3S3NA

Crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/inhibitor/dna
molecule keywords PFV integrase
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3nA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3nA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3nA03
5HRNA 4F4KA 4B8CA 4E89A 4M3UA 1T03A 1FKOA 2WONA 3AO3A 1NK8A 1JLEA 4NYNA 4CHNA 4O55A 4CEBA 1YT3A 1YVUA 1JLBA 3EAEA 3LANA 3LP3A 4KTZA 3OJSA 3DLKA 4KHSA 4FJJA 4FM0A 3KKRA 2JZ2A 2PQWA 1RDBA 3DMJA 4ZHRA 3AVJA 2WOMA 4GW6A 5T7BA 1EETA 5C24A 4FJGA 1NK6A 3QEVA 2HVHA 5KRSA 1C0UA 4E1MA 1MHNA 3DLMA 1N27A 2YNIA 1QSYA 1IH7A 4O0JA 1U49A 4E19A 3CEYA 2L89A 5M9OA 3HYFA 1RTDA 1RDCA 4DLEA 5D6WA 3DI6A 3DOKA 1TK5A 1WJQA 4E0DA 3OS2A 3QNNA 4B9TA 4IG3A 4C5IA 3ZT3A 2QQRA 1VRUA 1VSLA 1J54A 1JLAA 1S1WA 1LWCA 3QEWA 1VSFA 1S1TA 3CFPA 3DYAA 4HUEA 4YNQA 1U47A 4CK3A 2X6NA 1JLCA 4NCGA 3K57A 1XI1A 1K6YA 4CERA 1UA1A 2OYQA 3DLEA 4M3WA 4AH9A 4H8KA 3HM9A 5D3GA 3I0RA 1VSIA 3MAQA 3IS9A 2G8IA 3VQQA 3AVBA 3PX4A 4KAZA 4UC4A 3NHGA 4DTUA 2YV0X 4FYDA 3PUFA 3KIOA 2B5JA 4M3YA 4FLYA 4IUVA 3META 1HMVA 1QE1A 4OKKA 3VQEA 4BDPA 4ELTA 4KHNA 4CEFA 4CF9A 4DFMA 3HK2A 1EKEA 1ASWA 4HHTA 4HUFA 3OYMA 3OS1A 4FLZA 3PY8A 3MEAA 5FROA 4BDZA 3ME9A 1JXEA 3MEEA 1DLOA 2HNDA 3M8SA 2EKOA 4B9VA 4DQIA 3AO5A 4Z4FA 2RHYA 3SJJA 4NS5A 3NAEA 2EQKA 1ITGA 4RW8A 1A5WA 3OYKA 3FC3A 3E9FA 3VQBA 3ZSRA 4H4MA 1S5JA 4AHTA 3LWLA 1J5OA 2OZMA 1Q9XA 4RW7A 4E7IA 3LAKA 4KPYA 1ZBHA 4LSLA 1S9EA 4CFCA 1JL2A 2BE2A 2NUBA 3NCIA 2XY8A 4N4IA 3O3HA 4QQDA 3AA4A 2PZSA 1VRTA 4F3OA 2KTQA 2X74A 4OKEA 3KLHA 4Y1CA 4KB1A 5CZ1A 3MECA 4KKOA 3LZIA 2QKKA 4FJNA 3BDPA 3DRPA 1EXQA 2P5GA 4FJ8A 2RKIA 5KI6A 4DF8A 1SKWA 3TAQA 3OYLA 1BGXT 1HQEA 2BANA 5J1EA 3M8RA 3VQ9A 5SZTA 4L8RB 2G8UA 4E7KA 2HQEA 3VN5A 3PO4A 4FW2A 3LX7A 2X78A 1HYVA 4Z4HA 2M0OA 3KD1E 3L8BA 1LWEA 2FBYA 3DB4A 1WSIA 1WAFA 4CF0A 3TWHA 3HJFA 1VSMA 2D0CA 3DB3A 5JS2A 3DRSA 2Z1IA 4RG8A 1BCOA 4FJ9A 1WSHA 3PX6A 3B6OA 1EX4A 2OPRA 3WNFA 1NK0A 4B9MA 2Y1JA 1NK9A 1BL3A 2G8WA 2KW4A 3OYAA 2X4WA 5J39A 2E4LA 3P8HA 3HT3A 4JRQA 4HTUA 4DMNA 5C6SA 1HNVA 1RBSA 2GBZA 1XHXA 1LWFA 4B3OA 2G8HA 1SUQA 4FU6A 1LW2A 3SV4A 4E7HA 3FLGA 3LZJA 4N56A 4FJ7A 1BHLA 1S6QA 3K5LA 4DTMA 3ZT1A 3RMBA 4DSLA 4OPKA 3WNEA 1C0TA 3Q1JA 1WSEA 3LAMA 3C95A 1ZBLA 1FK9A 1N5YA 1C1CA 2RJFA 3QIIA 3ZEHA 4LY7A 3ISNC 4QW2A 4DLGA 2PYJA 5KH6A 2LDMA 4Z4EA 3VQPA 1NKEA 2RI2A 4LH4A 2R5MA 1S1UA 1X9WA 5JS1A 4NZGA 1RT3A 3AVFA 4DU1A 2F8SA 1L5UA 1A5XA 2E5QA 2O4XB 3PX0A 4KREA 4EZ6A 4CIEA 4EP5A 2VG6A 4KHQA 3SPYA 4C5EA 1S9GA 4PQUA 1HJRA 1SKSA 2VG5A 1CLQA 1WGSA 3LH0A 4PLIA 5C0MA 2EHGA 3V81A 3OQ5A 3SD4A 4OJRA 3KK3A 2IAJA 3K59A 3S6WA 1BCMA 1HPZA 3RMCA 5HRPA 3MP1A 2YHBA 4DTRA 4K8XA 4CJTA 4CJKA 3SZ2A 4NYFA 4JS5A 1SSFA 3LWMA 3QETA 1JLQA 3CG7A 1QQCA 1RCHA 1TKDA 4CCHA 3T19A 4DU3A 3MP8A 4DQRA 3TABA 1SL0A 4LSNA 4J2BA 2KQ2A 1DTQA 2RO0A 1NKBA 4CFBA 2YNHA 2PY5A 3BGRA 3OYGA 4FJXA 3L2VA 5EU7A 3WNGA 5CZ2A 5KCHA 3GOXA 3QBYA 4OKJA 2BDPA 2ETJA 4O0IA 3T3FA 3O3FA 2A1RA 4B9WA 3NBPA 4M3XA 3AA3A 4B9XA 1ZBFA 5KE2A 3PMIA 1U04A 3DLHA 3QKJA 4JRPA 4GVMA 5HLFA 4YFUA 4CEOA 5IAYA 3OYFA 2DFFA 4IUQA 3V6DA 3VQAA 4FJMA 4M3TA 3VA3A 2IOCA 2X4XA 2OPQA 3K5NA 3ZSVA 3TANA 4CJSA 3CFOA 5J2MA 1L3SA 4HCZA 3VA0A 3VQDA 1QSLA 5I3UA 3VQ4A 4W5OA 1IKWA 5J26A 1U45A 3VQ5A 4B9UA 2EFIA 2EQJA 4K8ZA 1LV5A 1G15A 1D8YA 4HCBA 1LW0A 3ZT2A 4DFJA 1SV5A 4QAGA 5HRSA 2YRVA 4CIFA 2A1SA 4MFBA 3V1OA 3HP9A 4BWJA 2G8KA 2F96A 3HO1A 5I42A 2FC0A 3V4IA 1BISA 3OMCA 3AV9A 3QNOA 3S9HA 1YTUA 1OZ2A 3NH0A 3SYZA 4E7LA 4QQGA 3LPUA 2O4GA 1XHZA 2QKBA 2Q3SA 1IO2A 4AILC 1TVRA 4R5PA 1WJSA 4KV8A 4MQ3A 3CM6A 2LCCA 2JLEA 2P0KA 4J2AA 4M45A 4F8RA 4CGGA 5KRTA 3DLBA 3ZCMA 3ZSYA 2RHIA 4KHUA 4X34A 2G8FA 3MO8A 1UA0A 1HYZA 2FHDA 1KHCA 4CFDA 3E01A 3QEIA 4RW6A 1D9FA 3V1RA 4F2RA 3O4QA 2X6SA 3AVGA 3IRXA 4CJLA 2DIGA 1RT6A 3ZSOA 1Z26A 4DFKA 4I7FA 4A4GA 1IKXA 3MP6A 1KTQA 3AVIA 5CY4A 4C8NA 2EX3A 4IURA 1JLFA 4IKFA 3SUNA 3M9QA 3UWNA 1GOCA 3MEGA 1L3VA 1GOBA 3AVLA 3WNHA 4CECA 3DOLA 3IG1A 4C5HA 3VQ7A 2O4XA 1BQMA 3MXIA 1H3ZA 1QS4A 4DTJA 1TGOA 5D6YA 2E6MA 3OYBA 3SQ1A 3V9SA 1ZBUA 3ZSXA 4N41A 3S3NA 3F73A 4G1QA 3O3GA 3ALYA 1KRPA 1BIUA 4I9LA 2YNGA 2KFZA 3L2QA 2D9TA 1TK8A 4DU4A 4Q5VA 1DTTA 2Z1HA 3NFAA 3NTHA 2DFEA 3TAMA 1HYSA 2P51A 3NGYA 2M16A 4M41A 4LH5A 4O44A 3TR8A 4IUUA 4FK2A 1TV6A 3L3VA 1WLJA 3HVRA 4TSXA 4CJ3A 1X1PA 4IFVA 1KVAA 4CEZA 4N47A 2X35A 5CIUA 2LSNA 4CEDA 4BDYA 1OYXA 1RILA 5D6XA 1Z25A 4CHQA 3QJ6A 1RT1A 1S1VA 3V1QA 2R7YA 2XK0A 3SPZA 2B4JA 3OYIA 3HPOA 1ASVA 3HP6A 4AHUA 2XDPA 4FVMA 3KJVA 3C6UA 4M3RA 3KLEA 2D5RA 1XWLA 5K14A 3PMTA 3TAGA 2HNZA 3QEPA 4ELUA 5KCOA 3JYTA 3LP0A 2L3RA 2B8AA 1KCFA 3AO2A 3BDLA 1T8EA 1FKPA 4Z02A 2ZD1A 3LDSA 4LD0A 2GFAA 4W5QA 1ZBIA 2ZQBA 4C8MA 3TAFA 3UIQA 4KRFA 1RT5A 2JGUA 4Q0BA 2Z1JA 5CYMA 2IC3A 3QO9A 4KTWA 4UQGA 1RTJA 4CEAA 4M42A 4FZXC 2EQMA 3HVTA 3O8VA 3KLIA 3QESA 3QIOA 2IDOA 3H8ZA 1XC9A 4DTNA 5KGWA 1FXXA 1ZYQA 2LTOA 1HNIA 4RW4A 1RBTA 1ASUA 2JTFA 3CYMA 1RTHA 1MU2A 3P5JA 2E6LA 2Y1IA 2DAQA 3MXMA 3OYDA 2E6NA 4CEEA 1X9MA 1KVBA 3L2UA 