3S3XA

Structure of chicken acid-sensing ion channel 1 at 3.0 a resolution in complex with psalmotoxin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
404
structure length
401
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
molecule keywords Amiloride-sensitive cation channel 2, neuronal
total genus 89
structure length 401
sequence length 404
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3xA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3xA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3xA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3xA02
1WP7A 2FB5A 2L35A 3IJ4A 4FZ0A 1WP8A 4NTWA 2QTSA 3S3XA 3N27A 4FZ1A 4NYKA 4NTXA 4NTYA 3S3WA
chains in the Genus database with same CATH superfamily
1IVSA 1B6QA 3M99B 3H01A 3JD2A 4FIPC 5JQGA 4MVQA 1RSOA 2CTQA 1M57C 1VQ9V 1PNMA 2AGAA 1E1RG 2CTWA 1SETA 4FM1A 4GYCB 3LNMB 1J5EO 2WLHA 4DR3B 3B09A 3FD9A 3HPLC 4DR3O 2EIJB 4Q20A 1R3JC 1YHQV 1IX9A 2W6JG 1R3LC 3JAKA 2WLMA 3K3WA 4OXSA 2EULA 4CS2A 3DTUB 4F6EA 3W7SA 4ZHQB 1QR9A 4OX9O 1OV9A 4TQFA 3I5DA 4C7UA 4D7TA 3RYCB 4IT5A 4PELA 1KQSU 3ZRVA 1SQPH 4JTDB 2K9PA 5KMGB 1OZ0A 2WA3A 2X7RB 1Q8IA 4JYAO 1S5HC 4LBEC 1KKDA 5IDJA 3ZMUA 2LJ2A 2GUZB 4PDLA 3RVZA 1XILA 3E8GA 4LF8B 3TJTA 4CC5A 1HNWB 4WBNB 4YIPA 1AR5A 1EN5A 2Q8VA 3JAWA 4EB6B 4O4IB 5IJ0A 1VQLV 4MVMA 3M8AA 4B3RO 2KKWA 3B40A 1LNQA 1WPXA 2A3QA 3CMEV 5J2UB 1Q6IA 1SF9A 1OCCC 1TUBA 2ADQB 4W4LA 3IAYA 3OD4A 3KZIZ 1KP2A 3K59A 1JPXA 5KHJA 4O4LB 3OT7A 2Q4PA 3WG7C 4DV1O 2DWEC 2YEVA 1LUVA 3ABTA 2Y69C 1MZEA 3MAQA 5CN0A 3BAAA 2P90A 1E1QG 3W7TA 1RPOA 4LF5B 4JYCA 5B5EZ 2VS0A 4FZ0A 2RN9A 2G38A 3F5TA 3G6BA 1I94O 4JYYA 3GB7C 4YJ3B 1URFA 2CGOA 5CBGA 1S5JA 1BQ0A 4P9PA 3IGAC 5KHGA 3UM7A 4J41A 1Q6HA 4L8JA 4GX1A 2Z0AA 3STZC 2BE3A 4DV2O 1SQXH 3B4SA 2JRIA 4JI8B 3JASA 3ABMB 4ASUG 1SERA 3CYOA 1FD9A 1K33A 4IYIA 1Q82W 1JFFA 1SKVA 2QTSA 2XAHA 4PDMA 1B04A 2VWKA 4D7SA 2H94A 3RWRD 4MTFA 3JCUZ 1IXBA 1VP7A 4JZ2A 1XMQO 4JPRA 5FL7G 4FVMA 4JI3O 5IYZA 2GDSA 4I0XB 2CDYA 3K03A 3K5LA 4PD4F 5L3BA 4B3RB 2UXCO 1KUQA 5CB4B 1COWG 3FB6C 2Y0IA 5IY5B 3IC9A 3JSNA 2ZT9B 2QDOA 2ADPA 4DUYO 5KLVH 2ZM6B 3GWKC 1VQOV 1XNQO 4FK5C 1H2SB 2MW2B 1IBMO 1GAXA 1BT8A 4K0KB 2CTPA 3AG4B 1NI8A 5HFMA 2ZE8A 1QLEC 4U7OA 1GN2A 4YJ2A 1M90W 1AB3A 2UXBO 1PPJH 4YY3O 3P30A 1H2LA 4UXNA 3QNEA 3APQA 1PD3A 4XBFA 5H2FZ 5EC2C 3LDCA 1WB8A 5IJ9A 1AJPA 1BL8A 3MDSA 4N23A 3SGIA 1GH6A 2QGNA 3N2KB 3G6EV 3LDEA 2XT9A 1WB7A 4JI2O 3TETA 1SC5B 1NBMG 1Y76B 1QHTA 1WA8A 4EB6A 1NTKH 2HP8A 4UCRA 4GUNA 3SYAA 4H37A 3DSQA 3ZMVA 4N21A 1FJGB 4MTXA 3VQXA 3ZRXA 4CH6A 1WA8B 4OGQB 3CP1A 2QKCA 1DTOA 3TXSA 2A9HA 4LWSB 4KUMA 3BHPA 2EX3A 1MOFA 3I56V 1XQ8A 1IBMB 5EYPA 5B1BB 4K8XA 4PA7A 3JYCA 1GRJA 3CEIA 2Q7GA 2JK5C 1W59A 1R6TA 1AI6A 1WAZA 4G2KA 3CPWU 3VQYA 1YJNV 3CRCA 2OIEA 2YIAA 2X6AA 4FLXA 2F4VO 3E86A 1BSMA 3D36A 2ZR3A 4PDRA 3E2EA 4G27B 3OMIB 2H3OA 3ABUA 4DV3O 3AG1C 4NVPA 3T2MA 3ZHRA 2NLJC 5BMVB 2LQTA 5IYBO 1AJQA 2QKSA 1YCIA 3C3SA 4PDVA 3S3WA 2ZNJA 4MVZA 5EC1C 5A9GA 1ROPA 1TVKB 1BCCH 5B1NA 5IT9N 4BW9A 5BXZA 4RAIA 4X88A 2JGDA 4B7EA 4MTGA 1SRYA 1FS0G 3ZN0A 4IIJB 2A0LA 1MG1A 3CCLV 1A32A 4U3JB 3ML0A 4LFCO 3E22B 1OCZB 4DW1A 4I9WA 4XDLA 2ZKOA 1I5XA 1KP3A 1SS3A 5D5QA 4O4HB 1H8HG 2Q0OC 3HKEA 1NZ6A 1NU1H 2YIBA 3H1KH 3ABKC 1CXZB 1B3QA 1GTOA 2EBOA 3UT5B 4L87A 1VQ4V 2Q6AA 2HEPA 4FLZA 3FKSG 2JS5A 5L3DA 2JJ2G 1P49A 4YHHO 2UU9O 4EFBA 4DR2O 3AG4C 4GLXA 5KHKA 1KC8W 4B3TB 3K58A 4ABMA 4K8ZA 1VQ5V 1K97A 2QM7A 2X6BA 3M7MX 2ODMA 3A8TA 1SQVH 5ITZA 2EILB 2CE4A 3JD4A 2WLJA 3CXHF 2HG5C 2OYQA 3Q4HB 3N2KA 3P3PA 2F23A 2LW7A 2FMLA 3ETDA 1YTFD 4WFGA 1ZSPA 1VQNV 1XL6A 1S0VA 3QTCA 4G28B 1YI2V 3J7AU 4J80A 5B1AC 3ABLB 2ZNIA 2IM9A 1SA0B 1MNGA 4GX2A 1YJWV 5EIBC 4B3TO 1H8EG 5IYCO 4YHHB 4CH3A 1VQKV 5JCOA 5J2UA 1MSDA 2GV9A 2ITCC 5KX5A 1HNZO 3B8NA 