3S3XA

Structure of chicken acid-sensing ion channel 1 at 3.0 a resolution in complex with psalmotoxin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
404
structure length
401
Chain Sequence
b'VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 89
structure length 401
sequence length 404
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3xA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3xA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3xA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3xA02
4NTXA 1WP7A 2L35A 3IJ4A 2QTSA 1WP8A 4NTWA 4FZ0A 4NTYA 3S3WA 3S3XA 4FZ1A 4NYKA 2FB5A 3N27A
chains in the Genus database with same CATH superfamily
2ATKC 4MVSA 4JV5B 3PJSK 3R65A 1VF5B 2R9AA 3MD0A 4LR3A 3KZIZ 3AEIA 4QE9A 3TGUH 1RP3B 4JI8B 2GBOA 4LF8O 5EZYA 5JVDB 1YXBA 5KMGB 5HFLA 2LGWA 4IYIA 4TUYB 5B1NA 2R72A 4DR2O 5IYDO 2KG7A 5B3SC 5IYZA 1FXKA 2Y48A 5LA6A 4LCUC 2XHBA 4EFEA 2RMKB 1FPOA 4K35A 4CS3A 3L70H 3OM3B 3K5OA 4I9WA 3DSQA 3CRMA 2YS8A 4UVCA 2PY5A 2WA4A 3WG7B 1NTKH 5K1PA 4FLZA 2Y69C 4DR7O 4WFEA 1AVMA 3AG2C 4BWAA 1FFXA 2CE4A 2GUZB 3RFRA 5LXTB 1AI5A 4MVQA 5IJ9A 2OCHA 4JI3O 1I7FA 2WLLA 4X20A 1N32B 1B06A 4FVMA 4DR4O 1CEZA 4LFCO 2PUSA 2A7WA 3CCLV 4GUNA 4L87A 4DR2B 2IW5A 3AG3C 2P4KA 4NR1A 1FJGO 4Q20A 2QKCA 4PDVA 1Q86W 1FFTB 1VQ6V 1W2BU 4C7UA 2ADPA 4J80A 5CBHA 2F4VB 3W7XA 5JQGA 1US6A 4DK1A 2Q8VA 1B6QA 5LMUO 4DR7B 3E86A 4UVAA 3W7UA 4MTXA 5KX5A 5EIBD 2X6CA 2EJ7A 5LHGA 5LGTA 2EIJC 4JI3B 5EIBC 4DRXB 2YIBA 1BT8A 5BZBA 3OUFA 3FB5C 3LUTB 2A9HA 5CMUA 1XL4A 4DR3O 2B1IA 1FJGB 2UXNA 3UT5A 1M56C 5DM6V 4R6ZA 3GWKC 3SPCA 1CP9A 4Z2WA 2ZINA 1OCRC 4JI5B 3K5NA 2JRIA 2H8PC 4O4LA 5LMUB 2ADQB 2CTQA 1I08A 3MAQA 1M56B 1K33A 1O9GA 1OCZC 3APQA 4LF5B 3DXRA 4QPKA 4EB6B 4RUEA 2JGUA 1PNLA 5H6RA 2CH7B 3OTOO 5B66Z 3G67A 3JASB 5C8YA 2VQEO 4CH4A 2P67A 2EZOA 3T4DA 1JFFA 3UO3A 4DR3B 2QM4A 3QTCA 5FNVA 2XUMA 3OUSA 1OCZB 2UXDB 1X59A 4QJFB 5DN6G 1XILA 1WAZA 3A0HZ 3JD0A 1Z5VA 2EINC 3D36C 1FKAO 3F5TA 4J10A 3RYIB 1NTZH 5GTHZ 1Y76B 5D5QA 1ZUQA 3QNEA 1AP6A 4PI2A 4X8AA 2ITCC 3CHXA 3SYQA 1QR9A 2EINB 1WB8A 3A8TA 3KKYA 2GV9A 4LWSA 2WLIB 4DV2B 3J7AU 1LUVA 1UFIA 3H9VA 2VQEB 2ZE8A 2CTPA 4IL6Z 3F5WC 2OWOA 3HPLC 4UVBA 5J2TB 5GONB 3IJ4A 3G4SV 3BEHA 1M93A 3BAAA 2BOBC 3JATB 1MG1A 2DQ0A 4QE7A 4PDRA 3STLC 3ETGA 4KXRA 5CB4A 5LOVA 1H8HG 3SPJA 4GKJO 5CA0B 3D3QA 1F4MA 3BA9A 4UCOA 2ZE6A 1P84F 2DYSC 4RO2A 2GHYA 3FKSG 1YTFD 2OIEA 3VQWA 2D3OW 2HVKC 4LH6A 4DUYO 4F6RA 4NB5A 2HP8A 3ABLB 4X62O 2UU9O 1IVSA 3ABKB 4IYHA 1BL8A 2PI5A 1XNQB 1H8EG 5EYPB 2BSKA 5IYCO 2X0LA 1Z5WA 1YCIA 3RW0A 2N04A 1NR1A 3HKBB 2HFEC 4B3SB 2YXLA 1KECA 4J9ZB 4GKKO 4PD4F 4D7TA 1AJPA 1N36O 4JYCA 3GB7C 1YZBA 3OR6C 4I5SA 