1HQUA 4CGHA 2LVMA 2WACA 4DQQA 4DS5A 3RTVA 2HB5A 4CEQA 4CF2A 2P1JA 1C6VA 1D9DA 2HNYA 4DTXA 4A4FA 2G8VA 3FEOA 4C8OA 3LGLA 1X9SA 1NKCA 2YHAA 2VG7A 3KUFA 3LPTA 4JLHA 4DWIA 1KLMA 2FBXA 3AVCA 1HRHA 5HBMA 3VQ6A 2VYTA 3NE6A 1N6QA 4KHWA 4Z4GA 2PYLA 1LAVA 4OLAA 4BE1A 3C94A 3NF8A 3SUPA 2DIQA 1BI4B 3OMGA 1WNSA 3OYJA 4L59A 3NH1A 4CJQA 4DFPA 4BE0A 3RRHA 2XY5A 3AVAA 4QCLA 2GFUA 1KSPA 3ZT0A 4CRIA 1WJRA 4RG2A 4FLXA 1YTAA 3RR7A 4FL6A 1C0MA 4PLLA 2HVIA 5FRNA 2RJDA 4N4GA 3OYCA 4AHCA 2B6AA 4CGIA 3V9XA 4DSJA 4EZ9A 3AA5X 1VSKA 1QHTA 2RPIA 2X4YA 1L3TA 5DMRA 3VQCA 2K3YA 3S3MA 4OPJA 4CGDA 3EYZA 3RWUA 2IS3A 4WE1A 4FLTA 4C8LA 1NOYA 1BIZA 4CK2A 3L3UA 1REVA 5KTQA 4C5GA 3AVNA 3EZ5A 4KI6A 2HHWA 3FDRA 2K3XA 1WSJA 3SCXA 3TARA 3F9KA 3P1GA 4QVZA 3B6PA 2RF2A 4IG0A 2OZSA 1R0AA 3I0SA 3O4NA 4FJLA 1B9DA 2I5JA 1KLNA 1JKHA 3HPGA 3KK1A 3LP1A 4W5RA 1W9HA 3TAEA 4F2SA 4IDKA 3C6TA 2GUIA 5HRRA 4CJEA 4DSFA 3SQ2A 2VWJA 3AO4A 3CFRA 4KO0A 1S6PA 1UWBA 1TL3A 4FLVA 4E3SA 1B92A 4CJFA 2F8TA 1G5VA 1RTIA 3G10A 3NF9A 4PL6A 3QLHA 1QTMA 4FW1A 1NJZA 1SL1A 1UOCA 4OLBA 2HQXA 4ID5A 2RHXA 4Z4CA 4E1NA 4I2QA 3EY1A 1NK7A 4DSKA 3T1AA 4FK4A 5HP1A 2BGGA 3V9UA 3L2WA 2L8DA 1L3UA 3SNNA 1U4BA 4JS4A 1I3AA 1TKTA 1OZ3A 3QERA 1RI0A 1RT2A 1WSGA 3FFIA 2KZZA 2DY4A 2G3RA 1VK0A 3H08A 1RDAA 3HXMA 4CHPA 3MEDA 2BKDN 5CYQA 1BQNA 4DTPA 2P5OA 4OVAA 4FM1A 1O1WA 1RDDA 3NDKA 4Z0UA 4AHSA 2NLUA 4A4EA 2HMIA 4BWMA 3H6ZA 4M3ZA 2OPPA 3HL8A 5FDLA 1UAXA 1VSHA 2R58A 1Q9YA 3MXJA 1TKXA 4CF1A 3M8QA 4AHRA 4CGJA 4OGEA 3DM2A 3NGZA 4DSEA 1VSJA 3PV8A 4DSIA 2ITGA 4CF8A 4FZZA 4GY5A 1SL2A 3DRRA 2XRIA 4EDUA 2Z1GA 2O4IA 1CZ9A 4IUPA 1CXUA 5IN1A 3K5OA 1KFSA 4NCBA 1B9FA 3ASMA 3UT1A 3SUQA 4BACA 3P83D 1TK0A 2HW3A 4O5BA 4CESA 3NNQA 2HHUA 3KD5E 1JL1A 4B9NA 1KFDA 4OVLA 2YKNA 2M1HA 2QXFA 3CM5A 2GF7A 3VQ8A 2F5KA 4CJUA 4CJVA 1NK5A 2MWPA 3A2FA 4KFBA 4CJ5A 3AVKA 4HUGA 4IUTA 2HHTA 4B8AB 4CJWA 3LGFA 3OYNA 1C1BA 4ICLA 3L42A 4FM2A 2MWOA 3NGIA 1C1AA 2HHXA 4DTOA 3HPHA 4N5SA 3SV3A 2DFHA 3KKSA 1RT7A 1NJXA 3OB9A 3SUOA 1NK4A 4CHOA 2OA8A 3QEXA 4NCAA 1IG9A 4PUOA 3K2PA 1Q8IA 4ID1A 1U48A 3U3YA 1RBUA 1XNIA 3QIPA 3KTQA 2XO7A 2HHSA 4C8KA 3ASKA 3K58A 4FK0A 4CHYA 4B9SA 4I2PA 4J2EA 2QK9A 4F3TA 2RI5A 3KK2A 3TI0A 2DTUA 4CK1A 3TAPA 1NOZA 4LD6A 4FLUA 2HHQA 2IGIA 1Y97A 2FBVA 3KLFA 4DF4A 5J2NA 2D0BA 4HVJA 3RMAA 1QSSA 1BI4A 3LLRA 4FXDA 2KFNA 4H4OA 3KLGA 4CJRA 2RJEA 3ITHA 3LALA 3ZSZA 5C42A 1LAWA 3I8DA 3ULDA 1IKVA 2QQSA 1RBVA 4XIUA 2HHVA 4N76A 5KGXA 1TL1A 4DTSA 2XY6A 4PY5A 3NF6A 3V9WA 1IKYA 4DQSA 3AVMA 3PNWC 5J2PA 3M8PA 3U3GA 1WAJA 1W0HA 2RHZA 4IFYA 3C4SA 1A5VA 1JLGA 2EQUA 4CJ4A 4FCYA 4ZTFA 1F21A 3F70A 4FLWA 3SI6A 4II1A 4J2DA 3P8DA 4Z4IA 1TAUA 1VSDA 3SQ4A 4E7JA 2XHBA 2BIVA 5HROA 1VSEA 4I9QA 3K5MA 4EP4A 1J53A 4B08A 3THVA 2RJCA 2R57A 3QINA 3CQ8A 2BUDA 1NJWA 1KVCA 3OYEA 1JXBA 2RN2A 4B9LA 3LP2A 4Q5WA 3LYIA 3IAYA 2VWKA 2ZE2A 1CZBA 4BE2A 1CXQA 1D5AA 5J2QA 3ZSQA 4W5NA 2RI3A 3MEWA 2FBTA 3RRGA 5DK5A 4A4HA 4FJHA 1I39A 1WSFA 1TKZA 2YKMA 4OGCA 4ELVA 4Y1DA 4FJKA 3AO1A 2LRQA 3S3OA 4CGFA 5SWMA 4KB0A 4DG1A 2GV9A 1RBRA 5FRMA 4CIGA 3V9ZA 4N4HA 2D0AA 4CHZA 5KE3A 4GMJB 1GOAA 2RHUA 4FJIA 1NJYA 2OPSA 4PA1A 2W42A 3PO5A 1OI1A 3HSTB 3RMDA 3NF7A 4QOZB 3OS0A 3NH2A 3OA6A 4BD3A 1T7PA 2IG0A 2ATQA 3OJUA 2AJQA 4HCCA 4QQ6A 1TAQA 3U6FA 3PFSA 3ZSWA 3MEUA 3DLRA 1SKRA 3MEVA 3SQ0A 4ZTJA 4CFAA 3NTKA 4IBNA 4RW9A 3AVHA 3RR8A 4DQPA 3L2RA 4PWDA 3DLGA 3ZT4A 1RNHA 4W5TA 3D0PA 3NTIA 4KI4A 4DS4A 1WN7A 2R5AA 3OY9A 4O4GA 4AHVA 2CKKA 1J9AA 3AA2A 1EP4A 3D45A 1RT4A 2YNFA 3G0ZA 5C25A 3E9GA 1S1XA 4CE9A 1T05A 4FJ5A 3OYHA 4KHYA 4KTQA 4FZYA 2KZMA 3OVNA 2XY7A 5E41A 3JSMA 4CJPA
chains in the Genus database with same CATH superfamily
3CO7C 2YU9J 4Y17A 4KFCA 1QWFA 1QKXA 4CHNA 2B9SA 4KTZA 4BRFA 1OR7C 5GAN8 3HB9A 1RDBA 2K6DA 4HF1A 1SF9A 3LSIA 3TTDA 4OMYA 2LF8A 5I2SA 4LUDA 2CFOA 2L9NA 2BY1A 4MMKA 2OZUA 2DK5A 4IG3A 2HOSA 4YTLA 1M3BA 3QWLA 2ICWG 2QBYB 1K0XA 4YNQA 3DLEA 1MNEA 2V52B 4PHTX 4X9DA 3VGLA 1RRQA 2E19A 4J9EA 4XU2A 3PUFA 4XTWA 3RTRA 2MABA 4M78E 4IHTA 5EX5A 1VQKN 1TL8A 1YIJT 3VYRB 4BDZA 2OTJI 2VBWA 1JXEA 3IH4A 3LDLA 3MEEA 5D4SA 3NAEA 1GLDG 1CQTA 3BF3A 4GCVA 4FPBA 3P7NA 3ZSRA 4JP0A 2CQXA 4LIVA 5BPDA 2NUBA 3AFHA 3O3HA 4QQDA 2KTQA 3LA3A 1R5ID 1PD0A 1KC8U 2V8IA 3H36A 2G8UA 2DA5A 1U84A 2W0ZA 2RREA 1R7JA 1V4RA 2O61A 2MC3A 2ELHA 2JPBA 3BLYA 5E3LA 1X3NA 2VXFA 5J39A 2DMQA 4N56A 3RMBA 2NS8A 2RK1A 1VQ9I 1TSFA 4AFSC 2O7OA 4LY7A 3CWAA 4BRCA 2O8EA 3J7YJ 3E6BA 4H5RA 1YHQQ 2M1BA 3BF1A 3VETA 2R0QC 2NRZA 1G4DA 3TEEA 3OQ5A 3SD4A 3K59A 2L9VA 2CQ7A 3U8XA 3QETA 3CG7A 3A0IX 1IZ1A 2OTLI 4KA4A 1FIAA 2ISYA 2UV1A 1J9IA 5K5RA 2PMHA 5ICFA 1RUNA 4M77C 1ZG5A 2OPQA 3FXMA 3FXJA 2IGOA 4M7DC 3MAJA 1U5TA 3VA0A 5I3UA 3VQ4A 1U45A 2K3FA 4K8ZA 2DBBA 2M30A 2IVNA 1U9OA 1ZLJA 5E20A 2F96A 2EJRA 1VQKT 3AV9A 3FGUA 3HG9A 3MZHA 3M0QA 2Y30A 3G3ZA 2HTJA 3I4MJ 2W04A 2VC1A 4ZYGA 2QKBA 1JJ2S 1KU3A 2C0OA 3WE2A 2BTTA 2YHTA 1HYZA 3SEQA 2LQ8A 4CZCA 1VQMI 1G2BA 1QLYA 2RV8A 4IKFA 4WWCA 1GOBA 3F2KA 1PSEA 1W0TA 4N9HA 2ELJA 2HYGD 2JK3A 1ARKA 1ZBUA 3O5BA 