OA6A 1RRSA 2DY4A 1BW6A 1R8OB 1MUDA 3OJUA 1IG8A 4OO1J 2ZGYA 3E9LA 3HPHA 4JPBW 4GNIA 2F2XA 2XY7A 4H8KA 4CI0C 4YDUC 3K6GA 2OZMA 2E12A 5MLCQ 4H03B 4LY7A 4M42A 4JLGA 2FYKA 3I56Q 3D5LA 2ZNYA 1X6OA 2UUAK 2DETA 2R7DA 2F5EA 2XY5A 1SKUB 1TKXA 4P9FA 4DFPA 1OYWA 1GDTA 4FXDA 2L2OA 1NBEB 2AQFA 5EU7A 3D2FA 1TZLA 2ZJ2A 4BROA 1FIAA 1UHWA 2XIGA 4II1A 4IBNA 3QWLA 3JCMc 3X20B 2M9HA 1TOVA 4N4HA 4TSXA 3MN7A 1QCFA 3BDLA 1N8RU 2LTPA 3GTQJ 1KU3A 2X3XD 1DT9A 4BC4A 3AO2A 3ZR8X 5HDGA 4EZ6A 1YIJA 3PL8A 2ITMA 3K10A 4JX6A 2EQKA 3K4MA 3S17J 2IVMA 3JRAA 1KEAA 1OZ2A 1RT5A 1VQ6N 4IUVA 4P1WA 1B1BA 2E5ZA 2GOXB 2HZTA 1VSLA 2ZJQF 3FBNB 2LVMA 2DL4A 3CPEA 1S7AA 2JM8A 2FBIA 3OR2C 1S5LC 2WA0A 4EZ9A 4C8QF 2WBMA 4ENNA 3CCUQ 1AOYA 2P0QA 3FISA 4JEPA 2LK2A 1B72A 2K3XA 1QVGS 3HO1A 3LDOA 2BTTA 2VWFA 2HL5C 1SKRA 1KD1U 1LVKA 1MMSA 4NZGA 2H8HA 3QIIA 2P81A 4LIUA 1ERDA 1O13A 3IG1A 4UVCA 5AQKA 3GE1A 4KO0A 1L3TA 1NLVA 3CM6A 2LVSA 4CF8A 2ZJRL 1ZBUA 5K5QA 4E47A 2QLZA 4QKUA 4KAZA 2EQJA 2V8JA 2XPUA 4H0VB 3A5LC 2QA4A 4QSHA 5H2FC 4MQVA 1IC8A 4NC8A 1X01A 4LDXA 2K02A 4R0KA 2E65A 2YT6A 3LSJA 5DM7L 2ZPBB 2JW4A 1T3SA 2GA1A 2LJ1A 2XUBA 3KXTA 1LKXA 1D09B 2A3SA 1R0BG 4MDXA 2JZ2A 2O88A 4CECA 2M16A 1RILA 3HDDA 1HPMA 3V8LA 2A5WA 5KNLA 3GCMA 2E5LK 3ZMVA 3VQEA 4IEJA 1UOCA 4E7JA 1ZREA 4J9GA 3LA3A 1QPMA 1T0HA 2VG7A 2MH9A 3LSTA 3FM5A 4EM0B 2D0OA 2QQ8A 1NK9A 2RNJA 2VJIA 4W5TA 4C8QA 3HRGA 1X9MA 3RCOA 3P7NA 3F8BA 2W42A 4KB0A 1WZOA 3S9HA 4FHTA 3LQRA 2YRVA 4LSNA 1KAXA 4C1NK 1RR8C 2E6NA 2KYMA 1ZBLA 4JUVA 4WQ5A 3L1AA 5AQXA 4FYVB 2P4RA 3NWSA 4MO7A 5EXWA 1WJAA 2GGRA 2J6OA 1VF9A 4M3FA 2HVSA 1GV2A 4BRNA 1NLPC 4KI4A 5CPRB 4CGGA 2KYBA 4L9TA 4OIQF 1ZUUA 1W7PD 5GINA 4BU2A 3FIFA 4WCIA 4D0PA 1KHIA 4R79A 1U5TC 2DFHA 4JZ3A 3VOVA 1S72N 1FP2A 1TAQA 3HOUJ 2KY9A 4RMNA 2DM1A 3M1CA 5KN9A 3B6AA 1VQ9T 4NDLA 2JVGA 2NOHA 3C12A 1VQ9I 1Q95G 5FKOA 4RS8A 1P8ZA 3JSCA 2DOAA 2RF0A 2DTZA 3GPLA 1R1TA 2CQXA 2COWA 3ZT4A 2L5QA 1TXQA 1YTAA 3PTAA 5GAMe 4HV6A 3S3NA 4ILHA 2JUGA 1JCFA 1IKXA 1A36A 1YRNB 3THYA 4RG2A 1YJNQ 1FYKA 3F0ZA 2P7CB 1S7EA 3I56A 1O4XA 4MZPA 4RW6A 2XO7A 4BRFA 4GFBA 1PU7A 1GLFO 2JOYA 5DY9A 4C0GA 1RBUA 4BVOA 1WH7A 3T9NA 2K2VA 4TV7A 3KWGA 2H3EB 4M9SA 1K8AC 4CHQA 2XB0X 2ENMA 1N8RO 4CJFA 1IG7A 3RRHA 4B6MA 3M4OJ 2XVCA 2YHYA 3BW1A 2YWWA 1NLOC 2CT3A 1Q7YR 2O8FA 1L3SA 3MVPA 4JX5A 1QZ6A 1KQSA 2BKDN 4M75E 3CETA 4C2MJ 2CV1A 5HODA 1TT5B 2RMOA 2V8IA 1D1AA 5GANe 2M87A 1ORPA 3MAQA 4O0JA 4BREA 5I2SA 2DZCA 5FGMA 4M7DG 3HYIA 3HB9A 3CVTA 2PJRB 4LB6B 3VS1A 3F6OA 4AIAA 3CCUA 3FR0A 4OKKA 2VGMA 3T8TA 4KHUA 1KTQA 3I0XA 2O8DB 4M77C 1H92A 3BTJA 1S1XA 5BPNA 2VJ4A 2DEQA 4NOYA 3VUZA 5CKDA 2X74A 4M3UA 3RKYA 2WB1A 1ETVA 3CC4Q 2SEMA 3ZPLA 3CF5L 2AKLA 2YHAA 3UA6A 3I3LA 3CMAT 3W6KB 3OW2S 2WACA 2XU8A 1IAWA 2RJEA 4AHSA 3CMAI 2YHTA 3M57A 4DTPA 4YIFA 2ASPA 4JI1K 1M8MA 2ZPEB 2HR3A 1KQ0A 3MO8A 3VJPA 4EM1A 4M75C 4H0TB 3C94A 3VRZA 1DGRM 1I0CA 2C0OA 4M73A 1ZC6A 4JRKA 2OPSA 3IFRA 3L0QA 4EIAA 1NOYA 3AT1B 3DLBA 1M8VA 1LCKA 5JS2A 3UNGC 1UFFA 3AVJA 3OS0A 