3S3NA

Crystal structure of the prototype foamy virus (pfv) s217h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSHGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV integrase
publication title Structural and Functional Analyses of the Second-Generation Integrase Strand Transfer Inhibitor Dolutegravir (S/GSK1349572).
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase/inhibitor/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3s3nA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3s3nA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3s3nA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3s3nA03
3ULDA 4Z4FA 2GFUA 2RPIA 1SKSA 2JLEA 5CZ1A 1YTUA 4FLYA 4E7IA 3TARA 5CYQA 3PO4A 4O0IA 1S6QA 3QLHA 4Z4GA 4O55A 1RT6A 1HRHA 4CJQA 1DLOA 3LZIA 3S9HA 3V9XA 1SL2A 1A5XA 3HPOA 4N4IA 3MEVA 3WNEA 4M3TA 4CF8A 3RRHA 1TV6A 3ZT0A 3TAGA 1K6YA 4K8ZA 2PYLA 2W42A 4QQ6A 3AVCA 3L2QA 1T03A 4DFPA 3QEPA 4B9VA 1UA0A 4BD3A 2R7YA 3FEOA 1NKCA 1SUQA 3VQQA 3SCXA 1H3ZA 4B8AB 1U49A 4KTWA 4FJ5A 3RMBA 4ELTA 3ZSZA 2RO0A 3UIQA 1O1WA 1JXBA 4DQQA 1QSSA 3AVNA 2RI2A 3VQBA 3PX0A 2HB5A 3CM6A 3RMAA 3QESA 3K5LA 2HNYA 1DTTA 2F5KA 4A4EA 5SZTA 4CF2A 3VQ4A 5KE3A 4GVMA 4NCBA 3KLEA 1Z25A 4II1A 1LAVA 5KE2A 2EKOA 3OQ5A 4HHTA 2GUIA 4I9LA 4KHSA 2YNFA 3NF6A 1VSMA 4KAZA 1JXEA 3HSTB 3LWMA 2HW3A 1B9DA 1D8YA 4ELUA 5C0MA 2E6LA 4AHSA 2HVIA 2YHAA 3LDSA 1TKZA 3MEDA 4PLLA 4AH9A 3M8PA 5IN1A 3E9GA 1EETA 1L3TA 1ZBLA 3RR7A 3L42A 3KUFA 4Y1DA 1SKWA 3D0PA 3AA2A 3NGYA 1KLMA 3IRXA 2Y1IA 4Z4EA 3M8SA 3DLEA 3AVFA 4FJ9A 3K58A 4FZZA 2P51A 4M3WA 4OVLA 4FM1A 5FRMA 1HPZA 4DQRA 3AVGA 4C8NA 2ATQA 3IAYA 2KQ2A 4CJVA 2IG0A 2EQKA 1HYSA 3ZSRA 4R5PA 5DK5A 1OYXA 2EQUA 4NYNA 1EX4A 3OB9A 3OY9A 5CZ2A 2M16A 4CJFA 3V4IA 3ZT4A 2FBYA 3OYEA 4DSFA 3KD5E 4CEOA 4CJ4A 1YTAA 1BCOA 1Q9XA 2IGIA 3KKRA 2K3YA 3SNNA 4BWJA 4FJJA 4DFJA 2QQSA 4JRQA 1QE1A 4I7FA 4DU3A 2XY8A 3DRPA 3OYMA 2LVMA 1RDCA 3PY8A 5KTQA 2BGGA 3LLRA 3ZT2A 1Q8IA 3B6OA 3K5MA 1WSHA 5SWMA 2RI5A 4CRIA 4BACA 3WNGA 3META 2XDPA 5FROA 5J2MA 3QINA 4B9NA 4CHPA 3T1AA 5EU7A 2X4YA 2XRIA 4IG3A 2B6AA 3K2PA 1QSLA 2ZQBA 2XY7A 1WSIA 4DFMA 4E7JA 4CE9A 1S1UA 1D5AA 4KI6A 3MP6A 3LWLA 1ZYQA 4IURA 1Q9YA 1J5OA 4OLAA 2E5QA 2HHWA 4CJSA 4QCLA 3QNOA 4L8RB 3CFPA 4DSEA 4KHNA 4IUVA 2L89A 1S1VA 1RT1A 1FKPA 3AA3A 2HHXA 2EQMA 1C6VA 3QIPA 1XC9A 3S6WA 2K3XA 1TGOA 4CCHA 2DAQA 4RW8A 2PYJA 2YHBA 4CK3A 3C6UA 1WNSA 5KI6A 2BDPA 4W5QA 2WOMA 1NKBA 1RNHA 3WNFA 5KRSA 3TAFA 3OYHA 4O5BA 3JSMA 1HYZA 1D9DA 3AVBA 3F9KA 2R5MA 4F8RA 5D6XA 4B9SA 4CGDA 5E41A 4HUFA 3SJJA 4LH5A 5J2PA 3QJ6A 1DTQA 5C24A 4HUGA 3AO4A 2P0KA 1BI4A 4LY7A 4B8CA 4B9TA 3ISNC 1TL1A 4GMJB 4MFBA 4NYFA 4CHZA 3KK3A 4HTUA 3VQPA 4MQ3A 5K14A 4E3SA 1NK0A 1JKHA 2EX3A 1WJRA 4CIFA 1WSEA 4KHQA 3AVLA 1GOCA 1RDBA 3MO8A 4FM0A 2OA8A 4YFUA 4DSKA 3PUFA 4E1NA 3ZCMA 2O4XA 1NK8A 2FBTA 2LRQA 3VA0A 1JLEA 3V81A 4RW7A 3L2RA 5HBMA 3AO2A 2M0OA 4KV8A 3NGIA 1B92A 2HHUA 2OPPA 2XK0A 3PMTA 4HCZA 2X78A 1L3UA 4CFDA 3B6PA 3K5NA 3AO5A 2A1SA 3CFOA 1ZBIA 3C6TA 5KGWA 2BIVA 3SI6A 4I2QA 4W5RA 2X4XA 4FK0A 4N56A 1IO2A 4G1QA 4FXDA 4CFBA 2DY4A 2JGUA 3SV4A 1KFDA 4O0JA 4IG0A 3LGLA 4C5GA 1VRUA 3NF9A 3WNHA 5C42A 4IFYA 3TR8A 3HO1A 4CF0A 3AVHA 2G8KA 2OZMA 1IKYA 4M3RA 3AA4A 2ZD1A 3QO9A 2P5OA 1G15A 2DFHA 4M41A 3HK2A 3DB3A 4WE1A 3SUPA 1JL1A 1IG9A 3DYAA 4AILC 3OMCA 2VG5A 1ASWA 3F70A 5M9OA 4FLWA 1VSKA 2FC0A 3F73A 2HNZA 2D0BA 3M8RA 1RBRA 4C8LA 3LP2A 4H4MA 4KB0A 4CECA 4OGEA 1R0AA 4X34A 2B4JA 4IUQA 4E89A 3KD1E 4E7KA 1RT3A 3NH0A 4EP4A 3MXIA 2GFAA 1TVRA 2G8WA 1RTDA 4KTQA 3QKJA 4RW6A 3ITHA 3LZJA 2RHXA 1JLBA 4DTOA 3QEWA 2OPQA 1YVUA 3PNWC 4F4KA 1C0UA 3TANA 2XY6A 3ZT1A 1XWLA 3IG1A 4KHUA 4CJWA 2E6NA 2P1JA 3OYCA 4DTXA 1RILA 4CEBA 1QQCA 4CIGA 3MEWA 4AHTA 2IS3A 5HP1A 1RBUA 4F2RA 3SQ2A 3QNNA 5HRPA 1TK0A 4CEEA 2HQXA 2RJDA 4FW2A 1T7PA 1KFSA 2G8IA 4M3XA 1U48A 4O44A 4FJMA 3M9QA 4CEQA 3U3YA 2L8DA 4N4GA 1F21A 4M3UA 1S6PA 4HCBA 3ZSVA 1QHTA 1NJZA 1WSFA 3T19A 4E19A 4FK2A 3VQ8A 3L2UA 4OKKA 2NLUA 1BI4B 3AVMA 4Z4IA 4YNQA 3KIOA 2QKKA 4OPJA 4ZTJA 4C5EA 1UWBA 3NGZA 5T7BA 3OS2A 3NH1A 4NZGA 4ZTFA 5J39A 3TI0A 4LH4A 1N6QA 2BE2A 4CJKA 2G8UA 4B3OA 3OJSA 3E9FA 3V9WA 2RKIA 1ITGA 2KTQA 4DLEA 2L3RA 3MXMA 2HVHA 3DLGA 2O4XB 4B9WA 4N41A 3NAEA 2JTFA 2VYTA 4E7HA 2EHGA 1G5VA 1WJSA 2BUDA 1TKTA 5CIUA 3VQAA 4C8KA 1A5WA 4CEZA 4DF4A 3AV9A 3DM2A 4QW2A 3AO1A 3OYGA 4Q5WA 1VK0A 3HT3A 4CEDA 3VQ6A 1RDDA 4DF8A 4FJLA 1WSGA 1Z26A 2DFEA 1LWCA 3QIOA 4DTUA 4PQUA 1BISA 2QK9A 4KHYA 3LP1A 4FU6A 3O4NA 4NS5A 3KLFA 3I0SA 2FBVA 4JLHA 3V9ZA 2X74A 3VA3A 4J2BA 3THVA 3HPGA 1IH7A 4A4FA 3CYMA 1VSEA 2LDMA 2D0AA 3LANA 1BHLA 4J2AA 4N5SA 4UC4A 4N4HA 4W5OA 2XO7A 4CGIA 4AHVA 2B5JA 2VG7A 4IFVA 4DTPA 4QQDA 4FJNA 1SSFA 3OYFA 4OJRA 2YKMA 1A5VA 3QEIA 5KCOA 1C0TA 3DB4A 3OYNA 3AVAA 4DSJA 1X1PA 2YNHA 4LSNA 3SZ2A 5C6SA 3QIIA 4Y1CA 3DMJA 5D6WA 5I3UA 3V1RA 4IUPA 3P5JA 1TAUA 2KFZA 2E4LA 3QEVA 4BWMA 1FKOA 1UA1A 2LSNA 4K8XA 4C5IA 3ME9A 3G0ZA 4DU4A 4OVAA 4CGHA 3K5OA 1SL1A 3UWNA 1LWEA 3AVIA 3E01A 1B9FA 4CHYA 3S3OA 3HP6A 3NH2A 3OYIA 4FK4A 1QTMA 2Z1IA 3C94A 2KW4A 4RG2A 2RHIA 4N47A 