2J4RA 3G73A 2D9TA 1Y0NA 4M3EA 4NBQA 1TNSA 2M16A 2I5WA 2GIVA 3WGGA 2QG9B 5M5YJ 4AIDA 5DLQE 1AWXA 5LJVA 1QA6A 1KG5A 5HCKA 3X25B 3V1QA 2JTMA 3HP6A 3F72A 2V4JC 3PMTA 4MEXF 5CKHA 4G6DA 5LJ3j 4W5QA 1ZBIA 2ZM6K 5AQVA 1E3HA 4IWVA 2FNAA 4JBAA 3JB9H 4JKFA 3KLIA 3ZQCA 1QRYA 1PVEA 1HNIA 2LQNA 1QPIA 1VQMN 3OYDA 4EJOA 1VZ0A 1JJ2P 3CCLQ 2OAZA 2KXDA 2HB5A 1U2VA 4BRQA 3P9KA 1NKCA 5CCAA 4F04B 2VYTA 2PYLA 1IGQA 1AEYA 3VKIA 3OW2M 4BREA 1IZ6A 4EMKB 1O4XA 1KSPA 5DS9A 5DYMA 5LJ3d 4FLXA 1YTAA 5JLFA 4PLLA 3BFMA 3DFGA 4LF9K 2FQ3A 2ZNYA 4OPJA 2CMPA 1ABOA 3TGNA 3BY6A 4PSWA 3LA2A 3RSEA 5LJ5j 2LJ3A 5J1YA 2ESHA 3FX3A 1TQPA 4F3QA 1FYKA 3VJPA 1U1TA 1TYQA 1JXMA 4B24A 1EJ9A 4FLVA 4YY3K 4JV5K 4BEHB 1WXUA 3H9QA 3CHWA 3MZYA 1IRXA 4FPAA 3FFIA 1RPWA 1MJBA 2WAQA 3H08A 1J75A 5TISC 3DTIA 2VN2A 2NNYA 3CCSQ 2ZNZA 1IN7A 2CP3A 5DM6F 1W7AA 5ICEA 2FE3A 4FZZA 2IPQX 2O9VA 3P83D 4IQJA 3EG0A 3GLXA 3VQ8A 1V5EA 1NK5A 2HHXA 1NK4A 2DVEA 2A36A 1Q8IA 3U3YA 3UA7A 3K4KA 4F3TA 3Q9VA 3ULQB 3TI0A 2KIFA 5CQEA 4V2SA 1QSSA 5GAOl 5AYFA 3KLGA 2W25A 2GQQA 4V2GA 1VQOI 4F7UE 4RMNA 3CCMA 1QZYA 1BIBA 4FLWA 2XHIA 2FF6A 3P8DA 4Z4IA 5LJ5d 3KZBA 1SG5A 4AIAA 3KWIA 5AQWA 2NVQJ 3LP2A 2JQ7A 4N0AA 2FBTA 3VF4A 5DK5A 4JI8K 4FYWB 3NAUA 1ZSZC 4FJIA 1RAIB 1NJYA 4AM7A 4TVRA 2L7MP 2IG0A 2KE9A 3BR2A 1RNHA 2VCPA 3QYHB 2GBQA 2LD5A 2NLXA 1BOAA 4RTYA 2P7CB 3OYHA 4WQ4C 3WQTA 4LFCK 1JHHA 3EAEA 4KYWA 1IUFA 4HLXA 1RZ4A 1HDPA 3ERMA 4A3DJ 4IIMA 2BW3B 2ELKA 1BI0A 2KQWA 3AGKA 1VQMA 3G4SN 2JPSA 3GPLA 3FE1A 2VJJA 3S32A 5HDKA 2PVDB 1S1WA 3HC7A 4JI2K 5HY6A 4CERA 3EFOA 1YLFA 1S1NA 3S17J 3IS9A 4KAZA 2CH6A 1ZH5A 1VNDA 4M3YA 2PBIA 5KYXB 1BOTO 4BXFA 2KMUA 3ZMUA 2ZPIB 4QTRA 1Z91A 1VQOT 3HDDA 4AM6A 4D7NA 2W48A 2DVJA 3NWTA 2DTOA 2CGPA 1D5VA 1UG2A 1TW3A 4E7IA 4JRIA 2HBMA 5JR3A 4OKEA 1A36A 2ID3A 2RKIA 1N39A 3F23A 5GANf 3VQ9A 3DPTA 1LUJB 3BDDA 1KC8C 2MF2A 1ULYA 2PFBA 5HL7L 1VSMA 2D0CA 3WG7H 4XOTA 5JS2A 4JEPA 2ISZA 1C0WA 2DOAA 4RTXA 1S72A 4JRQA 1OFCX 2H1KA 3QZ5B 1LW2A 4E7HA 3FLGA 4A3LJ 2XROA 2F8TA 1EH8A 1C1CA 1W7PD 4DIQA 4Q4ZF 2Y90A 4DJAA 2RI2A 4M3DA 1RT3A 2SEMA 3SAFA 2K4BA 1A5XA 3HOTA 4EP5A 4MDAA 4IOCF 1OISA 2Q0UA 3SWNA 5C44J 4LDUA 1ZA1B 5C0MA 2XICA 1HD3A 2IAJA 3T9NA 2RNAA 1Q1VA 2V1UA 2XASA 1NGAA 4HVVA 2KROA 3IRQA 1K8AC 4FSVA 2KRNA 2I2LA 1EV7A 3T3FA 1NBEB 4AG1C 4J7IA 3HOUJ 1S3JA 1PU7A 3V7RA 4IUQA 1A6QA 4XONA 4XTYA 4RS8A 5KAIC 1L3SA 2LX7A 3QJYA 3FISA 3PM1A 2VOPA 4LFAK 3S2HJ 3ELKA 5FKKA 1N9SA 4PFZA 2Q2EB 3R8EA 1R0BG 1IBMK 5K1YA 3VYTB 3GTGJ 1RACB 1B9MA 1HBXG 1X9JA 2J6KA 4RGRA 3DLBA 4Y15A 1AHJB 1XCBA 4X34A 1KFZA 1ETOA 2BBYA 3ZQ7A 2DIGA 3L0QA 5IT9Z 1BYMA 1SD5A 3GOIA 3UKUB 1N6AA 3MP6A 2EX3A 3IWFA 2R7SA 3VQ7A 3H3NO 2O31A 2YUSA 1BU1A 3LFKA 2COWA 2LKXA 3ABUA 3SAGA 1YS7A 3JB9D 1QVUA 4I09A 3AL0B 2Q8KA 3R0AA 3KP7A 3NFAA 2IGMA 1KJWA 4O44A 4RM2A 2JHJA 5GAOq 3C0CA 4KMFA 3CPWP 4PNOA 1F4KA 4EV0A 5M1NA 2UUCK 1ATRA 3OYIA 1E17A 3KJVA 4H4KC 2NXNB 2EGCA 1KD1C 4UB6C 4N0AC 2K5CA 4XIDA 2ZD1A 4J9FA 2CZ7B 2HMAA 1UECA 3I8BA 3TAFA 2COZA 1M1FA 4GXOA 2E36A 1KIKA 2EYZA 3VRZA 5BN8A 4E9GA 1H9TA 1TZLA 3W2WA 1YRNB 3KUFA 1RDUA 5HBMA 1LJ9A 3TO7A 1LMZA 3TSZA 3REBB 2EFPA 4L59A 3RRHA 3EUHA 2E1MB 3GUDA 5CVRA 3VEOA 4CGIA 2X4YA 1L3TA 1FYNA 1G6NA 3VYSB 4X1EA 2ROTA 2IS3A 9ANTA 5CQYA 2O8EB 2FG0A 4C5GA 3AVNA 2MLKA 1PU8A 5KAFC 3I0SA 3RPUD 2W4SA 1TG0A 2DNUA 4M9SA 2PBDA 2LRDA 5GPAA 3N05A 1M3CA 3PFYA 4PGHA 3QLHA 4FW1A 1SL1A 3EYIA 3I71A 4Z4CA 1XB4A 4I2QA 3CCMN 1MDMA 3TOAA 4CXFA 2F1LA 1M90C 1RDAA 3K4MA 1ZK8A 1YQRA 1RAGB 1YHQT 2Y4XA 1IXRC 5FKOA 1M2VB 2DBMA 4L3QA 5FDLA 2WTEA 3IUOA 3CJCA 3OL3A 2HDAA 1MJAA 2GXAA 2O4IA 4IUPA 2DRMA 3A8MB 3ASMA 2HW3A 4AIJA 3K70C 3LNQA 2YR2A 3L4QA 2MPXC 2L0AA 4MMLA 5HLHA 3A2FA 3AVKA 4B3AA 2HHTA 2HZYA 3R6SA 3NGIA 4G8XA 4N5SA 3CJNA 4EMHA 3QEXA 2ECZA 2OJ2A 1WBBA 1B07A 4BY1J 2V1QA 1YUWA 4C8KA 4YIRX 2QK9A 3LOCA 1XG7A 4LJZF 4DF4A 3CCMT 4FXDA 1OU8A 3LALA 4FT4A 4G7ZF 2E5ZA 4CC4B 3V9WA 2QF7A 2ZXHA 4H0EA 3JRHA 4B3XA 1A5VA 2EQUA 2DPDA 4M7AE 2B0LA 3QB0A 5H1SQ 1NJWA 2O9LA 2BUDA 2MAMA 1KVCA 1Y6IA 2DA6A 1N75A 3SJMA 3QYBA 1VQ6A 2H8HA 3RRGA 2JTEA 4K11A 3IKVA 1AKHA 5GMKl 2EZHA 4HSBA 2FBHA 3HSBA 1IV6A 2FEZA 3OS0A 2L4AA 5DUIA 1T7PA 1NLVA 3UE5A 2BZXA 2XI9A 2E35A 4RW9A 3AVHA 1T3LA 1X2NA 3ZT4A 4KI4A 1KYZA 4JKEA 1TUYA 3JSMA 3D2EB 1BL0A 3HXLA 3THXB 1QKWA 4WTOB 4KHSA 1FBSA 1MD0A 4CCLA 3F3XA 1QVPA 5C24A 5L3FA 4BRGA 4W97A 1AVZC 1W36C 3TOBA 3JSOA 5HS8A 3MWPA 4QT7A 3CEYA 4DV5K 4BC4A 5B8HA 4HF2A 2M9UA 5JHUA 4XNFA 3FXQA 3N5NX 3QNNA 4JJBA 5HDNA 2E1YA 1XGNA 5BS6A 3AKZA 4JKCA 4IHSA 1M1KC 3GYHX 1M30A 2DK8A 5MLCQ 1WPYA 4UNOA 3TCJA 1BI2A 1R22A 2FZCB 3HSFA 4DK9A 3OYMA 1CKBA 2COYA 3PY8A 2CQNA 2CS7A 2KZVA 3ROUA 3SJJA 3ABLH 4WXDA 1E4FT 4KPYA 3LAKA 2YX4A 1FMWA 3NCIA 3JTHA 2FXAA 1ZQ3P 2GTOA 3LL7A 3W6VA 2DT5A 2H3JA 3I3LA 4KKOA 5IXFA 3GEZA 1TWCJ 5SZTA 4C8QG 2JS0A 3OOUA 4AFQC 2HQEA 1NMDA 4A12A 1HYVA 5E1ZB 1OH6A 2HBPA 1QZZA 2DILA 4RG8A 3HYIA 2I0NA 2G8WA 3OYAA 1RR8C 2EKHA 2GBZA 1TT0A 2G8HA 2K2VA 1KG6A 1BA5A 1ETQA 1VQ4Q 3C95A 3CUQA 3KX2A 4V2FA 3ZEHA 3DQVC 3THYB 1R23A 3EG9A 3NHNA 