3U0ZA 1YXBA 3SJBC 3BA9A 2DE0X 2Y48A 3SJAC 3VOUA 2OWOA 1XNRB 2UUAB 3OE7G 1BQZA 3G80A 3CC7V 5E79Z 2LFRA 2YSUB 1VIBA 4JTCB 4X1KB 4E4EA 4NTWA 1IURA 3CCEV 1S72V 1HNWO 2P4VA 2VQFO 1BHBA 4WF9V 2ATKC 1V55C 4NYKA 3EXAA 4ZHQA 1Y74B 4D6TH 3IC7A 3RYFB 2R70A 4YJ3A 1HNXO 1FYJA 1VQPV 4A5UB 4F6RB 1QU7A 1US6A 4JYAB 2M6YA 3L71H 1LUWA 5B3SB 3IFXA 1O9GA 1NR7A 1HW7A 4FLUA 3K04A 3SR2C 3ZEDA 3LSSA 1M57B 1NT2B 2QWNB 2JVDA 5LA6A 3SYOA 2VWJA 4I7ZB 4ZIBA 5C8YB 4KP4A 2EJRA 1OCRC 1N4CA 5LL6Y 1AI7A 1MMMA 1PP9H 1N8RW 4FLVA 2P4KA 3CD6V 3E89A 3OMAB 3WU2Z 1G1XB 3JAWB 3W7XA 4GKJO 4HNAA 3T1YO 1ZL8B 4LNUA 4FLWA 1SQBH 4LF9O 3JARB 2QJ1A 3HKCA 4HNAB 2WPDG 2UXBB 3CCVV 3NR7A 1GK9A 3ABKB 4NTYA 4NXMB 5EBLC 2R9AA 3E83A 2BSKA 2ARHA 1BGYH 5CA1A 3AK1A 4ZOLA 4WFAV 5D5PA 4JV5O 2DMXA 1N0JA 4MTOA 2M7WA 3UKMA 2ZM6O 3FYEB 1W0KG 4Z1VA 3T4ZA 2PI5A 5GONA 4B3MO 4R8CA 2DJVA 4AQYB 3CC4V 1AI5A 5H6QA 1MA1A 2EILC 4H44B 2HJFC 1XOUA 5BR8O 3OTOB 1GN3A 2IJKA 3OMNB 2GSMB 1Q6UA 5JQGB 2EJ7A 1R6NA 3J80N 2GTAA 2YI9A 2X6CA 4X64O 5A2QN 1WLEA 1CPYA 4MW3A 1SA0A 3G67A 1THZA 2NNUA 3A0BZ 4FFKA 1NVPD 2EZOA 3ASOC 1Y67A 2JGDB 3ZHSA 2JDIG 4X66O 4I55A 1K8AW 5LOVA 1AP6A 1UFIA 1J95A 1DK1A 2NN4A 2YXHA 4JI8O 3ZCCA 3K9SA 2YIBD 4P9OA 4TV9B 2Q73A 1FAFA 2VQEO 1JJ2U 1Z5VA 2N74A 4TV8A 1QBZA 2CH7A 4DUYB 4B08A 3H9VA 1XI1A 2PYJA 1SESA 4DV5O 1UPGA 3CRQA 2DW4A 2WA4A 2ZE6A 1MSWD 4CC6A 2GHYA 4DR7O 1NKDA 2UUAO 3ZN1A 1Q81W 1Y66A 3K0GA 2YDEA 2ZR2A 5LXTB 2FTKA 3N2GA 1G4YB 2Y4TA 5ITZB 3H1IH 3ABMC 4X1IA 4MVOA 2CUGA 1XHXA 1R73A 4HAMA 2P7TC 1HDJA 3OFNG 2E5LB 1BS3A 4BIZA 1NH2B 4LF9B 2O57A 3O65A 4H0LB 3JAKB 2YS8A 4GKJB 1XMOO 3QO7A 4FM0A 1IBLB 4QE7A 4DV7O 1N33O 1SZXA 1M56B 1IXMA 2RDCA 3CRMA 4JI4O 2B1IA 2Y69B 3T4DA 1K7DA 3B2EE 4U7NA 4XDKA 5JCOC 2ETNA 2F1MA 1RM1B 3ASNC 2LO1A 2WLKA 2BCCH 4Z2WA 3EHBB 5L3GA 2Q9LA 3HKEB 2XTAA 4X65B 3FB5C 1N34B 3CSXA 5E1AC 3ZBHA 3DXRB 2Y0PA 2ZXWC 1NJIW 1H2NA 4FZ1A 4CS4A 2XOKG 3JALB 1JVMA 3JCZA 1AR4A 2HVKC 3K5MA 2A79B 3KG2A 4X89A 4BW5A 1WP8A 5IE9A 1Q90D 1ZUQA 3HKDA 2WLLA 5JJNB 3JALA 4X1IB 3CCRV 3EVKA 4H13B 1CP9A 4LF8O 4EKWA 1KD1W 2DN9A 5L3FA 4LFCB 2W0XA 4LH6A 1V9PA 1HR0O 4AILC 2Q5ZA 1FXVA 5JH7A 3RT3C 2QSAA 1KB9F 5LHIA 3QO8A 5LOVB 2YICA 3UO2A 5DM6V 4GT1A 4Z1MG 4J42A 5LHGA 3IJ4A 3D3IA 1H2MA 2XUMA 4JI1O 4RWUA 5DEDA 2UXXA 4TUYB 4NKGB 2ZD9A 2PF4E 2PI4A 1UJWB 1H2GA 4O4LA 1TA8A 4OX9B 3CXCU 1R1BA 3ICXA 1QVGU 4TWKA 4JGSA 3JD1A 3J81N 5FNVB 1QLEB 4LF4O 4JZGA 5CB4A 1S76D 2Q7EA 3FB7C 5KA6A 1WPBA 4QPKA 4LFAO 3R65A 4F6RA 2B9ZA 1SQGA 5CA1B 4YJ2B 4HZ3A 1AJNA 4WFFA 5CBHA 4X1KA 5LYJA 1FXKB 2N04A 4DR5O 3KCYA 4FLYA 4LR3A 2WLIA 1RPRA 5KAIZ 1EN4A 1KMIZ 2QA4V 1Q43A 1Q7YW 1Q3EA 1IBKO 2UUCO 1YTFB 3FB8C 5LYJB 2EIKC 1VQ8V 1FJGO 1F51A 3BABA 3THOA 3L72H 2Q67A 4FJCC 4DUZB 1F4MA 1S77D 2GTSA 3F5WC 3AG2B 2QKAA 4U3JA 1ZL8A 5L3CA 4DYLA 2WLNA 1OCOB 4QE9A 1JR9A 4BAYA 1XMOB 2XHBA 4DR6B 1ZAUA 2A7WA 1FXHA 3ZMSA 2F95B 4YY3B 2ZINA 1AILA 4GX0A 5LMNB 1KECA 2P06A 3AEIA 2IU3A 1R6KA 4CZZA 2QWQB 2BOBC 1GKFA 2QR4A 3HKBA 4JI0B 4ZKIA 4JASA 2KG7B 4UVAA 3BCCH 3RFRA 3B77A 3RYIB 1X59A 4LF6B 2UXNA 1KU9A 2PTMA 4JI7O 4B3MB 3T1HB 4DV5B 4NTXA 3A0HZ 3RYIA 2XNDG 4PA9A 4R50A 1N36B 1TVKA 3W7UA 3K06A 3WFVA 5H5NA 3OEEG 5HFLA 2DYRC 2V4DA 4QJFB 4QGPA 3ZMTA 3SJCC 2EIMC 4J9ZB 4WBNA 4O2AA 2LGWA 5LMNO 1D5NA 2ZIMA 2XASA 1GN4A 2BTQA 1YEWA 2JEUA 3LSQA 2PYLA 2AHYA 3ZX6A 2UUBB 5CMUA 2RQ6A 1O9HA 4JI2B 1FFXB 1VQMV 2DWDC 3UT5A 1L8DA 1SQQH 5KHHA 1YZBA 4AI8A 5BZBA 4DV6O 3HR0A 5GTHZ 4UCTA 1GMGA 1P7GA 4LF5O 5GTIZ 2YUAA 2ZDIA 3ZS8C 5KA5A 1M5IA 4NXNO 5DECA 3PN1A 2ZE5A 4X62O 3CWBH 1JX9A 1JA8A 2OTLV 1KYOF 3WB1A 1DGSA 4X1YA 1NVPB 3G71V 1R3IC 1FXKC 2OCHA 3K08A 3ZRSA 2JIZG 5KMGA 4DR5B 2W6IG 1FPOA 3E35A 1G8MA 5B3SC 4IYHA 2UXDO 4XDJA 2DQ3A 1L0NH 4X65O 2VQFB 2LFSA 2OCCC 1TGOA 4FFBB 4JF3A 4DO2A 3N27A 4FPPA 2F43G 4IIJA 1VF6A 