3L3VA 1EXQA 1VSHA 3EZ5A 2RHUA 2X4WA 3DLMA 3U3GA 2F8TA 2M1HA 3LP3A 3P1GA 4KKOA 3DOKA 4JS5A 4B9MA 5DMRA 5HRSA 3KKSA 2YNIA 3UT1A 3MP1A 2LCCA 3QETA 2HMIA 3OS1A 4FJ7A 4OKEA 1T05A 1KHCA 1NJXA 3CG7A 3HL8A 4EP5A 2WONA 1QSYA 4DS5A 3L2WA 2OZSA 3OYKA 1L5UA 2R57A 2Z1HA 4FYDA 2FBXA 1U04A 3HXMA 3DLKA 2OPSA 4HVJA 3TAEA 2CKKA 4FLXA 3DI6A 3OYBA 4CK2A 4KTZA 1JLGA 4DTRA 4DU1A 1I3AA 4CJEA 1XNIA 3H8ZA 1CXUA 2RF2A 4PA1A 1VSLA 2B8AA 3BGRA 2YNGA 4C5HA 4FL6A 4H8KA 2IOCA 4EZ9A 3DLHA 5KGXA 3KLHA 3AVKA 4CIEA 3DLBA 3I0RA 4JRPA 2KFNA 2DFFA 3O8VA 1RT4A 1RCHA 4CERA 4CEAA 3IS9A 4DMNA 3KLGA 2GF7A 4KHWA 4O4GA 4F3OA 3L8BA 3ZSYA 1W9HA 2VWKA 1NK5A 3TWHA 1C1AA 1S1TA 3NCIA 4W5NA 1N5YA 2VG6A 4ID5A 3RMCA 5J26A 1KSPA 2YRVA 3P83D 1BIZA 1VRTA 1KTQA 3OJUA 3CEYA 2X6NA 1X9SA 4M42A 3PO5A 2YV0X 4RW9A 2IC3A 2F8SA 4I2PA 1HNVA 3JYTA 3T3FA 1HMVA 2RJFA 5HLFA 2X6SA 1LV5A 1REVA 1S1XA 2IAJA 4FCYA 4E1MA 3OVNA 3V9UA 4FZXC 3OYJA 3NF8A 1RBSA 4PWDA 4AHRA 5JS2A 2NUBA 3RMDA 4CFCA 3AVJA 3NF7A 4C8MA 1RDAA 3TAPA 3QERA 1WAFA 1KLNA 3ASMA 1WN7A 3AA5X 4J2EA 3LX7A 3SYZA 3SQ4A 3V6DA 4DTNA 2A1RA 3OA6A 2GBZA 1SL0A 2O4IA 1IKWA 1ZBHA 4HCCA 1W0HA 3K57A 1CXQA 2BANA 2AJQA 3VQ9A 4BDYA 2MWOA 3L3UA 1RBTA 1JLAA 1X9MA 3FLGA 4CHOA 1NK4A 4ICLA 5HRRA 3V9SA 2P5GA 2RJEA 4QAGA 3SQ0A 3EAEA 4FZYA 4EZ6A 4DTJA 4IBNA 2RHZA 2G8HA 4BE0A 3MEUA 4M45A 3AO3A 5J1EA 3A2FA 2QXFA 2HQEA 1FK9A 4BE2A 1LWFA 3O3HA 4B9UA 1BIUA 4IUUA 4ZHRA 3PFSA 4GW6A 3FC3A 1RTJA 4FW1A 3TAMA 3V1OA 3OS0A 4OKJA 4FLTA 4NCAA 5KH6A 4FM2A 4XIUA 1VSIA 4PUOA 2WACA 3SUQA 1TKDA 4KFBA 4DTMA 3NDKA 3LYIA 4RW4A 1RT5A 1NK9A 4DSLA 3BDLA 1BCMA 3V1QA 3O3GA 1UAXA 5HRNA 3DOLA 3LP0A 1TK8A 4OPKA 1N27A 2R58A 4CF1A 1KRPA 1EKEA 2HHTA 2IDOA 5D3GA 1GOAA 4DQPA 3NTHA 2RI3A 5FDLA 1IKXA 3ZEHA 3K59A 3NBPA 2KZZA 1UOCA 1IKVA 3OMGA 4FJ8A 1SKRA 4KRFA 3LALA 3VQ7A 5JS1A 1NK6A 1LW2A 4AHCA 1HQEA 4H4OA 4ELVA 3PV8A 4E0DA 2LTOA 2DIGA 4BE1A 4KO0A 4CJTA 5C25A 4Q0BA 1BGXT 2YKNA 3ZSQA 2RN2A 3H6ZA 3Q1JA 4PY5A 1D9FA 1XI1A 1JLCA 1OZ2A 1Y97A 1NOYA 3S3MA 4QVZA 1JL2A 3CM5A 1KVCA 4OGCA 3M8QA 2FHDA 4FJKA 3P8DA 3RTVA 2HNDA 4B08A 4TSXA 1EP4A 4QOZB 3DLRA 3KK2A 4CFAA 4A4GA 1VSJA 1BQNA 5IAYA 5KRTA 4Q5VA 4LSLA 4ID1A 1S9EA 2XY5A 3RRGA 4FLZA 4FLUA 2PZSA 5CYMA 1KCFA 1FXXA 1TKXA 3VQCA 1RT2A 3KLIA 3ZSWA 1LW0A 4KPYA 3BDPA 3D45A 1ZBFA 4B9XA 3MEAA 3FFIA 2KZMA 5I42A 3S3NA 1NJYA 4IDKA 5KCHA 1MHNA 1XHZA 4FJXA 3ZSXA 5D6YA 1RBVA 3HPHA 2E6MA 3NE6A 2D5RA 4CGGA 1TK5A 1WJQA 2RHYA 3MAQA 3C95A 1ASUA 3SPZA 1RTHA 2DIQA 3OYAA 3H08A 3U6FA 3KJVA 2F96A 1RT7A 1S1WA 4LD0A 3DRRA 1WGSA 3KK1A 3LGFA 3KTQA 4CHNA 2D0CA 1HYVA 1NOZA 3OYLA 2Z1JA 2G8FA 2BKDN 5J2NA 3LPTA 4FJGA 3TABA 2JZ2A 1JLQA 2ITGA 4HUEA 4UQGA 1CLQA 2QQRA 3G10A 4PLIA 1OZ3A 4CJ5A 3SD4A 4M3YA 4AHUA 4CF9A 4B9LA 1ZBUA 3HJFA 4CJ3A 4PL6A 5FRNA 3VQ5A 4OLBA 4IKFA 1OI1A 1CZBA 5J2QA 1J9AA 4BDZA 4F3TA 1HJRA 1WAJA 1U4BA 3DRSA 1KVBA 3QBYA 3EYZA 2VWJA 1X9WA 3NNQA 3VN5A 2PQWA 3TAQA 1WLJA 3LH0A 1WSJA 3O3FA 4I9QA 3SUOA 3RWUA 3LAKA 3P8HA 2G3RA 4CK1A 1YT3A 4FJIA 4E7LA 1C1CA 4DG1A 4Z0UA 3LAMA 4DQSA 4FLVA 1S9GA 2GV9A 1L3SA 1I39A 3NTIA 4LD6A 3MEGA 4CJPA 3MXJA 1RI0A 3EY1A 3HVRA 4CESA 3MEEA 3FDRA 4KI4A 3MP8A 4Z4HA 4F2SA 3ASKA 4W5TA 2QKBA 2I5JA 1NK7A 2HHQA 4KREA 4KB1A 2G8VA 4DS4A 1J54A 1L3VA 1XHXA 3VQDA 3HM9A 4DLGA 1LAWA 4C8OA 4CJLA 4FVMA 3C4SA 3NTKA 4DWIA 1RTIA 3RR8A 2ETJA 1S5JA 1BL3A 1T8EA 3MECA 2R5AA 5CY4A 4DQIA 2DTUA 4Z02A 3PX4A 4CGFA 4DFKA 4NCGA 5HROA 1C0MA 4CJUA 1JLFA 4CGJA 4BDPA 4CEFA 2EQJA 1TAQA 3SQ1A 1NKEA 3HVTA 3O4QA 3CFRA 1J53A 2HHSA 3HYFA 3PMIA 1C1BA 3HP9A 2Y1JA 1GOBA 4CJRA 3SUNA 4IUTA 2MWPA 1HQUA 2Q3SA 3SV3A 3ZSOA 4CHQA 4J2DA 2EFIA 4M3ZA 3QEXA 1HNIA 2OPRA 3LPUA 2XHBA 1KVAA 3NHGA 4Z4CA 3SPYA 4EDUA 1CZ9A 4L59A 2OYQA 2PY5A 4A4HA 1BQMA 1U47A 3OYDA 1U45A 1MU2A 3PX6A 1VSFA 4GY5A 3NFAA 4JS4A 2Z1GA 4FJHA 1NJWA 1SV5A 3ZT3A 2D9TA 4RG8A 1VSDA 1ASVA 2ZE2A 3L2VA 4QQGA 1QS4A 4DTSA 4N76A 2HHVA 3ALYA 2O4GA 2RJCA 2X35A 3I8DA 4DSIA 3VQEA 3GOXA 3CQ8A 1TL3A
chains in the Genus database with same CATH superfamily
1WXTA 4NO7A 2H94A 3W6JB 4E7IA 3RMSA 2OAZA 4NB5A 4XU2A 3PO4A 5CAIA 4IOXA 1YCYA 1V3FA 4RCHA 3HPWA 3ZFJA 4JI1K 3KXTA 2ZGZA 1S22A 3M4GA 4F3QA 4K41A 2RQUA 1SL2A 4E2FB 3VEOA 1P7MA 3A0HC 2A7YA 2JOYA 1VQLN 3BROA 1TV6A 3ZT0A 4R79A 1X1AA 3QRFF 3G71T 1Y1VJ 2W42A 2NRTA 2J06A 2P7VB 3WTWC 4BRMA 3LSPA 3AVCA 2A07F 2ECBA 4GNIA 4RMNA 1WZ2A 5FKLA 5KQ8A 1KQ0A 3KP4A 1XGNA 3EDPA 4FJ5A 5CJ9A 2ZPIB 1DQUA 1ACIA 4AYBA 4NC7A 4WQ4A 4M72A 4IDHA 4JI4K 2ZB9A 4B22A 2GAUA 2RI2A 3VQBA 1E2XA 2E1OA 3U23A 3L6QA 3I59B 3OR1C 3RMAA 5LHIA 3QESA 1KHIA 4HSBA 1IG7A 2PI0A 4L18B 1Q18A 2K5FA 1Z21A 4UHTA 4F7UF 1Z25A 3KZYA 3MWPA 2J05A 4HHTA 2GUIA 3GMEA 4I9LA 2VQFK 2Q1NA 1S9HA 3NF6A 1JKQC 2XVCA 4KAZA 1JXEA 4EV0A 3HSTB 1GCQC 4B1ZA 1IXRC 4W97A 3DKXA 3M0RA 3G1LA 2HW3A 4M7YA 5J1UA 2ZF5O 5JI6A 1KC8C 5C0MA 1T6CA 2HVIA 1TKZA 2MC3A 5GAMd 4KMUX 4JOMA 2DE0X 3DFGA 5CKBA 3KVGA 3MEDA 3M8PA 5K5RA 2EINH 1ZBLA 3HTUA 1OFCX 1T3VA 2P9PB 4AVZA 5LJ5g 2CUDA 3EUAA 3NGYA 2CZ7B 2EYQA 2RK1A 1Q81R 3O8GA 1VQLQ 3CDLA 4MDBA 3CJ1A 2WUSA 4FWMA 2RV8A 3CP8A 4PGGA 3KETA 2ATCB 4FJ9A 4PHTX 