2HL3A 2IOCA 3HEFA 1E3PA 3CTAA 1FTTA 2JA8J 3JRGA 1VQ4Q 1AWXA 4ID1A 4XTWA 3LWHA 3CCEA 1QS4A 2JVVA 5CQXA 4BR4A 3RPUD 1RCHA 1HQCA 1BOTO 2D1XA 1KU2A 4CJEA 3S1MJ 3AV9A 4KUIA 3MXJA 3OYGA 2F2EA 5E3MA 2R7ZJ 1HKTA 3HTVA 2ZMEB 5GIPA 1RDBA 5LJ3e 3RUXA 3AA5X 3CCEN 2HNHA 3TP3A 3SEQA 1DU6A 3G6EN 1IHVA 2FEZA 2LD5A 2YNIA 2RB6A 2K5IA 4F3TA 3MCZA 2PZ1A 2KMTA 3ASMA 1RUWA 3K9JA 2UU9K 4B47A 2PFUA 3TREA 5D3GA 4KICA 2R7OA 1RAHB 3I5UA 3FSPA 4NCAA 2PJPA 2YXYA 3VQDA 3MCPA 2DTHA 1VQPQ 2DA7A 1YG2A 4AVPA 2Z5UA 3U1KA 3B8AX 1PP8F 3MKDA 5FROA 3ZSWA 3DKMA 3L09A 3QEXA 3SHWA 2F8TA 4UV8A 1BB9A 3FRNA 4NXNK 3G73A 1EWRA 1G15A 2VQLA 3DF8A 4DS4A 4EJTA 4ZHRA 5AQVA 3IAYA 4Z8AA 4HBLA 2O7OA 2DX1A 4HW0A 2NYSA 2W6LA 3EUAA 5LGUA 3A8MB 2KRSA 3OIOA 1A04A 4R1HA 1FBSA 3OGDA 2FG0A 2F8SA 4ZYDA 4IXCA 2BE5F 2EINH 1D3YA 5KYXB 4U7BA 2A6EF 2VC0A 2KHOA 5BN8A 4WXDA 2LJ0A 5GAN5 1S1VA 2RO0A 1Z91A 2HDCA 1G3YA 5E18F 3CUQB 3BZCA 2IA1A 1YJNA 5GMKi 3AY9A 3KYLA 2COMA 1ZRCA 3F10A 4BY1J 1LW2A 2JSCA 2ZE2A 3KEYA 3FHZA 4JLHA 1MUYA 3H0FA 5LJ5e 4S0HB 1X2MA 1OZ3A 1IXRC 3JCMb 5L3FA 4M78B 3M0TA 1RZ4A 2CH5A 2CUEA 3PX6A 2MMPA 4CH7A 1U06A 2CDTA 4B1UB 5JVHL 1W5TA 2ATCB 3I9QA 2FOKA 4IOCF 1AT1B 4AYBN 1MUNA 3INZA 4X9DA 1ZELA 1UE9A 3WVEB 9ANTA 3MEWA 1VI0A 3H3UA 3GTGJ 4A3IJ 1M1GA 3CCRQ 2DO7A 1NGGA 3CPWP 1J75A 4QS9A 2VB6A 1JL1A 3OYIA 5ILSA 4E6RA 4BRAA 4D5FA 5J2MA 3C6AA 1M5Q1 1RLQC 3I55N 4B9LA 2DPDA 2R4GA 3J7YP 3RWUA 1NK0A 3QRFF 4A54A 2J5OA 4IFEA 2WSEE 4DF8A 3K4NA 2E3IA 1SVMA 3CP2A 4CEZA 2A42A 3TAPA 2XMFA 1KVCA 1BR2A 5FPDA 4X1VA 4RB3C 2E10A 3CJAA 4CEAA 1WPYA 3VEYA 3UB5A 3BF3A 5SZTA 1I3QJ 4IHYA 4Z94A 4JZ4A 2JMCA 3MDQA 1QW1A 1NWKA 1JLCA 3ZQGA 1MUZA 4XTYA 4RB2C 3HSBA 3SLCA 4PL7A 3K9KA 2G8WA 3VYSB 1VQ8Q 4CSWA 4NC6A 3FHGA 2D0CA 4NHJA 2HGCA 3MHXA 4EMKA 5GIOA 2HBPA 1KSWA 4ZYEA 4DQIA 2MG4A 1W1FA 5AQTA 5M5WJ 1OFCX 3HPOA 3SDBA 4LE9A 4C8QC 4M7YA 3QBWA 2EV6A 2OPTA 2DQLA 3VN5A 1AHJB 2W00A 5ICEA 4CBXA 4IRGA 5LHHA 2CGLA 5M1FA 4ELVA 1V5FA 2X4YA 1HX1A 2E2QA 1NGEA 4QPOA 3FHFA 1NGIA 4LG0B 3PO4A 4DWIA 3FZKA 4J2AA 3RKXA 4C8KA 4G6DA 1KQJA 1MZBA 4WQ5C 2QKBA 2EFNA 3ISPA 1ATSA 4EA5A 2Y30A 1M2VB 5FWBA 3PO2J 1VQ4A 1VYUA 4CF1A 4JKAA 4A4KA 3ZEUB 4IHWA 3VYRB 3O8VA 5CAIA 3CDIA 2SRCA 3KLOA 4IG0A 3TABA 1E7OA 4EP4A 2DDAA 2ADUA 5ILVA 2HEOA 5FLMJ 2HQXA 1JEGA 2JN0A 3SUOA 3MZHA 2L3QA 3CCVQ 3CC2T 3BUZB 4DR4K 4NUBA 3Q3SA 4CEDA 3CC2I 3LSIA 4ELYC 4ASNA 1QQCA 5GAOq 4XAXB 2L2PA 3K0SA 3HVTA 4DW6A 2GM4A 3LWMA 4EQQA 3NMUA 4OMOA 2XHCA 3ENOA 1I07A 1UJ0A 4A3MJ 5CKTA 3CCLQ 3S3MA 1R77A 5CR2A 4DYRA 1M3HA 4BJ6C 3G25A 4UNOA 3X26B 1K8KB 2OTLN 1E3MA 1ZHIA 3WQTA 4CHPA 2UV1A 3PGGA 4DSFA 1B4AA 3A5OC 3TU5A 2X85A 4KHPK 1TWHJ 1YP5A 1JKPC 4A93J 4Z02A 1GLNA 1KK7A 4IO9F 3LCNA 2CGPA 4M6YA 4Q5VA 4HLXA 4M71A 2E70A 3EFRA 1VOMA 1P2FA 2LP5A 2X78A 1B8IB 4FTHA 3M56A 2R58A 1F21A 3ZCMA 2KRMA 4FJ8A 4LJZF 4RCHA 4KHYA 3ZX2A 5AQOA 4BVPA 2Y1IA 3Q9SA 4KYWA 5J8FA 2YCHA 1S29A 5EC7A 3G2BA 2HSPA 3W2WA 4BGAA 4HOBA 4PJOG 4XH1A 2JRTA 5IN1A 5CYMA 3ZYYX 1H89C 2GCXA 4BHBA 4JN4A 3R60A 