1S5LZ 4LF4B 5FPOA 3A0RA 4TSFG 2PY5A 2UXDB 3E22A 1PL4A 1Y76A 3A2FA 2AW9A 2QEXV 1OCRB 1GM7A 2DYSB 4WFBV 3SPIA 3TGUH 4J9YB 1Q86W 1M4UA 4P2ZA 1N33B 2HVJC 4UV9A 3FAVB 3ZHVA 1XMQB 1FFXA 4X9QA 5H6RA 3U10A 4JI1B 4DV4B 2AZ2A 1VQ6V 4J7KA 1MABG 1AVMA 4J11A 3AK3A 1XDCA 2BSKB 2C2AA 3FAVA 4X8AA 1GM9A 3JATA 1V55B 1QR8A 3Q4HA 3D3QA 2YXYA 3OM3B 2HKOA 4OPAA 5GONB 1NH2D 1D5AA 1XREA 2DOSA 1W2BU 1H2KA 1MZFA 3ZRWB 5LBQA 4NXNB 3OR6C 4UB8Z 3I55V 3L74H 5CA3A 3OR7C 1P4RA 3LUTB 4JI7B 5KUMA 3W7WA 3N2GB 4B7KA 4O4JA 5LGNA 3CCQV 5J2TA 4DXWA 1EZVH 1ZTEA 5KUKA 1SZTA 4DV1B 3TK1A 5JH7B 3U11A 1TUEB 5LGUA 2R9RB 2EIMB 3LSUA 2HLDG 4OPHA 3ZIAG 1OHHG 2ZE7A 4PI0A 4ZI7A 4X20A 1YDXA 3G4SV 2IH1C 5TISZ 3JATB 1IBLO 2LP7A 3SJQC 4LF7B 3APOA 3RYHB 3F7YC 2OIGA 1N32O 4PA3A 4X64B 4B3SO 3ETQA 1GM8A 4ZBMA 4I5SA 4W4KA 4K3AA 3MHHC 3UO3A 5CBFA 3L9DA 2YC0A 3R66A 4PA4A 4RQEA 2K1EA 2CAZC 3RW0A 2UU9B 1RSOB 3CRRA 1YITV 4LFBB 2MK3A 4DR6O 5CA0B 1IDSA 2RNBA 5K1PA 4JI6O 3ASOB 2CTRA 1L0LH 3JD0A 5LA6B 3BA8A 5FPRA 4JAAA 4LF6O 1K5SA 3JARA 3T1CA 3KCXA 4AHCA 3E8FA 2H8PC 4B3SB 3ETGA 1N32B 5AG2A 4JAVA 5IJ0B 4LFBO 2P6JA 2UUCB 1H38A 1LR1A 1P84F 1NS1A 4BIUA 2DYSC 2X0LA 3E8BA 1XL4A 1JOYA 2QTOA 3HKBB 4U3FH 2HFEC 2HJDA 3D8CA 4PI2A 5LGTA 4JYBA 4MW8A 2Q69A 4DV4O 2ZXWB 3K57A 5LP6A 4ZOLB 3FX7A 1M93A 2ZQMA 3SPGA 3RN4A 3K9AA 2RCVA 1AROP 4LH7A 3ZHQA 1ZWIC 1YF2A 4UCOA 4AQYO 3KKYA 2EINC 4UB6Z 1M1KW 1JMKC 1NTMH 4DK0A 4UV8A 4I55B 3CX5F 4JTAB 4CS3A 4O4JB 2YIDA 1Z2GA 4O4IA 2GUZA 2Q0AA 4LC1A 1OCZC 1IBKB 3L70H 4BR6A 2JEXA 1TUBB 1M9NA 3H1HH 4NXMO 1AP5A 2CH7B 4QPJA 1VF6C 3L73H 3LDDA 2HHHO 2WAMA 1TAEA 2CK3G 4X20B 3ZHUA 1K3EA 3C90A 2P67A 1I5YA 3PJSK 4UVBA 4TV8B 1HP8A 2A06H 1XNRO 5JJEB 5LP6B 1KKCA 3CCMV 3OGIB 1VEWA 1U97A 1DF5A 2BTOA 3E8HA 4WCEV 1K73W 2ZCEA 1XUQA 4NB5A 2Q68A 3TCUA 5EIBD 3RYCA 3DXRA 2AZ0A 3CE2A 2F66C 1CEZA 1V54C 4JI4B 1PKXA 1HR0B 4F4LA 1WN7A 1F4NA 2EZPA 1F23A 4IGGA 2XAQA 4TOIA 1IZ3A 5IWAO 4UUJC 1FFTB 2XAJA 1E79G 4J10A 1QLNA 1QVFU 2E3CA 4NR1A 4RO2A 3T1HO 2E5LO 3CS5A 2UXCB 4DV6B 3AG3B 3OGCC 4EFEA 5C8YA 3BRCA 4PHZA 1PL0A 4JI3B 4TUYA 1I0HA 4O4HA 1K34A 2RJZA 3QG5A 2HR3A 4ZI7B 4RQFA 4ICGA 3WB0A 1N34O 2KSDA 1FKAO 4PJ0Z 2XAFA 1WP7A 5JVDB 2YI8A 4CBCA 2IH3C 2B5UA 5IY5C 2B1GA 5KX5B 2P22C 4WFHA 4DR7B 2ZDIC 3UQ8A 1P7BA 5JJJB 4I4TB 2VRZA 2UUBO 4FMTA 2ZIOA 1ZLZA 2GBOA 1JQ0A 1R3KC 3CJHA 2NR5A 1FXKA 4PV1B 2EIKB 2JGUA 4FM2A 5EBWC 2WLLB 1I7FA 3C3TA 5EZYB 3VQVA 4LF7O 5EYPB 1K92A 1G6UA 3H1LH 4DV3B 4MS2A 4H33A 4WFEA 5EBMC 4O2BB 3VBBA 2OTJV 2JS3A 4J7JA 1B06A 4QNHB 4R7CA 4TT3G 2KQXA 1VF5B 3OUSA 3BY6A 5J2TB 3TXQA 1Z5WA 1JFFB 2DYRB 1L1FA 1GO3F 3JAMN 3SYCA 1XBLA 1VARA 4LWSA 3X2QB 3K5OA 4KL1A 3RBZA 4IHJA 1NQTA 3S3XA 3OUFA 5KHIA 3K5NA 3QO5A 4K35A 2IBZH 4MVRA 3CCUV 1J5EB 1XHZA 1NTZH 2Q7HA 4JI0O 5FNVA 2IJIA 3OAAG 2QE7G 4MSWC 3VQWA 5KAFZ 3GWOA 1ORQC 2IW5A 5LP6C 4LCUC 4DK1A 3RYHA 5IYDO 1XEQA 3CMAV 1Y74A 3ZJZA 4KXRA 5B1BC 4GX5A 5CA0A 4DV0B 1QQCA 3SPJA 2Y4UA 1WNSA 4DUZO 2WLIB 3FYIB 2E76B 4YIOA 3T1YB 3BPZA 2KB1A 2L6LA 5BMVA 4DV0O 1BE3H 2QM4A 4HBNA 1HWYA 3DC5A 1V54B 1HNXB 3H1JH 4J7ZA 4HYOA 3F7VC 1Y6XA 3P3NA 3GVMA 2PZSA 4IHJB 2OCCB 1PNKA 2ITDC 1YVWA 5FLXN 5H9CA 5IWAB 2BOCC 4UCSA 5JWPA 1OJHA 3K79A 3AG3C 2AHZA 2D3OW 3RGBA 4KHPO 4FLTA 2KG7A 5LMUB 1DF4A 4GCZA 3JSLA 3STLC 1XNQB 1M56C 2E74B 4X62B 5B1OA 4TV9A 4DW0A 3MHSC 4MVUA 4LP8A 1X4TA 2R9IA 2W0FC 3ASNB 3CRAA 1RM1C 3CJHB 3HB3B 2LW1A 1Y4MA 5DN6G 3O9OA 5LXTA 3ZRWA 4QIWF 2WWWA 3DGEA 3AG1B 3LNNA 3OW2U 4DR1B 4Q6GA 3K0DA 1GN6A 3CCSV 2DQ0A 3HKDB 3FFQA 4GKKO 4JAUA 2F93B 1BHAA 4E2LA 2QWRB 4DRXA 1NR1A 2IU0A 1WJZA 1YIJV 2QWPB 4K0KO 3SDLA 1EBOA 3CCJV 1PM9A 2Z5UA 4UCVA 4O2AB 4DRXB 4DR4B 1VMGA 1PNLA 1ZX3A 1VQ7V 5IYZB 4UCUA 2OT5A 4TQDA 3X2QC 2BTQB 1N36O 2EIJC 4BIOA 2V7QG 1I94B 2QM8A 2P5OA 4MT8A 3RVYA 3ETEA 2IJJA 2CGNA 3EFFK 1BZKA 3SPCA 