2MPXC 3CUOA 2JM8A 4OVLA 2J5PA 4BRGA 5FB2A 2QWRA 4HV5A 3HOVJ 1WI9A 1JB0E 4FM1A 1QA6A 3MPUB 3VRYA 4CCOA 5IOZA 4DQRA 2KQ2A 2IG0A 1BJAA 5AZIB 5DK5A 1MV3A 3WVEB 3I5UA 2MI6A 3BG3A 1OJLA 3VU3C 3OB9A 2VJIA 5AR0A 3G6EN 5IOYA 2E6ZA 3CQYA 3OYEA 4DSFA 3KD5E 1B9MA 2HVRA 1EV7A 4FSSA 1VIFA 4DIQA 1OU9A 4BR2A 3VB2A 1YITN 5D4SA 1VQ9A 1BCOA 4C92A 4CI0C 2IGIA 4G6TB 4M74A 2K3YA 3J8AA 4Z89A 2WSCE 3O3KA 1ZSZC 4FJJA 4DFJA 1UHFA 3FWEA 1QE1A 4DR2K 4J6YA 3TO9A 2E8AA 1MBJA 3VEPA 1K9MC 2BGGA 4UVAA 3HZJA 2KR3A 4EJUA 5H2FC 1SVMA 2AA4A 2PBIA 3EG9B 3M0UA 4F7UE 3R0AA 2OCEA 2FJ1A 1TUDA 1U2VB 4IEEA 2HBMA 3CETA 2DA1A 2F48A 2QXLA 5FROA 3H0IA 5K7ZA 5I2MA 3RKWA 1T44A 3F2KA 4E1JA 4FWPA 2E20A 1VQOQ 1YW8A 4I6ZA 3EFOB 1RFQA 1XCBA 3JRGA 1KAZA 3CCEA 3CCJA 2XY7A 2PLYA 1VQ9I 5AN4A 1JJ2S 1D5AA 3N0UA 3MP6A 3OWTA 3P39A 4IURA 1Q9YA 2EJRA 4FWRA 1J5OA 2KIUA 4BRIA 1ETYA 1D5YA 3VTHA 3B02A 4IOAL 4FE4A 1U2WA 2L89A 3HOUJ 1FX7A 2JA8J 1FKPA 4XLNF 3AG1H 2JA5J 2YS9A 3GG4A 2WB1A 3I59A 2EZKA 3S6WA 1TGOA 2FLOA 2E65A 2D1XA 3A5LC 5DD8A 2PYJA 2JTMA 2YHBA 1I4K1 4J9CA 3W2VA 3H3ZA 4CJ7A 1Q81U 3JCMX 1YITQ 3S32A 2RVCA 4I09A 4NQWB 3T8RA 3JCMe 4TV7A 4M77F 1D9DA 3AVBA 3CCEI 3ULQB 5AQOA 1Y71A 5D6XA 4B9SA 4FQGA 5HY6A 3QQAA 4RLQA 1X2KA 3LW5E 5C24A 1OPKA 1R5ID 3BR0A 4LJZF 3AO4A 1QNTA 4LY7A 2KPMA 1N36K 3FMSA 3LA7A 4B8CA 2YCHA 4GMJB 4YHHK 1NK3P 2FZGB 4M3BA 4NYFA 1M4ZA 4Y0WA 3J7AO 1HKGA 4MQ3A 5L3FA 5AJ3K 3R61A 1NK0A 1GLBG 4B9QA 1VQOI 4YOTA 1X3MA 1JKHA 4JKHA 4CIFA 2O5RA 1WSEA 4KHQA 4BRKA 2LJ0A 1GOCA 4BY7J 1RDBA 1N8RC 4WQ5C 1WGXA 4YEJA 2TDXA 1FWZA 3MX5A 5GANf 3ZCMA 2XRLA 2LT1A 2GEMA 3M1CA 1GCQA 3TOAA 4H03B 1RR8C 1XS9A 1VQ5T 2RA2A 3CCRA 5HBMA 2CP5A 2V9PA 4D8DA 4UUSB 5CE3A 2M8EA 2OD5A 5F64A 4AFSC 1X9JA 2EW3A 1L3UA 4OPAA 4CFDA 3B6PA 4EJTA 2HQNA 3AO5A 2JWTA 1BWFO 3AT1B 2A1SA 1ZBIA 3FXLA 2LY2A 4KIBA 5F04A 5AQPA 3SI6A 1PU8A 4C8QC 4W5RA 3ZETB 4WX9A 4N56A 1IO2A 5ICFA 1ZRFA 2ROTA 4LFCK 5GANj 5A2QO 2AT1B 3EL2A 2DRMA 1UGVA 2EA2A 2RF0A 4CFBA 2L7FP 1K1ZA 4O0JA 3HOYJ 2DA6A 1AWCA 3LGLA 3FSPA 1W2BA 5EXWA 5GAEP 3NF9A 2MGQA 3WNHA 2BZYA 1KG6A 1NHAA 1S3XA 2E12A 1QCNA 4IFYA 3TR8A 5FU6B 3HO1A 4ENMA 4CF0A 4BR4A 3TU5A 1K78B 5GAN4 2NAZA 1U2VA 4BNCA 1WBDA 1XMOK 1M1KR 3GXOA 4HCKA 1K4TA 4LC9B 3O08A 2XGXA 1JL1A 1UGRB 3NVMA 1IG9A 2O9LA 3OMCA 1H8KA 2VG5A 1P4WA 2K86A 4L9JA 5C44J 2QKMB 2HNZA 2D0BA 1XDSA 1QVUA 4C8LA 2BOLA 1NBWA 2DOAA 1A0NB 3B6CA 2Y2ZA 1MBFA 2DOFA 2UXDK 1R0AA 4X34A 3O9TA 3OTOK 5IY5H 5FJ8J 2CUZA 2AS5F 4E7KA 1RT3A 3NH0A 2M3AA 2NRZA 5CKFA 4EP4A 1NBEB 3I56Q 4XLAA 2O03A 1YWPA 2LC4A 2CGLA 1QU3A 4RLFA 5L3BA 2PMZA 4RW6A 4CBUA 2FYKA 3BTIA 1JLBA 4FYVB 3JS6A 3CF2A 2JW4A 1YVUA 2XY6A 3ZT1A 3D2EA 5GAMf 3IG1A 1NEGA 4CJWA 5C15A 4M6XA 4C92F 1RILA 3ERED 2Z1DA 3FXJA 1WHHA 4LN2A 2J6FA 2O88A 5HL7L 1WDXA 4BRHA 4AHTA 4BRAA 5D4RA 3VYGA 2L9RA 3QNNA 1TK0A 2UU9K 1Y0UA 5B3SH 3J81K 2JJ7A 4LDWA 1U1TA 4P9UA 3NWSA 4XH5A 3HSCA 3DF8A 5JFRA 2G8IA 5GAMj 1ITYA 3M5AA 4BGBA 3JSCA 3CCSA 3M1FA 2ZPBB 2G7HA 2NRVA 4O44A 4WXHA 1SD4A 1YBYA 4FJMA 3JCMh 2EAYA 2GXGA 4CEQA 2CQKA 1LE8B 2L8DA 3C7NB 3QMLA 1F21A 2QGUA 1K9MU 5GPCA 1YQAA 5E79C 4HXJA 2M34A 3H9JA 1S6PA 4HCBA 3ZSVA 2CYZB 5E1XA 3T19A 3PO3J 5FU7B 3C6AA 1X75C 3I0TA 1M2VB 4E19A 1SAZA 3LNQA 1LDDA 1FYKA 2YSQA 1BI3A 4Z4IA 2GGRA 4DHYA 5TJJA 4KN7X 3NGZA 2O8EB 2DBMA 4B1RA 2E64A 4BEHA 3NH1A 4UUSA 3BR1A 1CGPA 1O75A 4G7ZF 3TI0A 2XAGA 1AZEA 1SAXA 1Q86R 1M1KU 4F92B 3GWZA 4XNFA 2XHIA 1TUYA 2G8UA 1UB4A 3EGUA 1ABQA 1XDUA 1IRGA 3V9WA 2Q0UA 2XICA 1RI9A 4HSRA 1ITGA 2KDOA 5IHIA 2KTQA 3CCSI 3G1JA 4DUZK 1SF9A 5GAN3 3PLAA 5JLWA 2E1YA 2LYCA 2ZPGB 1SMYF 2C0OA 4WQ5A 1FIAA 4NXNK 4DYCA 1PCXA 3WU1B 4N41A 3NAEA 3AHUA 3VOEA 1PYVA 4A2BA 1NGGA 2W10A 2GXAA 4IOAF 4HDUA 1M30A 3ER0A 2CFXA 4LIVA 1E4FT 3K9TA 1WJSA 3OSVA 4X0GA 3NVKA 3FZKA 5CIUA 3RZDJ 4K2EA 3GIBA 1A5WA 4CEZA 4D7NA 3AV9A 3DM2A 3CJRB 3GTQJ 1P7IA 3OYGA 3O9QA 1KU9A 5GAOm 1VK0A 3HT3A 2B9SA 1OH7A 4CEDA 1F4KA 4C92E 4DF8A 1WSGA 1I6XA 4HTLA 1KQSS 2CW0F 2LMJA 4CI6A 2Z9OA 4KH1B 1LWCA 2Q1ZB 2W25A 3CCQT 3WGIA 2Y69H 3ZQHA 2LVSA 1ETVA 2VWBA 2V1XA 4KHYA 1LVKA 3CPWM 3LSMA 4GXOA 3LP1A 2M1BA 1U3OA 4MZPA 1W5SA 2XI9A 1A31A 4G9YA 4MMKA 4JLHA 1A5JA 4QWQA 4CCKA 1R1UA 3WTZA 2OI3A 4JZ4A 2E5NA 2LY9A 2VKNA 4J2BA 4MQVA 4DR3K 3OBWA 3CYMA 3E7LA 2DTHA 3R3LA 2NVYJ 5HCKA 1N8RU 3L0QA 2RD1A 1BHLA 1T95A 2E7WA 4IF4A 4HNUA 4N5SA 4UC4A 4CD3A 2MBFA 4DJAA 1D5VA 4H0OA 3FFKB 2XO7A 1IDYA 2QENA 4AHVA 3ZOBA 2VG7A 4QQDA 2YKMA 2P6SA 5ED4A 3F23A 1NGEA 2E2OA 3QEIA 3CDHA 5KCOA 2AZSA 1PP7U 4DSJA 2DXIA 3S2WA 1B72B 5FKOA 3WTTC 1K8KB 1PUFB 3DMJA 1FTZA 3R8EA 1EJ9A 1IRXA 1YIOA 4QS7A 1FKOA 4ME7A 2LSNA 5L23A 4EMGA 2QLZA 3R1XA 3MD2A 4OVAA 4DV0K 1R0CB 2GIVA 3E9PA 1LWEA 3B73A 4V2SA 3BG6A 4CHYA 2EIFA 4RTFD 5TKWA 1MWKA 3NH2A 3C12A 4FK4A 1QTMA 4JK8A 2X3XD 2IS1A 3M0PA 5CCAA 3VYHB 3A98A 2W84A 4ZN3A 2ESWA 4N47A 3LMMA 2WY7Q 3SDGA 3CO6C 2P5LC 1EXQA 1QPIA 1SD7A 5D8LB 2M1HA 1WHKA 2LLKA 3LP3A 4V2GA 1OOTA 2VBWA 1SS6A 4B9MA 5DMRA 5EG0A 2E2HJ 2LCCA 3DBLB 2ZPHB 2EV5A 5LHHA 4FJ7A 2MABA 3HRMA 3JTGA 3CG7A 2KMUA 3WU2C 1MMAA 4EM0B 1FIPA 1ZXOA 5K5OA 4OOIA 1S8NA 2P5VA 4PKCC 5BRDA 