3LALA 2LCSA 5J47A 3H9GA 1JXMA 1RLPC 1IHWA 5L23A 1K9MC 1I39A 2A6HF 4B3AA 1ZARA 3R3LA 1T6CA 1Q7YU 2ZCFB 4I98B 1K4SA 4KIFA 2LTOA 2DAQA 2V7ZA 4A5MA 4C9YA 3HRUA 1YVNA 1JHHA 3K2AA 4XLAA 3CCRA 2VXEA 3N05A 1LMZA 3BQYA 2TRTA 2PJRA 4M63C 2NLXA 2JGUA 1Q8IA 4DMNA 5AQWA 1QNTA 1JJ2S 2O8DA 3MEDA 2QENA 3EG2A 1OYYA 1X27A 3ZQLA 2ME6A 1IKYA 1W6XA 4OB3B 3VS6A 1WAJA 5AONA 3VOEA 3I54A 2BY2A 1IRXA 1PDNC 1ETQA 2GA2A 3CC7N 2HB5A 2WV0A 2NRTA 3PNVA 1JKOC 2D0NA 1WWXA 1VQKQ 1UECA 4HUGA 5BMZA 4HWIA 1MD0A 1VSDA 3FXLA 3UATA 2D0QB 4IIOA 2I5WA 1I1SA 1QP2A 3N97A 4FT2A 1SG5A 3TTDA 3VS7A 2FSJA 2JLEA 3T1AA 1VQ8A 4LD5A 1TK0A 5AQSA 5L3DA 4M3XA 2HHQA 4LN2A 1KHCA 3ML6A 3V7RA 3BDDA 3PY8A 3VSKA 1I94K 3FJ5A 3WTZA 4YOQA 2V9KA 1ETKA 3QLHA 4OX9K 4JJBA 3CQTA 3JSOA 3HSTB 5CE3A 3OY9A 2NOEA 4LUEA 2Z1IA 3H0GJ 4UY8I 1TBXA 4LITA 2FUG2 2W85A 3U4LA 4A57A 3LSMA 1KFZA 4A3FJ 1DP3A 3ZMUA 4F3OA 5H6RA 3UKUB 3DBHB 2XAGA 3JB9D 4CZJA 4BD3A 1D1BA 4ABZA 2PFBA 1I8FA 1AWJA 4B3OA 2LNBA 1F43A 2QASA 3D0PA 4AVZA 5BRDA 1SL2A 1NGJA 3GF2A 4Z4EA 1XC9A 3HHTB 3QPTA 4II3A 1D8KA 1XMXA 3VETA 2E71A 1M1KU 1YX5A 2ZMEA 3PMIA 5C12A 3L2RA 4D7NA 4M78F 4KN7X 4Y17A 5JVGL 3VQ6A 1WHMA 2W48A 4P5OA 4EEFG 2O6GE 3HKZA 1V5GA 4OB2B 2DYIA 2A41A 2OAWA 3ERMA 5BREA 5J40A 4C3IJ 1NTCA 1VTNC 4DTUA 2QQAA 1RBRA 2RREA 4OMPA 3CCVA 1J09A 5IHNA 1IREB 3OA9A 3OIQA 4KUDK 3HKZN 1ZSGA 4E7KA 5AZJB 5H6QA 4W5RA 1OPKA 3JCMh 1LFBA 2G9WA 3TKYA 1XMAA 4YY3K 4MQ9F 3J80O 2WSCE 1PHTA 2R57A 4DV5K 1FY7A 4OMNA 4A0ZA 3GVAA 3CCLA 2CUJA 2HI3A 4I02A 2DA5A 2IS3A 2O2OA 2O4XB 1D8YA 2L8DA 4A6EA 5A0LA 4ZDOA 1J53A 1PVSA 2L01A 4L9NA 5KYXA 3OMGA 4MNUA 5EG2A 1SFKA 3PX0A 3CBOA 2M8EA 5E79C 3JV3A 3CUQA 1FOKA 4ESFA 4PFPA 2HF3A 1BBYA 3S6IA 3ZFJA 1XX5A 3P8DA 3Q0WA 4QVCA 1IN5A 1OR7A 1PRLC 3ATUA 3EQLF 3F22A 3CHWA 3KK7A 3ABLH 5E1ZB 2BZYA 1ETWA 3K57A 3BY5A 1W0HA 4M78A 3PFSA 2KROA 1VQOQ 3U9DA 1TLHB 2HVIA 4RWTA 2IEKA 2QG9B 2KFZA 3TSUA 4YFKF 2D45A 2KRNA 1QHTA 3LFUA 5AQYA 4XSZF 4M7AD 3SZ2A 4DBHA 3GBTA 1YITN 3H5NA 1I1JA 3QEWA 1E2XA 3A5MC 2HOSA 4I7FA 1IZ6A 2HKQB 4HUFA 2EV5A 1BC7C 1RT3A 5ICGA 3THWA 3I35A 2WV1A 3S14J 1BN5A 1YQAA 2O9VA 3J7YJ 4JI8K 4RKUE 4RM2A 5EOYA 3MMVA 4E3SA 4E4HA 2BE7D 1GOAA 2G8VA 1VQ5T 2ZSIB 3HRMA 1VQ5I 4JRIA 5IP9J 2D1HA 1I50J 3MX5A 2XPVA 4A2UA 2BHZA 1LFUP 1NKBA 3S32A 4EMKC 4FLWA 4XORA 1XWLA 3H46O 3WTTC 3LWFA 2VI6A 3N4MA 2QQ9A 3GFIA 2LKSA 1TL8A 2I7NA 1C6VX 4GMJB 3PIPF 1MDMB 4XSXF 3CMEQ 1E17A 4OOIA 3WXMB 1VA7A 3KP7A 3P38A 1K4US 1K73C 1VQKA 2MC4A 3FXJA 4DOWA 3FXUA 3KBGA 1MJ9A 4KFBA 1SD4A 2QM1A 4KULA 2OQRA 3BLYA 4L5GA 5E3LA 4FJHA 2EIKH 2EKHA 5GAN3 2W1OA 3O3GA 3V9SA 2RHIA 2Y90A 2J7IA 1YYVA 4AFQC 5I42A 1B59A 1SSHA 3BOQA 2NOFA 2YUSA 5KE3A 1B6AA 1FWZA 4LG0A 1RBTA 3V42A 2F4IA 1NGDA 3VPZA 4DR1K 3K1PA 1Z7UA 5FO5A 3N4QA 4GO1A 4LD6A 1G3WA 2HNZA 3LAJA 4KBMB 3OYBA 2XF7A 3ULRB 1M2VA 3CDHA 2V79A 3FWEA 4I9LA 3RSEB 2XAFA 3CCSN 1AHDP 3PNYA 4I2OA 1SV5A 3VTIA 3ZEUA 1VK0A 4U0YA 2E6LA 3BTLA 1I5OB 2KLAA 4BRQA 1M1KO 2ZPIB 2IVWA 1AZEA 3MFKA 2K3BA 2FVUA 2L4MA 4PZJA 3IAM2 