3I35A 2LK2A 4JLGA 2F6CA 2K9GA 4RCBA 2G0EA 2X4JA 2GX9A 1ZSZA 1VQNI 2DA1A 4BJTA 4K25A 1UFMA 2DLLA 2CU7A 4DBFA 3CTAA 1Z1DA 1AWCA 1J09A 4DBHA 1PUEE 2ATCB 1SSFA 3T19A 4IHVA 4DQRA 4LSNA 5BPNA 1KYWA 2A08A 2TCTA 5KCHA 3GOXA 2E5KA 2ETJA 2KHMA 2RF0A 3PMIA 1U04A 3OGDA 3DLHA 4QKUA 4YHHK 2KZGA 3WTUC 4FJMA 2DXCA 3CFOA 1JKOC 4BRDA 3VQ5A 2QGFB 2EIKH 2QQ8A 2OTLT 1JUMA 2HBWA 4ESBA 2WUSA 3HRSA 3TQ7P 1MJ9A 4BH9A 3FRNA 4X62K 2FC0A 2Q0OA 4JJDA 2ZFWA 4LF6K 3QG1A 2X1DA 2P9LB 1IO2A 1D09B 1WJAA 2AKKA 5FGMA 2YDLA 1LB2A 2M2EA 2V7YA 3U23A 1TTHB 3QEIA 3O4QA 2RQQA 3CCLN 2DYRH 4U67L 4BRNA 5M5WJ 3SEMA 3M9QA 1IB8A 1GOCA 4MFDA 1TUCA 3WNHA 1D1AA 2XKOC 3S1NJ 3JCMe 3MN9A 4X65K 3SQ1A 5AQUA 3N97A 2E2IJ 3F73A 2Z1DA 3G71N 1NE8A 4I9LA 1G59A 1QQMA 2P9UA 1ORKA 3HGYA 4DU4A 1WB9A 3H5RA 1SRLA 2LH9A 1U06A 1Q95G 2KRFA 3P9CA 1X2MA 4Z94A 3EHRA 2LSNA 2OA4A 3NARA 2VT3A 5GTIC 3OIOA 3KLEA 3CBPA 2WV0A 1OULA 4ATOA 4DQ8A 3G71A 2DEQA 4IDHA 3M56A 2P5VA 2VJ5A 3D2FA 2HZDA 4OINF 4B4CA 2E2JJ 4RTFD 3N0UA 4MZTA 1ZRFA 1Y96A 3QICA 5AJ3K 2A69F 3CQXA 4CEEA 4ISEA 5M5XJ 1K1ZA 5GMKj 1VIFA 4EAHD 4DQ2A 2G8VA 1D9DA 4GLKA 5E26A 5GINA 1K76A 4BE1A 2RA2A 1STZA 1A31A 5A2QZ 1VQ9A 3MWTA 5FU7C 4BI3A 4DUYK 4K2EA 4YFKF 4A63B 4JI1K 1QVGM 5DY9A 1X69A 3QRFF 3CCRQ 1SMTA 5IP7J 1YI2N 4IEEA 5HNHA 4EMGA 3CC7Q 1R0AA 3I56T 3LP1A 1WCMJ 5HRRA 2LBFB 4E3SA 2IVOA 4I02A 3G10A 2DJIA 1X1BA 4J7FA 1M2VA 4DSKA 2ADUA 5HODA 1W36D 4JS4A 2HZTA 3J7YP 1XGMA 4C0GA 1OKRA 1QVFP 2HSPA 3VMFB 3OWTA 4GLMA 2O8CB 3OIQA 3U9DA 1Q82U 3GBTA 5KPRA 2Z1GA 3BOQA 4O5BA 3TW7A 2YX7A 4GGGA 2EBIA 5GADJ 1Y64A 1VRLA 2F5KA 5GAMg 4EQQA 2HVQA 2DFHA 3JCMX 1GXQA 1RBUA 1VQ7Q 1WOQA 3KK2A 2WAQN 4OMPA 3LLRA 2JJ9A 3ULDA 3JCMP 5JVGF 2EJFA 3OH9A 3NF6A 4C3JJ 1YRNA 1R1TA 1IRGA 3JAMO 5IP6A 6AT1B 3S6IA 2ZMEA 2ZF5O 2XHBA 1UCRA 3GF5A 3M0PA 2J05A 2R93J 1N5ZA 2ZE2A 5F0XA 3I9V2 4A4HA 1WSFA 3I56I 2DXUA 4RGXA 4M75E 4CIGA 4N4HA 3QBWA 5DDGA 1GOAA 2R7FA 2DN0A 4PA1A 3HSTB 1X01A 1OQYA 1FT9A 4NNJA 4KITB 4XLPF 1T8IA 2Z2SB 3ZSWA 1YW9A 1P4AA 4UHTA 1RGIA 2QSFX 3M55A 1YW7A 2ZWHA 1DP7P 3PVLA 4BGDA 4FT2A 1VQ8Q 3CC7T 5E41A 1P6RA 1GXPA 1Y39A 2L7ZA 2DD4A 3KP3A 1YT3A 3EG9B 3M8JA 4EMKC 1W7PA 4EIAA 2EPDA 5EZHA 1D3BB 1Y0UA 4HNUA 2QSHX 1RTDA 2PJRB 4E0DA 5EYRA 4ZN1A 2HF3A 1HSJA 3BROA 3ZETB 3DYAA 3K57A 4F55A 3QP6A 4EVVA 1OKJA 4PJJA 5H6QA 2R7OA 1ILYA 3AVBA 4LK1F 4UC4A 5F0FA 2KR3A 2EH3A 1K4US 4FLYA 4XBFA 2QGUA 3VQEA 4CEFA 2DETA 5C2DA 1ASWA 2P4RA 3H9GA 2OCEA 4U88A 5CQXA 1TWBA 3ME9A 2KJCA 1F36A 5LFAA 1YNZA 3EE8A 3F9MA 1J5OA 1Q9XA 1X1AA 3PUBA 1GCQC 3CETA 4M7AA 1ATNA 2PZSA 3BDPA 1QHAA 3EFSA 1O3TA 2HAXA 1QVFA 2OF7A 3A8GB 2CH0A 5J4VA 1AT1B 3LAPA 1EX4A 2OPRA 1NK0A 1OEBA 3ZQQA 3V7CA 3A5NC 4D5CA 4M7DE 3IAS2 1HCRA 5F1JA 3ZT1A 3CCVA 3LAMA 1N5YA 5K5QA 4UUSB 2FXUA 2UXDK 3H9NA 4BY6B 3AVFA 3PO3J 2JA6J 1GLFO 2QA4A 2CO5A 2XHCA 2DA3A 3ZX0A 3WTVC 4A4KA 4C0DC 4GBQA 3TU4K 3VRYA 4CD3A 2O6GE 3MP1A 1V3FA 2HS5A 2JUFA 1TP4A 2DODA 1JJ2M 4NHJA 2VUMJ 4KDPA 4J00A 2E12A 3TKYA 4CI0C 1ON1A 3G7ZA 4B47A 4XRSA 4YFUA 5IAYA 3I56A 3N4MA 2E4HA 1EQYA 3K5NA 2EV5A 4RUGA 3ZEUA 1FOWA 1LV5A 1XDUA 2J6FA 2YRVA 3FM3A 1M3AA 4IQ4A 3V4IA 3QNOA 3OMCA 2GEMA 2KHOA 3PJRA 3GCMA 4P1WA 2JMCA 2K3PA 1QNTA 3LM9A 3SFMA 5F27A 2UUBK 3E6DA 4H0TB 2P0KA 1WUAA 2K4YA 2G8FA 3MO8A 1DJ7B 3G71I 2F4MB 5ELZA 2KP6A 4C92G 3SDBA 4BUPA 3VEVA 2O3FA 1V4SA 4P5OA 1WYXA 3UR3C 4YDUA 2O4XA 4EM1A 1IXDA 2CYYA 2O0YA 4JX5A 4EGYA 1M90O 4KN4X 2FOKA 5IT9E 2IEKA 4Q5VA 3S93A 1U5TC 3CPWS 2P51A 1AA7A 3RVCA 2ZFUA 3OYYA 2LFBA 3ZMZA 5CPRB 4IFVA 4PL8A 1ERDA 5CIUA 2ZMEC 2KBTA 4CEDA 2B4JA 2P9IA 4AHUA 4GDFA 2D5RA 3BEXA 4BC3A 1AKHB 1T38A 2K40A 2SRCA 3H0DA 2GFAA 3GNFB 2Z1JA 3EZWA 3WXJA 3LQQA 4ILJA 4E6RA 5KGWA 4RW4A 2E6LA 2E6NA 3MD2A 3NVMA 2L3DA 1G3TA 1ZA2B 1SKUB 4CEQA 2HNYA 2V1XA 1KLMA 4KHWA 1HRHA 3TREA 1K78A 1RAFB 2A5XA 2GELA 1N34K 3AG1H 2VE8A 1A35A 4WQ4A 4BGBA 4C8QD 1WJRA 5CVUA 3T8TA 1EA3A 1KU9A 4M78D 3OYCA 4N4GA 4EZ9A 1MWKA 2GZWA 3C7NB 5K7FA 3KYLA 1ZG1A 2QASA 3EYZA 1WXBA 5GAMe 2DX1A 2YUNA 2P4TA 1ATSA 2DCEA 4D5FA 3C6TA 2JNGA 2VWJA 3UA6A 3ZP5A 5KPZA 3FZLA 3M54A 4CD1A 4M4ZA 1WHLA 2X3XD 2D1HA 4KH0B 4RCCA 5CR4A 1I27A 1IW7F 2ZJ2A 1NK7A 2QDLA 2W84A 2UYTA 1WSGA 3K9JA 2QAZA 3BQYA 3MMYB 3JCMh 4LK0F 3BR3A 1VQLT 4AHSA 4A4EA 3CJ7A 4D7MA 1AZEA 3RDIA 1VSJA 1XDSA 2M0YA 3DKWA 3K5OA 1KFSA 4CZIA 4EJWA 1TK0A 4PZJA 2WSFE 5AZIB 2DDAA 4HQEA 5IHIA 2QXFA 2DBKA 2GF7A 1UGPB 3TDUC 4C2UA 5J47A 4NLCA 1WH7A 2LBFA 1XNIA 4NDLA 1U2WA 1YITA 4LMYA 5JLWA 1W2BS 4M73A 3ZX2A 2DRKA 1BI4A 3A5LC 4FETA 5IY5H 3JCMV 3ZSZA 3EGDB 5GJVB 4KGXB 3RI4A 4IFEA 2VC8A 4XSZF 1T98A 1FN7A 1NK3P 3QFUA 1H89C 4CW7B 2P6SA 3THVA 2RJCA 2WWYA 2MLGA 4E7SA 4OIQF 1Z67A 4J9HA 5IT9O 1XNQK 2NAZA 1VQNQ 3LWIA 1NHAA 1VTNC 4M78G 3J7ZO 5KE3A 5KHDA 4D8DA 2ZO4A 2K02A 1X2KA 2WY8Q 4RM3A 4BD3A 2E2NA 2H94A 5C4JJ 1UHCA 3SWNC 3GE1A 1ZBXA 3DLRA 3CQZJ 1WQWA 4DQPA 3CCRT 3KTUA 2VQLA 3O6BB 1KU7A 5KQDA 5LJ5f 1V5GA 1DEJA 4HSRA 3ZOBA 2YNFA 3KYCB 4BRIA 1PUFA 4H0XB 1USSA 4CEBA 4C1NI 2DMNA 3Q5FA 3RR6A 1Y57A 3CC4T 1IH7A 1U49A 1KA8A 4PJOD 3GG4A 3UKGA 5M9OA 1EH7A 