4PZJA 2OZSA 1P90A 4YOXA 3C2BA 3HXMA 1N77A 4NUBA 2K79A 2X0LA 4HA8A 3VUZA 2F69A 3S17J 1J59A 2COBA 4BU2A 2HQ5A 1I1JA 4DU1A 3SDBA 2MIOA 4JPBW 3E6MA 4Q48A 4KH5A 3HSEA 1VUBA 2RQRA 1AEYA 3EO3A 1IV8A 4OAYA 2W40A 1QQJA 5J4YA 1VSLA 3U9GA 2QQ8A 2YNGA 4BC4A 2LNHB 4C5HA 3EFRA 4WF2A 4EZ9A 3LFKA 2LK2A 2EYWA 1XB4A 1YW9A 3OW2M 1BA1A 4DV6K 3I55A 3DLHA 4ZYDA 3KLHA 1S72I 1VQMN 3CQZJ 3DP7A 2H56A 2DFFA 3O8VA 4XTUA 2H3EB 2XPUA 3RKYA 4V19S 5FLXE 2SEMA 3JB9H 4LB6B 3UKRB 2JTEA 3M58A 1G8XA 4C2MJ 4M7AG 3IS9A 1R71A 3OHRA 2CV2A 1ETQA 5CVRA 2DTOA 1MJAA 2UXXA 5A2QZ 4V19K 2KI7A 1HXDA 3L8BA 2GBQA 3K2ZA 1FP2A 3KP5A 4OO1J 1K7AA 2XHCA 1H1VA 2V1QA 1N5YA 4BRNA 4A93J 2A05A 5J26A 1OX9A 1F1BB 4EQQA 4U67L 1YJNT 3G71A 2R4GA 3MN2A 1FN7A 3P83D 1BIZA 2IXSA 2KXCA 4WCIA 2X6NA 3AFHA 2W41A 3FHZA 4XICA 2WSFE 4RAZA 3I55I 2IBDA 1BUPA 4M42A 3S15J 3CJ9A 2IC3A 4AM7A 2F8SA 2XAQA 2LMDA 1EO1A 2OTLT 2CUJA 4WFNL 3T3FA 3VF2A 1HMVA 2KSSA 2BW3B 1ZC6A 2DPDA 5HLFA 3PNVA 2X48A 1FY7A 3CDIA 4MEXF 2HAXA 1K79A 1T8IA 1Y39A 1ZQ1A 4FCYA 1BI0A 4MO4A 4E1MA 3IRRA 1B72A 2WFBA 3P4IA 1ABOA 3OYJA 3EUHA 1YUWA 5ILUA 1O57A 1IB8A 3ELKA 2EFNA 4U0WA 3REBB 1K8AO 5AIQA 2GTJA 2QDYB 4E6KG 2Y9YA 2EILH 5GJWB 3GW2A 4AVPA 1IRFA 3ASMA 2IVOA 3G71I 2KRFA 4J2EA 3SQ4A 3V6DA 4DTNA 4ASNA 1P59A 1VQMQ 3H0FA 1VQNT 3ATUA 2JMAA 1SVOA 1TQPA 1Q1HA 4A3IJ 4B21A 3VQ9A 4FX4A 2YRDA 3NRVA 2GWKA 2OBPA 1WHGA 1R5HA 4OX9K 4EEFG 3CCVN 3FLGA 2K3FA 1NK4A 4OMFB 4ICLA 2Z2SB 5HRRA 4A69C 1KG7A 2Y0MA 2RHKA 3SQ0A 3EAEA 1U0JA 3G3ZA 3JV3A 4OIRF 2EIMH 4JRKA 3ZGKA 3JCMP 2YXYA 3KFVA 1YJWT 1BOTO 4JLGA 1NGBA 2LD5A 5K7HA 3QYFA 4BE0A 2HQEA 1AZGB 1RETA 1LWFA 2QWWA 3O3HA 1VZ0A 2FQ3A 1Z1DA 3THXB 1SRLA 3EYIA 1X3ZB 3RZOJ 5F27A 3THWB 3ABLH 1SHGA 4NCAA 3A5ZB 2NVQJ 5GAN2 4FWSA 4BKXA 3CCMT 4WWCA 5KYNA 3EYYA 3BY7A 4Q4ZF 4PUOA 3CCJN 5FKNA 2E1MC 1QGPA 2G0EA 4UOBA 2E71A 4XSXF 2JA7J 2KLOA 1BCMA 1C6VX 5C3EJ 2XRNA 3BG9A 5L8RE 5AQVA 1UAXA 4BC2A 2KY9A 2JN0A 2Q0RA 2L2PA 1FTTA 5C10A 1EKEA 2W82A 2HHTA 5M1FA 3ZMZA 4LF9K 2RI3A 2FBHA 4L9NA 1YP5A 3ZEHA 4A5MA 5DEQA 2VXFA 4CZJA 4OIOF 4XL9A 1BR1A 2VE9A 5JVTA 4GY2B 2L9SA 2KZZA 1UOCA 2WY8Q 1LNWA 3I64A 1S7OA 2BXYA 3SEQA 3QHSA 4KRFA 3QPTA 2YU9J 1NK6A 4AHCA 2VT2A 4A57A 3CXCA 4IOCL 4ISEA 4ELVA 3PV8A 2CS3A 4KULA 2DIGA 4EVIA 4CJTA 5E3OA 4AMCA 1OMIA 3BF3A 2Y9ZA 5IXBA 3CCVQ 1XC3A 3H6ZA 2VGMA 1QBJA 2P81A 4LLNA 2DL3A 4EHTA 2DFUA 4F7UG 1Z3YA 4QVZA 1JL2A 4PKIA 4XH4A 1YIJN 3CM5A 5L3GA 2AHQA 3T1BA 1KVCA 2A28A 3QYHB 1GLDG 4FJKA 2R7OA 2PVDB 3RTVA 4P1WA 1E3HA 3CUQC 2HNDA 1IUFA 2FE3A 4RB2C 3ML6A 3BTLA 2B63J 3O4WA 3ZEUB 2HEOA 3CCUN 2J5OA 4C8QE 3DLRA 1YI2N 3SAGA 2V52B 2DETA 4CFAA 3CXCP 4A4GA 2QM3A 3ABTA 3VS1A 3WXIA 1TWCJ 2KKOA 2K7LA 3SFZA 2H3JA 4X9DA 4OB2B 3CMAT 3THYB 3PT9A 4LSLA 1H89C 1U6ZA 2CQNA 4X6AJ 5DD4A 1KCFA 1WFWA 1FXXA 3E6BA 1RACB 3CJQB 3IV5A 1K73C 2LC2A 2H8RA 3ULEB 1M3HA 3FDYA 1SRMA 3CCRN 4PNOA 1ZBFA 5I22A 3FFIA 3S3NA 1QVGP 1NJYA 1JJ2M 5FGMA 1MHNA 1G3TA 3K1PA 4B6MA 4A0XA 5D6YA 1TUGB 3CQTA 3KNTA 3TSWA 2DODA 2HOTA 5FPNA 2D5RA 4CGGA 4KYWA 4M71A 4M7DB 1TK5A 2DPPB 2OTJN 5AT1B 2YJFA 3INZA 1RTHA 1Z77A 2ZGWA 1S1WA 2QBYA 2DO7A 4E9HA 3VEXA 3O8HA 4ABZA 2OC6A 3CC2T 3ZPLA 1DP3A 2LJ3A 2OZ6A 3RTRA 3E3VA 1OKRA 2A5YB 3TABA 2JZ2A 1JLQA 2ITGA 4HUEA 4UQGA 3HGYA 3FZLA 4GRIA 2QQRA 2QWPA 3MHXA 4FT8A 1IAWA 2ZWHA 4LF7K 5KHDA 4PLIA 4CJ5A 3SD4A 1H9GA 3ZP5A 1W2BS 1YIJQ 2AQFA 1BBZA 3THXA 1ZBUA 4CJ3A 1VQ8T 4OLBA 1TNSA 4OF1A 2XAUA 4IKFA 2HOAA 2L4AA 4AD9A 5J2QA 4FWOA 2DK3A 3CCUQ 2RKHA 4G8XA 1YJ9N 1YI2Q 5K5QA 3EG1A 2GZWA 3UNGC 2ABKA 2LREA 3DRSA 1KVBA 3QBYA 1M8MA 4ILHA 3H3NO 1X9WA 2HQAA 2ZM6K 3TAQA 1HJOA 1VQ5A 2UZKA 3GX4X 3HYIA 4C0DC 4J7IA 5HS7A 1XNQK 3LAKA 4CA0A 1YT3A 3DTEA 5E3MA 3BFMA 4E7LA 2BTTA 3J7AP 2AK5A 3MEXA 3CCRQ 4XLCA 3TW6A 3H36A 3MX2A 4LD6A 1LWVA 2HDCA 2I7PA 3FBIB 2PMZN 2CQQA 3OGDA 3SK3A 2WAFA 3CMET 4KI4A 3DU5A 2RPNA 2HVQA 5D7UA 3CCYA 3WQUA 4J9BA 2CH4W 2LTPA 1EIFA 3R6SA 2OTJQ 3HOZJ 1WJ5A 2ZNYA 2IGKA 1BOAA 2HHQA 4KREA 1GT0C 2HDAA 1CQTA 4DCHA 5J8CA 5JVHL 5CKEA 2PQ8A 2DO3A 2A0FB 2O8FA 4E9FA 4JI7K 1VQ5I 1ZGJA 1L3VA 3U9DA 3DPTA 3VQDA 3J80E 4C8OA 4CJLA 4BBRJ 5E26A 3W0LA 2P9NA 2KISA 4EJOA 3HFOA 2DXCA 3L1AA 3IRQA 4DWIA 3WTSC 1OKJA 1RTIA 2CDTA 1QZ6A 5HDGA 4RWTA 4F7ZA 3ZEUA 4JKEA 1BL3A 2MD0A 1T8EA 1KFZA 1NG9A 2R5AA 4L0ZB 3FM3A 3MN6A 2TRTA 2DTUA 1UDLA 3PX4A 4A6EA 3FB9A 3KEYA 4DFKA 1C0MA 4BS9A 3LA3A 5J3LA 1YJ9Q 3GTKJ 4BDPA 4YIIA 2XIDA 5GAOn 3MQ0A 1X6GA 1NKEA 4XAXB 2A6HF 3HVTA 3O4QA 5HNHA 4ZZLA 3G4SA 2KT8A 1MJ9A 4Z6YA 3G7ZA 1U78A 1Q7YO 4BGDA 4RCBA 4HNVA 1QCFA 4EJVA 1J5EK 3HSBA 4PKHA 1GOBA 5KN8A 3OSFA 4QVDA 3SV3A 3ZSOA 2EFIA 4M3ZA 5LJ3h 1X1DA 4OMQA 2F5VA 3RSEB 1GL5A 2XHBA 1ZUUA 3CUQA 3CP2A 2DXBA 1CZAN 1NGFA 4P96A 4EDUA 3QWYA 1FP1D 4KBOA 4A4HA 1BQMA 1RZ4A 2NOBA 4JI8K 2E19A 3FLCO 4XQFA 1KONA 1QVFA 3WTVC 1YQKA 2J6KA 3ZYYX 1WBBA 3PFYA 5KNLA 4JS4A 1RDUA 3IH2A 2C6YA 2Z1GA 2MK5A 4FJHA 3I9V2 1NJWA 4RUGA 4O5VA 3AL0C 1NWKA 3QWLA 4JZ3A 1ASVA 2ZE2A 4QQGA 3H5AA 2D45A 3AGKA 2RJCA 1UHSA 1HX1A 2NRXA 4LG0A 3MN9A 1IN4A 1X3NA 2ME0A 2AXTC 3VQEA 1TL3A 1VQ4N 4Z4FA 4BL0B 4XORA 4N9HA 1NH3A 3R60A 2Y4YA 1DU0A 