2EK5A 3AG4H 5E17F 2V1UA 1QHAA 3K70C 3JXUA 5GAOm 1QQIA 2XY6A 4XK4A 1VFCA 3JCMg 4IHSA 4O8KA 2E1YA 1JE8A 4IF4A 3PIPA 4RB0A 5AYFA 2E35A 4H0PA 1OH8A 3ZL7C 4IOXA 2BTFA 3IRXA 1IUYA 1IDZA 2QWOA 1J5YA 1V54H 1VSMA 1EV7A 2R5ZB 4OPHA 4E19A 4FJNA 1YXQA 2R7FA 3O9SA 1J6ZA 2VJ5A 1GXPA 5LJWA 1WGSA 4X34A 1KVBA 2DEUA 4N4IA 1EKEA 3WTXC 2X6YA 1K8KA 2ZZDA 3LP0A 4RGXA 2LR8A 4C5GA 1KZHA 4C30A 4YPHA 4NLBA 5AQNA 3HL8A 4O5FA 5D6YA 4GLKA 4XH4A 3QP5A 3O4NA 2J6FA 3KUFA 2KKOA 4GVEA 2FQ3A 3LH0A 3M9QA 2Q0OA 4WTOB 4A61A 3DOLA 2DT6A 2CSIA 2IDOA 1B8IA 1QVGP 2ZWHA 1UMQA 2JSPA 1Q82U 1U9NA 1JB0E 1MJAA 3QPHA 3AO3A 2KE9A 3DLKA 2RI3A 4Q0BA 4XTUA 1T8IA 5F27A 1H0MA 2EPFA 3PM1A 4E7HA 1QVFA 2E41A 4EMHA 3LAPA 5HLHA 4EAHD 3IH3A 2H8RA 3AVAA 1K76A 4BQNA 4A0YA 2OANA 4GXOA 2L0AA 3M4YA 1MMNA 1Y7XA 2X6NA 4P55A 5HVQC 1VQOA 4RGRA 3ZT3A 4DSJA 1DTTA 1RAAB 3VS3A 3WTYC 3EGXB 2O8EA 1RKTA 5B3SH 4XTVA 1O3RA 2BEOA 3WU2C 2LOOA 1Q81U 4L18B 1X6GA 1X43A 5KPTA 3CVSA 3M07A 2P5VA 4YOUA 3QYGB 2Z1DA 1JCGA 2XSJC 4NQWB 4DKWA 3LSRA 1OV3A 4H4KC 5GAMd 2KL4A 1IKVA 4B9WA 4HQMA 3RSNA 1BR4A 4YFXF 4IHVA 2GUIA 1ASWA 3M53A 3VS5A 3V6DA 4A3DJ 5AZIB 4I2QA 1NOZA 2AXLA 2P0KA 1QLYA 4HF2A 2L9NA 1YWOA 4JK9A 4W5OA 2NNYA 4AM6A 4BQZA 4DSEA 3NGZA 1C0GA 2V7FA 1FSHA 2QYZA 4KT6A 4BWJA 4XH5A 1I6HJ 1CKBA 4A5BA 4V19S 1Y97A 2F69A 4RLFA 1C0UA 3FKJA 3JCMQ 2BGCA 2EJRA 3J81E 5KGWA 4UY8O 1TKZA 2PN6A 1PP7U 4FETA 5GANd 5AQUA 2A0FB 1QA6A 3EE8A 1RI7A 4DV6K 1RPWA 4NB4A 3QNNA 4H5RA 3L2ZA 1XQSC 1VRTA 2DO3A 4Y33A 1HKBA 3UKUA 1VQNT 2A1RA 2ZMEC 5AQPA 4KHNA 2VQEK 1K4TA 3EG9B 2COBA 2XK0A 3ZX0A 3K58A 2MCNA 1FKOA 1BCOA 3VGMA 3D45A 3CWTA 3DB3A 1PKTA 1J0RA 2ZXHA 3VA0A 5FW9A 4F2SA 4BI4A 3ZN1A 5C15A 4JRQA 1M3CA 3WNGA 2DNUA 3HOVJ 1NGBA 4F7UG 4WK8F 3J80Z 4BHPA 2KP6A 2M3AA 1EQYA 2HOEA 2BHYA 1HDDC 3V1QA 3ASOH 2LX9A 4BRPA 2DYBA 4RCCA 5CKEA 1Z77A 1KC8O 4RW8A 2DFFA 2G6FX 2F9WA 4E1NA 1OYXA 1K79A 2O61A 4X9CA 5HROA 2ISZA 1W36C 4PJLA 5EZGA 4FT4A 5J6XA 2XG8D 1O57A 4HVVA 1VQLQ 3RI4A 5AZJA 1W7PB 2X48A 3OH6A 3J81K 4B3SK 1ZQ3P 3TL4X 3HXLA 4K0KK 1RTHA 4A6DA 1NJIU 1OH6A 2KJCA 3H0HA 4C3JJ 4KHQA 1N32K 2OYQA 4CZFA 3CUQC 1B9FA 4LLNA 5H20A 3I4MJ 2PMUA 1GVDA 4HPQA 1NGAA 3OTOK 2O4XA 3WG9A 2DOFA 4BRKA 3PNWC 1OR7C 1J9AA 4CZHA 3DMJA 5D5XB 2XI9A 1DJ7B 5LJ3d 4OPJA 4OJRA 4BDYA 2L3RA 4ZTJA 4M78C 3AO4A 2ZJQL 4G1QA 3MPUB 3H5RA 2RAEA 4Z4HA 4FVUA 3H0IA 1Q82O 4DLEA 3RYPA 4NCGA 1HNIA 2BYVE 3AVHA 3E01A 1U47A 1X75C 5IY5H 4DR6K 5IXBA 4PGHA 4BXUA 1O1WA 2ZJPF 1JUSA 1FBUA 4XKWA 2LKPA 4J19A 4M77G 1M90C 2F4OB 3LM2A 3OBWA 3AA4A 1UJYA 3VUBA 1HOMA 4M4ZA 3COAC 3LDLA 1XOVA 2HHTA 4LK1F 1TQPA 4M6XA 4YG2F 1NMNA 1MBGA 3MXMA 1BA1A 3AG2H 2HHSA 1ZLJA 3WG7H 4CGHA 2XDVA 1CZBA 3ABTA 4CC2A 2E1HA 2L7MP 1IN7A 5FWCA 1KAZA 3CC7Q 2JG6A 3VW4A 2VQGA 4CK1A 2DLPA 3HHGA 3R0JA 4BRCA 5F04A 2Y0SA 3ZRGA 3G4SQ 4M75G 2HPMA 4J01A 4RAZA 1KXPA 2A5YB 3AGRA 1JLBA 2CH6A 4GV3A 1FW6A 2L0KA 3BR0A 3LSKA 3MMYB 3NAEA 3A02A 4BWMA 4CK3A 2YNFA 5AQQA 2Y2ZA 2Z99A 3NQOA 2UYTA 4LIVA 3QUIA 1TKDA 2KQWA 2B8AA 5IPAA 5HLFA 