4YJ3B 2FB5A 4R50A 4WFGA 1Q3EA 3LSUA 3HKEB 4DUZO 1WPBA 4BAYA 3ASNB 2YEVA 2WWWA 3B40A 3CC4V 2H3OA 4DUYB 1MSWD 1D2DA 4X62B 1AB3A 1HNWO 3CCSV 4B3TO 2X6AA 2AGAA 2GDSA 2FKXA 3SDLA 3H1KH 4H13B 1QHTA 3WB0A 1Q6IA 2ZR2A 1ROPA 1XNRB 1SQFA 4X89A 1KB9F 5C93A 3CJHB 1I5YA 2ZKOA 1N36B 2QKAA 4ICGA 1IXMA 1YJ9V 2DYRC 4GX5A 3JD4A 4DUZB 4YHHO 3OMAB 1O9HA 4WFHA 1W59A 5KA5A 4U7OA 1TUBB 2CK3G 1GMGA 3BCCH 1AI4A 4UB6Z 4MW8A 1HNWB 4LNUB 4H33A 4B3TB 5EBMC 3CC2V 4WF9V 1T5EA 2DYRB 3OE7G 4MVUA 4O2BB 1VQKV 1HNZO 3B77A 1WP7A 2WA3A 3T4ZA 2Z3YA 2GTAA 5JVDA 2QEXV 1SERA 1QNMA 1V54C 4JYAB 5L3CA 4TUYA 2W0XA 4CS2A 2HKOA 1M9NA 5CA1B 1SRYA 1RM1B 1NZ6A 1F7YA 1QLEB 1QVFU 2V1DA 2ZIOA 4XBFA 3K79A 4QIWF 2JS3A 4YHHB 2WLJA 4LF9B 2OCCC 4JI2B 2UXXA 3ZHUA 4KL1A 4F4LA 1K5SA 3SYCA 1S72V 1S3JA 2P06A 1AI7A 3JD1A 2ZXWB 3AK2A 1ENVA 2OTLV 2HG5C 1ZSPA 1RFYA 2VRZA 1BSMA 4Z1MG 1HWYA 2BOCC 4YY3B 1NKDA 1GKFA 2GUZA 5LXTA 3ABMB 1HNZB 1YHQV 1BHBA 2Q4PA 1MABG 3SPHA 2ILMA 2OCCB 1WP8A 2YSUB 1LNQA 1N4CA 4X1IB 1JA8A 1P49A 1R73A 5KAIZ 1PNMA 2Q73A 1IURA 1VIBA 3IC7A 4DV4O 1K92A 4B7KA 1KBHA 1I94O 3DC6A 4CH6A 1NVPD 3HKDB 3OMNB 3CRCA 4QPJA 3AG1B 4UCTA 2LFSA 3STZC 5B1AB 3SJQC 3E83A 3CRAA 3ABUA 1VQMV 4X65O 2Q9LA 2Q7EA 1R6NA 3L73H 2QM7A 5AG2A 5LHIA 4X9QA 2QDOA 2WLNA 2OT5A 3SJCC 1KP2A 4ABMA 4CH5A 2JJ2G 4JGSA 3HB3B 4DRXA 1KU9A 3P32A 2QKSA 1R3LC 1XBLA 1AJQA 1S77D 3ZCCA 2KKWA 2Y4UA 1VF6C 2F23A 2HEPA 2WSSG 5LL6Y 1G8MA 1GRJA 3L75H 1F51A 2KQXA 1FS0G 3P3PA 2KB1A 4DV4B 3UKMA 3N27A 5EBWC 1U96A 5A9GA 2Q67A 2JK5C 3ZMUA 1I94B 3BFRA 1RPOA 3W7WA 4PI0A 1PKXA 2YUAA 4H37A 4J7ZA 2DE0X 1EZVH 4PHZA 4N21A 1N0NA 3MHHC 2V4DA 1EBOA 3K9SA 1XMQB 3BABA 4LC1A 5CA3A 3B8MA 1Z2GA 4JAVA 3LSQA 4EB6A 4LP8A 4JYBA 2FMLA 1SF9A 3CRQA 2CH7A 2F43G 3VBBA 4AI8A 1VQLV 4GX2A 3TXSA 3JASA 5KHHA 2ZNIA 2DOSA 4CH3A 1YJWV 1KKDA 2YC0A 1N32O 1K8AW 2VS0A 1E1QG 1AROP 3K04A 3AK1A 4EEQA 2N05A 5LBQA 1QBZA 3AK3A 1V9PA 3CB2A 4GYCB 2M7WA 4FFBB 2CTRA 1U97A 3ASOC 2O57A 4R8CA 1ZL8B 3D8CA 1R3JC 2QJ1A 3RYIA 3SJBC 2XOKG 1PP9H 4KUMA 4O4JB 1Y76A 1AR4A 5KUMA 4GX0A 4JTCB 2ODMA 1AP5A 2F4VO 3ZMSA 3JCUZ 4TV9B 4D6TH 5B3SB 3RYHB 1JOYA 1KP3A 2QWQB 1YEWA 3SGIA 2WLIA 1R3KC 1GTOA 3E8GA 4XDJA 5JCOA 5IY5C 3OFNG 4PA3A 1PD3A 2NR5A 1SETA 4MVOA 1AJNA 4NVPA 2RJZA 1GAXA 5J2TA 3T1YO 1S5HC 2EIKC 5GONA 4NTWA 2Y69B 1YITV 1G6UA 5B1BC 2ZNJA 3AG2B 3FYEB 3JD3A 3JATA 4XDLA 4TV8B 3RVYA 4JASA 1HR0O 2P5OA 4R7CA 2IJIA 5CA0A 2E75B 3JCZA 2E76B 2Q7HA 4FFKA 5DEDA 5JWPA 2IJKA 3ETQA 1W0JG 2YDEA 2EIKB 3AG3B 4JI5O 1KQSU 1PM9A 4EFBA 4I7ZB 2JDIG 4CS4A 3K08A 3C3TA 1R6KA 2ZDIC 2VQFB 1TGOA 5EYPA 4LF5O 4JI1B 2LW7A 5FL7G 2NN4A 1PNKA 2JGDB 1L1FA 4DO2A 3VQYA 1JMKC 3HKBA 4MSWC 3GVMA 1XHZA 4ZKIA 4NKGB 3I5DA 4UCSA 3T1YB 2LQTA 