2GWRA 1JCGA 3TARA 2HEQA 5CYQA 3OR2C 2AP1A 3I8BA 2XAFA 4Z4GA 2QZ8A 4O55A 1FT9A 4M6VA 1LDJA 1LWWA 3O2PE 3OL4A 2HS5A 3V8JA 3DXMB 1VQ7N 2XHKA 4BQQA 2XAJA 3S9HA 2QTDA 4IOCF 1N6AA 3VPZA 3V9XA 2QSGX 1FPQA 2ESHA 2NUPA 4RTYA 2KHOA 4PJJA 4BQAA 3HPOA 2UUCK 3MEVA 3FBNB 1GRIA 4M3TA 4X9CA 2I0NA 4E7ZA 1TOVA 2V1UA 2PYLA 2K9GA 4QQ6A 1MIJA 2A08A 4ELYC 3L2QA 5D5UB 4J19A 2WV0A 3DXKB 3AL0B 3JR9A 2E1HA 2O9SA 2WTEA 1UA0A 3MWTA 1TG0A 1T98A 2O8DB 5LL6S 1NKCA 3VQQA 2MLGA 1H3ZA 2EFPA 1JE8A 2JQ7A 4M3FA 4KTWA 2ZJPL 2GQIA 4QS9A 4BRLA 4G12A 2VKHA 2RQPA 2EH3A 3VRZA 5IPAA 1V4RA 4GDFA 4HX7A 3AVNA 3CCQQ 4IWVA 3PX0A 3T69A 4GLMA 3EE9A 4XRSG 4A4EA 4D8KA 2XG8D 1XSVA 2LBFB 2BVLA 2L0AA 1M8VA 1APLC 3E9OA 1FC3A 4GVMA 2BZTA 4NCBA 2D2WA 2H1KA 4E6RA 1LAVA 4ZYEA 4XLHA 4NL2A 5KE2A 4XONA 3H41A 2GTDA 2IS6A 4KHSA 2YNFA 1VSMA 2ZFWA 3GTGJ 1VQ6T 3CMMA 2UV1A 3UDCA 2JSPA 2VQCA 1QWFA 2VV5A 1VF9A 2DDAA 4UB6C 2XU8A 1QMCA 1VQ4Q 4B1YB 4C92G 3RYRA 4QKUA 2DI3A 1DIZA 2LF8A 2XB5A 1NLVA 3RR7A 3V7RA 3KWIA 3KUFA 2JA6J 1VQ7Q 5GIOA 3IRXA 4LMYA 2Q2EA 5EZHA 1M90R 2HPMA 4QIWN 1GCPA 1MH3A 1AWXA 3ID8A 1KQSM 3CIPA 2VI6A 4O8UA 1CF7B 2P51A 1ENHA 4KT6A 3HB9A 1USSA 1HPZA 3HHTB 3AVGA 4J01A 1WOQA 3DKYA 3SBGA 2EQKA 2NNWA 1U5TB 1P8ZA 1ZLMA 4PJMA 2QYOA 2EQUA 2HZYA 3UKGA 1AHDP 5KCMA 1FOXA 1GLFO 3CCQI 1TW2A 2IVPA 2EFQA 4PSXA 2XDDA 3FZFA 1NJIO 3M7GA 2M16A 2DZCA 3VEYA 1ORPA 1ZBXA 3UA6A 5JHUA 1PSEA 4RAYA 3LDLA 2O31A 4H0VB 1ZLJA 4AIAA 3U4LA 3U21A 4KRTA 4HDVA 3VODA 1O13A 3JRHA 4CEOA 2VXDA 1YXQA 4HQMA 4KFCA 3U1KA 1X01A 2FRYA 3KKRA 3K1MA 3F6OA 1FBQA 1BOBA 3PQKA 3C1DA 2HCKA 3ZXSA 1SFEA 3FMRA 3RPUD 3VESA 4JRQA 4DR7K 3S1QJ 2V51B 2ME6A 5E8GA 4I7FA 3DRPA 2F2VA 1R1TA 4M75D 3PY8A 3NMUA 2L3SA 3LLRA 3ZT2A 2K02A 5BN9A 4HX8A 2GLOA 3N5BB 3BR3A 5F6FA 2L9VA 5K7FA 2OANA 5AQNA 3LSTA 4BACA 2PX9A 1KU2A 2F4OB 3SWNB 3WG7H 3U9ZA 2XDPA 1ATSA 2MG4A 1ZK8A 2DQLA 1MMSA 4DV5K 3E1YA 3JB9D 1TT5B 4CCMA 4JKGB 4FO0A 5EU7A 2H1LA 4NL3A 2X4YA 1TT0A 3J80K 1QSLA 4DFMA 2Q36A 1NGIA 3C3WA 4YIRX 5KN9A 4KI6A 3ZMDA 4J00A 4B1UB 4CCNA 1ZYQA 4OLAA 2ROLA 1YHQN 2A5WA 4E4HA 2OJ2A 1N5ZA 1VQLT 4CJSA 5IXFA 1YX3A 3IAM2 2HHWA 3QNOA 1K76A 2CSOA 4KHNA 3RKQA 3LDQA 3E66A 4FPBA 1IJWC 4FL9A 2JS0A 2QTVA 2RMOA 3AGRA 1BI2A 1C6VA 3QIPA 4CZMA 3QG1A 1O4XA 4M75B 1X69A 4RM3A 2FBKA 4H4KC 2DRKA 4UY8I 1V29B 4RW8A 2L01A 4G7HF 3AKZA 3CJNA 3TU4K 3SZGA 1M90U 3C6UA 1WNSA 5KI6A 3BW1A 2WOMA 3L4QA 1NKBA 1HKSA 5KRSA 4H5RA 3OYHA 4O5BA 1E7OA 1HYZA 3G0QA 3F9KA 5HK3A 4F8RA 1KQ9A 4CGDA 5L3EA 2NOJB 4M78B 1LNXA 4LH5A 1TWGJ 3QJ6A 1V5GA 1DTQA 4HUGA 5GANe 4R56A 4CZEA 1WH7A 1DPRA 4HBLA 3IP4B 2QG9B 1TL1A 4YOYA 2NVXJ 3DU6A 1ZX6A 5HVQC 1RIOH 3CF5L 2HL5C 4XBFA 2ZXHA 2WWYA 1XGSA 1BC8C 5A0LA 2K9LA 1Z6TA 5K14A 4E3SA 2CREA 2EKHA 1U6GA 1WJRA 1HF0A 3TPQA 1UZCA 4CC4B 5CK9A 4M63C 4MFDA 4EMKB 1ORNA 5A0DA 1ZELA 6PAXA 4DV3K 2JXBA 2OA8A 1YJNA 3BPXA 4YFUA 2ELHA 2BY1A 3BQZA 3M0TA 2EPDA 4AQYK 3U2RA 3IMXA 1E6HA 1NK8A 4A3FJ 2FBTA 5EYRA 2LRQA 3VA0A 2HMPA 3TEEA 2ESNA 2OFIA 3BDDA 4BQOA 1YHQQ 5EVZA 5DTDA 2FNPA 2Q2RA 4I0BA 2OTLA 1B92A 2HHUA 3MKLA 4HCZA 2XK0A 2X78A 3K7AJ 1ON1A 3K5NA 2K85A 5B1AH 1K9AA 2ZMEB 2ELKA 2JUGA 1J09A 4IX7A 4FK0A 3ABUA 4XRFA 2M51A 3JSPA 2YDLA 3CBPA 4XEIA 2KDZA 2VT3A 4Z88A 2KHMA 2CS7A 3SV4A 4Y4RA 3G6ET 3MCAB 1CKAA 4JAXA 4IG0A 4L5GA 4JK7A 4C5GA 4BYYA 4M4ZA 3A01A 2ZJPF 1YJNI 2D1KA 1B8IA 5GTIC 3U1DA 2M0YA 2P84A 1JXOA 1PKTA 1YITT 3KLOA 5KYWB 1OISA 1C0WA 2VXEA 2V1DA 3D6RA 5EGOA 1RDWX 2G8KA 1IKYA 5E17F 2E4HA 4M3RA 3AA4A 3U8XA 1XQHA 1KC8O 2OTLI 3QO9A 2GQQA 4IHTA 1O9SA 3HJEA 2F1LA 1M3AA 1YTYA 5H6QA 2DFHA 1JJ2P 2OAUA 1ZAOA 2E60A 4JKGA 1FMKA 3W6VA 1RKTA 4HG2A 2A61A 3A0IX 1YG2A 3SUPA 2HNHA 1SVLA 1XJWB 4NNJA 1F9NA 1VQPN 3EKUA 1ASWA 2MA3A 2O8BB 3CXCS 2FC0A 1ZKGA 2BH1A 3F73A 2A42A 2EBPA 1T3LA 3NARA 5FLXO 4B3RK 2K5LA 4JLIA 3PSFA 2HR3A 3CCMA 2LSOA 3MDQA 1GDTA 2Y90A 3CZ6A 4E89A 2IIRA 1VQNI 2GX9A 3L7WA 3K6GA 4PJOC 1OLTA 1JT6A 1JQQA 3F6VA 5LEJA 2QK0A 3JCMg 4CVNE 3WTXC 2FUG2 3LOCA 1QVGS 3JCMb 1I07A 3ISPA 4MO7A 3PNWC 2LNVA 1C0UA 4OMLA 3M1EA 2J7IA 1YJWI 3JTHA 2P1JA 4LOCA 4A63B 3OYCA 5GADP 2K7AA 1Y6IA 5E84A 2HSPA 4CEBA 5GAN5 4A3GJ 2GOMA 3DPLC 1N3CA 3BUZB 2RAEA 4B3AA 3JRZA 1TU0B 4CIGA 4X66K 2OF7A 2IS3A 5HP1A 2ID6A 1LPQA 2N8GA 3FXMA 5AQZA 1U9NA 4K42A 3COAC 2P6TA 2ITMA 5HRPA 5M5XJ 4D9JA 3CCMI 1K9MO 2BZ8A 3PVQA 1BR4A 2O7OA 2GQVA 2ICWG 1KFSA 1XGMA 4EATA 3HTSB 1GBQA 5BPNA 1AWJA 2YHXA 1TH7A 4M3XA 2R0QC 2HD0A 4JK9A 1G2BA 1SSHA 3HBTA 1QW1A 3M9QA 1REPC 3U3YA 4N4GA 1S5LC 3MZYA 2OAWA 2EWNA 4M7XA 2YU3A 3JB9J 2XC7A 4RMOA 1NJZA 1WSFA 1VQPQ 5GANh 2AQEA 2K4JA 2K4BA 4Y91A 2E5KA 5GINA 5JLHA 3TSQA 1A36A 3PIOL 3DBRB 4FK2A 3L2UA 2BY0A 1BI4B 3JB9I 3GEZA 3KIOA 4IL6C 2FMLA 3QJYA 1I5OB 3AG2H 3DLLL 2A5XA 4Z2YA 2CP2A 2DJZA 2FSJA 4LITA 1R58A 1G59A 3CMAA 5T7BA 2CG4A 4C8QG 2VKDA 5JLXA 3A02A 3O9UA 4DUYK 1GFCA 1TTYA 3QB0A 3FIWA 4NZGA 4ZTFA 2WC2A 3EQLF 4YOUA 3QOPA 5J39A 4Y28E 4I99C 4LH4A 2ZMEA 2D0QB 2BE2A 2P9UA 2KAFA 4BR0A 4B3OA 4GYIA 2BE5F 2NYXA 3VJPA 3PIOA 3AAQA 3K4MA 3CCLN 3I56T 2IW5A 2YT6A 4RB3C 4AI5A 3DLLA 1JGGA 4GV9A 2HVHA 1LUJB 3F8CA 2O4XB 1XQPA 4XRMA 2IGMA 1W7PA 