4E6KG 1MDMA 2KRCA 4V2FA 4GLMA 3HK2A 1BOAA 3MXIA 5EDNA 3F9KA 1Y07A 2JHJA 5AR0A 4C5EA 2NYXA 4C2UA 2MGQA 4J2EA 5AIPA 2P8TA 3QEIA 4AC0A 1NH3A 4CGIA 1KQSP 3IKVA 2GZWA 5JI6A 3FLGA 2VG6A 1EXQA 3EO3A 2YNHA 4CA0A 3OW2M 3B6CA 2W24A 4XIUA 4CZMA 3MN2A 2OPPA 1P7JA 1Q86R 3AG3H 4B3XA 3C7JA 1VQ6T 1RT7A 3KLGA 4RAFA 3JRDA 3ONQA 2NZTA 1VQ6I 5GMKe 2DQRA 4A3JJ 1JRIA 2UUBK 3CCMN 1P4AA 4J9HA 1YQKA 2I5JA 4Y1DA 4J6XA 4FM1A 1YQMA 1YIJT 2DL3A 2IXSA 4JOMA 1YIJI 3RSEA 4M7DB 2VLAA 2OX7A 4BDZA 2W57A 1ZA1B 3VYGA 5D5VB 2OTJN 4XLPF 2HOAA 4JJDA 1JLGA 2Q0RA 1EP4A 2CQQA 4PLIA 1LEBA 2DFUA 1VSJA 1L5UA 3C65A 4KN4X 3O8HA 5D5UB 4F9OA 1UHCA 1QRYA 1RDWX 1Z3YA 4F2RA 1QVFM 3IUOA 3PO5A 2IGMA 1M9SA 1H8AC 2K4JA 2X4WA 3KTUA 1VQ7N 4FPBA 3T69A 2VKHA 3P4IA 1E6HA 2HKOA 3GLXA 2XIDA 4EIKA 1J7KA 3FZVA 4Y1CA 2A7YA 1DGKN 2R5ZA 3TO7A 1MSEC 4Q5SF 3K2ZA 1P90A 4V19K 2G3RA 3WGHA 3A98A 4HYEA 5HNHA 1W9HA 4MIMA 3G0QA 2LT1A 3NGPA 4BS9A 3VEPA 4ICLA 3WHCA 4JI0K 2MFZA 4F17A 1YN8A 4FVMA 1WZ2A 4CHYA 3E1YA 4ZGEB 4CCOA 3JAMO 1WQWA 3QZ9B 4KDPA 2DTIA 2HYFA 2V6CA 3MX2A 2HSEB 3BP8A 1TUYA 3SI6A 3SBTA 2X9DA 1A5JA 2XGDA 2P9PB 2YU9J 3F8CA 3K4CA 3SV4A 1YWPA 2BZXA 1I27A 1TWFJ 2R5YB 5GAN8 5AQJA 4M3ZA 1IJJA 1IO2A 2FRYA 5TKWA 2QDYB 1MBFA 2NNNA 1JI8A 2WAQN 2VKEA 4NCBA 3S1RJ 1UEBA 3LM9A 3EYYA 3DPLC 5HOOA 2ZSHB 3U8XA 4EJZA 4EM2A 5CVIA 2ZNZA 2NUZA 1BR1A 1W4SA 2FC0A 2K3PA 4M45A 1NG9A 3J80E 3EGXA 4CD1A 2O4GA 2IPOB 4BQAA 2KXDA 3H08A 5K1YA 3AVNA 4PJJA 4FWLA 1S72T 1Z21A 1S72I 3PSFA 4X65K 2A08A 1YCYA 2EGCA 4NQWA 3M3YJ 4W1UA 1BC8C 4G12A 2PYLA 5IHIA 2EPDA 4DA4A 2ZF5O 3VFZA 4PIIA 3KYCB 2HVHA 2KJBA 1MV0B 3IKMA 2KRHA 2RM4A 5CZ1A 5HBMA 2GF7A 3QZ5B 5GAOr 4FL6A 4B21A 2DKGA 2DI3A 2LY2A 5AZIA 2P0WA 2YSRA 5C44J 3M0PA 1FIPA 5EY4A 2K79A 3CQYA 2W10A 2YLBA 4FE4A 2CRGA 2JJ9A 2ZC2A 2JWLA 3LQQA 2V1NA 4OIPF 3EG0A 4XRSG 2AXTC 4AFSC 1VQ9Q 4NB5A 1PG5B 2FRHA 3HM8A 3QICA 2KIFA 4E7ZA 1IG9A 3THVA 3S6WA 3KX2A 3AO5A 2KBTA 4NYNA 4KA4A 4IFYA 4OFHA 2CW0F 2IP2A 1TG0A 2HBKA 2BY1A 3M55A 4F3QA 1R7JA 1LAWA 4DR5K 2E4HA 3K0LA 1LEAA 4AI4A 1HKGA 2V1XA 2P9LB 2L9RA 3H9JA 3J80K 1NJYA 3ZOBA 1NG6A 3CPWS 1DDNA 3ISNC 4DTOA 4JRPA 3L3VA 3EG9A 1K8AO 2NLUA 3SQ1A 3O6BB 1YCSB 1R4NB 4CZLA 3BCBA 3VYUB 2RPIA 1PC0A 4M3YA 3CXCA 2K86A 5BR9A 1FEXA 3HGYA 2FBXA 4CZGA 4CEBA 1GBQA 3FBIB 2IAIA 1ZSZB 3E3VA 1ZUYA 3M4GA 3HM5A 4IHTA 4WFNL 1A5WA 4CXFA 2W03A 4PCQA 2M5WA 5HDNA 3LWLA 2R7TA 1X2QA 4IWVA 3SUPA 4HX7A 2F1LA 2KI7A 3VQPA 1BOBA 1AOJA 3IUCA 2DRKA 2LQWA 2F6CA 5HRNA 2XF5A 5GMKl 1HJOA 1W7PA 3ECHA 1RAFB 5E41A 1BJAA 4JHDB 4WFBL 2GTJA 2EV0A 3DRSA 1NK7A 2P84A 2IS6A 3R61A 2HHHK 3ID6A 1A6QA 1BIZA 1X58A 3M8QA 2OZUA 4EGZA 5J4VA 1A5XA 4EHTA 3Q7CA 3DXMB 2KR3A 3F21A 3P8HA 3PX4A 4MLEA 2E6ZA 4JQFA 3DBRB 4Y91A 3CMAQ 1XMQK 4F8RA 3IC7A 3ASKA 4CBUA 2CGJA 4YEJA 2A37A 1JLFA 2W0ZA 3O8GA 1YI2A 3NMZC 4FYXB 2DBKA 2RN8A 2E20A 3WTUC 4BL0B 1T8EA 1TYQB 2WFBA 4HNTA 4J9IA 3R2XC 3EETA 5KHDA 5J4YA 3D4VA 1VSEA 2P6SA 3M1FA 3JCMV 1YI2N 1NM1A 2EH3A 2FF6A 4M9ZA 2KAFA 4IJAA 3CCET 4BH9A 3G6ET 5FKNA 2H6CA 