1WLEA 4J41A 3RN4A 1BZKA 5IJ0B 1K5QA 2ZQMA 4OGQB 2UXDO 4YJ3A 1IBMO 1HR0B 3HKEA 2EIJB 4Q6GA 4LFAB 4HYOA 2XAGA 3JAKB 3LDDA 3M99B 1Q81W 4I50B 4FMTA 1AR1B 4PELA 5H6QA 1YVWA 3NR7A 1GO3F 2UXBB 5FLXN 2NNUA 4IIJB 3WB2A 5JH7B 3RYCB 3E2EA 1XUQA 2P7TC 2Q7GA 2DN9A 2A06H 4DV2O 1OCRB 3CWBH 1H38A 5IE9A 3JARB 3CJHA 1OHHG 1P4RA 1DGSA 4K8XA 1HW7A 1PPJH 3K03A 4XDKA 3KCYA 4DV0O 4YIOA 1HDJA 1IBMB 2IH3C 2ZT9B 2WLMA 4JF3A 4FK5C 2FYUH 2ZCEA 4DV3O 3I55V 1SQBH 1YIJV 5KHJA 1TUBA 3TCUA 5H2FZ 3ZHRA 1AR5A 3JD2A 4LNUA 4JI6B 1QQCA 2JVDA 3K59A 4O2BA 4H44B 3CE2A 1IX9A 2IU3A 1NQTA 3SYOA 4WCEV 4J42A 1XNQO 1SQXH 4E4EA 2JIZG 5CA1A 2ETNA 4B3SO 2EJRA 1KKCA 1KD1W 1GK9A 2XAFA 4DV0B 4IHJA 5KHKA 4NXNO 3B4SA 1M57C 3RVZA 4JPRA 3C3SA 4WFAV 4AILC 4DV3B 3WFVA 4MVRA 5H9CA 1BMFG 1QCEA 1KUQA 2XNDG 4MW3A 1AI6A 3FFQA 3H1HH 4PA6A 4O4HB 4B3MO 4RWUA 4DV6O 2WPDG 1OCCC 2IJJA 4BR6A 3AG4C 3JYCA 2EULA 3BRCA 5LP6C 1M57B 1Q8IA 1H2LA 3X2QC 1I0HA 1JQ0A 3ETDA 3T1CA 1NJIW 2YIBD 5EK0A 1YI2V 4X1IA 3KCXA 1HP8A 3FB8C 1ZX3A 3U10A 1BCCH 4FLWA 4UV9A 4F6EA 2L6LA 1M5IA 2DYSB 1G4YB 3QVNA 4J9YB 1XNRO 3N2KB 2Y0PA 2OYQA 1DTOA 1NR7A 2Q0OC 3OEHG 1XREA 5CBGA 3ZRWB 3GWOA 5LP6B 3TETA 4NXNB 2VWJA 1THZA 4X88A 2A79B 4LF6O 1YTFB 2Q0AA 2YXHA 3HKDA 2ZIMA 4DYLA 2BTQB 2WLKA 4MTGA 1UJWB 5IWAO 2LW1A 3I56V 2PF4E 2K1EA 4DXWA 4E2LA 1QLNA 3TK1A 2RDCA 3TXQA 1ZWIC 3UCSC 1RSOB 1XDCA 4B3MB 4DV6B 3OD4A 4P2ZA 1J95A 5LGNA 4HBNA 3CXCU 4FJCC 4PA4A 3SJAC 4JTDB 3CX5F 3M7MX 1BGYH 4G27B 4H0LB 3ZHQA 4U7NA 3ICXA 5GW7A 2AXTZ 4G2KA 2QWNB 2R70A 1MZFA 3K0GA 4JYAO 1EZJA 3B2EE 3E22B 1GN6A 2MW2B 1MOFA 1OCOC 4LF6B 3RGBA 1BQ0A 1S5JA 5IWAB 4FLVA 3JAWB 3ZMTA 2CTWA 3N2GB 3L72H 1JJOA 1K9MW 5EC2C 3BVOA 2JEUA 1GM7A 4LF9O 3ZRXA 2A3QA 2UUAB 3ZIAG 1FXVA 2QTSA 1NH2D 4JI2O 1K4CC 2CGOA 3J81N 1BS3A 4FM0A 3W7SA 1V55C 2WLHA 4ZHQB 1JX9A 2B1GA 2E74B 2QWRB 4YY3O 3LNNA 1B04A 4DV1B 3ZMZA 3O9OA 2RNBA 3PN1A 4I0XB 5DECA 4JI4O 3ZBHA 5KMGA 3JALB 4FZ1A 1K34A 4PA7A 3CMEV 2JEXA 2YI9A 1NTMH 1K4DC 2AW9A 4JYYA 1Q7YW 2W6JG 3K3WA 4U3JB 1S76D 2EILC 4FFBA 1XOUA 4UCRA 1ZLZA 1ZL8A 3CCEV 4YIPA 1K73W 4O4JA 3ZX6A 3DC5A 1V54B 4P9PA 3FX7A 3OR7C 4J7KA 4DW0A 2H94A 1H2SB 4TV9A 3L74H 2CGNA 3RYHA 4MTOA 4TQFA 1CPYA 1DF5A 2PYLA 4DR5O 2NLJC 3UO2A 1EN6A 2ZE7A 1H2GA 3WU2Z 2V7QG 4NTXA 4HAMA 3CCUV 5F2VO 1KYOF 4WBNB 2E5LO 4JI4B 1W0KG 1YDXA 2RCVA 4W4LA 2CDYA 2EBOA 4GLXA 4LFBO 1M4UA 5ITZB 1EN5A 4TV8A 1NT2B 5E1AC 4FM2A 3VQXA 2AZ2A 5KLVH 3ML0A 1KMIZ 1MZEA 2BSKB 1QU7A 2OIGA 2P6JA 1TUEB 5LMNO 3SYPA 3SYAA 1N8RW 1BQZA 4GT1A 1XMQO 3HR0A 2UUBO 3IC9A 4DR5B 1SZXA 1IDSA 2JGDA 2E5LB 4UFZA 4BW9A 3MDSA 4OX9B 1NVPB 3U0ZA 4JAAA 4CZZA 2EZPA 4J7JA 3B09A 1N34O 3DGEA 2QWPB 4DV5O 1DLBA 4LFBB 4B3RO 1Q43A 2QE7G 4UXNA 4D7SA 5IJ0A 