2JTFA 1QHAA 1OCCH 2HOSA 3K0SA 2NOIA 3Q5FA 5AQMA 2X1EA 3E6DA 4AIKA 4C8KA 4I6MB 4DF4A 2G6FX 4ON0A 4QW2A 3CMAI 2WSEE 3CC2A 4XOPA 4Q5WA 1QZYA 2Y48A 4HYEA 3M8JA 3A5OC 3VQ6A 4BB7A 4FJLA 2V8KA 3ZR8X 1Z26A 1QRYA 1GLJO 4KUIA 3GOIA 3A03A 3G2BA 5FLVA 4EPCA 2FB7A 2ECZA 2QK9A 5JR3A 4KH6A 4CC7A 2KGTA 4QVCA 4AM6A 2O8BA 4BHBA 4M77C 1VHXA 1MUDA 1R8OB 2I2LA 3O4NA 4J6WA 3CJTB 1VQ8A 1IBLK 3KLFA 4L5EA 1PD1A 2L7KA 3KP2A 3VEZA 3VS6A 1N8RO 3A8HB 2HQRA 2M87A 1NM7A 3CWTA 4FWNA 1U84A 3CF5F 2CP7A 1XN7A 4RGXA 2MMPA 2KIMA 2X74A 1KA8A 1E4GT 3THVA 3HPGA 1IH7A 1TP4A 2ED0A 1VSEA 4VUBA 2FXAA 4DQ8A 3S41A 1W2BM 4J2AA 2LH9A 1U06A 4BJ6C 2NS0A 4W5OA 5GAMh 2B5JA 3G4SN 1UFMA 2KYBA 1RAGB 4GV3A 3W2WA 4OJRA 3CWAA 3CCLQ 3BT9A 2YHTA 1VQKN 3RR6A 4AUXA 3OYNA 5L3CA 2C0IA 2IS2A 3CC7Q 2EGCA 2BY2A 5C6SA 3CMEA 1VQ8I 2HDDA 3QIIA 4Y1CA 2DA7A 2R7SA 3V7CA 1ZYRF 5D6WA 1ZSGA 5I3UA 3HC7A 1TAUA 3K4CA 4A61A 2P9KB 1GLNA 4BWMA 1KSWA 2FPEA 1KXPA 3VS3A 1WB9A 4L6V5 4DU4A 2Z33A 2QA4A 2XSDC 3GZ5A 3EUKL 4PJOA 5AQRA 3JAMZ 3UWNA 3HL2A 1Q7YR 4CYCA 3AVIA 3E01A 2ENMA 4PGHA 3S3OA 3HP6A 3OYIA 1P4AA 1NYGA 2OJED 2VKVA 5D5WB 1UCRA 3HKZA 1W4SA 4HW0A 3R9PA 4U7DA 2H27A 4Y92A 3L3VA 2P9SB 3W2AA 3EZ5A 3P8BB 2CP6A 3DLMA 1TBXA 2Y0SA 2F8TA 2YR2A 4KKOA 1B34A 4X1VA 2QCOA 4JS5A 2F5FA 5HRSA 3KKSA 2YNIA 3WE2A 1QKXA 2KJBA 1WI7A 4JQFA 1N78A 3UT1A 4A3MJ 3CMEI 3C0CA 4CXFA 2C0TA 3THKA 2WBMA 2QQAA 2CGPA 1BC7C 1MBKA 4HX4A 4RGRA 1XQSC 3LSGA 1KG2A 3L2WA 4M75F 2R57A 1Z9ZA 2Z1HA 2L0KA 1U04A 2P4TA 5F1XA 3O5BA 2NNYA 4F16A 1ACMB 1X3UA 3UATA 2X9DA 4FLXA 4CK2A 4KTZA 2HTJA 2EA4A 3DLAA 4DTRA 2K3PA 3I4MJ 1UELB 2W48A 1KAYA 1XNRK 2DD5A 1HNWK 4HEA2 1VQKQ 3JB9F 3X28B 2R7XA 3CMYA 4F52A 3BGRA 3M55A 4H8KA 2DA5A 4BAYA 3ESWB 4DGWB 5D5XB 2M30A 2JS2A 2ZXJA 4LGWA 3ZQIA 1UJ0A 2R7DA 1NPPA 3I0RA 1MW7A 2KFNA 2V4JC 5BPLA 1LEAA 3M59A 2L2OA 3ZQQA 3KYLA 3H3OB 5BRFA 2QEXN 3KLGA 2OX7A 3KE2A 1KJWA 3H46O 2OCCH 1LOJA 4CZHA 2YRCA 1ZR2A 5CKHA 3OBYA 3CPEA 4C2UA 3D5RC 1I81A 1D3BB 4ZYGA 3SYTA 3BEXA 1KZHA 1BA5A 2XROA 1KGSA 3RMCA 4YPRA 3S93A 1DKGD 4Y7NJ 2YRVA 2RM4A 4IXCA 2VPRA 4U87A 1R0BG 2M7BA 1KTQA 3J80O 1XG7A 2QWOA 3BP8A 4XK4A 2JHJA 4C1NI 2HYJA 1Z7UA 1N32K 3O5ZA 2CMPA 4LDUA 4I2PA 3LM2A 3JYTA 1ZG3A 4ITVA 2E7XA 2M02A 2X6SA 3VKIA 3PIOF 2E34A 2CV1A 3CWSA 2ETHA 5ECAA 3M5RA 3DLLF 2FSWA 4FZXC 2V1NA 4BBSJ 5D6FA 3BZCA 5IT9E 3EZWA 4AT1B 4GKJK 4PWDA 1OQYA 5FLXZ 4M73A 2P9KA 1R9TJ 5DUIA 4GKKK 5KYUB 1VRLA 2IS4A 1RAAB 4C8MA 1RDAA 4CC2A 2P4RA 3S1MJ 3QERA 1KLNA 4JKAA 1HBXG 1WN7A 2BGCA 4EIAA 3AA5X 2YG9A 5DUKA 1MJBA 4RTUA 2JPCA 1ETOA 5C2FA 2A1RA 2GBZA 1SL0A 2WAQA 3QU3A 2O4IA 1WHJA 1BB9A 2I5UA 1VQ6A 1L0OC 1Z91A 4HCCA 3BCAA 1W0HA 3K57A 1CXQA 1NK2P 4BQLA 3MKYB 1JHHA 2MWOA 1Y96B 1X9MA 4J9HA 4CHOA 2P9SA 3DEEA 1PWTA 2QEXQ 2RJEA 4QAGA 3IHOA 1XC5A 4FT2A 4FZYA 1RLPC 1HJDA 1NJIR 3VFZA 4BG8A 3MFKA 5GAN6 5AQQA 4CC3A 5I11A 2KP6A 2JG6A 3ZX3A 3C7JA 5AQTA 4B8XA 3AO3A 2CZ0B 3FXUA 1R00A 4BE2A 3M3YJ 4BY9C 4B23A 4B9UA 5LJ5d 2DDBA 3PFSA 3TTDA 4CZFA 3AG4H 1SFUA 4FLTA 5KH6A 1QHGA 4K0KK 2OQRA 4XIUA 1N34K 1BI1A 4HVWA 3K2AA 3JW4A 3OW2A 3NDKA 1YRNA 4RW4A 4GYGA 2R7WA 1JHFA 1VQ6I 3H5NA 4EGYA 2DYSH 3LDPA 4KT5C 4OMNA 1BL0A 4ZGJB 4HV6A 4FISA 5HRNA 3LP0A 2JMWA 1TK8A 3PIPL 5M3MJ 3RDIA 1IHWA 4QT7A 3ENBA 1N27A 2ID3A 1T6DA 1KRPA 2F6CA 2IDOA 4G9ZA 2YLCA 2P0WA 1GOAA 4DQPA 4BR9A 1IKXA 3LSJA 1YQMA 5LBQA 1J6ZA 5DM7L 3BCBA 4WCEL 1IKVA 5IHKA 1TQMA 3TCJA 3UKUA 1ZH5A 2RQWA 2KKZA 1SKRA 3JXUA 4PJOF 5I21A 1NLPC 1P7JA 2M4GA 1LW2A 1HQEA 4LLGF 4DV7K 4H4OA 3PIPA 2OUMA 5K1YA 4D1QA 4BE1A 4LFUA 4KO0A 1AKHB 1K8AC 1STZA 4MLHA 1VQMT 3E97A 2R7FA 4HQEA 3BF1A 4O6JA 1D9FA 1KD1C 2F2XA 1XI1A 2RNAA 1OZ2A 1Y97A 1R23A 3O8MA 1D8JA 2DD4A 4DBRA 4PUSA 1J9IA 4DA4A 2FEZA 3RIRA 4ETSA 3DKMA 2D4WA 4BH9A 4LLLA 3NMZC 3ID6A 1EP4A 1N9SA 5KYYB 3S16J 3KK2A 3HM8A 3H9NA 1WJDA 2FF3B 1BQNA 1HLVA 3NEUA 3J81E 2K5CA 2MSYA 4BROA 1E6GA 1YJNN 2SRCA 2XY5A 4FLUA 4M7AD 2PZSA 5CYMA 2YLBA 3DBHB 4DBQA 2F2WA 1HDDC 3LDOA 3VQCA 1RT2A 3KLIA 4JD2B 1OH5A 1XTAA 1NJIU 2BY3A 4NHJA 1M3CA 2R92J 1R7JA 2VGNA 4PL8A 1N39A 2VWFA 3BDPA 2OTLN 5D5VB 2FMYA 3DEWA 4B9XA 1DGKN 2VC8A 3EFSA 4JDSA 4KH0B 2Y30A 4IDKA 5FKMA 1KYZA 3TW7A 4BC3A 2EZLA 1Q82C 2KQWA 1WX6A 3HPHA 2E6MA 2HMAA 3F8FA 1YW7A 5LGUA 1D3YA 1WJQA 3MAQA 3KBGA 2M5WA 1MDUB 2QWMA 2PZ1A 5BREA 1YS7A 2DIQA 3KJVA 2F96A 1QLYA 1K4SA 4LD0A 4FWLA 1KIKA 3LGFA 1K4US 2A6AA 1MKMA 2H8HA 1UE9A 2DVEA 1VQLI 1FMWA 1Z3XA 3P9CA 1ZLKA 1ATRA 4EM2A 4YFKF 3I5SA 3LL3A 2G8FA 2BKDN 2HF4A 2DT6A 3VV0A 3AAFA 2QGFB 4FJGA 3IWFA 2F5EA 2F4IA 2XPWA 2R7ZJ 3EPZA 4J83A 3C2HA 3G10A 1Z67A 4M7AB 1MMGA 4ESRA 3Q3SA 4PJOE 1OZ3A 2LG4A 4ATOA 1XTDA 4GO1A 1B7TA 4AHUA 3CCVT 5FPDA 4B9LA 4JBAA 1JUPA 4O5FA 3VPRA 3T7ZA 4PL6A 5FRNA 1OI1A 2HVSA 2CT3A 4HF1A 2F2EA 4F3TA 1VQOA 3KHYA 1WPKA 1HPMA 1GV2A 2V8IA 3G6EQ 3EYZA 4KIGA 2FOKA 2A3ZA 2PQWA 2DMUA 5DPKA 5LGNA 4A53A 2K57A 2MAMA 3LH0A 1WSJA 4I9QA 4EMSA 4RKUE 4B1VA 4OMOA 1KC8R 2G3RA 4YRVA 3TP0A 1R49A 5F2RA 5DLOA 3LAMA 2K27A 4BRCA 1EWQA 2KRCA 1S9GA 2Z3YA 2GV9A 2E2IJ 4WTOB 1L3SA 2ISZA 5MLCQ 1I39A 4CJPA 5BPIA 1RI0A 1A04A 2GNCA 4JI3K 1V55H 3HVRA 1ZHIA 1BU6O 