1UG1A 2CUBA 2FYKA 1J54A 2AIRB 3PVQA 1H88C 4YG2F 2E1CA 2OYQA 5D3GA 2R7TA 4LN2A 4BQAA 2ECBA 1MW7A 4WF2A 2KXCA 2B5JA 3WTWC 1WJBA 4M77F 2ACJA 1ZLKA 4CF9A 3EUKL 2BE9B 1DLOA 3M8SA 5A0DA 2R4GA 2RHYA 4QVDA 5C4XJ 4LITA 2OX7A 3HTRA 2XIGA 3VQBA 1YJWN 2ZPEB 2R5ZB 3IH7A 2H6CA 3OH6A 4ESRA 1XMKA 3TVTA 2O8FA 2XD0A 2QKKA 4FJ8A 5CKFA 4EFHA 5KI6A 4DF8A 2CH5A 5H20A 4ZDOA 2XV4S 2X9HA 3PO4A 3ZQIA 3LX7A 2LC4A 3I55T 1WAFA 3CW7A 1NLPC 2MW8A 1BCOA 2HD0A 3IDHA 5HLTA 1WSHA 2VPLA 2CP6A 1NK9A 3CQYA 2M8GX 2ME6A 1MMSA 1V55H 2LTPA 1KAZA 4DTMA 4XTZA 2V1DA 1WSEA 4DLGA 2HGCA 4OAZA 3VQPA 1OJLA 4M75B 4N4NB 5JS1A 3CMYA 3U1KA 5F64A 1S22A 4EZ6A 2VG6A 2A6TA 4I01A 1RL2A 3BW1A 3VS4A 5M1OA 2VLAA 2DPUA 4JS5A 1NWKA 1TKDA 2DO3A 4J2BA 1DTQA 3FMSA 3VGMA 1KQ8A 1P7JA 2LJ1A 5E79C 4KUDK 3T8RA 4XSXF 1E6HA 3F5TA 5CLSA 4JRPA 4GVMA 1UG0A 3LSHA 1ZSGA 1I1JA 5AQZA 3UPUA 1HJOA 4NO7A 2DPPB 1R59O 1F43A 2GLOA 1MV0B 4M71A 3QYGB 3VF2A 3HO1A 5HS7A 1VFCA 3GTMJ 3CCUI 3IKMA 1Z7LA 3I64A 3QDFA 2BEOA 4CHUA 1SSHA 3CIPA 1XPXA 2LCLA 2OD5A 4XTVA 1XHZA 4BBRJ 4KT0E 4ILGB 2M9HA 1T3VA 3ZSYA 2P7VB 2D0OA 2OFIA 1UA0A 2FHDA 2JW4A 2XSDC 3SEZA 3M07A 4OB0B 4AYBA 1JLFA 2RGVA 3MEGA 1VQ9Q 3CCQN 3QPSA 3DOLA 4FT8A 2YUPA 3RKYA 3JB9I 2MOXA 1NG9A 4G1QA 3HFOA 1M90U 1EZZB 1LPLA 3WU1B 2PQ8A 4C92D 1CF7A 1DTTA 5ILUA 1YI2A 4E9EA 4TSXA 4CJ3A 1FC3A 1KVAA 3HOVJ 5FPMA 1M8VA 3G6EN 1RDWX 3KP2A 4C92B 4LF4K 1U8RA 2JGUA 3H1CA 4AQYK 4JK7A 1JTYA 3LCNA 3JRIA 3MX5A 2KEAA 1XC9A 2RC4A 3TDZC 2DL7A 1IHWA 4IJAA 4NUBA 3MDQA 1VHXA 4J6WA 1J0RA 3RPUA 5JICA 5ADXA 4Z4GA 1FSHA 5A0GA 3MZ8A 4X1VA 4FVUA 1WNSA 1O3QA 4HRIA 3J80O 1IBLK 5HLGA 2QWRA 4EW4A 1VQPN 1ZGJA 4I76A 1E7OA 2HL3A 1S7AA 3JB9F 2XUBA 4ZC3A 3RWUA 4M6VA 4WE1A 2DM1A 1CSKA 3L3UA 5IHNA 2OUMA 2MD0A 4QVZA 2OZSA 3TTCA 1OH7A 4E9FA 4LDVA 1U2VB 1LWWA 3TAEA 2HKQB 1TL3A 1V5FA 2NWMA 1B92A 1RTIA 3E66A 4HW0A 3Q0WA 1L3UA 3FMRA 2KZZA 1OV3A 3WU2C 2K9QA 4ISGA 4IJNA 1K73R 1RLPC 3HRGA 1N3AA 4PGGA 4B6MA 1VSHA 2GUPA 2R58A 3B02A 1E0EA 1R00A 2YJFA 2Z9OA 1HKCA 4BU2A 3FBNB 5IN1A 2M02A 1H1VA 4MQVA 3TPQA 2GA1A 4NC8A 1I07A 2P0PA 4WX9A 1SRMA 1X27A 3CJBA 4XICA 2CH4A 1JCGA 4CJ5A 3NGPA 1M1KO 3O9TA 4XLNF 3H5AA 2UXCK 3BG3A 3KKSA 3A5OC 3SUOA 4PUOA 2W40A 4RAYA 2OZ6A 3THXA 1QVTA 2CP2A 5KYYB 1Y97A 2O8BB 2OTLQ 5IYBJ 2FLOA 4H4OA 4I2OA 3H35A 4Y52J 2QQSA 4KH1B 4XIUA 5KGXA 4Y7NJ 3X20B 1VQ5T 1QQJA 4IFYA 1W0UA 3SI6A 5IT9K 4II1A 3QODA 1ZX6A 3S14J 3EKUA 2QUFA 1J53A 1RFQA 2R57A 1YXQA 4C1NK 4J8FA 5DLOA 3LYIA 3ZMVA 2RI3A 2YKMA 4ELVA 3JCMW 1WLPB 4CJ7A 1SFEA 2BTFA 3A98A 5FU6C 1FTZA 5GAEJ 5HDGA 3L1AA 3CCLA 4B1ZA 5FB2A 4QOZB 3KZIC 2FPEA 1TAQA 3PFSA 4BC2A 4EIKA 3OR1C 4PWDA 3PE0A 2DT7B 1RC9A 2KRHA 4ON0A 2X6YA 1BDGA 3M1CA 3K0LA 3P8BB 2E41A 4CJPA 3HTSB 4ZDLA 2Q0RA 3LANA 1JLBA 1FSEA 4YOVA 2GGRA 1EETA 4GV6A 1X4PA 4EA4A 3VEXA 4CCMA 3ABTA 2QENA 3A8LB 4E19A 2WFBA 3VV0A 2IGNA 3HYFA 3Q7CA 2DDBA 1TK5A 3DOKA 2D45A 3HOYJ 2DK3A 2ZXIA 1BI1A 4X0GA 3NVKA 4U87A 3GFMA 2X6NA 4OB2B 4HTLA 3VDXA 3SZPA 3V7SA 6PAXA 1UZCA 3MAQA 1WPKA 3AT1B 4DTUA 4F93B 3SDZA 2QA4N 1Y8QB 3DKXA 2I8DA 2V7FA 1T2KA 4BR5A 2VB6A 3H45C 2WBMA 1V54H 3A5ZB 3HGGA 5KK1A 3ZMSA 3P31A 3S2WA 1FZPB 4E1JA 3EGUA 2KDOA 3CMET 1A5WA 3TBIA 5DV5A 3C65A 2M4GA 2E3HA 4LSLA 5CKBA 2QCOA 3CC4Q 1JL2A 3QMLA 4C92E 4KBOA 3CDLA 1Q82O 3H9JA 1I4K1 1UE9A 1B72B 2ABLA 3MECA 1VI0A 4JK9A 3TAQA 3G6EA 2X85A 3ECOA 4B21A 3VS3A 1FJGK 3ABMH 4JK1X 3T1YK 1JUSA 4RAFA 2LKSA 3DRSA 3DXMB 4GYIA 5GAEP 1MBEA 4FHTA 2GWRA 2XG8D 4TV7A 3HT3A 3P8HA 3M4OJ 2YI1A 3ONQA 1RBSA 4AG2C 3SV4A 1UUEA 1S3XA 1K6OA 1X9WA 3HFNA 1YFHA 3PIOA 5JFRA 3VPRA 4O8KA 3ULEB 4A61A 3CCRN 3JS6A 4HV5A 2VG5A 5FKNA 3U1DA 1IC8A 3A01B 3LFUA 3S1MJ 4NYFA 3ECHA 1UB4A 3V8LA 1SL0A 1NKBA 1JRIA 3BGRA 3OYGA 4JKDA 3L2VA 4FJXA 3H1QA 8AT1B 2FSNA 2FBKA 1Q7YO 1VQOQ 2MBFA 3VOVA 4CC2A 1M1EB 3HIFA 4L9TA 3M7GA 3OYFA 3VQAA 3OBYA 1B4AA 3X24B 3LAJA 4NB5A 2CREA 2LSOA 1QVGP 2KISA 3GNGA 4JZ4A 4F7UF 1JCEA 2MC4A 5IP9J 4BAYA 4OB3B 1I1GA 3DU6A 1EFNA 3B8AX 3CMEI 3S9HA 4DYCA 4QQGA 1E6GA 4KN7X 2H27A 1G3YA 2P9NB 3FHFA 3QDKA 2VPRA 5KRTA 4XKCA 1DKGD 4CFDA 3TL4X 2X6SA 3IRXA 4A4GA 3AVIA 2HDCA 1B59A 3J7AP 3UWNA 3CP2A 3MX2A 2O8DA 4CECA 3O08A 5HNFA 3MXIA 3CXCP 3H5NA 4WCGA 3WGIA 1TGOA 4BYYA 1K73U 2QM1A 2P5KA 3M3ZA 1R4NB 4KGVB 2HI3A 2DFEA 1HXDA 3MN6A 2BW3A 4C30A 5M1QA 2HKXA 2L0KA 3GTQJ 3MK6A 3WGHA 1OYXA 1W5CC 2KIMA 5K14A 2L7KA 2KPMA 4Z89A 1T6CA 1T8EA 2YPRA 1TW2A 4C23A 2XVCA 1DT9A 3JAMK 5L3DA 1VQ4A 2OPTA 5CYMA 2A42A 2FMYA 4AC0A 1RTJA 2KAFA 4QPOA 5JLHA 3RUXA 1T6DA 1KQ2A 3CCEQ 1QP2A 5LD2C 2XSJC 4J19A 5I11A 2DMTA 4L0YB 1NGGA 2QI2A 2VXDA 4JLHA 2M7BA 5GANg 2VQGA 4MO7A 4N4OB 1BA1A 2JN6A 2A05A 2MK5A 2O8BA 3RJPA 3CCVI 5IOYA 3G4ST 4CSWA 4XRSG 1GBQA 3WVEB 2Y2ZA 1VQKA 4DA4A 2VKNA 2RPIA 3MN5A 3VQCA 3S3MA 2CT3A 4C8LA 2DMPA 4B22A 2QEXT 4IEIA 2ZJQF 1KG4A 3RSEB 1A04A 1W9HA 3JRDA 3OW2A 1VYUA 4DSFA 1HSQA 2KRCA 5GAHJ 2VGMA 3E1YA 3NF9A 3WEEB 5C10A 1APLC 3FXUA 2V26A 1I6HJ 4EMKA 1AOJA 1I8FA 2BGGA 3GO5A 2L3SA 1R71A 4XLAA 5CAIA 5AQYA 1XJWB 2G3RA 1A5JA 2R3SA 4OVAA 1N8RC 1OCZH 5M1KA 1YITI 1OPLA 2L9SA 1B8IA 