2YICA 3CCJV 1IXBA 1X4TA 1Y74B 4X66O 3EVKA 2X7RB 3OT7A 3K58A 1H2NA 3CD6V 1KC8W 1XI1A 2QWOB 3JAKA 5JJNB 3LNMB 4I50A 3F7YC 3ZS8C 3CCRV 4I9QA 3OW2U 2F95B 1TVKB 5LMNB 1QR8A 1PL0A 1XHXA 2RN9A 2E3CA 1SQGA 1GH6A 2UUBB 4LH7A 4ZOLB 3K0DA 4IIJA 3CPWU 2R9RB 1ORQC 4AQYB 3ETEA 3RYCA 5FPOA 3A2FA 3CC7V 1F23A 2P90A 4DR1O 2JS5A 3JARA 1VEWA 3K57A 1N34B 5LYJB 4RQEA 1Q6UA 1R6TA 4IGGA 4DV5B 4B3RB 3SPIA 2ZD9A 4FZ0A 3TJTA 4RQFA 4X64B 4RUFA 4KHPO 4X66B 2B9ZA 2BCCH 2IH1C 3VQVA 1L0NH 3JSLA 1DF4A 1K7DA 2D2CB 4MT8A 2R9IA 1Q82W 1Y6XA 4X1KB 1A32A 1GN4A 3CEIA 1NU1H 3WG7C 4TQDA 1Q6HA 3FAVB 2BE3A 3A0BZ 3K9AA 1NS1A 1VP7A 1M1KW 3ZHTA 1JJ2U 3D36A 3ASOB 4QNHB 4PJ0Z 2VQFO 4DR1B 4NXMO 5KHGA 1G1XB 4JI1O 2Z0AA 5EBLC 4I4TB 5BMVB 1SA0B 4QGPA 3CCQV 3APOA 2ZR3A 3OGCC 3P3NA 3ZJZA 3HKCB 4X1YB 4OPHA 4KHPB 1WNSA 3ZEDA 1WPXA 2HJDA 4PA9A 5IYBO 5J9PC 3E8BA 5IY5B 4LF8B 4ZI7B 1FD9A 4YJ2B 1BE3H 4LFAO 2G38A 1EM1A 4O4HA 4JI0O 2RQ6A 2VWKA 3ZHVA 1Q5OA 1Y66A 5B1BB 2UXBO 4PDMA 1FAFA 4PDLA 3CRRA 4NXMB 3FB7C 3AG7A 3EFFK 1SKVA 3N2KA 3H1JH 4ZBMA 5BXZA 3LDEA 3ZRWA 5LP6A 5J2UB 2W0FC 4OPAA 4FPPA 4TT3G 4I55B 1K97A 1K3EA 2BTQA 3BY6A 5L3DA 2AHYA 3M8AA 2HLDG 2EIMC 4MS2A 2QTOA 1GN2A 3Q4HB 1GM9A 1N33O 3W7TA 4DR4B 1SS3A 1R3IC 4LFCB 1OJHA 2L35A 4O4IB 4JI0B 1RSOA 4MTFA 1ZAUA 4ASUG 2QGNA 2B5UA 4HZ3A 2YIDA 3RBZA 5LGUA 3FD9A 3K5MA 2Y0IA 2N74A 2GSMB 4FLXA 1WA8B 5L3GA 3K5LA 2LP7A 3ABTA 1L8DA 4NTYA 2EIMB 4ZIBA 4P9OA 4JI6O 1UPGA 3L9DA 2HVJC 5CBFA 5D5PA 3RYFB 4O2AB 4HNAB 5B1OA 4A5UB 4DW1A 4N23A 4NYKA 1BHAA 3E22A 1PV0A 2QA4V 3DTUB 4DK0A 1EN4A 5KA6A 2DMXA 1SESA 5IDJA 3JAWA 2CUGA 3CP1A 3N2GA 1XQ8A 2Y4TA 1P7GA 2GTSA 1N33B 1FXKC 5KAFZ 5B5EZ 5BY1A 1VQ4V 2C2AA 1WB7A 1LR1A 3EHBB 2XASA 3NXSA 5EZYB 2LJ2A 2PYJA 3RWRD 4BIOA 5L3EA 2EX3A 4K8ZA 4FLTA 4ZHQA 4FM1A 2KG7B 2HR3A 3MHSC 3SR2C 5IYZB 1FXKB 4I0XA 2OTJV 4PV1B 5LA6B 2UUCO 3JALA 5JCOC 4K3AA 4UCUA 2ZM6O 1JR9A 2WAMA 5KHIA 3ZRSA 1SQQH 4WFBV 3LSSA 4U3JA 3T1HO 4FLUA 3G80A 3CS5A 1JPXA 2DWDC 1FFXB 3OTOB 2Q5ZA 4U3FH 4B7EA 3ZRVA 3IGAC 4JTAB 5IJ9B 3J80N 2WLLB 4X20B 3G6BA 4UCVA 4CBCA 4G28B 2XAHA 2LO1A 4JZGA 3ABLC 3E8FA 3ABKC 3O65A 5CN0A 3CCVV 4WBNA 2UUCB 1TAEA 2P4VA 2IBZH 2Z5UA 1H2KA 2ITDC 2ZM6B 3KG2A 3ZHSA 4LF7O 5ITZA 3QF7A 4GZRB 1Q90D 5JQGB 3T1HB 1OCCB 3AG4B 3H1LH 3QO5A 4GCZA 1FYJA 3X2QB 5JJJB 5KX5B 3ZN0A 4Z1VA 3K06A 4TOIA 5TISZ 3E89A 1H2MA 3ASNC 1COWG 3OMIB 3BA8A 2UUAO 1JCHA 1GM8A 3UM7A 3D3IA 3F7VC 4BIZA 3UT5B 4MVZA 4DV1O 4GKJB 5BR8O 3RT3C 1E1RG 4LF7B 4CC6A 1WJZA 1OV9A 3OAAG 3ZN1A 4O4LB 1YF2A 4L8JA 2XTAA 1S0VA 2UU9B 1D5NA 1Y74A 2Q68A 4LBEC 1Y4MA 4DV7O 1SZTA 1F4NA 3DXRB 3H1IH 3JSNA 5FPRA 1HNXO 2W6IG 5KUKA 1S5LZ 1XMOO 1VF6A 1MSDA 1AILA 1TVKA 4J11A 1CXZB 4GKKB 2UXCO 5C8YB 5LHHA 1RPRA 