4BXUA 4FT4A 4B48A 2P9PA 3GDQA 3ASKA 2JZYA 8AT1B 1HW1A 4HLYA 2EYZA 5AFUH 4BY6B 2ZBKA 2NLXA 2QKBA 2I5JA 1EA3A 1YITA 2O8XA 2P9IB 1HKBA 4CZCA 2IPQX 1AKHA 3MN5A 2EV0A 5IT9K 4I2OA 1J54A 2FD5A 1SD5A 1JCEA 3ZQLA 1ONVA 1XHXA 1WQWA 3QICA 2DNUA 1YNZA 5LJ3g 3M4YA 4FVMA 1Z9QA 4A3DJ 3M8FA 4L3QA 2UXBK 4YOVA 2BYVE 1OCZH 3A5MC 3HIFA 1RRJA 3ZMVA 3NTKA 3K10A 1Y64A 5FU6C 5AZIA 4HT9A 2K2VA 2HL3A 1S5JA 4A5NA 4D0PA 4EM1A 2CSQA 2ZAEA 2V7ZA 2H3GX 2V6CA 1J2XA 3MECA 5CY4A 5IT3A 4MGRA 4DR5K 1YIJT 3G6EI 1P9QC 2LQKA 1TAQA 1HC8A 2NUTB 4E70A 4OFHA 1J53A 3CCUT 1YITI 5J1YA 1K9MR 3PQJA 2DMTA 1YI2T 4JD2A 4MDWA 2HHSA 1QQMA 1V5FA 4XR6A 1ZTRA 1C1BA 3T1HK 3FKIJ 2IIMA 3D2FB 1D0ZA 4ZDOA 4CJRA 3H3UA 2L3PA 4IUTA 3CXCM 3BY5A 4X65K 3QEXA 2MH9A 4NLCA 5TRDA 3CTAA 3VF4A 2MOXA 1KVAA 4ZYAA 3IFRA 3EG9A 2HPIA 4Z4CA 3SPYA 1CZ9A 2OYQA 3VGKA 3ABMH 2RQTA 1LKXA 1X3WB 3CCRT 3J80Z 1IZ1A 3KCCA 1KO9A 1UHMA 4B24A 3VEWA 4M77E 5EC7A 3NFAA 2HDWA 3VOVA 2V1RA 2KDSA 3WGHA 1KQ2A 4LNPA 5LJ5f 3EFOA 3HRTA 1SV5A 3PIPF 1QVGM 1PP8F 2O6GE 5M1NA 1PU7A 1W5CC 2HYFA 5CR2A 1QS4A 1KC8U 1W2BP 3ALYA 1QP2A 1S29A 2OTJT 2D5VA 4XM3A 1TTHB 3CLOA 3VW4A 3GOXA 3CQ8A 3I71A 1ARKA 1T3SA 3ULDA 5DM7F 5B66C 3EGXB 4JN4A 1SKSA 2JLEA 2IA2A 4FLYA 3CC2N 4IJAA 2VLAA 2V7YA 4O0IA 2NOFA 4FSVA 1S6QA 2NXNB 4CZGA 1RT6A 2KE9A 2PBDA 3JRBA 4BY1J 2JT4A 2XPVA 3CJBA 4II2A 1T0JA 3JCMV 1DLOA 2IT0A 1K61A 2CQ7A 3K4KA 3BOQA 1LVAA 3GPLA 4BJ5C 3C6HA 5E18F 1NZ9A 1A5XA 5LJ5j 2KROA 2LCSA 4DEXA 5I2SA 1RAHB 2DCEA 1OH8A 1KD1U 1UAAA 4ANJA 5JHFA 1K6YA 1BU1A 5AQKA 3E5XA 1WIEA 2EB7A 1T03A 4NQWA 3VYRB 3PJRA 1LFPA 2FF6A 5FU7C 1YJ9T 3HOTA 1JUSA 4UXNA 3M3ZA 4BD3A 4CCJA 1VAZA 4B3XA 3EE8A 2R7YA 2E2PA 1WH5A 1UEBA 3SCXA 3MKWB 1P4XA 4B8AB 1U49A 1K73O 3RMBA 2PMHA 1MNMC 4N9IA 3UIQA 2Q31A 3QDRB 2JRTA 1JXBA 3I56A 1QSSA 1RUOA 1VFCA 2M9UA 3ZMSA 2XF5A 3EKSA 2KRSA 4OB1B 2F5KA 2MF2A 1U8RA 5SZTA 3NFCA 3EEQA 1N8RR 4RGUA 4ZJZA 4CF2A 4F55A 3VQ4A 3S2DJ 5KE3A 4FX0A 5J47A 3ZMUA 4II1A 2EYXA 3QFUA 5ICEA 1ON2A 2DEQA 4OIPF 4JHDB 4EW0A 4PIIA 1Q82U 2F9WA 4BG9A 1MBGA 2WC9A 5M3FJ 2DYIA 3IC7A 2F5DA 4J9IA 1D8YA 4ELUA 3TO7A 1GHCA 1KG4A 4XKBA 1M1FA 4MZTA 2YHAA 2QA4N 3LDSA 1HU0A 1WEIA 4PLLA 3GVAA 4AH9A 1JO8A 3VYTB 1WFXA 3E9GA 1EETA 2CUBA 3I56I 3L42A 1OYIA 1BK2A 3I0XA 2HKXA 1SKWA 5GIPA 5J8FA 2P9LB 3AA2A 2XV4S 1KLMA 1C0GA 3P31A 2Y1IA 4Z4EA 4XKWA 2FPDA 3ZETA 2FO0A 3ZN0A 3AVFA 3DAWA 3K58A 1W70A 2AKLA 2O8CB 2YJEA 4ZZDA 1N3AA 3LAJA 1H8AC 3EGDB 1NGHA 4C8NA 4H5TA 3IAYA 2E2QA 2BHYA 1MBEA 5LJWA 1HYSA 3ZSRA 2ZSHB 4JI0K 1OYXA 2L9NA 2XF6A 3TSZA 1MD0A 4NYNA 3H1VX 3WT0A 2VXZA 5FPEA 5CQGA 3IKMA 2HBKA 5CKTA 1K78A 2VIXA 1Q1VA 2XF7A 4CJFA 3V4IA 4H0XB 5AZJB 3ZT4A 1J7KA 5E3LA 2DL7A 2O9VA 4CJ4A 1YTAA 1E3MA 1S1NA 2CH5A 4BWJA 5DY9A 3QDKA 4DBHA 1U8BA 3WTYC 4RAFA 3OYMA 1H641 1RDCA 1SHFA 3T8TA 2E10A 4KGXB 2LF7A 3EUHC 5CVUA 3B6OA 3K5MA 2M9HA 3JREA 1HK9A 1WSHA 5SWMA 4DZPA 4CRIA 2E35A 3PE0A 3WNGA 1RI7A 3J7AY 2QA4Q 1TUUA 2RC4A 3KZZA 4BQZA 2ZJ2A 4BI3A 3CC4N 1NYFA 2HGCA 3CD6N 3F10A 1EZZB 1JU5C 3QINA 1VQ4T 2QSFX 4CHPA 2R7UA 1HSTA 2F4MB 5LGTA 2XRIA 4IG3A 3TDUC 2ZQBA 3LWFA 3M4OJ 1WSIA 1MGTA 1QKWA 5ILSA 4C1NK 4J9DA 4CE9A 1VQ7T 1S1UA 1JEGA 2YUNA 4BRPA 4AIDA 4TVRA 1H0MA 1SC7A 2V79A 1D4XA 4Q5SF 4BXXJ 2COZA 4QPQA 3UPUA 4DYRA 4L8RB 4CDGA 3C2GA 4DSEA 3D5SC 3H3VK 4ISGA 3HG9A 4IUVA 1WWXA 1S1VA 2VUBA 1M90O 1VYTA 2DK5A 4FYWB 3AA3A 4L9TA 2HHXA 4CCLA 1LWYA 1OH6A 2Q0OA 2P5KA 1XC9A 3VS7A 5CQXA 2K3XA 2DYRH 2E1CA 4UY8O 1ZR4A 1UFFA 4A2AA 3RBBB 1SMTA 4RS8A 1VI0A 4ZGDB 2DKGA 2FSKA 2BDPA 4BGAA 2EFWA 4W5QA 2KQRA 2X1CA 5GMKh 1LE8A 4LK0F 3WNFA 1O3SA 3FF5A 4ZH4F 3C7NA 4MO5A 2VJ5A 2E3IA 4IHYA 4JHDA 1H92A 4X62K 1Y0NA 1RLQC 2K6DA 3SJJA 3S6IA 1M2VA 2E1NA 2FA5A 5AYFA 2H6CA 3ASNH 3V8KA 4LUDA 3D7EO 5AQWA 3QXEB 4B9TA 3BTJA 3PFIA 3ISNC 3J7YP 2CGHA 4M7AF 5E3NA 3IDHA 2O8EA 2O2OA 1V4TA 4CHZA 2W57A 4X1EA 1S72A 2JT1A 2WAQN 3BG7A 3VQPA 3D7SB 4P55A 1BKBA 4CD1A 2P9LA 1I94K 3OA9A 3CC4Q 2EIKH 2QWNA 3CD6Q 1PVSA 2EX3A 3QUIA 2DA9A 1TS9A 3QBXA 1G3YA 2MW8A 2PVOB 3I33A 4F93B 1WQ2A 1TL8A 3MO8A 2W85A 1EH6A 2GTOA 4DSKA 3PUFA 4OINF 2NS7A 2MYSA 2LX9A 5HS9A 4C3JJ 1JLEA 4OB3B 4IRGA 3VGMA 2FOWA 4RW7A 5TKYA 3L2RA 3K69A 4XKCA 4KV8A 3NGIA 4AYBN 4Y15A 4HF0A 3SFMA 5EDNA 2OPPA 5I9EB 3Q0WA 3PMTA 1I0CA 5FWCA 1NGNA 3DQVC 2DTRA 4IFEA 1RR7A 1PD0A 1I1GA 3CFOA 1QQNA 3GTPJ 5AZJA 3C6TA 5KGWA 2K5IA 4JYKA 3DTKA 2BIVA 3KX2A 3QOEA 2UXNA 5HLGA 1M2OA 4I2QA 4OU0A 5GAGP 3EG3A 1FSEA 3E5QA 5GAHJ 2CU7A 3KYCB 4A12A 4ISFA 1X43A 2BBYA 3ENOA 4G1QA 1LPLA 5BN8A 4PJLA 5FPMA 1Q81C 2JWLA 3TQ7P 4B4CA 4I0AA 3OSGA 2AKKA 3A1YA 5B1BH 1MGQA 1LOTB 3L00A 5BNGA 5LHGA 1Z0XA 1ZA2B 2DEUA 4B44A 2VC0A 3JRAA 1RESA 3ZBDA 2DT7B 3AVHA 5AQGA 2OZMA 2L4MA 1NLOC 2VUMJ 3TSPA 3ZMTA 3VF6A 2NOHA 5GANd 1MUZA 3OIOA 1JTXA 3JB9G 4AF1A 1WQ7A 1LDKB 3E5UA 1NGJA 1G15A 5BR8K 2ELJA 1WYXA 4OFAA 4C92B 1HNXK 3HK2A 3DB3A 5GAOp 4FOEA 4IHXA 4AILC 1YYVA 2ZNZA 4I02A 5C0YA 1VSKA 2JPBA 1DT9A 3X2QH 5GTHC 4DNCA 2PTKA 2R5ZB 2CGJA 4KB0A 2QAZA 1K8KA 5ADXH 1PUFA 1ZUYA 4DZJA 2VOOA 4O3MA 4BHPA 4ESFA 1FEXA 2DTIA 4D7MA 3S1RJ 3QPLA 3GZ6A 2GM4A 2GFAA 1TVRA 2G8WA 2KIFA 4IQ4A 