4I6ZA 4MDBA 4M3ZA 4B3RK 1IUYA 1SQKA 2AHQA 2A6HF 4CF8A 4IRIA 1WEIA 5BRDA 4EDUA 2R92J 1CZ9A 1CXUA 4A3MJ 5L23A 4BACA 4HWIA 4MTDA 3M1FA 5JI6A 3LDQA 3OS5A 2XDDA 1R49A 3WTYC 2DJQA 4B8AB 5KYYA 2DFUA 1JT0A 3HPHA 4NQWA 2QTVA 5GJWB 3TSQA 2X51A 1SANA 1EO1A 2F5CA 1I5ZA 2DTUA 3BZ6A 3HM8A 2PMZN 3KP5A 3N4PA 2K5IA 4GNIA 4JHDB 4CJRA 1F1ZA 2JT1A 1DU0A 3ITHA 4A2AA 2TDXA 1TL1A 5FPEA 1T0FC 4M77D 1OPCA 5E1XA 1FOYA 1J5EK 3M8PA 1YHQN 2GWKA 1X1DA 4XH5A 2GOMA 2XRNA 1VSDA 3D2EA 4XU0A 1PKSA 5HKCA 2YXYA 3CQ8A 3IRRA 1QQIA 4WCEL 2A0FB 1CXQA 2HQHA 4W5NA 1VQ6Q 2HSEB 5KYXA 4DG1A 1Q18A 2CYZB 1PU6A 2RHUA 4F92B 4XRMA 5H2FC 2ATQA 4UY8O 3C6HA 2NOGA 4M7DA 2RAEA 4EJZA 2Z3YA 1VQLA 1U5TB 5GP9A 3KEYA 1SVLA 5C25A 1MUZA 3D45A 1JGSA 4MEYF 3OVNA 2XGDA 4KUIA 4B8CA 4E89A 1T03A 5AQMA 2A07F 2Y31A 1C0UA 3CCRI 2A61A 1Z6RA 1K8AU 3SQNA 5EGOB 3R1XA 4H5NA 1Q7YC 1YIJI 1R36A 1QQNA 4OMNA 3HSRA 1S72I 1MNMC 1U0JA 2VWBA 2QA4T 2JRTA 3H0GJ 1PKTA 3HM9A 2M45A 1S29A 2LLKA 2QWOA 4HUFA 2HNDA 4B9VA 4B1UB 3Q7BA 5CKTA 1MA9B 2RH2A 1BU6O 4CFCA 1TOVA 2E10A 2X74A 2FNPA 1DPRA 1XG1A 2JVGA 1DGKN 2P5GA 3FXRA 2H8WA 4L8RB 2DMUA 4IEJA 4ENJA 2FBYA 2XGXA 3U21A 4CZGA 3Q3SA 1SFKA 1LWVA 1MBKA 5DD8A 1BL3A 2VODA 5J6XA 4J9CA 4DMNA 3C2BA 5C6SA 2D4WA 2HR3A 2DQRA 4BR7A 3EG2A 3A4CA 1HKGA 2OQGA 3A1YA 3U2RA 1MWMA 1MMNA 1VQ7A 3HJEA 1WJ5A 5J40A 5EF6A 3JCMc 4PKGA 4EHTA 1KQ0A 1Y71A 1T95A 1GFCA 3R60A 4IOAF 2C0IA 2KSSA 4NL2A 5EEHA 1QHGA 2JOYA 5LL6S 4PJ0C 3V81A 4FWMA 2K2MA 4QVCA 1P7IA 3DTKA 1IF1A 1YWOA 3RESA 5CE3A 2MSYA 2TRTA 3T7ZA 3A5MC 2QTDA 4WQ5A 4M3XA 4B9WA 3RYRA 2QA4I 1SFXA 1WX6A 5DCMA 3W0LA 2KKZA 2VASA 5FLXZ 1SMYF 3F8CA 1R8OB 4B9UA 2GAUA 4A5NA 5GAMf 1GLLO 3RERA 4UVBA 4J5YA 2KYBA 3KEQA 4F7UG 4B9QA 3K1NA 4E7LA 1HC8A 4ANJA 4AILC 1YI2Q 4J6YA 3D6RA 4J2AA 2F4OB 4FX0A 2HQAA 3EL2A 4RW6A 1TC3C 2F69A 3TEDA 3DBHB 1KTQA 5CY4A 1LOTB 4ORZA 2QQ9A 4KULA 2XF6A 1BQMA 5FPNA 1QS4A 5EOYA 2E6MA 3L2CA 1XTDA 1J2XA 3RDVA 1D3YA 2ZCFB 4BRAA 2HVSA 1BIUA 2LP5A 3SXYA 3W6KB 2KIUA 3TAMA 3SZGA 4M41A 4II3A 3HVRA 1YYVA 3QJ6A 1V1CA 1YJNQ 2XDPA 1WDXA 3DXMA 4NC6A 2FRHA 4JYKA 5FPDA 2DF6A 1MV3A 3EN9A 4YRVA 3DXJF 3K4NA 1P4XA 3M58A 2EQRA 3VGKA 3CBOA 1K7AA 3X2QH 1YJ9Q 1B3QA 1FYLA 2M0CA 4M9XA 2WACA 2P8TA 1O3RA 4OLAA 4EHUA 4C8OA 1SFUA 2DMOA 3CZ6A 2EYWA 4BR2A 1TU0B 2OU2A 3C2HA 3O9SA 4HEA2 4PKHA 2K9SA 1HK9A 1BI4B 1VQ4N 4EPCA 2HVIA 1GL5A 5DMRA 2K3YA 3CCRA 1SD7A 4HVUA 1REVA 2HHWA 4M6YA 3FDRA 2HF4A 1B9DA 2I5JA 3CWSA 4PK4A 2E3IA 4MDWA 1HYOA 2RN7A 3DLLL 2P9KB 4H5TA 5IH2A 1YBYA 1VYVA 4BI4A 3FWEA 4CJFA 1VYTA 2HFHA 4PL6A 1X6OA 2ED1A 2WC9A 1X43A 4E4HA 1JQQA 1FW6A 3RZDJ 3SNNA 1U4BA 5FW9A 3HOZJ 4UXNA 2HNIA 3ZMDA 2W03A 2O2OA 5GMKm 2QM3A 2OTJA 1XMXA 1YITN 2RNJA 4OGEA 3PV8A 3FZKA 3I59B 3DP7A 2IA0A 1HW2A 3KBGA 3OA9A 2M7AA 4CESA 5LJ5g 1Y56A 3LGFA 4FM2A 3QU3A 5GAOm 4DTOA 3JAME 5B3SH 2Y0SN 5FD6A 4CHOA 2OA8A 4WXCA 4DR5K 1DGWY 2VKDA 1MMDA 4FK0A 3CCEI 4UUTA 3UB5A 4ZN3A 3QOEA 1XC3A 3I8DA 1KD1O 2CG4A 4KIBA 1OU9A 3U3GA 2EIFA 3HM5A 5AQQA 2NYSA 3VS2A 1Q86C 1VSEA 1TXQA 1GLJO 3QINA 5LGUA 1YVNA 1YN8A 4CZJA 5SWMA 1USTA 1VQ5I 2H6BA 3RMQA 4CBWA 4GMJB 2C6YA 3NF7A 1H92A 2XDBA 2NRWA 4HCCA 1BR2A 3KLNA 3PL8A 4GRIA 3KE2A 1FYMA 3PQJA 4W5TA 3D0PA 3OSFA 4FE7A 2R5AA 4A0YA 3T69A 2ZJQL 4CE9A 2O9SA 3EKSA 1I0CA 3CC2T 4AFUC 3G25A 2EYXA 3AO3A 2XMFA 4NYNA 3VEYA 1UGVA 5AQOA 2V9VA 4PFOA 3VFZA 1K73O 3ULRB 4A54A 4Q47A 2A41A 3DCFA 4C5IA 1BIAA 3ZN1A 4M3WA 3CP8A 1SFOJ 2QEXN 1BOBA 1VSIA 2RQTA 4ENKA 2G8IA 5E17F 4DZPA 2NOHA 3M0UA 3OHRA 1EKEA 4EVIA 2J5PA 1PCXA 1OQKA 3AO5A 5LY3A 4JD2B 1NNEA 3E5QA 2RQVA 3VS6A 1IRFA 1VQ5Q 2QKMB 3LWLA 3H3UA 4C8QE 4I7HA 1VOMA 3CF5F 2AKLA 3ZGKA 4JHDA 3M8RA 5AQIA 4ZGJB 3K7AJ 1ON2A 2ZCWA 5TGTA 2ECCA 1QO0D 1X75C 1Z9CA 3DB3A 4FJ9A 3AY9A 3E9LA 1RI9A 3PX6A 3B6OA 3WNFA 1SAXA 4BJ5C 2M5WA 5J8CA 2FZKB 1FEXA 1GV5A 2WAFA 4E7ZA 3Q1JA 4XU1A 4FE4A 1Q7YR 3ZLJA 2A3SA 1ENHA 3C12A 2WB1A 3HI0A 1L0OC 2E5QA 2JA5J 1I5OB 2E2HJ 4C5EA 4CVNE 2YCHA 4XKVA 4ZNXA 4PLIA 2M4KA 2EHGA 2P9PA 2RE2A 3RMCA 1NPRA 1QQCA 3MP8A 3WNGA 3I59A 5FLXE 2OTLN 5K7ZA 2A1RA 3NBPA 1ZBFA 5BN9A 2XKOA 4CEOA 2DFFA 3CCMQ 2YU3A 4DBQA 4BHCA 3I4PA 1IAWA 2PFUA 3ZPLA 2EFIA 3RZOJ 4MFBA 1G83A 1BISA 2F48A 2VVKA 4G7HF 4C0FA 2PUOB 4AWXB 3JRAA 3FBIB 2WC2A 4KH6A 5I21A 4FTHA 2Q3SA 3ATUA 1LE8A 3MKDA 3I54A 2EFNA 1GDTA 4F8RA 2RHIA 2F2EA 1NGIA 4JKGB 2HDDA 3JCMb 4BB7A 2Z5UA 4DFKA 1S6LA 3NFCA 4BQZA 3BWGA 4ENNA 2EVRA 2V8JA 3I55Q 3QZ9B 4N41A 1KC8O 2ZJRL 3K4LA 4O6JA 4R79A 2Z1HA 3S1RJ 3KHYA 5KYWB 4M7DF 2MD5A 1K9MC 2IGKA 1X1PA 3F8BA 1NH3A 3CPFA 4GVEA 4N47A 4CHQA 3EQLF 5BNGA 1VQOA 4M3RA 2P6TA 1XWLA 5KCOA 5D4RA 2BY3A 4HZFA 4LDYA 3FXOA 4HYEA 4L9JA 5DCFA 1JUPA 1ZLMA 2JVVA 2CZ1B 5GAN2 5BMZA 1BR1A 3DWLE 4AYBN 3CCQI 3QIOA 2IDOA 3H8ZA 2WAEA 3L7WA 1FXXA 2LTOA 3P5JA 1ASUA 2XF7A 1RTHA 2CZ0B 4M78B 4DEXA 4OMFB 1HQUA 1RAHB 4CGHA 3KYDB 4GY2B 4IRGA 1GLAG 1BI3A 3LGLA 3BJ6A 4P9UA 3AAPA 1PP8F 2P81A 1IREB 3GBGA 2DIQA 4O5VA 1VQPT 3MN2A 3MCZA 2JS2A 4WFBL 1W1FA 1WA7A 3EHQA 5E3MA 4S04A 1PSFA 3AA5X 3GL1A 4IZ9A 1NGJA 5FKMA 4J01A 2AHJB 4CK2A 1NGNA 1KQSP 1BJAA 4G9YA 