1S3JA 4X1YB 4I0XA 4RUEA 1W0JG 4DV7B 5K1XA 5EK0A 3ZHTA 3SPHA 1HNZB 1EFRG 1Q5OA 4JI5B 4R6ZA 4DR4O 5LHHA 3L75H 2VQEB 1SQFA 4I50B 1RFYA 5C93A 3WB2A 2R72A 2QWOB 3BEHA 1YJ9V 3OTFA 2FKXA 4YXWG 4KFMA 4UVCA 1JJOA 3CC2V 4CH4A 3OEHG 5IJ9B 2YXLA 4FFBA 1AR1B 4DV2B 3D36C 2RMKB 3JASB 4X66B 2Z3YA 3QF7A 4JI5O 4RUFA 1YSCA 2XAGA 1KBHA 3CB2A 2D2CB 1EZJA 1F7YA 4MVSA 1PV0A 3SYQA 3UCSC 2L35A 5B1AB 3ABLC 3ZMZA 2E75B 5BY1A 2F4VB 3DC6A 2PUSA 4DR2B 3BVOA 4JI6B 1D2DA 2V1DA 3QVNA 2IJHA 2WSSG 1QCEA 5GW7A 1JCHA 1OCCB 4CH5A 1VF7A 1K4CC 2HHHB 3BFRA 1QNMA 4JV5B 3AG2C 2LGQA 3CHXA 3WG7B 5LMUO 4KHPB 5F2VO 5L3EA 3SYPA 2JJ1G 4LNUB 1OCOC 1BMFG 2FB5A 2YEVB 4BWAA 2ILMA 4I50A 3P32A 1U96A 3HKCB 5JVDA 2FYUH 3AG7A 3MD0A 2N05A 4P30A 4GKKB 4IL6Z 4LFAB 1RP3B 3B8MA 4O2BA 3JD3A 1EM1A 4I4TA 4DR1O 4EEQA 4PA6A 5J9PC 1K5QA 5BR8B 3OTOO 3NXSA 3AK2A 1K9MW 1T5EA 4UFZA 1AI4A 4GZRB 4I9QA 2EINB 2PGGA 1K4DC 2AXTZ 5EZYA 1I08A 1N0NA 3RYFA 5B66Z 1EN6A 1ENVA 2FL4A 1DLBA
chains in the Genus database with same CATH topology
1WP7A 2FB5A 2L35A 3IJ4A 4FZ0A 1WP8A 4NTWA 2QTSA 3S3XA 3N27A 4FZ1A 4NYKA 4NTXA 4NTYA 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WP7 A;  2FB5 A;  2L35 A;  3IJ4 A;  4FZ0 A;  1WP8 A;  4NTW A;  2QTS A;  3S3X A;  3N27 A;  4FZ1 A;  4NYK A;  4NTX A;  4NTY A;  3S3W A; 
#chains in the Genus database with same CATH topology
 1IVS A;  1B6Q A;  3M99 B;  3H01 A;  3JD2 A;  4FIP C;  5JQG A;  4MVQ A;  1RSO A;  2CTQ A;  1M57 C;  1VQ9 V;  1PNM A;  2AGA A;  1E1R G;  2CTW A;  1SET A;  4FM1 A;  4GYC B;  3LNM B;  1J5E O;  2WLH A;  4DR3 B;  3B09 A;  3FD9 A;  3HPL C;  4DR3 O;  2EIJ B;  4Q20 A;  1R3J C;  1YHQ V;  1IX9 A;  2W6J G;  1R3L C;  3JAK A;  2WLM A;  3K3W A;  4OXS A;  2EUL A;  4CS2 A;  3DTU B;  4F6E A;  3W7S A;  4ZHQ B;  1QR9 A;  4OX9 O;  1OV9 A;  4TQF A;  3I5D A;  4C7U A;  4D7T A;  3RYC B;  4IT5 A;  4PEL A;  1KQS U;  3ZRV A;  1SQP H;  4JTD B;  2K9P A;  5KMG B;  1OZ0 A;  2WA3 A;  2X7R B;  1Q8I A;  4JYA O;  1S5H C;  4LBE C;  1KKD A;  5IDJ A;  3ZMU A;  2LJ2 A;  2GUZ B;  4PDL A;  3RVZ A;  1XIL A;  3E8G A;  4LF8 B;  3TJT A;  4CC5 A;  1HNW B;  4WBN B;  4YIP A;  1AR5 A;  1EN5 A;  2Q8V A;  3JAW A;  4EB6 B;  4O4I B;  5IJ0 A;  1VQL V;  4MVM A;  3M8A A;  4B3R O;  2KKW A;  3B40 A;  1LNQ A;  1WPX A;  2A3Q A;  3CME V;  5J2U B;  1Q6I A;  1SF9 A;  1OCC C;  1TUB A;  2ADQ B;  4W4L A;  3IAY A;  3OD4 A;  3KZI Z;  1KP2 A;  3K59 A;  1JPX A;  5KHJ A;  4O4L B;  3OT7 A;  2Q4P A;  3WG7 C;  4DV1 O;  2DWE C;  2YEV A;  1LUV A;  3ABT A;  2Y69 C;  1MZE A;  3MAQ A;  5CN0 A;  3BAA A;  2P90 A;  1E1Q G;  3W7T A;  1RPO A;  4LF5 B;  4JYC A;  5B5E Z;  2VS0 A;  4FZ0 A;  2RN9 A;  2G38 A;  3F5T A;  3G6B A;  1I94 O;  4JYY A;  3GB7 C;  4YJ3 B;  1URF A;  2CGO A;  5CBG A;  1S5J A;  1BQ0 A;  4P9P A;  3IGA C;  5KHG A;  3UM7 A;  4J41 A;  1Q6H A;  4L8J A;  4GX1 A;  2Z0A A;  3STZ C;  2BE3 A;  4DV2 O;  1SQX H;  3B4S A;  2JRI A;  4JI8 B;  3JAS A;  3ABM B;  4ASU G;  1SER A;  3CYO A;  1FD9 A;  1K33 A;  4IYI A;  1Q82 W;  1JFF A;  1SKV A;  2QTS A;  2XAH A;  4PDM A;  1B04 A;  2VWK A;  4D7S A;  2H94 A;  3RWR D;  4MTF A;  3JCU Z;  1IXB A;  1VP7 A;  4JZ2 A;  1XMQ O;  4JPR A;  5FL7 G;  4FVM A;  4JI3 O;  5IYZ A;  2GDS A;  4I0X B;  2CDY A;  3K03 A;  3K5L A;  4PD4 F;  5L3B A;  4B3R B;  2UXC O;  1KUQ A;  5CB4 B;  1COW G;  3FB6 C;  2Y0I A;  5IY5 B;  3IC9 A;  3JSN A;  2ZT9 B;  2QDO A;  2ADP A;  4DUY O;  5KLV H;  2ZM6 B;  3GWK C;  1VQO V;  1XNQ O;  4FK5 C;  1H2S B;  2MW2 B;  1IBM O;  1GAX A;  1BT8 A;  4K0K B;  2CTP A;  3AG4 B;  1NI8 A;  5HFM A;  2ZE8 A;  1QLE C;  4U7O A;  1GN2 A;  4YJ2 A;  1M90 W;  1AB3 A;  2UXB O;  1PPJ H;  4YY3 O;  3P30 A;  1H2L A;  4UXN A;  3QNE A;  3APQ A;  1PD3 A;  4XBF A;  5H2F Z;  5EC2 C;  3LDC A;  1WB8 A;  5IJ9 A;  1AJP A;  1BL8 A;  3MDS A;  4N23 