3CCEI 1D5YA 4PJOE 2RGVA 1N8RR 3NE6A 3F3XA 4ISEA 1Y0UA 2HBLA 2H09A 2E1OA 4ID5A 2HQHA 1KJWA 3HOXJ 3QYEA 2QWNA 3IP4B 5DCFA 3C2HA 4RGSA 4R55A 3REOA 3D7SB 1VQMN 4N4GA 2CQKA 3OB9A 3KZIC 2D8HA 3PQKA 1DIZA 1G99A 1JTYA 2ECZA 2HXIA 5DM6L 3FXOA 1KLNA 3GYHX 1G2BA 4X6AJ 1T6SA 4FJ5A 2EFPA 2EILH 1X19A 5GAOp 2M2EA 3JRCA 3VMFB 4LUDA 5BN9A 3UWNA 1N6QA 1KD1R 1FSEA 1VSKA 4F04B 1UZCA 3CIPA 1T3LA 1BG3A 2EB7A 2CP2A 5HK0A 3BQZA 1F36A 3P31A 4CHUA 3HPGA 2XKOA 3F8FA 5F08A 4N0AA 4B8AB 2HAXA 2EFWA 5GJWB 5BNGA 4CJPA 1JJ2M 4FPAA 4PJ0C 2M0OA 4IUPA 2VC1A 2DPNA 1EX4A 5KK1A 2YS9A 2OUMA 3KFWX 1SAXA 4DLGA 2LY9A 2J06A 2CGKA 2RH2A 3LSPA 3HVRA 1PYVA 3FB9A 3LSGA 2MW8A 5FLXO 1JLQA 3CJRB 2ED1A 2X1EA 4ZYHA 2AJQA 4GV9A 1V76A 1NU0A 4PJOB 1TC3C 1JJ6C 1XS9A 1FK9A 2DJNA 1LNWA 3ZSYA 2D1VA 2Z1HA 5K5OA 3NNQA 4DU4A 3VQ8A 5F6FA 4K11A 4YOWA 3GMEA 2VJJA 3VF6A 1GLLO 1REVA 2QXFA 1IKWA 1WSIA 4BJTA 4B9QA 2VBWA 1BIBA 2XHKA 3CWUA 4B9TA 1Z25A 1LE8B 3O3FA 1Q86U 3S2WA 2RQTA 3K1MA 3VDXA 1N8RC 5CQYA 3L2UA 4ORZA 2CUBA 1MMAA 1LWVA 3L3UA 3I55T 1R58A 4BAYA 3I55I 5E1WA 5F0HA 1PD1A 2YX6A 3RPUA 4DBQA 5J1YA 2F4VK 4DFJA 1K9MU 2F96A 4RTXA 3NFCA 4I99C 4CCMA 3FIWA 4FJKA 4UVAA 2VODA 4L9JA 4PNOA 3M8JA 4A3LJ 1LPLA 1FMVA 3SCXA 1WXBA 5FKKA 2P51A 1SKSA 4H0XB 3CQZJ 3JAMZ 2EFIA 4IO9L 1X9JA 4ZH4F 2ESWA 3TANA 1W2BS 1KD1C 2WONA 1H9TA 1QQOA 4MDAA 1V5EA 1BQNA 3LYIA 4OKEA 2G8IA 2QEXN 2ME0A 4RMOA 2VE8A 2RJCA 1EJ9A 3S16J 2O01E 4PJNA 2H3GX 3HOWJ 1JHFA 3EG3A 3OMCA 3TR8A 5HDKA 1KIKA 3DEEA 1V4TA 2IIRA 1WQ2A 3FZLA 4PKGA 2QQSA 3H9QA 1LQ1A 3O80A 3TWHA 4D7MA 3PIOF 4DEXA 3CMAA 2LP0A 2EAYA 1BL0A 1L3VA 1Y57A 1WSUA 2NOIA 5FU6C 4DZJA 5LD2C 4CW7B 3K4LA 2P9PA 1H8KA 2R5YA 3KD5E 3SFZA 1VSHA 1V4SA 1TNTA 3CD6A 1NZ9A 2Y9YA 1U3EM 1FC3A 2DPUA 4LF9K 2NS0A 3EGDB 3AAQA 5JMVA 1U04A 3V4GA 4HNUA 2DXIA 4CJTA 5GADP 1J3TA 4BG8A 4UB8C 1FN7A 3JCMe 5CHZA 2KQ2A 3CD6N 5GAN4 2AK5A 5KYUB 2IGIA 1XDUA 2MA3A 4DV4K 1ETOA 3VGLA 4CI6A 3VYTB 4FM2A 2BUDA 2KNBB 4DSLA 1FJLA 3CQXA 4M7AB 2OPQA 4A12A 1TAUA 2JT4A 2W84A 1F9NA 3CJ7A 3O08A 2BVLA 4O0IA 2FZKB 4H0OA 3E2UA 4U0VA 3CCJA 2BBYA 4B9NA 1HDPA 4Z2YA 3TQNA 1OCPA 3CXCM 1D4XA 4DV7K 4O55A 3LLRA 3ITHA 4OMYA 1RAIB 1IN4A 3SUQA 3CC2Q 3C2BA 2OTLT 2RI5A 4C92E 4XU0A 2OTLI 3LA2A 1VNDA 4PY5A 2L3DA 3QSUA 4J8OA 1YJ9Q 1Y6IA 4IEIA 2EQIA 2D0PA 2RD1A 2WADA 1FKPA 2MWPA 2XF6A 3PIOA 5CY4A 4F55A 1BI2A 4J2BA 1FYNA 4KITB 3JRBA 1RDCA 1FXXA 1HK9A 3CCQN 3J7ZI 3J7AP 1ABQA 2LSNA 4AIJA 3JRHA 3F8NA 1SF9A 2JTFA 1U78A 1UA0A 2ZGZA 2LT4A 2EVRA 1TUDA 1O3QA 3T5XA 3NARA 5GAMf 2QWPA 2P9LA 2CFXA 3EH2A 2KISA 3QBYA 4WF9L 3OS2A 4UXNA 1NM7A 4CJWA 1AEYA 1R59O 2P5OA 5IT3A 5A2QE 4CEEA 5J2QA 5EYRA 5A0DA 1M3BA 2FBHA 3P39A 4Y52J 4OMZA 1ZA2B 2DT5A 5KPZA 1ZG3A 2CUDA 2NRXA 2BOLA 5IWAK 3CF5F 4DR3K 1O9SA 1K0SA 3RR7A 3OYJA 1NYGA 4G94A 1JQQA 2XGXA 3H0DA 2FPDA 3I9V2 3RMQA 1EETA 4A3KJ 3FM3A 1G83A 2XAUA 2FBTA 1K9MO 3ZETB 3U6FA 4PL8A 4KGZB 4FSVA 4CEOA 4OIOF 2K9NA 2IVPA 3E5QA 2F48A 2WAFA 1OCOH 2PVOB 4BUGA 3BROA 1KSPA 2RF2A 5GANf 2O8BB 3CYMA 1J54A 1R23A 3NAUA 