1RTDA 4KTQA 4JKDA 1YHQT 3ITHA 5JICA 4IXAA 1AU7A 3SLCA 2RHXA 1DP7P 3DTIA 1YE9A 3H9QA 2OPQA 4F4KA 1VQ9N 3TANA 3IUOA 5GANg 1UHWA 3AY9A 4KHUA 1JKPC 5IH2A 4B3MK 3PGGA 3R6NA 3CJAA 1QQCA 3IKVA 2ASMA 4N0AC 5TISC 3LAPA 2HBWA 1EH7A 1MSFC 1UJYA 4CH7A 1RBUA 4J7FA 1U1SA 4EMHA 4F2RA 3LSKA 3WHBA 4CEEA 2IGNA 2HQXA 3SAFA 3SEZA 2EPFA 3SEMA 1UB9A 2AHJB 1UG1A 4E47A 3CLQA 4LD5A 5HLIA 1VQMA 2VASA 5IT9O 1U48A 2CH4A 4DOWA 5E1WA 4Q47A 5GP9A 2EZIA 1PSFA 1M9SA 4XU0A 5HNFA 1XMAA 3FZHA 3M9AA 3CCEN 4M3UA 1HKTA 4XU3A 1UECA 1S6LA 1NNEA 5CYVA 1AD5A 1ZARA 1JGSA 1YQRA 2K9MA 3VQ8A 4MMLA 3GZNB 3AVMA 4YNQA 3VEVA 4C5EA 1UWBA 4A5AA 3OS2A 3SZTA 1HLUA 4XMYA 4A6DA 1PUEE 1WEGA 2XGCA 5BPDA 2WB1N 2ZKZA 3WQTA 4GLKA 3FJPA 3L4IA 1FJGK 1JUMA 3S1NJ 1N6QA 1VQON 2BHZA 4F9OA 3NWTA 3OJSA 2YX6A 1SFXA 5AQHA 3E9FA 3LWHA 1VQMI 2IA1A 1X2MA 2LT4A 4XLPF 1X27A 1BR2A 3UKRA 4BHCA 1VQ9Q 4JX4A 1T39A 4ZGEB 4XRSA 5C4JJ 1WJCA 3DLGA 4B9WA 5EEAA 1NM1A 5JVGL 2VYTA 2NYSA 3JRCA 4BC5A 1G5VA 3RKXA 2X4HA 2BUDA 1WHLA 3CO7C 2W00A 4M7DD 2A41A 3GFMA 2CSIA 1AOYA 3K4NA 1B59A 4OPHA 1I27A 5GAMg 3MCZA 4M7DC 2ZO4A 1GLAG 2DFEA 5LJ3e 5CQEA 4MLOA 2W24A 1XMKA 3QIOA 1UGQB 1GXIE 4FYXB 1RPWA 2OA4A 3N97A 3CCVA 2BW3A 1XPXA 1ATNA 3CCEQ 4DQ2A 4FU6A 3CCJQ 3BJ6A 4HSTA 2JUFA 4PJOG 2R5ZA 1NGDA 1YF5L 2QVOA 3N4QA 1D0XA 3BR5A 2L7ZA 3N4PA 2FBIA 1UG0A 3OV8A 1WJEA 4XTXA 2XAHA 3CVTA 1PNJA 4HLXA 1VQPT 2YX4A 2B0LA 1IREB 3CW7A 4CSWA 3J7ZI 3LSHA 4EW4A 3OS5A 5EEHA 2D0AA 4CUGA 4LDXA 2BUPA 5FFXA 5B5EC 3F9MA 2MCNA 4RAGA 1OCTC 3BWGA 3RCOA 1M1KC 4ZNXA 1XMXA 4DTPA 1SSFA 2M7AA 1IC8A 1J75A 4J9FA 1ZSZB 5GAOl 2W4SA 1A5VA 3P7NA 4I76A 2YWWA 1C0TA 2YNHA 3CCVI 1OV3A 4LSNA 3SZ2A 2JSCA 2HZTA 3FXOA 3J81O 4LFBK 4KICA 3WHCA 1FMVA 1KG3A 4BR7A 3ZN1A 3V1RA 2KFZA 3QEVA 4ZDLA 4OFEA 4OMZA 1NG2A 2M0CA 2VBYA 4K8XA 4C5IA 3G0ZA 5AONA 4KGVB 1NKUA 4CGHA 1GXQA 1DEJA 3KYDB 2ZSIB 1SL1A 1W1WE 3ECOA 4A3JJ 1VTNC 5DM6L 2Y4XA 1B9FA 3THWA 1LJOA 3D2EB 2IEKA 4YORA 2JTVA 2EJGA 4LDYA 5LMNK 1KU7A 1X6BA 3C94A 4RG2A 2DZ9A 2LJ1A 3CCJI 1Y8QB 2XD0A 1JRIA 2A6TA 5EY4A 2RHUA 3D1NI 3P1GA 4WF9L 1PKSA 4BR5A 1FNNA 4N0AA 4BRQA 4GVEA 1YIJA 3V8LA 2IPOB 1Q95G 3LCNA 4OKEA 2YUOA 4RGSA 1T05A 1ODDA 3K70D 1KHCA 2STTA 3BDUA 3R4KA 3H5RA 2ZPEB 3VS0A 4EP5A 3TL4X 3C0BA 3CCUA 1QSYA 4E9EA 4DS5A 1YI2A 1IXDA 4IZZA 3ONQA 4YTLA 2GWJA 3OYKA 1L5UA 3K70C 2GA2A 1AHJB 1BM9A 3DLKA 2FSNA 2D6FA 2GBYA 2LCLA 4R55A 3TAEA 2A3SA 2CKKA 1YFHA 1WNLA 1JLGA 1TWHJ 2YUSA 4L5JA 1IG8A 1XNIA 2DW4A 1RC9A 2LKPA 3H8ZA 1IHVA 2RF2A 2PVGB 2YHWA 4H5NA 4JNEA 2X6WA 3DKWA 1G99A 2B8AA 4FL6A 2IOCA 5EJCA 3LH5A 3I56N 4BEHB 3TTCA 3ECHA 3CCLT 1KAXA 4C8QD 1I1SA 1YIJI 3D4VA 4XTVA 2EJ9A 3CC7T 1HDPA 4BXFA 5GPAA 3E0JB 4KNYA 1HYOA 4M77G 3DEUA 2D0NA 4CZIA 2PFBA 2OTJA 3T5XA 3CCSN 3CCUI 1RCHA 4CERA 2FL7A 1YI2I 3DPUA 1ZGWA 1Q86C 3R0JA 4CEAA 5DCFA 4BUPA 3THYA 2YHYA 1K73R 4JRIA 4DMNA 4C0FA 4M9SA 3LA2A 4KHWA 3JRFA 4O4GA 2W03A 3ZSYA 1W9HA 2VWKA 1WI3A 3ZQGA 1RAEB 3P9KA 3HXLA 5GAEJ 2VYPA 3ULEA 3H1CA 1I6HJ 4NBQA 4HT8A 3GF5A 2GXBA 2GUPA 2YSRA 1X2QA 2VG6A 1XSXA 2K2MA 2WAEA 3CCRI 1EQYA 1BW6A 2D1VA 3ENHA 3OJUA 2GIZA 5CPRB 2X9HA 3BE3A 3VGLA 1X9SA 1LQ1A 1YJ9A 1AWOA 4XIDA 4M7DA 4ESBA 4RW9A 2DVJA 1I50J 2VOPA 4C8QB 4RBOA 4JKBA 4FHTA 2BE7D 2OTJI 2WTUA 7AT1B 4AIHA 1NEBA 1VYVA 4B1XB 2A69F 1ZSZA 1LV5A 2PFUA 1MDMB 5AFUA 1MWMA 3FHGA 5LRRA 4BQNA 5KQDA 2I8DA 3NF8A 1RBSA 1YAGA 2ISYA 1OYYA 3TKYA 4AHRA 3HKSA 4L9VA 5EG2A 3G4ST 1RKWA 3VSKA 4S05A 2NUBA 4KJZA 3RMDA 2EGEA 3WXKA 5E20A 3AVJA 3NF7A 3ZQFA 3TAPA 1WCMJ 3RJPA 5F1RA 4LB5A 1WAFA 1FZPB 4Z94A 3BLYA 2Y75A 3W3DA 1VQKT 5D6EA 1QVFP 5AQXA 4Y33A 2BEOA 2LQWA 3LX7A 3SYZA 4BVOA 3BG5A 3OA6A 3KEQA 3E2UA 3A2KA 2PMUA 1J0RA 1IKWA 3EH2A 3CCSQ 5B8HA 1YJ9I 1TLHB 2IVMA 4MZMA 3L3UA 5JVGF 4C3IJ 1RBTA 1JLAA 3SJMA 2HTSA 2GCXA 4WYBA 3SFIA 2D0OA 2P5GA 3V9SA 4UVCA 3A8LB 4MHGA 4XOTA 3SDZA 2QDLA 4EZ6A 2GOXB 4IBNA 1HSQA 1HR0K 1A6QA 2RHZA 2G8HA 3GL1A 3S2HJ 4M45A 4WCGA 2RDPA 1FK9A 3MKDA 2VQHA 4NLBA 3VYSB 4RTTA 2I10A 4IUUA 3G73A 3FC3A 1IBKK 1RTJA 2HQHA 1BYMA 4FW1A 2ASPA 3TAMA 3V1OA 1BN5A 3OS0A 3I4NJ 1KQJA 2KYMA 3OYYA 4FM2A 1VSIA 4IQJA 5IT9Z 1FJLA 1IXSB 3SUQA 2P7CB 4KMFA 5EF6A 3GF2A 4JK1X 1K73U 3LYIA 1RT5A 1NK9A 4DSLA 3BDLA 1L3LA 1F5TA 5F0FA 3PNYA 5FD5A 5C2DA 2UUBK 4MTDA 3HM5A 2V9KA 4YDUC 1TW3A 3JRIA 5EG0B 4OPKA 1LB2A 2R58A 2DMOA 3WEEB 2XKOC 4R1HA 5KYXB 1U5TC 4LUEA 3IWZA 2QW9A 2RQVA 5GJVB 3CCQA 3RSNA 3K59A 4CBXA 3NGPA 3NBPA 5EOYA 3BPVA 4RTXA 5DCMB 3TTFA 5KPTA 3QP5A 3HTVA 1AOJA 3OMGA 4NOYA 3EHRA 1FOKA 3IH4A 2FF4A 1WPYA 1E3PA 3O6WA 1ZN2A 1TSFA 2ZJRL 5JS1A 4J9EA 2CW8A 3GO5A 4BRFA 2NOZA 5GMKj 4H0TB 2EV6A 4E0DA 1P92A 4OWRB 3MVPA 1W4MA 1UG2A 3ZSQA 2RN2A 4UNFA 3Q1JA 3CQXA 1LEBA 1OULA 3T9NA 1JLCA 1OPCA 4PSWA 1GVDA 1J5YA 1NOYA 3S3MA 3GTMJ 2KRNA 1VQ4A 3HBLA 4OGCA 2FHDA 1KG5A 1E17A 1U3EM 2QEXT 1S72N 2FG0A 4B08A 1QCOA 2NWMA 3RSEA 5DM6F 4C3HJ 3GBTA 3SWNC 3QU6A 1VQ7A 4C23A 2VBXA 2P4WA 1VSJA 5IAYA 2BXZA 3FZVA 4C8QA 2AXLA 1IJJA 5KRTA 4Y13A 3KWGA 2DJIA 1MH4A 4MLEA 8ATCB 5HOOA 3RRGA 4FLZA 1MDMA 3JAME 4MIMA 4LE9A 4YELA 1WA7A 2OFKA 2HBJA 1NPRA 1IBMK 2R93J 3ZSWA 4ZN1A 5EEGA 3GBGA 3IKTA 2STWA