A;  3SGI A;  1GH6 A;  2QGN A;  3N2K B;  3G6E V;  3LDE A;  2XT9 A;  1WB7 A;  4JI2 O;  3TET A;  1SC5 B;  1NBM G;  1Y76 B;  1QHT A;  1WA8 A;  4EB6 A;  1NTK H;  2HP8 A;  4UCR A;  4GUN A;  3SYA A;  4H37 A;  3DSQ A;  3ZMV A;  4N21 A;  1FJG B;  4MTX A;  3VQX A;  3ZRX A;  4CH6 A;  1WA8 B;  4OGQ B;  3CP1 A;  2QKC A;  1DTO A;  3TXS A;  2A9H A;  4LWS B;  4KUM A;  3BHP A;  2EX3 A;  1MOF A;  3I56 V;  1XQ8 A;  1IBM B;  5EYP A;  5B1B B;  4K8X A;  4PA7 A;  3JYC A;  1GRJ A;  3CEI A;  2Q7G A;  2JK5 C;  1W59 A;  1R6T A;  1AI6 A;  1WAZ A;  4G2K A;  3CPW U;  3VQY A;  1YJN V;  3CRC A;  2OIE A;  2YIA A;  2X6A A;  4FLX A;  2F4V O;  3E86 A;  1BSM A;  3D36 A;  2ZR3 A;  4PDR A;  3E2E A;  4G27 B;  3OMI B;  2H3O A;  3ABU A;  4DV3 O;  3AG1 C;  4NVP A;  3T2M A;  3ZHR A;  2NLJ C;  5BMV B;  2LQT A;  5IYB O;  1AJQ A;  2QKS A;  1YCI A;  3C3S A;  4PDV A;  3S3W A;  2ZNJ A;  4MVZ A;  5EC1 C;  5A9G A;  1ROP A;  1TVK B;  1BCC H;  5B1N A;  5IT9 N;  4BW9 A;  5BXZ A;  4RAI A;  4X88 A;  2JGD A;  4B7E A;  4MTG A;  1SRY A;  1FS0 G;  3ZN0 A;  4IIJ B;  2A0L A;  1MG1 A;  3CCL V;  1A32 A;  4U3J B;  3ML0 A;  4LFC O;  3E22 B;  1OCZ B;  4DW1 A;  4I9W A;  4XDL A;  2ZKO A;  1I5X A;  1KP3 A;  1SS3 A;  5D5Q A;  4O4H B;  1H8H G;  2Q0O C;  3HKE A;  1NZ6 A;  1NU1 H;  2YIB A;  3H1K H;  3ABK C;  1CXZ B;  1B3Q A;  1GTO A;  2EBO A;  3UT5 B;  4L87 A;  1VQ4 V;  2Q6A A;  2HEP A;  4FLZ A;  3FKS G;  2JS5 A;  5L3D A;  2JJ2 G;  1P49 A;  4YHH O;  2UU9 O;  4EFB A;  4DR2 O;  3AG4 C;  4GLX A;  5KHK A;  1KC8 W;  4B3T B;  3K58 A;  4ABM A;  4K8Z A;  1VQ5 V;  1K97 A;  2QM7 A;  2X6B A;  3M7M X;  2ODM A;  3A8T A;  1SQV H;  5ITZ A;  2EIL B;  2CE4 A;  3JD4 A;  2WLJ A;  3CXH F;  2HG5 C;  2OYQ A;  3Q4H B;  3N2K A;  3P3P A;  2F23 A;  2LW7 A;  2FML A;  3ETD A;  1YTF D;  4WFG A;  1ZSP A;  1VQN V;  1XL6 A;  1S0V A;  3QTC A;  4G28 B;  1YI2 V;  3J7A U;  4J80 A;  5B1A C;  3ABL B;  2ZNI A;  2IM9 A;  1SA0 B;  1MNG A;  4GX2 A;  1YJW V;  5EIB C;  4B3T O;  1H8E G;  5IYC O;  4YHH B;  4CH3 A;  1VQK V;  5JCO A;  5J2U A;  1MSD A;  2GV9 A;  2ITC C;  5KX5 A;  1HNZ O;  3B8N A;  3U0Z A;  1YXB A;  3SJB C;  3BA9 A;  2DE0 X;  2Y48 A;  3SJA C;  3VOU A;  2OWO A;  1XNR B;  2UUA B;  3OE7 G;  1BQZ A;  3G80 A;  3CC7 V;  5E79 Z;  2LFR A;  2YSU B;  1VIB A;  4JTC B;  4X1K B;  4E4E A;  4NTW A;  1IUR A;  3CCE V;  1S72 V;  1HNW O;  2P4V A;  2VQF O;  1BHB A;  4WF9 V;  2ATK C;  1V55 C;  4NYK A;  3EXA A;  4ZHQ A;  1Y74 B;  4D6T H;  3IC7 A;  3RYF B;  2R70 A;  4YJ3 A;  1HNX O;  1FYJ A;  1VQP V;  4A5U B;  4F6R B;  1QU7 A;  1US6 A;  4JYA B;  2M6Y A;  3L71 H;  1LUW A;  5B3S B;  3IFX A;  1O9G A;  1NR7 A;  1HW7 A;  4FLU A;  3K04 A;  3SR2 C;  3ZED A;  3LSS A;  1M57 B;  1NT2 B;  2QWN B;  2JVD A;  5LA6 A;  3SYO A;  2VWJ A;  4I7Z B;  4ZIB A;  5C8Y B;  4KP4 A;  2EJR A;  1OCR C;  1N4C A;  5LL6 Y;  1AI7 A;  1MMM A;  1PP9 H;  1N8R W;  4FLV A;  2P4K A;  3CD6 V;  3E89 A;  3OMA B;  3WU2 Z;  1G1X B;  3JAW B;  3W7X A;  4GKJ O;  4HNA A;  3T1Y O;  1ZL8 B;  4LNU A;  4FLW A;  1SQB H;  4LF9 O;  3JAR B;  2QJ1 A;  3HKC A;  4HNA B;  2WPD G;  2UXB B;  3CCV V;  3NR7 A;  1GK9 A;  3ABK B;  4NTY A;  4NXM B;  5EBL C;  2R9A A;  3E83 A;  2BSK A;  2ARH A;  1BGY H;  5CA1 A;  3AK1 A;  4ZOL A;  4WFA V;  5D5P A;  4JV5 O;  2DMX A;  1N0J A;  4MTO A;  2M7W A;  3UKM A;  2ZM6 O;  3FYE B;  1W0K G;  4Z1V A;  3T4Z A;  2PI5 A;  5GON A;  4B3M O;  4R8C A;  2DJV A;  4AQY B;  3CC4 V;  1AI5 A;  5H6Q A;  1MA1 A;  2EIL C;  4H44 B;  2HJF C;  1XOU A;  5BR8 O;  3OTO B;  1GN3 A;  2IJK A;  3OMN B;  2GSM B;  1Q6U A;  5JQG B;  2EJ7 A;  1R6N A;  3J80 N;  2GTA A;  2YI9 A;  2X6C A;  4X64 O;  5A2Q N;  1WLE A;  1CPY A;  4MW3 A;  1SA0 A;  3G67 A;  1THZ A;  2NNU A;  3A0B Z;  4FFK A;  1NVP D;  2EZO A;  3ASO C;  1Y67 A;  2JGD B;  3ZHS A;  2JDI