1VQNV 4ZOLA 1JFFB 2JJ1G 1Y67A 2AZ0A 2QSAA 3IAYA 1OCOB 2DW4A 5FNVB 3CMAV 4MVMA 1YSCA 1J5EO 2DJVA 3OTFA 5BR8B 1VF7A 3S3WA 4GX1A 4UV8A 5LYJA 4W4KA 1IBLO 1VARA 2X6BA 3VOUA 1B3QA 3U11A 4LF4O 1V55B 3THOA 2PI4A 1VQ8V 1NH2B 2YI8A 3E35A 1VQ9V 1IBKO 1N0JA 4DV7B 1RM1C 4K0KO 1I5XA 2F66C 3SPGA 1QLEC 1LUWA 5A2QN 1HNXB 4FLYA 3UQ8A 1XMOB 2DWEC 4KP4A 1SQPH 4LWSB 3G71V 5H5NA 3G6EV 4X1KA 4AHCA 1JVMA 1MA1A 2UXCB 2PGGA 2F1MA 3QO8A 2DQ3A 3CSXA 5JJEB 2CAZC 3A0RA 3EXAA 2ZXWC 2FTKA 3FAVA 3LDCA 3OEEG 4IHJB 4KFMA 1J5EB 3S3XA 2EILB 4BW5A 3ABMC 2FL4A 2F93B 3E8HA 1R1BA 4BIUA 4I4TA 1IBLB 1L0LH 5BMVA 5CB4B 2K9PA 5LOVB 1SA0A 4IT5A 1P7BA 4OX9O 1GN3A 1M90W 4WFFA 4LF4B 2ARHA 3T2MA 3HKCA 4X1YA 2HHHO 2XAQA 1IBKB 1IZ3A 4RAIA 1ZTEA 4K0KB 4F6RB 2MK3A 5L3FA 4P30A 2P22C 3H01A 4CC5A 4ZI7A 3AG1C 4YJ2A 2XAJA 5HFMA 5B1AC 3BHPA 4JI7O 5K1XA 1VQ7V 4TSFG 2XT9A 5IT9N 4FIPC 1SQVH 4DR6O 3QG5A 1MNGA 1PL4A 4AQYO 2LGQA 1FXHA 4UB8Z 2YIAA 2LFRA 1NBMG 3WB1A 2IM9A 1E79G 3L71H 1OZ0A 4EKWA 4YXWG 2PTMA 3QO7A 4JZ2A 3BPZA 5J2UA 2YEVB 1VQPV 2HHHB 4I55A 2Q69A 2ZDIA 3P30A 4JAUA 1VQOV 4X64O 3ZMVA 4JV5O 2ZE5A 3Q4HA 4TWKA 2QM8A 5E79Z 3CXHF 1MMMA 1VMGA 4O4IA 1XL6A 1URFA 4JI7B 4JI8O 1XEQA 3FYIB 4UUJC 2HJFC 2IJHA 1WA8A 2QR4A 3OGIB 5GTIZ 1NI8A 5L3BA 4DR6B 3IFXA 3CYOA 1EFRG 3JAMN 5JH7A 1YJNV 2YXYA 3C90A 2PZSA 3RYFA 4O2AA 4HNAA 2A0LA 3CCMV 2Q6AA 2KSDA 3FB6C 4OXSA 2IU0A 4B08A 3B8NA 2BTOA 2AHZA 1QVGU 1DK1A 2M6YA 4X65B 1WN7A 1TA8A 1SC5B 1D5AA 3R66A 1VQ5V 5EC1C
chains in the Genus database with same CATH topology
4NTXA 1WP7A 2L35A 3IJ4A 2QTSA 1WP8A 4NTWA 4FZ0A 4NTYA 3S3WA 3S3XA 4FZ1A 4NYKA 2FB5A 3N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTX A;  1WP7 A;  2L35 A;  3IJ4 A;  2QTS A;  1WP8 A;  4NTW A;  4FZ0 A;  4NTY A;  3S3W A;  3S3X A;  4FZ1 A;  4NYK A;  2FB5 A;  3N27 A; 
#chains in the Genus database with same CATH topology
 2ATK C;  4MVS A;  4JV5 B;  3PJS K;  3R65 A;  1VF5 B;  2R9A A;  3MD0 A;  4LR3 A;  3KZI Z;  3AEI A;  4QE9 A;  3TGU H;  1RP3 B;  4JI8 B;  2GBO A;  4LF8 O;  5EZY A;  5JVD B;  1YXB A;  5KMG B;  5HFL A;  2LGW A;  4IYI A;  4TUY B;  5B1N A;  2R72 A;  4DR2 O;  5IYD O;  2KG7 A;  5B3S C;  5IYZ A;  1FXK A;  2Y48 A;  5LA6 A;  4LCU C;  2XHB A;  4EFE A;  2RMK B;  1FPO A;  4K35 A;  4CS3 A;  3L70 H;  3OM3 B;  3K5O A;  4I9W A;  3DSQ A;  3CRM A;  2YS8 A;  4UVC A;  2PY5 A;  2WA4 A;  3WG7 B;  1NTK H;  5K1P A;  4FLZ A;  2Y69 C;  4DR7 O;  4WFE A;  1AVM A;  3AG2 C;  4BWA A;  1FFX A;  2CE4 A;  2GUZ B;  3RFR A;  5LXT B;  1AI5 A;  4MVQ A;  5IJ9 A;  2OCH A;  4JI3 O;  1I7F A;  2WLL A;  4X20 A;  1N32 B;  1B06 A;  4FVM A;  4DR4 O;  1CEZ A;  4LFC O;  2PUS A;  2A7W A;  3CCL V;  4GUN A;  4L87 A;  4DR2 B;  2IW5 