5FLVA 2M0YA 3SMPA 2NVQJ 1G59A 2EKOA 4DSKA 5CKBA 3CJ1A 3KJVA 1TQMA 1T3VA 4O5BA 3BEXA 1JO8A 1ETYA 2DMOA 1U8BA 1R5HA 4CJUA 3O5ZA 4XOPA 1MBJA 2VQFK 2ASOA 4RG8A 4OMMA 3DXMA 2K4YA 5HCKA 2VVKA 3OYYA 4LOCA 4EVIA 4EHUA 4EV0A 4FOIA 2OFIA 2KQRA 1K61A 3A8OB 1WXTA 2O8KA 5GANh 1K73U 1Q9YA 3NHNA 4B9UA 5A2QK 3A2KA 1NKCA 1YJWN 2DJIA 2L89A 4UUSA 3G71N 3HT3A 4DUYK 4MLOA 1NPPA 3QHSA 3V1OA 5GAHP 2X35A 3MEEA 2FE3A 4LF6K 3EG1A 3EDPA 3IHOA 4C8MA 3Q7BA 3VV0A 2F5VA 2EJGA 3I0WA 1B7TA 2OA8A 1YHQA 2E7XA 4JNEA 3LGFA 4RW4A 5HKCA 4FWMA 5AQIA 2V9PA 1S8NA 5F2RA 3DTKA 3CCYA 2AO9A 2R3SA 3SFIA 1YF5L 4DF4A 1HKCA 3H1CA 1NG2A 1RABB 2KIUA 4FLXA 4KT0E 4OLBA 3Q1JA 1WHUA 3K69A 5JLFA 1YHQN 1NKEA 4OGEA 1Z05A 5BPIA 2EYZA 3C0CA 4MFBA 3FHNA 2QWQA 3PIPL 2A6TA 3PV8A 3C3WA 3VRYA 1WPKA 3T3FA 3JAME 4K8ZA 1MPGA 2XKOC 2PY5A 3JB9F 4N0AC 2ROLA 5LJ3f 5CVJA 5CJ9A 3DQVC 2HDAA 1FT9A 3VF4A 2XROA 4C0ZA 3S8PA 5FLXZ 4KNYA 2BV6A 5AQZA 5ICFA 2YR2A 3CF2A 3W3CA 3MKWB 3MECA 1YIJN 1WSHA 3U2RA 4KFCA 2E4LA 4HVJA 2K4BA 5IP6A 3NVMA 3QU3A 4KTQA 2V6EA 1BIAA 3EL2A 3CC2A 2FLOA 4K2EA 1UB4A 2YNGA 1HPZA 3UKRB 4CGJA 3TEDA 4DR7K 1YJ9A 3QB0A 2RHZA 2GAUA 2QGUA 1WYXA 5GAOn 1HJDA 2VGNA 1TGOA 2YRDA 4OMLA 3JTGA 2R5MA 1JLAA 3TQ7P 3T8RA 5DPKA 5I3UA 2BANA 1XN7A 2GTDA 1X1DA 1USSA 4IFVA 5LJ3h 1P6RA 1NBWA 5DM7R 5ELZA 2QDLA 1IW7F 4DQ2A 4EW4A 4N76A 4H4OA 2PEXA 1LWWA 4RAYA 3KZZA 3RPQA 4BR0A 5JICA 1YS6A 1QP3A 5DYMA 4BY7J 3RJPA 2M34A 5E84A 5D6XA 1GOCA 2FF3B 4RM3A 2Q2EB 5E8IA 4FK2A 4U67L 3SXYA 1VHXA 1YITT 2LKXA 2F2VA 2CSQA 2JTVA 1YITI 2E5KA 3Q0UA 3BCAA 5JVTA 3GTKJ 3LDPA 1LE8A 4XTZA 1CZAN 1FZPB 2PG4A 3VEVA 1LWYA 1VZ0A 3KIOA 3C95A 2QA4N 3ZP5A 4QAGA 2A07F 3JAMK 5LJ3j 1QU3A 1J5OA 2CG4A 1ULYA 1X3WB 2Q36A 4O4GA 3RKQA 5J8CA 1P9QC 2OAUA 4JD2A 1N36K 1LNXA 2JNGA 3M59A 3BDPA 2VN2A 1RT2A 3QQAA 3D1NI 3WGIA 1PSFA 1VSIA 2RN7A 1N33K 3KP2A 1C1CA 3FLCO 4F7UE 3SNNA 2DMNA 3ER0A 1AWCA 3DWLE 2NRWA 1IN8A 2IIMA 1HKQA 1X4OA 1M3QA 1ESVA 2OPRA 4XMYA 2QBYB 4C0DB 3FZFA 4KHWA 2E34A 5ECAA 2MH2A 2C0TA 2KZZA 1VQ5Q 2QSGX 2NOLA 3BR6A 1ZBXA 4JAXA 1L3LA 4RW9A 4FYYB 4M7AF 1YVUA 5EEAA 5I21A 2AS5F 1GLCG 3GO5A 2VASA 2EQMA 2PX9A 3CDLA 4FJ7A 1S1TA 1WB9A 2ZCWA 4E89A 1I5LA 3BT9A 4XLCA 1PSEA 2RHUA 4J7FA 1A0NB 4B3RK 2PUOB 3VQ9A 3HFNA 1K73O 4DIQA 1HYSA 2BXYA 3ZGKA 3SZGA 3AAFA 3EZWA 2D0BA 2DJQA 2OD5A 2PVDB 3JTHA 3E6MA 5HP1A 1IXSB 5HK3A 3SQ4A 1ZH5A 2HQRA 3I58A 3LGLA 3CCST 2MD0A 3M54A 3REAB 4EPCA 4D8KA 3CCSI 4DSIA 2P9SB 3M5RA 3JW4A 3HSCA 3ABUA 5GADJ 5B66C 1TWBA 5DLOA 3EGDA 1D0ZA 3FF5A 1RAEB 1OCTC 3UF4A 3MN5A 2NOZA 5CZ2A 4M77E 3RYRA 2UUCK 2DTUA 2QSFX 4MLHA 3OS5A 2IGNA 3L00A 1SS6A 3LDSA 3MN6A 5M1OA 4RTZA 1UAAA 4BNCA 1QWFA 5L8RE 1D1CA 5KYUA 1RAGB 1NK2P 3I56N 2CS7A 2K5CA 3AVKA 5M5XJ 1OH5A 1ZX6A 3ZMTA 4M7AA 3GDQA 3H1QA 3FEOA 1WX6A 1WH5A 2JUFA 4XM3A 1U84A 4F92B 3ZQIA 2F7TA 4OKJA 2DFIA 4HA8A 1RI9A 2IS4A 2KLOA 3BR1A 4E7SA 3ERED 3NVKA 2HOTA 1GV5A 1RACB 1S9GA 1IXCA 1WJDA 2LNHB 4Q5WA 4ON0A 2PYJA 3T1YK 3ULEA 1WHHA 2H3JA 3J7ZO 1KG6A 4BR9A 2MBFA 2EZLA 2HBJA 4FJJA 4W5NA 