G;  4X66 O;  4I55 A;  1K8A W;  5LOV A;  1AP6 A;  1UFI A;  1J95 A;  1DK1 A;  2NN4 A;  2YXH A;  4JI8 O;  3ZCC A;  3K9S A;  2YIB D;  4P9O A;  4TV9 B;  2Q73 A;  1FAF A;  2VQE O;  1JJ2 U;  1Z5V A;  2N74 A;  4TV8 A;  1QBZ A;  2CH7 A;  4DUY B;  4B08 A;  3H9V A;  1XI1 A;  2PYJ A;  1SES A;  4DV5 O;  1UPG A;  3CRQ A;  2DW4 A;  2WA4 A;  2ZE6 A;  1MSW D;  4CC6 A;  2GHY A;  4DR7 O;  1NKD A;  2UUA O;  3ZN1 A;  1Q81 W;  1Y66 A;  3K0G A;  2YDE A;  2ZR2 A;  5LXT B;  2FTK A;  3N2G A;  1G4Y B;  2Y4T A;  5ITZ B;  3H1I H;  3ABM C;  4X1I A;  4MVO A;  2CUG A;  1XHX A;  1R73 A;  4HAM A;  2P7T C;  1HDJ A;  3OFN G;  2E5L B;  1BS3 A;  4BIZ A;  1NH2 B;  4LF9 B;  2O57 A;  3O65 A;  4H0L B;  3JAK B;  2YS8 A;  4GKJ B;  1XMO O;  3QO7 A;  4FM0 A;  1IBL B;  4QE7 A;  4DV7 O;  1N33 O;  1SZX A;  1M56 B;  1IXM A;  2RDC A;  3CRM A;  4JI4 O;  2B1I A;  2Y69 B;  3T4D A;  1K7D A;  3B2E E;  4U7N A;  4XDK A;  5JCO C;  2ETN A;  2F1M A;  1RM1 B;  3ASN C;  2LO1 A;  2WLK A;  2BCC H;  4Z2W A;  3EHB B;  5L3G A;  2Q9L A;  3HKE B;  2XTA A;  4X65 B;  3FB5 C;  1N34 B;  3CSX A;  5E1A C;  3ZBH A;  3DXR B;  2Y0P A;  2ZXW C;  1NJI W;  1H2N A;  4FZ1 A;  4CS4 A;  2XOK G;  3JAL B;  1JVM A;  3JCZ A;  1AR4 A;  2HVK C;  3K5M A;  2A79 B;  3KG2 A;  4X89 A;  4BW5 A;  1WP8 A;  5IE9 A;  1Q90 D;  1ZUQ A;  3HKD A;  2WLL A;  5JJN B;  3JAL A;  4X1I B;  3CCR V;  3EVK A;  4H13 B;  1CP9 A;  4LF8 O;  4EKW A;  1KD1 W;  2DN9 A;  5L3F A;  4LFC B;  2W0X A;  4LH6 A;  1V9P A;  1HR0 O;  4AIL C;  2Q5Z A;  1FXV A;  5JH7 A;  3RT3 C;  2QSA A;  1KB9 F;  5LHI A;  3QO8 A;  5LOV B;  2YIC A;  3UO2 A;  5DM6 V;  4GT1 A;  4Z1M G;  4J42 A;  5LHG A;  3IJ4 A;  3D3I A;  1H2M A;  2XUM A;  4JI1 O;  4RWU A;  5DED A;  2UXX A;  4TUY B;  4NKG B;  2ZD9 A;  2PF4 E;  2PI4 A;  1UJW B;  1H2G A;  4O4L A;  1TA8 A;  4OX9 B;  3CXC U;  1R1B A;  3ICX A;  1QVG U;  4TWK A;  4JGS A;  3JD1 A;  3J81 N;  5FNV B;  1QLE B;  4LF4 O;  4JZG A;  5CB4 A;  1S76 D;  2Q7E A;  3FB7 C;  5KA6 A;  1WPB A;  4QPK A;  4LFA O;  3R65 A;  4F6R A;  2B9Z A;  1SQG A;  5CA1 B;  4YJ2 B;  4HZ3 A;  1AJN A;  4WFF A;  5CBH A;  4X1K A;  5LYJ A;  1FXK B;  2N04 A;  4DR5 O;  3KCY A;  4FLY A;  4LR3 A;  2WLI A;  1RPR A;  5KAI Z;  1EN4 A;  1KMI Z;  2QA4 V;  1Q43 A;  1Q7Y W;  1Q3E A;  1IBK O;  2UUC O;  1YTF B;  3FB8 C;  5LYJ B;  2EIK C;  1VQ8 V;  1FJG O;  1F51 A;  3BAB A;  3THO A;  3L72 H;  2Q67 A;  4FJC C;  4DUZ B;  1F4M A;  1S77 D;  2GTS A;  3F5W C;  3AG2 B;  2QKA A;  4U3J A;  1ZL8 A;  5L3C A;  4DYL A;  2WLN A;  1OCO B;  4QE9 A;  1JR9 A;  4BAY A;  1XMO B;  2XHB A;  4DR6 B;  1ZAU A;  2A7W A;  1FXH A;  3ZMS A;  2F95 B;  4YY3 B;  2ZIN A;  1AIL A;  4GX0 A;  5LMN B;  1KEC A;  2P06 A;  3AEI A;  2IU3 A;  1R6K A;  4CZZ A;  2QWQ B;  2BOB C;  1GKF A;  2QR4 A;  3HKB A;  4JI0 B;  4ZKI A;  4JAS A;  2KG7 B;  4UVA A;  3BCC H;  3RFR A;  3B77 A;  3RYI B;  1X59 A;  4LF6 B;  2UXN A;  1KU9 A;  2PTM A;  4JI7 O;  4B3M B;  3T1H B;  4DV5 B;  4NTX A;  3A0H Z;  3RYI A;  2XND G;  4PA9 A;  4R50 A;  1N36 B;  1TVK A;  3W7U A;  3K06 A;  3WFV A;  5H5N A;  3OEE G;  5HFL A;  2DYR C;  2V4D A;  4QJF B;  4QGP A;  3ZMT A;  3SJC C;  2EIM C;  4J9Z B;  4WBN A;  4O2A A;  2LGW A;  5LMN O;  1D5N A;  2ZIM A;  2XAS A;  1GN4 A;  2BTQ A;  1YEW A;  2JEU A;  3LSQ A;  2PYL A;  2AHY A;  3ZX6 A;  2UUB B;  5CMU A;  2RQ6 A;  1O9H A;  4JI2 B;  1FFX B;  1VQM V;  2DWD C;  3UT5 A;  1L8D A;  1SQQ H;  5KHH A;  1YZB A;  4AI8 A;  5BZB A;  4DV6 O;  3HR0 A;  5GTH Z;  4UCT A;  1GMG A;  1P7G A;  4LF5 O;  5GTI Z;  2YUA A;  2ZDI A;  3ZS8 C;  5KA5 A;  1M5I A;  4NXN O;  5DEC A;  3PN1 A;  2ZE5 A;  4X62 O;  3CWB H;  1JX9 A;  1JA8 A;  2OTL V;  1KYO F;  3WB1 A;  1DGS A;  4X1Y A;  1NVP B;  3G71 V;  1R3I C;  1FXK C;  2OCH A;  3K08 A;  3ZRS A;  2JIZ G;  5KMG A;  4DR5 B;  2W6I G;  