3F8NA 1ZTRA 3H3OB 8ATCB 3K4JA 1D5YA 3G4SI 4GV3A 1NTCA 5BR9A 4BKXA 3ZRGA 3JRCA 4LF5K 5GANh 4E1NA 1S72Q 4PKCC 5HP1A 3V9UA 2A7YA 1BW5A 1IGUA 4IRHA 1XN7A 2QEXI 2BXZA 1MMAA 3E1SA 4FM1A 3TTFA 1O3SA 2HMIA 1K8KA 2CUJA 2HEQA 3MXJA 1F9NA 1YI2T 4NB4A 1JTXA 3RCOA 4U0WA 2BVLA 1HJDA 3VSLA 5IWAK 3SBGA 3JAMZ 3UT1A 2HHUA 3QPHA 5M3MJ 1UGRB 4AMCA 3CCQT 2VBYA 4OMOA 4OIPF 3HL2A 3PSIA 1RT7A 1N77A 4HT8A 1YQMA 3CUQC 2R7WA 3BTLA 5ADXH 4CCNA 4CK1A 2ASPA 1WFWA 4KISA 3RMAA 4L18B 5C42A 3W3CA 2OTJT 1LQ1A 1XQSC 2X1EA 4P5NA 5EEAA 1RABB 2RB6A 1X1CA 3IMXA 3IAM2 3SQ4A 4FO0A 2BIVA 3HKZN 4HLYA 1C0FA 1HW5A 1UELB 3H0IA 4NXNK 3ZSQA 4PJOA 1FY7A 4FJKA 1FP2A 3BJAA 2GV9A 1VIEA 4LOCA 2L3QA 4RB0A 2KIQA 1BK2A 1BA0A 3VOEA 2DOEA 4J9DA 4XH1A 5DPKA 1ONVA 4QQ6A 1U1SA 3MEVA 1ZR4A 3CXCA 1P9QC 3TMOA 2XAGA 2X9DA 3A8HB 1OLTA 1BN5A 1RT4A 3EFOB 3E9GA 4KTQA 2XAHA 2YSRA 3NPFA 4BY6C 2CQKA 2K5FA 1FKOA 4AUXA 4A3CJ 3COAC 1KAXA 2DJNA 1FMVA 4B8XA 1I5LA 2I7NA 3OBWA 4P55A 4BQLA 4OPAA 5GMKi 3CWTA 3PO2J 3T5XA 1UTIA 2Q97A 1QVGA 3OS2A 4B9TA 1J5YA 4FWSA 2WA0A 2M0MA 3EGXB 4M78C 3BPVA 4CK3A 1JLCA 2P84A 1K6YA 1XTAA 4LDWA 4HBLA 2MG4A 2AQFA 4H0VB 1UB9A 4BC5A 4FYDA 4Q48A 2E1HA 1QMCA 3CMAA 3GX4X 1VQPA 3K9TA 4KHNA 4DFMA 3HK2A 4HHTA 2LY1A 1JJ2A 3S41A 4FWNA 1UHFA 2VKVA 3PNYA 2NVYJ 1S72T 1ETXA 1B34B 2PVOB 3V8JA 2W00A 1S9EA 5FKLA 1WXTA 5LHIA 4B3MK 3I5UA 4XH4A 3KLHA 4Y1CA 5CZ1A 1DUXC 2CV1A 3DRPA 3K6GA 1JGGA 4IZZA 1OYIA 3I58A 2ESWA 3RQIA 3ZQHA 3I56Q 1MKMA 2VI6A 1U3EM 2R7DA 1IGNA 3R6NA 3R6OA 3DAWA 3PIPL 3C7JA 1UJ8A 1YJWI 1SUQA 1KAYA 3MMVA 4DSLA 2CP5A 3D7EO 2WADA 1ZUKA 1W6XA 1YJNT 1WHKA 2ROLA 3LSGA 1OCOH 3CD6N 3PX0A 5FO5A 3SYTA 3MJXA 4CGZA 1YHQA 1KQ1A 4KHQA 2P9SB 3OV8A 3QUIA 1VQ6I 3BY7A 1ZYRF 2OV7A 3S6WA 2KK4A 4Y0WA 3CC7N 1R5HA 1BC7C 2PVGB 2V1RA 4CCHA 4JYAK 5F2RA 5KE2A 5E18F 1C0GA 5HLFA 1B8IB 3TANA 2BZ8A 3RKQA 3H0FA 4W5OA 1YJNN 5AQRA 3A8OB 5LHGA 4M6XA 2NRTA 2LY9A 3KEOA 1U8BA 3BG7A 1E3OC 1IBKK 3G1JA 4XTXA 3G1OA 1T0HA 3GF2A 2YHXA 2P0QA 4LG3A 4C8QA 2KYMA 3VODA 1HLVA 3SJHA 4KHUA 2YJEA 5AZJA 3JB9G 2CV0A 3KK7A 3Q9SA 2VUBA 2E2PA 1WIEA 2OAWA 3LSMA 4MTEA 3IG1A 4C5HA 3CPWA 1X19A 5CO7A 5LRRA 4QSHA 2AZSA 2KFZA 3MCAB 2CGHA 2CSOA 1HYSA 2EIMH 2CUEA 1D4XA 3HBLA 3KLOA 1VQ9T 4CZEA 3VENA 4FK2A 4KH5A 1YJNI 1I3QJ 5GMKe 4BDYA 2LT1A 1RILA 4G9ZA 2JPCA 4A6EA 4WK8F 3UATA 1ASVA 2R7QA 1WEFA 2B8AA 4RCHA 5M1PA 4J9GA 2GA2A 2EJGA 3R3LA 1R77A 4NC7A 3JXUA 1KQSA 5ICGA 5GAN7 5CR2A 4RGUA 4CEAA 2QK0A 1K73C 3QBXA 3M9AA 4IO8A 4DTNA 2KKOA 1M90R 2AP1A 2Y1IA 4RTZA 4OIRF 3MXMA 4J9BA 1K9MR 1W2BA 4CF2A 1C6VA 2DXTA 2G9WA 2P9KA 4D8KA 4DWIA 2M34A 1SHFA 2LZ6B 2EINH 1HKBA 3NF8A 5EZGA 4QCLA 4BE0A 1RETA 4HPQA 2M87A 1TH7A 2COMA 2RJDA 1WBDA 2GXGA 5K5OA 2I5UA 2CV2A 2UU9K 3JSCA 2Y0SA 1NOYA 4KI6A 1K4TA 2CWEA 5KYUB 2V51B 2HL5C 3BQZA 1VQMT 3SQ2A 2VWFA 4J9IA 1UWBA 5IHKA 3M53A 5GAMh 4A0XA 1NJZA 3R6MA 5AQJA 4CCJA 4XK4A 2L8DA 3QHSA 2KL4A 3VEPA 1OZ3A 4I6MB 3W3DA 1T39A 1YTYA 1O1WA 1YX3A 4DR1K 2OPPA 1YJWA 1S7EA 4L9VA 3NGZA 4DSIA 2ITGA 3PIOF 4GY5A 1SL2A 4M9ZA 2PU9B 2W82A 1M3HA 3FMQA 4NCBA 3SUQA 4KUMA 4H5VA 3CJTB 3NEUA 2RQUA 1JEGA 2YWWA 4CJVA 2FMLA 5AQKA 3E5UA 5JHFA 2JT4A 4M7DG 4ICLA 3L42A 3D5SC 1H9GA 1TWAJ 1Y1WJ 2XB0X 4A59A 2X0LA 4LF8K 2L7FP 4ELZC 5DM7R 3L4IA 2EZLA 2E34A 3D5RC 3IHOA 4HVJA 2LNVA 2RJEA 1LAWA 1RBVA 3DLAA 3P39A 3HKSA 4OB1B 1IKYA 3AVMA 2KQRA 2RHZA 4ZTFA 5C3EJ 1XOVA 2M8EA 2KT0A 5LHHA 4JKGA 4Q5WA 3VEWA 4L0ZB 4BE2A 3CCJQ 1IXSB 4F91B 1Q1HA 4J83A 2LRQA 4G7OF 2JJ7A 3A0HC 2L4MA 4DNCA 3ZQFA 3O8HA 1YCSB 3FZVA 4N9IA 4OFHA 3U6FA 3DLLA 1KG7A 2UXBK 4D0PA 4AIKA 4ASNA 4CFAA 3BPXA 3QWXX 3A0BC 2K79A 3O80A 1K9MO 3A01A 5CJ9A 2NUPB 1IV0A 3H6EA 2GIZA 2BY0A 2EPFA 2VGNA 4YOXA 2WONA 1JLEA 4ZHRA 3AVJA 1O75A 1NK6A 2HVHA 1WJCA 5GAOp 3A8YA 1K9AA 4BVPA 1VQMQ 5L3GA 1X3WB 1RDCA 3DI6A 1WJQA 1PVSA 4IO9L 4CBXA 3CC2I 4WFNL 2KLOA 1TUUA 2QXLA 2NRHA 3CFPA 1Y96B 3KXTA 2V8KA 4XAXB 1Y1VJ 2B63J 3F22A 4DR4K 4FYYB 4MIMA 4KGZB 1QE1A 4ELTA 1QCOA 3C18A 3OS1A 5IYDJ 2EKOA 5F1RA 2YSQA 1W70A 3JCMJ 4W1UA 1OCRH 1IHVA 4OFAA 1ZGWA 4XLHA 4CZZA 4AFZC 4RW8A 3SMSA 2DEUA 3C1DA 4BNCA 4AHTA 1YFNA 3EG3A 4Y91A 3GXOA 1ACIA 1Q86R 4OU0A 4J8OA 4DZJA 1FPQA 2ZJPL 1HW1A 3FLCO 4FWRA 4BGAA 4M3GA 4Z4HA 2ETHA 4UV8A 2QDYB 5GANd 3VPZA 2DA4A 2KW4A 3QFPA 2E4LA 4H5WA 1WJEA 2FA5A 1RIOH 5LJ5h 5M1FA 4BY9C 5JVHL 1Z3YA 1NG6A 1F1BB 4CZHA 1VQ4I 4LH4A 5BREA 1S1UA 3IC7A 1L5UA 4KREA 4M7XA 1RUOA 3CMAN 2CGLA 4HV6A 4PQUA 1M1KU 3CJRB 1FOXA 1NYFA 2P4WA 2D1KA 1SEMA 3KK3A 2JM8A 5AZJB 5HRPA 4AD9A 4LUEA 1RCHA 2A5YB 2LDUA 5EU7A 2AT1B 3HRUA 1DP3A 5FLXO 2VQCA 2LMDA 4XEIA 2W7NA 3K9KA 2JA8J 1AOYA 1HNXK 3FKJA 1MUDA 3KNTA 1Q81U 1ODDA 4JKAA 2K7AA 2D8HA 5J26A 5KYWA 4GKKK 3R61A 2WB1N 2IS4A 4JI4K 2QKLB 5D8KB 4CIFA 2YS9A 3V1OA 3HP9A 1NGDA 1J59A 1WRJA 4ZYHA 2FZGB 1DIZA 2M51A 1VQNN 1WHUA 4PJLA 3ZX3A 4EM0B 4DB3A 4B48A 4A0ZA 2Z0WA 2V6CA 2DTIA 2RNGA 4YPHA 5ED4A 2K5LA 1JI8A 3C0BA 2PI0A 3ZL7C 2FJ1A 3GTLJ 5JMVA 2KVQG 4DV6K 3EO3A 3HHGA 4DTJA 2NUTB 5D6YA 3ZMTA 2AQEA 3RPQA 1SAZA 4XN0A 1NMNA 2PJRA 1R9TJ 4M7AC 5F6FA 1VQ7T 4P96A 2JG6A 1WHGA 3CUOA 1BO5O 