A;  3AG3 C;  2P4K A;  4NR1 A;  1FJG O;  4Q20 A;  2QKC A;  4PDV A;  1Q86 W;  1FFT B;  1VQ6 V;  1W2B U;  4C7U A;  2ADP A;  4J80 A;  5CBH A;  2F4V B;  3W7X A;  5JQG A;  1US6 A;  4DK1 A;  2Q8V A;  1B6Q A;  5LMU O;  4DR7 B;  3E86 A;  4UVA A;  3W7U A;  4MTX A;  5KX5 A;  5EIB D;  2X6C A;  2EJ7 A;  5LHG A;  5LGT A;  2EIJ C;  4JI3 B;  5EIB C;  4DRX B;  2YIB A;  1BT8 A;  5BZB A;  3OUF A;  3FB5 C;  3LUT B;  2A9H A;  5CMU A;  1XL4 A;  4DR3 O;  2B1I A;  1FJG B;  2UXN A;  3UT5 A;  1M56 C;  5DM6 V;  4R6Z A;  3GWK C;  3SPC A;  1CP9 A;  4Z2W A;  2ZIN A;  1OCR C;  4JI5 B;  3K5N A;  2JRI A;  2H8P C;  4O4L A;  5LMU B;  2ADQ B;  2CTQ A;  1I08 A;  3MAQ A;  1M56 B;  1K33 A;  1O9G A;  1OCZ C;  3APQ A;  4LF5 B;  3DXR A;  4QPK A;  4EB6 B;  4RUE A;  2JGU A;  1PNL A;  5H6R A;  2CH7 B;  3OTO O;  5B66 Z;  3G67 A;  3JAS B;  5C8Y A;  2VQE O;  4CH4 A;  2P67 A;  2EZO A;  3T4D A;  1JFF A;  3UO3 A;  4DR3 B;  2QM4 A;  3QTC A;  5FNV A;  2XUM A;  3OUS A;  1OCZ B;  2UXD B;  1X59 A;  4QJF B;  5DN6 G;  1XIL A;  1WAZ A;  3A0H Z;  3JD0 A;  1Z5V A;  2EIN C;  3D36 C;  1FKA O;  3F5T A;  4J10 A;  3RYI B;  1NTZ H;  5GTH Z;  1Y76 B;  5D5Q A;  1ZUQ A;  3QNE A;  1AP6 A;  4PI2 A;  4X8A A;  2ITC C;  3CHX A;  3SYQ A;  1QR9 A;  2EIN B;  1WB8 A;  3A8T A;  3KKY A;  2GV9 A;  4LWS A;  2WLI B;  4DV2 B;  3J7A U;  1LUV A;  1UFI A;  3H9V A;  2VQE B;  2ZE8 A;  2CTP A;  4IL6 Z;  3F5W C;  2OWO A;  3HPL C;  4UVB A;  5J2T B;  5GON B;  3IJ4 A;  3G4S V;  3BEH A;  1M93 A;  3BAA A;  2BOB C;  3JAT B;  1MG1 A;  2DQ0 A;  4QE7 A;  4PDR A;  3STL C;  3ETG A;  4KXR A;  5CB4 A;  5LOV A;  1H8H G;  3SPJ A;  4GKJ O;  5CA0 B;  3D3Q A;  1F4M A;  3BA9 A;  4UCO A;  2ZE6 A;  1P84 F;  2DYS C;  4RO2 A;  2GHY A;  3FKS G;  1YTF D;  2OIE A;  3VQW A;  2D3O W;  2HVK C;  4LH6 A;  4DUY O;  4F6R A;  4NB5 A;  2HP8 A;  3ABL B;  4X62 O;  2UU9 O;  1IVS A;  3ABK B;  4IYH A;  1BL8 A;  2PI5 A;  1XNQ B;  1H8E G;  5EYP B;  2BSK A;  5IYC O;  2X0L A;  1Z5W A;  1YCI A;  3RW0 A;  2N04 A;  1NR1 A;  3HKB B;  2HFE C;  4B3S B;  2YXL A;  1KEC A;  4J9Z B;  4GKK O;  4PD4 F;  4D7T A;  1AJP A;  1N36 O;  4JYC A;  3GB7 C;  1YZB A;  3OR6 C;  4I5S A;  4YJ3 B;  2FB5 A;  4R50 A;  4WFG A;  1Q3E A;  3LSU A;  3HKE B;  4DUZ O;  1WPB A;  4BAY A;  3ASN B;  2YEV A;  2WWW A;  3B40 A;  3CC4 V;  2H3O A;  4DUY B;  1MSW D;  1D2D A;  4X62 B;  1AB3 A;  1HNW O;  3CCS V;  4B3T O;  2X6A A;  2AGA A;  2GDS A;  2FKX A;  3SDL A;  3H1K H;  4H13 B;  1QHT A;  3WB0 A;  1Q6I A;  2ZR2 A;  1ROP A;  1XNR B;  1SQF A;  4X89 A;  1KB9 F;  5C93 A;  3CJH B;  1I5Y A;  2ZKO A;  1N36 B;  2QKA A;  4ICG A;  1IXM A;  1YJ9 V;  2DYR C;  4GX5 A;  3JD4 A;  4DUZ B;  4YHH O;  3OMA B;  1O9H A;  4WFH