1FPO A;  3E35 A;  1G8M A;  5B3S C;  4IYH A;  2UXD O;  4XDJ A;  2DQ3 A;  1L0N H;  4X65 O;  2VQF B;  2LFS A;  2OCC C;  1TGO A;  4FFB B;  4JF3 A;  4DO2 A;  3N27 A;  4FPP A;  2F43 G;  4IIJ A;  1VF6 A;  1S5L Z;  4LF4 B;  5FPO A;  3A0R A;  4TSF G;  2PY5 A;  2UXD B;  3E22 A;  1PL4 A;  1Y76 A;  3A2F A;  2AW9 A;  2QEX V;  1OCR B;  1GM7 A;  2DYS B;  4WFB V;  3SPI A;  3TGU H;  4J9Y B;  1Q86 W;  1M4U A;  4P2Z A;  1N33 B;  2HVJ C;  4UV9 A;  3FAV B;  3ZHV A;  1XMQ B;  1FFX A;  4X9Q A;  5H6R A;  3U10 A;  4JI1 B;  4DV4 B;  2AZ2 A;  1VQ6 V;  4J7K A;  1MAB G;  1AVM A;  4J11 A;  3AK3 A;  1XDC A;  2BSK B;  2C2A A;  3FAV A;  4X8A A;  1GM9 A;  3JAT A;  1V55 B;  1QR8 A;  3Q4H A;  3D3Q A;  2YXY A;  3OM3 B;  2HKO A;  4OPA A;  5GON B;  1NH2 D;  1D5A A;  1XRE A;  2DOS A;  1W2B U;  1H2K A;  1MZF A;  3ZRW B;  5LBQ A;  4NXN B;  3OR6 C;  4UB8 Z;  3I55 V;  3L74 H;  5CA3 A;  3OR7 C;  1P4R A;  3LUT B;  4JI7 B;  5KUM A;  3W7W A;  3N2G B;  4B7K A;  4O4J A;  5LGN A;  3CCQ V;  5J2T A;  4DXW A;  1EZV H;  1ZTE A;  5KUK A;  1SZT A;  4DV1 B;  3TK1 A;  5JH7 B;  3U11 A;  1TUE B;  5LGU A;  2R9R B;  2EIM B;  3LSU A;  2HLD G;  4OPH A;  3ZIA G;  1OHH G;  2ZE7 A;  4PI0 A;  4ZI7 A;  4X20 A;  1YDX A;  3G4S V;  2IH1 C;  5TIS Z;  3JAT B;  1IBL O;  2LP7 A;  3SJQ C;  4LF7 B;  3APO A;  3RYH B;  3F7Y C;  2OIG A;  1N32 O;  4PA3 A;  4X64 B;  4B3S O;  3ETQ A;  1GM8 A;  4ZBM A;  4I5S A;  4W4K A;  4K3A A;  3MHH C;  3UO3 A;  5CBF A;  3L9D A;  2YC0 A;  3R66 A;  4PA4 A;  4RQE A;  2K1E A;  2CAZ C;  3RW0 A;  2UU9 B;  1RSO B;  3CRR A;  1YIT V;  4LFB B;  2MK3 A;  4DR6 O;  5CA0 B;  1IDS A;  2RNB A;  5K1P A;  4JI6 O;  3ASO B;  2CTR A;  1L0L H;  3JD0 A;  5LA6 B;  3BA8 A;  5FPR A;  4JAA A;  4LF6 O;  1K5S A;  3JAR A;  3T1C A;  3KCX A;  4AHC A;  3E8F A;  2H8P C;  4B3S B;  3ETG A;  1N32 B;  5AG2 A;  4JAV A;  5IJ0 B;  4LFB O;  2P6J A;  2UUC B;  1H38 A;  1LR1 A;  1P84 F;  1NS1 A;  4BIU A;  2DYS C;  2X0L A;  3E8B A;  1XL4 A;  1JOY A;  2QTO A;  3HKB B;  4U3F H;  2HFE C;  2HJD A;  3D8C A;  4PI2 A;  5LGT A;  4JYB A;  4MW8 A;  2Q69 A;  4DV4 O;  2ZXW B;  3K57 A;  5LP6 A;  4ZOL B;  3FX7 A;  1M93 A;  2ZQM A;  3SPG A;  3RN4 A;  3K9A A;  2RCV A;  1ARO P;  4LH7 A;  3ZHQ A;  1ZWI C;  1YF2 A;  4UCO A;  4AQY O;  3KKY A;  2EIN C;  4UB6 Z;  1M1K W;  1JMK C;  1NTM H;  4DK0 A;  4UV8 A;  4I55 B;  3CX5 F;  4JTA B;  4CS3 A;  4O4J B;  2YID A;  1Z2G A;  4O4I A;  2GUZ A;  2Q0A A;  4LC1 A;  1OCZ C;  1IBK B;  3L70 H;  4BR6 A;  2JEX A;  1TUB B;  1M9N A;  3H1H H;  4NXM O;  1AP5 A;  2CH7 B;  4QPJ A;  1VF6 C;  3L73 H;  3LDD A;  2HHH O;  2WAM A;  1TAE A;  2CK3 G;  4X20 B;  3ZHU A;  1K3E A;  3C90 A;  2P67 A;  1I5Y A;  3PJS K;  4UVB A;  4TV8 B;  1HP8 A;  2A06 H;  1XNR O;  5JJE B;  5LP6 B;  1KKC A;  3CCM V;  3OGI B;  1VEW A;  1U97 A;  1DF5 A;  2BTO A;  3E8H A;  4WCE V;  1K73 W;  2ZCE A;  1XUQ A;  4NB5 A;  2Q68 A;  3TCU A;  5EIB D;  3RYC A;  3DXR A;  2AZ0 A;  3CE2 A;  2F66 C;  1CEZ A;  1V54 C;  4JI4 B;  1PKX A;  1HR0 B;  4F4L A;  1WN7 A;  1F4N A;  2EZP A;  1F23 A;  4IGG A;  2XAQ A;  4TOI A;  1IZ3 A;  5IWA O;  4UUJ C;  1FFT B;  2XAJ A;  1E79 G;  4J10 A;  1QLN A;  1QVF U;  2E3C A;  4NR1 A;  4RO2 A;  3T1H O;  2E5L O;  3CS5 A;  2UXC B;  4DV6 B;  3AG3 B;  3OGC C;  4EFE A;  5C8Y A;  3BRC A;  4PHZ A;  1PL0 A;  4JI3 B;  4TUY A;  1I0H A;  4O4H A;  1K34 A;  2RJZ A;  3QG5 A;  2HR3 A;  4ZI7 B;  4RQF A;  4ICG A;  3WB0 A;  1N34 O;  2KSD A;  1FKA O;  4PJ0 Z;  2XAF A;  1WP7 A;  5JVD B;  2YI8 A;  4CBC A;  2IH3 C;  2B5U A;  5IY5 C;  2B1G A;  5KX5 B;  2P22 C;  4WFH A;  4DR7 B;  2ZDI C;  3UQ8 A;  1P7B A;  5JJJ B;  4I4T B;  2VRZ A;  2UUB O;  4FMT A;  2ZIO A;  1ZLZ A;  2GBO A;  1JQ0 A;  1R3K C;  3CJH A;  2NR5 A;  1FXK A;  4PV1 B;  2EIK B;  2JGU A;  4FM2 A;  5EBW C;  2WLL B;  1I7F