5DUKA 2PG4A 4UVCA 1PRMC 3C3WA 4KICA 1RT1A 3PQKA 4KT6A 3C6UA 1O13A 3I5SA 3JYTA 1MBJA 2HSTA 1N25A 2A28A 2YHYA 3S1QJ 3DWLA 4Q5SF 4HX7A 4HNVA 4FZXC 1ZYQA 1V76A 1BKBA 1LWYA 1X9MA 3EDPA 2DAQA 3FHGA 3T0YA 3JCMg 5BPLA 3NWSA 5M3FJ 3CJQB 3CCUA 1KG2A 3M0TA 4MFEA 3LPTA 3AVCA 4JI3K 2WBNA 1N8RU 3VSKA 1QVFS 3BZCA 5IXBA 3AG3H 2HBJA 2W6LA 3SUPA 2RQWA 2OC6A 2X3WD 1BW6A 3V8KA 1NEBA 5KN8A 1PRLC 3FZFA 1XQHA 4RG2A 2FU4A 3ML6A 4FL6A 1FJLA 4WQ5C 4ELYC 1QHTA 1N36K 4C92F 3LWHA 2K3BA 5EG0B 1SS6A 1WI7A 5J3LA 4A3JJ 2AXTC 1GT0C 3A03A 3P1GA 1MBHA 1VQPI 4JI0K 1CKAA 3KK1A 2IBDA 2OQRA 1VQLI 2WSEE 3P4IA 2W6KA 3E9PA 2XGCA 4DEYA 1G5VA 1N8RO 3L09A 4PJOG 3WHCA 3LSJA 2QEXQ 4ZYAA 1LNXA 4ID5A 3IV5A 3CCEN 2MIOA 1WQ2A 3CVSA 1I3AA 4CZFA 4M7AG 2LOOA 3HXMA 3MEDA 2FEIA 1WI9A 1UHWA 1BQNA 1QW1A 2UXXA 3NMUA 2FBIA 1QGPA 2X6WA 5B66C 2HDWA 2WSCE 5FJ8J 3CCVN 1LCUA 3I0XA 4HVWA 4AI5A 3R4KA 4JAXA 2ZAEA 4EGZA 4JPBW 1X4OA 4I98B 2EJ9A 2M1HA 4PJOB 2K7LA 1HU0A 3BDUA 5HOOA 4ZYEA 4KFBA 3JV3A 4CJWA 2HBKA 2VXEA 4NCAA 4JJCA 1P59A 1SD6A 3TSUA 1YI2I 4ZGDB 3DBLB 1GCPA 4I2PA 3QPLA 3G71Q 5GANj 1YWPA 3I0WA 1TBXA 3H1VX 3QU6A 4YOUA 2KFNA 2UUZA 3MEXA 1AD5A 2EAYA 4LC9B 5GADP 1TAUA 3CVTA 1MNDA 5GPCA 4EP4A 5I2MA 4PDKA 2A40A 2RN2A 5LEKA 2VWKA 3CCQQ 3FJ5A 3M5RA 4FJHA 3CCUN 3AO1A 4PIIA 4M77B 5FRMA 2D0AA 5K7HA 5A0LA 3JR9A 1KXPA 1YJ9I 1Q7YU 2PJPA 5I9EB 3J81K 3NTKA 3L2RA 2XPUA 3CC4I 2VBXA 4Z2YA 2MMPA 2E1ZA 3AA2A 2AS5F 3W6JB 1P8ZA 4F17A 2HNHA 2IRFG 4BI8B 3CMAQ 4F7ZA 2FL7A 4UNFA 1XQOA 3K69A 4A2UA 4UY8I 5KRSA 5KYUA 1ZUYA 4DV7K 2PZ1A 2EK5A 2QYOA 1HSTA 2ZB9A 3J7AY 4IO9F 4Y33A 1Y07A 4FYXB 5GMKh 2F9WA 1VSFA 2BGCA 4NCGA 3E7LA 4OAYA 4YDUC 2BE5F 4XTUA 2KFDA 3LM2A 3WXLA 3KIOA 1B72A 1EIFA 4IIOA 1P92A 4BDPA 3HRMA 3W2AA 4FLZA 3G1MA 5J4YA 4K0KK 4AVPA 2F7TA 3BE3A 1XC5A 1OYWA 1ZRCA 5FU7B 5KVRA 2LQWA 4NS5A 1ITGA 4XQ3A 4FJ5A 2E5LK 3E9FA 4H4MA 4RW7A 5DEQA 2H56A 2BE2A 4OF1A 3HOXJ 1MSEC 2XY8A 4Y28E 2ZZDA 4F3OA 3H3ZA 3D2FB 4FOIA 3LZIA 5BPIA 2BV6A 4ZJZA 2XKPA 1VQON 4BJ6C 2BH1A 3ISPA 2EWNA 3C2GA 3O1BA 5CHZA 2R7XA 1YJ9T 1QPMA 2JA2A 3EUHC 4AM3A 1ORPA 5JVGL 5HK0A 2Y1JA 2JUCA 4B3OA 1NG7A 2W57A 3CCYA 4N0BA 3K5LA 1PP7U 4R55A 1FK9A 3D4VA 1ZXOA 1NKEA 4BROA 3EUAA 4NZGA 5E8GA 4DKWA 2G7HA 4DV4K 2MFZA 5IPAA 3DV8A 3TO6A 1W4SA 1HDDC 1S9GA 3TP0A 5H6RA 1CLQA 3LH0A 4IL6C 4IOXA 1HPZA 3P38A 3VS5A 4K8XA 2YUQA 1BBYA 2CQQA 2JMWA 5AR0A 3LWMA 2E1OA 2CW7A 1GLBG 4X64K 4XORA 4NOYA 1BR4A 2D6FA 2FPFA 2KJBA 2NS0A 1VQ6T 2KRMA 3SMPA 2IOCA 2X4XA 4BR0A 1GRIA 1JJ8C 2IAIA 3CBMA 4AIHA 1D8YA 3SWNB 1LW0A 3PLAA 2HYJA 3JTGA 1Z6TA 4Y4RA 2JTVA 2QBYA 3NH0A 3LPUA 3GTJJ 2Y69H 2COBA 2OAUA 1TVRA 3L6QA 4KV8A 2LCCA 4JKHA 4EJUA 4C3IJ 3WUHA 2E5NA 5LLQA 4IHYA 3CC2Q 2E65A 4FYVB 1Z26A 1UJ0A 2P9SA 1L3LA 1YQKA 2KRSA 2FVUA 4XU3A 1JKQC 3C7NA 3CJAA 4LLGF 3CF5L 3S3NA 2RPNA 1QBJA 2FX0A 3M59A 3R9PA 1BWFO 4XLEA 3NGYA 3TR8A 2YT6A 4CICA 1VQKQ 5FLVA 4GKJK 3MKYB 1FP1D 3ZCOA 4XLCA 3SPZA 1S1VA 4BRMA 2XK0A 1TNTA 4F7UA 2HPIA 3D5LA 5GAMd 2Y0MA 2RK2A 2YLBA 4IX7A 3WTZA 4BRKA 3GP8A 3FK7A 2E60A 1E4GT 1K83J 3DXKA 4PL7A 3RKXA 4M42A 5B1AH 3DEWA 4H03B 1A0NB 4C0ZA 2EZIA 2J06A 3CYMA 2JTFA 4CC7A 2K86A 2KT1A 1KVBA 2E64A 4QS8A 3SB2A 2V9KA 4A4FA 1XMQK 3FEOA 2CT4A 4IHXA 4X66K 1OCCH 2C0TA 3ZQLA 3VQ6A 2R7ZJ 4BQQA 3NE6A 1ETKA 1UGQB 3ASOH 2ZXWH 4XK8E 1NYGA 3VYGA 5FRNA 5J3BA 4HT9A 4LD5A 1TLHB 2GQIA 2XRLA 2MA3A 3SAHA 3ZR8X 3GFIA 4KRTA 5GANe 3KPHA 2OBPA 4B1VA 4ZDPA 1RI7A 3BR1A 2XB5A 4M7DB 2E1NA 2CW8A 1QTMA 1UOCA 2RHXA 1Z05A 1TKTA 3QERA 4E9HA 2O88A 5EG2A 4BUGA 1VK0A 3IH2A 1A6IA 2FQ4A 4DTPA 3FFKB 1SHGA 3I5RA 3EPZA 4M7DD 2W24A 1HOMA 1TKXA 1RRSA 4CF1A 3EYYA 1IDZA 4Y13A 3GFLA 2GNCA 1CZAN 2EA2A 2R5YA 3HTUA 2XU8A 1JL1A 2QWMA 3D0SA 4HUGA 1ETVA 1QP3A 2FD5A 3C6AA 1ZHFA 3I56N 4YPRA 3PFIA 4RDUA 4BXXJ 1NJXA 4BVOA 3VESA 2Y9YA 3AAFA 1U48A 3QIPA 1IDYA 3VUZA 2XO7A 2CUDA 2YUOA 4J2EA 3TAPA 5A2QE 2D0BA 1KG1A 3J7AF 1IKVA 4N76A 5GAHP 4DTSA 4YOQA 2XY6A 1MH3A 1UFFA 3EE9A 2X1CA 3CCSA 1TWHJ 4LB5A 1VQPQ 3LQRA 2LNHB 2RMOA 5J8FA 1KHIA 1JLGA 1FBUA 1HR0K 4C8QF 4B3SK 2F5FA 3WXMB 5J2QA 3F6VA 1G8XA 1XGOA 5F08A 4LXCA 1I39A 4OGCA 3WU0A 4RMOA 2ESNA 3S3OA 3ENOA 2EFWA 4BY7J 4BEHA 4CHZA 3J81O 4M75F 2C06A 3LSRA 4RTTA 3MKWB 1ZBSA 1OI1A 4LB6B 3I4NJ 5EDNA 1G3WA 3NH2A 2UZKA 1TYQB 3FZHA 3OJUA 2VYPA 1M27C 2IIMA 1TUDA 4IXCA 3SQ0A 2K57A 5DM7L 3RR8A 1ZHIA 4E6KG 3NTIA 1MDMB 3ASNH 1M4ZA 1XMOK 1T05A 2V9PA 4BG9A 3WHBA 3THKA 2MGQA 2KGTA 4M3UA 5GAGJ 3KFWX 3T1HK 4JJNK 4FWKA 1R6RA 4KHPK 3LDPA 2DYSH 5J1UA 5T7BA 4FJGA 3R0JA 3FHZA 1X3ZB 1PD1A 4E1MA 3QWYA 1MHNA 3DLMA 4D6WA 4FM4B 2A68F 4PJOC 5D6WA 2GXBA 3GFJA 1T0JA 2LREA 3CCLT 1JLAA 3CC4A 1IG8A 1PUFB 2L3PA 3SHFA 1QWEA 4PJOE 3IUCA 1XGSA 2MYSA 1WKMA 4OKKA 3META 2DTRA 3M4GA 5LJ3f 1ZKGA 2JSPA 4CYDA 4M7AB 4A93J 4YOYA 1K8KB 4RLFA 3FC3A 1WGXA 1ZBHA 1RLQC 1BBZA 5EC7A 2IA2A 3F0ZA 1GVDA 2BANA 3CC2N 3UNGC 4ISFA 4M7AD 3L8BA 3DB4A 1WSIA 4K41A 3OTOK 1VQ9N 2Z1IA 4BBSJ 3ZETA 4B9MA 2CGJA 3E97A 2L54A 3FK6A 2DFIA 2DD5A 2ZGZA 2IVMA 3O8MA 1RNLA 4OPKA 4MGRA 1B6AA 2DYIA 2ITMA 3NRVA 2KY9A 2F8SA 3GIBA 4KH4A 3BG6A 3HSCA