A;  1W59 A;  5KA5 A;  4U7O A;  1TUB B;  2CK3 G;  1GMG A;  3BCC H;  1AI4 A;  4UB6 Z;  4MW8 A;  1HNW B;  4LNU B;  4H33 A;  4B3T B;  5EBM C;  3CC2 V;  4WF9 V;  1T5E A;  2DYR B;  3OE7 G;  4MVU A;  4O2B B;  1VQK V;  1HNZ O;  3B77 A;  1WP7 A;  2WA3 A;  3T4Z A;  2Z3Y A;  2GTA A;  5JVD A;  2QEX V;  1SER A;  1QNM A;  1V54 C;  4JYA B;  5L3C A;  4TUY A;  2W0X A;  4CS2 A;  2HKO A;  1M9N A;  5CA1 B;  1SRY A;  1RM1 B;  1NZ6 A;  1F7Y A;  1QLE B;  1QVF U;  2V1D A;  2ZIO A;  4XBF A;  3K79 A;  4QIW F;  2JS3 A;  4YHH B;  2WLJ A;  4LF9 B;  2OCC C;  4JI2 B;  2UXX A;  3ZHU A;  4KL1 A;  4F4L A;  1K5S A;  3SYC A;  1S72 V;  1S3J A;  2P06 A;  1AI7 A;  3JD1 A;  2ZXW B;  3AK2 A;  1ENV A;  2OTL V;  2HG5 C;  1ZSP A;  1RFY A;  2VRZ A;  1BSM A;  4Z1M G;  1HWY A;  2BOC C;  4YY3 B;  1NKD A;  1GKF A;  2GUZ A;  5LXT A;  3ABM B;  1HNZ B;  1YHQ V;  1BHB A;  2Q4P A;  1MAB G;  3SPH A;  2ILM A;  2OCC B;  1WP8 A;  2YSU B;  1LNQ A;  1N4C A;  4X1I B;  1JA8 A;  1P49 A;  1R73 A;  5KAI Z;  1PNM A;  2Q73 A;  1IUR A;  1VIB A;  3IC7 A;  4DV4 O;  1K92 A;  4B7K A;  1KBH A;  1I94 O;  3DC6 A;  4CH6 A;  1NVP D;  3HKD B;  3OMN B;  3CRC A;  4QPJ A;  3AG1 B;  4UCT A;  2LFS A;  3STZ C;  5B1A B;  3SJQ C;  3E83 A;  3CRA A;  3ABU A;  1VQM V;  4X65 O;  2Q9L A;  2Q7E A;  1R6N A;  3L73 H;  2QM7 A;  5AG2 A;  5LHI A;  4X9Q A;  2QDO A;  2WLN A;  2OT5 A;  3SJC C;  1KP2 A;  4ABM A;  4CH5 A;  2JJ2 G;  4JGS A;  3HB3 B;  4DRX A;  1KU9 A;  3P32 A;  2QKS A;  1R3L C;  1XBL A;  1AJQ A;  1S77 D;  3ZCC A;  2KKW A;  2Y4U A;  1VF6 C;  2F23 A;  2HEP A;  2WSS G;  5LL6 Y;  1G8M A;  1GRJ A;  3L75 H;  1F51 A;  2KQX A;  1FS0 G;  3P3P A;  2KB1 A;  4DV4 B;  3UKM A;  3N27 A;  5EBW C;  1U96 A;  5A9G A;  2Q67 A;  2JK5 C;  3ZMU A;  1I94 B;  3BFR A;  1RPO A;  3W7W A;  4PI0 A;  1PKX A;  2YUA A;  4H37 A;  4J7Z A;  2DE0 X;  1EZV H;  4PHZ A;  4N21 A;  1N0N A;  3MHH C;  2V4D A;  1EBO A;  3K9S A;  1XMQ B;  3BAB A;  4LC1 A;  5CA3 A;  3B8M A;  1Z2G A;  4JAV A;  3LSQ A;  4EB6 A;  4LP8 A;  4JYB A;  2FML A;  1SF9 A;  3CRQ A;  2CH7 A;  2F43 G;  3VBB A;  4AI8 A;  1VQL V;  4GX2 A;  3TXS A;  3JAS A;  5KHH A;  2ZNI A;  2DOS A;  4CH3 A;  1YJW V;  1KKD A;  2YC0 A;  1N32 O;  1K8A W;  2VS0 A;  1E1Q G;  1ARO P;  3K04 A;  3AK1 A;  4EEQ A;  2N05 A;  5LBQ A;  1QBZ A;  3AK3 A;  1V9P A;  3CB2 A;  4GYC B;  2M7W A;  4FFB B;  2CTR A;  1U97 A;  3ASO C;  2O57 A;  4R8C A;  1ZL8 B;  3D8C A;  1R3J C;  2QJ1 A;  3RYI A;  3SJB C;  2XOK G;  1PP9 H;  4KUM A;  4O4J B;  1Y76 A;  1AR4 A;  5KUM A;  4GX0 A;  4JTC B;  2ODM A;  1AP5 A;  2F4V O;  3ZMS A;  3JCU Z;  4TV9 B;  4D6T H;  5B3S B;  3RYH B;  1JOY A;  1KP3 A;  2QWQ B;  1YEW A;  3SGI A;  2WLI A;  1R3K C;  