A;  3C3T A;  5EZY B;  3VQV A;  4LF7 O;  5EYP B;  1K92 A;  1G6U A;  3H1L H;  4DV3 B;  4MS2 A;  4H33 A;  4WFE A;  5EBM C;  4O2B B;  3VBB A;  2OTJ V;  2JS3 A;  4J7J A;  1B06 A;  4QNH B;  4R7C A;  4TT3 G;  2KQX A;  1VF5 B;  3OUS A;  3BY6 A;  5J2T B;  3TXQ A;  1Z5W A;  1JFF B;  2DYR B;  1L1F A;  1GO3 F;  3JAM N;  3SYC A;  1XBL A;  1VAR A;  4LWS A;  3X2Q B;  3K5O A;  4KL1 A;  3RBZ A;  4IHJ A;  1NQT A;  3S3X A;  3OUF A;  5KHI A;  3K5N A;  3QO5 A;  4K35 A;  2IBZ H;  4MVR A;  3CCU V;  1J5E B;  1XHZ A;  1NTZ H;  2Q7H A;  4JI0 O;  5FNV A;  2IJI A;  3OAA G;  2QE7 G;  4MSW C;  3VQW A;  5KAF Z;  3GWO A;  1ORQ C;  2IW5 A;  5LP6 C;  4LCU C;  4DK1 A;  3RYH A;  5IYD O;  1XEQ A;  3CMA V;  1Y74 A;  3ZJZ A;  4KXR A;  5B1B C;  4GX5 A;  5CA0 A;  4DV0 B;  1QQC A;  3SPJ A;  2Y4U A;  1WNS A;  4DUZ O;  2WLI B;  3FYI B;  2E76 B;  4YIO A;  3T1Y B;  3BPZ A;  2KB1 A;  2L6L A;  5BMV A;  4DV0 O;  1BE3 H;  2QM4 A;  4HBN A;  1HWY A;  3DC5 A;  1V54 B;  1HNX B;  3H1J H;  4J7Z A;  4HYO A;  3F7V C;  1Y6X A;  3P3N A;  3GVM A;  2PZS A;  4IHJ B;  2OCC B;  1PNK A;  2ITD C;  1YVW A;  5FLX N;  5H9C A;  5IWA B;  2BOC C;  4UCS A;  5JWP A;  1OJH A;  3K79 A;  3AG3 C;  2AHZ A;  2D3O W;  3RGB A;  4KHP O;  4FLT A;  2KG7 A;  5LMU B;  1DF4 A;  4GCZ A;  3JSL A;  3STL C;  1XNQ B;  1M56 C;  2E74 B;  4X62 B;  5B1O A;  4TV9 A;  4DW0 A;  3MHS C;  4MVU A;  4LP8 A;  1X4T A;  2R9I A;  2W0F C;  3ASN B;  3CRA A;  1RM1 C;  3CJH B;  3HB3 B;  2LW1 A;  1Y4M A;  5DN6 G;  3O9O A;  5LXT A;  3ZRW A;  4QIW F;  2WWW A;  3DGE A;  3AG1 B;  3LNN A;  3OW2 U;  4DR1 B;  4Q6G A;  3K0D A;  1GN6 A;  3CCS V;  2DQ0 A;  3HKD B;  3FFQ A;  4GKK O;  4JAU A;  2F93 B;  1BHA A;  4E2L A;  2QWR B;  4DRX A;  1NR1 A;  2IU0 A;  1WJZ A;  1YIJ V;  2QWP B;  4K0K O;  3SDL A;  1EBO A;  3CCJ V;  1PM9 A;  2Z5U A;  4UCV A;  4O2A B;  4DRX B;  4DR4 B;  1VMG A;  1PNL A;  1ZX3 A;  1VQ7 V;  5IYZ B;  4UCU A;  2OT5 A;  4TQD A;  3X2Q C;  2BTQ B;  1N36 O;  2EIJ C;  4BIO A;  2V7Q G;  1I94 B;  2QM8 A;  2P5O A;  4MT8 A;  3RVY A;  3ETE A;  2IJJ A;  2CGN A;  3EFF K;  1BZK A;  3SPC A;  1S3J A;  4X1Y B;  4I0X A;  4RUE A;  1W0J G;  4DV7 B;  5K1X A;  5EK0 A;  3ZHT A;  3SPH A;  1HNZ B;  1EFR G;  1Q5O A;  4JI5 B;  4R6Z A;  4DR4 O;  5LHH A;  3L75 H;  2VQE B;  1SQF A;  4I50 B;  1RFY A;  5C93 A;  3WB2 A;  2R72 A;  2QWO B;  3BEH A;  1YJ9 V;  3OTF A;  2FKX A;  4YXW G;  4KFM A;  4UVC A;  1JJO A;  3CC2 V;  4CH4 A;  3OEH G;  5IJ9 B;  2YXL A;  4FFB A;  1AR1 B;  4DV2 B;  3D36 C;  2RMK B;  3JAS B;  4X66 B;  2Z3Y A;  3QF7 A;  4JI5 O;  4RUF A;  1YSC A;  2XAG A;  1KBH A;  3CB2 A;  2D2C B;  1EZJ A;  1F7Y A;  4MVS A;  1PV0 A;  3SYQ A;  3UCS C;  2L35 A;  5B1A B;  3ABL C;  3ZMZ A;  2E75 B;  5BY1 A;  2F4V B;  3DC6 A;  2PUS A;  4DR2 B;  3BVO A;  4JI6 B;  1D2D A;  2V1D A;  3QVN A;  2IJH A;  2WSS G;  1QCE A;  5GW7 A;  1JCH A;  1OCC B;  4CH5 A;  1VF7 A;  1K4C C;  2HHH B;  3BFR A;  1QNM A;  4JV5 B;  3AG2 C;  2LGQ A;  3CHX A;  3WG7 B;  5LMU O;  4KHP B;  5F2V O;  5L3E A;  3SYP A;  2JJ1 G;  4LNU B;  1OCO C;  1BMF G;  2FB5 A;  2YEV B;  4BWA A;  2ILM A;  4I50 A;  3P32 A;  1U96 A;  3HKC B;  5JVD A;  2FYU H;  3AG7 A;  3MD0 A;  2N05 A;  4P30 A;  4GKK B;  4IL6 Z;  4LFA B;  1RP3 B;  3B8M A;  4O2B A;  3JD3 A;  1EM1 A;  4I4T A;  4DR1 O;  4EEQ A;  4PA6 A;  5J9P C;  1K5Q A;  5BR8 B;  3OTO O;  3NXS A;  3AK2 A;  1K9M W;  1T5E A;  4UFZ A;  1AI4 A;  4GZR B;  4I9Q A;  2EIN B;  2PGG A;  1K4D C;  2AXT Z;  5EZY A;  1I08 A;  1N0N A;  3RYF A;  5B66 Z;  1EN6 A;  1ENV A;  2FL4 A;  1DLB A; 
#chains in the Genus database with same CATH homology
 1WP7 A;  2FB5 A;  2L35 A;  3IJ4 A;  4FZ0 A;  1WP8 A;  4NTW A;  2QTS A;  3S3X A;  3N27 A;  4FZ1 A;  4NYK A;  4NTX A;  4NTY A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...