4G9YA 4BUPA 4A53A 1WCMJ 5B5EC 2W25A 2L54A 4A3GJ 1UGSB 5DEQA 1YT3A 1LFPA 1LAVA 1S5JA 4IRHA 3SAHA 3VENA 3KNTA 5DV5A 4YOXA 5HLTA 2QWMA 3CCUN 4JKFA 4N4NB 2DK5A 3C4SA 4FWKA 1LPQA 4HQEA 2JQ7A 2V8KA 4AHUA 3WODF 2FSWA 3WU0A 1G6NA 1MBKA 4AUXA 4JYKA 3JCUC 3OR1C 4L9VA 1ITYA 1BIUA 1XMKA 4KH1B 3ZT2A 3RR8A 2WB1N 5I22A 4DQQA 2LX7A 3F0CA 3EZ5A 2IT0A 5KYWB 3BPXA 3UKGA 4IZZA 2NUBA 2OJED 5DUIA 1YNZA 4JJNK 2NOBA 2X6WA 1HW5A 5GTIC 2G8UA 4M75B 2HHVA 3E9OA 4FLYA 4AMCA 4MGRA 5FFZA 4M7DD 3E9PA 4E7IA 2CZ0B 3KCCA 4CGDA 3Q9VA 1NK3P 2K40A 4I6ZA 4DU3A 3U3GA 3ME9A 1XI1A 2M0MA 1NJZA 1M1KR 3CO6C 1BI3A 2E88A 3ZETA 4K41A 4M74A 5FLXE 5BR8K 1JXBA 2HNDA 2A05A 4GY2B 4FK4A 3X24B 1I1GA 1Q7YC 2QW9A 5FD6A 3NBPA 5AJ3K 3LX7A 4XRMA 3MEVA 2RQVA 2O31A 3LDNA 4DFMA 1X3NA 5F0CA 3BZ6A 2DJZA 3JCMP 3DEUA 2PU9B 3KP3A 1KQSS 3O4WA 3DJCA 3QG1A 1N39A 2LDUA 2NS8A 3D5RC 2Y1JA 2B9SA 3LPTA 4HX8A 3ZT0A 3GTJJ 1VQ5A 3N4PA 2WTUA 4LF4K 2RJDA 2K5LA 3KLHA 2DE0X 5IYBJ 4X0GA 2L9SA 2GWJA 5I9EB 2BIVA 4XR6A 1U8RA 2QTVA 1R36A 5CKHA 3K9TA 2IVNA 3LP2A 1VRUA 3LP1A 4LH5A 3KVGA 2DXTA 3EHRA 4M6VA 2HFHA 2AQEA 1VIFA 1SVOA 5FJ8J 4A4HA 3NCIA 1HSTA 1LVAA 2ESNA 3IRRA 3AVGA 5GAHJ 2D5RA 3NF8A 3VSLA 3KEQA 5EEHA 4Z4CA 2EZIA 1KYWA 2OU2A 1JKQC 1XGOA 4I6MB 1TNSA 2K9SA 4QLCU 4KIBA 4LNPA 4DTMA 4ESRA 4R5PA 4EW0A 1K1ZA 1N6AA 3HTRA 1JKHA 2OZSA 2HW3A 3R0AA 4B23A 1XGNA 2JA5J 3X2QH 2Y75A 3TGNA 3KHYA 1VQNQ 1N75A 5FLXK 4RBOA 2XD0A 1IB8A 5C4JJ 2UWMA 4B44A 2EX3A 1XTDA 3GW2A 4J7IA 1KVAA 3MZYA 3WUHA 1S6LA 4DOZA 2DD5A 2QQBA 2A3ZA 3LAKA 3QIPA 4UNFA 1WSFA 1YJNN 1WUAA 3K4BA 1GLAG 4CUGA 3H3VK 3KLNA 1IBKK 2FBYA 3OYCA 4JV5K 1VYVA 3WXIA 4OF1A 2HBWA 1MBHA 3J81O 3E97A 3TP0A 1NEBA 4BQOA 1R49A 3A8HB 1IGUA 2JM9A 4C8QE 2NRVA 2QWWA 4YNQA 2VWBA 4HAMA 1UG0A 4ZYAA 4CJQA 2X1DA 3SYTA 2PBDA 1T38A 4M9XA 1N25A 5IT9O 4DBRA 2GXAA 3DM2A 3UKRA 4KJZA 2VBXA 5CVRA 2Z1JA 2W04A 4WF2A 1LUJB 2VWKA 4IURA 4MZMA 3CM5A 3AVLA 5KRSA 2O4IA 1Q1HA 3CJ9A 1WSEA 2VL8A 2R7SA 5DS9A 3GFMA 2JZYA 4B8XA 1J2XA 3HJFA 3R6MA 3CLOA 4FJIA 1XCVA 4ZZLA 4JS5A 3GIBA 3T1HK 4XN3A 5LMNK 2DT7B 2BGGA 5K7HA 1D9DA 2E36A 3OSSC 3AG1H 3CC4A 4DEYA 1N3AA 1I4K1 5FU7B 2DA3A 5M1KA 3QESA 2Q2EA 1UHSA 3J7AO 1XQHA 2YUQA 2OQGA 3HL2A 1LB2A 3SWNB 3HOYJ 2XRLA 2FSKA 2P5LC 2L4AA 1SMTA 1QQJA 1X1CA 4OU0A 3WXLA 4O6JA 1KGSA 1LV5A 4I09A 4DK9A 3QWXX 4IZ9A 4JP0A 2FU4A 4CFBA 3CC4N 1ACMB 4WWCA 1ATNA 3OSFA 3CPWM 3A01B 1QWEA 1M90O 3W2AA 3C2GA 1F4KA 2G0EA 5CIUA 1D9FA 2DLLA 3FDYA 4HG2A 2EBIA 2BH1A 1T95A 3F9MA 3DV8A 2VXFA 3NFAA 3BG9A 1Y1VJ 2QAZA 1GUUA 1U49A 5TGTA 3DLRA 5KPRA 2AHJB 4AILC 1HXDA 5BPDA 1KG3A 2QBYA 3SK3A 2DVJA 2KW4A 1HR0K 2PVGB 1WHGA 4PLLA 1KC8R 1NK6A 4RB1A 5HS9A 1VQ4N 1P7MA 2HVQA 4UC4A 2O3FA 2DCEA 4JX4A 2VUMJ 2EWSA 3LDQA 4JDSA 2HDWA 2ECCA 2BZTA 4EJUA 3DPTA 1T7PA 2EJ9A 2HKXA 3O9UA 1SRMA 2EYQA 5KYYB 2C06A 4FWQA 1K0XA 1XDSA 3V7CA 1RBSA 3OWTA 4CCNA 1MA9B 1NK4A 4LFAK 3ZQHA 1BJZA 3V9WA 3VWBA 4QQ6A 2CH0A 1IO6A 2ZPFB 3D6RA 1VQPA 3CCMT 3BPVA 5M5YJ 4MO5A 4FOEA 3CCMI 1XGMA 5BQTA 2KDSA 2D1KA 1D8JA 2MD5A 3RMCA