1GTO A;  3E8G A;  4XDJ A;  5JCO A;  5IY5 C;  3OFN G;  4PA3 A;  1PD3 A;  2NR5 A;  1SET A;  4MVO A;  1AJN A;  4NVP A;  2RJZ A;  1GAX A;  5J2T A;  3T1Y O;  1S5H C;  2EIK C;  5GON A;  4NTW A;  2Y69 B;  1YIT V;  1G6U A;  5B1B C;  2ZNJ A;  3AG2 B;  3FYE B;  3JD3 A;  3JAT A;  4XDL A;  4TV8 B;  3RVY A;  4JAS A;  1HR0 O;  2P5O A;  4R7C A;  2IJI A;  5CA0 A;  2E75 B;  3JCZ A;  2E76 B;  2Q7H A;  4FFK A;  5DED A;  5JWP A;  2IJK A;  3ETQ A;  1W0J G;  2YDE A;  2EIK B;  3AG3 B;  4JI5 O;  1KQS U;  1PM9 A;  4EFB A;  4I7Z B;  2JDI G;  4CS4 A;  3K08 A;  3C3T A;  1R6K A;  2ZDI C;  2VQF B;  1TGO A;  5EYP A;  4LF5 O;  4JI1 B;  2LW7 A;  5FL7 G;  2NN4 A;  1PNK A;  2JGD B;  1L1F A;  4DO2 A;  3VQY A;  1JMK C;  3HKB A;  4MSW C;  3GVM A;  1XHZ A;  4ZKI A;  4NKG B;  3I5D A;  4UCS A;  3T1Y B;  2LQT A;  1WLE A;  4J41 A;  3RN4 A;  1BZK A;  5IJ0 B;  1K5Q A;  2ZQM A;  4OGQ B;  2UXD O;  4YJ3 A;  1IBM O;  1HR0 B;  3HKE A;  2EIJ B;  4Q6G A;  4LFA B;  4HYO A;  2XAG A;  3JAK B;  3LDD A;  3M99 B;  1Q81 W;  4I50 B;  4FMT A;  1AR1 B;  4PEL A;  5H6Q A;  1YVW A;  3NR7 A;  1GO3 F;  2UXB B;  5FLX N;  2NNU A;  4IIJ B;  3WB2 A;  5JH7 B;  3RYC B;  3E2E A;  1XUQ A;  2P7T C;  2Q7G A;  2DN9 A;  2A06 H;  4DV2 O;  1OCR B;  3CWB H;  1H38 A;  5IE9 A;  3JAR B;  3CJH A;  1OHH G;  1P4R A;  1DGS A;  4K8X A;  1HW7 A;  1PPJ H;  3K03 A;  4XDK A;  3KCY A;  4DV0 O;  4YIO A;  1HDJ A;  1IBM B;  2IH3 C;  2ZT9 B;  2WLM A;  4JF3 A;  4FK5 C;  2FYU H;  2ZCE A;  4DV3 O;  3I55 V;  1SQB H;  1YIJ V;  5KHJ A;  1TUB A;  3TCU A;  5H2F Z;  3ZHR A;  1AR5 A;  3JD2 A;  4LNU A;  4JI6 B;  1QQC A;  2JVD A;  3K59 A;  4O2B A;  4H44 B;  3CE2 A;  1IX9 A;  2IU3 A;  1NQT A;  3SYO A;  4WCE V;  4J42 A;  1XNQ O;  1SQX H;  4E4E A;  2JIZ G;  5CA1 A;  2ETN A;  4B3S O;  2EJR A;  1KKC A;  1KD1 W;  1GK9 A;  2XAF A;  4DV0 B;  4IHJ A;  5KHK A;  4NXN O;  3B4S A;  1M57 C;  3RVZ A;  4JPR A;  3C3S A;  4WFA V;  4AIL C;  4DV3 B;  3WFV A;  4MVR A;  5H9C A;  1BMF G;  1QCE A;  1KUQ A;  2XND G;  4MW3 A;  1AI6 A;  3FFQ A;  3H1H H;  4PA6 A;  4O4H B;  4B3M O;  4RWU A;  4DV6 O;  2WPD G;  1OCC C;  2IJJ A;  4BR6 A;  3AG4 C;  3JYC A;  2EUL A;  3BRC A;  5LP6 C;  1M57 B;  1Q8I A;  1H2L A;  3X2Q C;  1I0H A;  1JQ0 A;  3ETD A;  3T1C A;  1NJI W;  2YIB D;  5EK0 A;  1YI2 V;  4X1I A;  3KCX A;  1HP8 A;  3FB8 C;  1ZX3 A;  3U10 A;  1BCC H;  4FLW A;  4UV9 A;  4F6E A;  2L6L A;  1M5I A;  2DYS B;  1G4Y B;  3QVN A;  4J9Y B;  1XNR O;  3N2K B;  2Y0P A;  2OYQ A;  1DTO A;  1NR7 A;  2Q0O C;  3OEH G;  1XRE A;  5CBG A;  3ZRW B;  3GWO A;  5LP6 B;  3TET A;  4NXN B;  2VWJ A;  1THZ A;  4X88 A;  2A79 B;  4LF6 O;  1YTF B;  2Q0A A;  2YXH A;  3HKD A;  2ZIM A;  4DYL A;  2BTQ B;  2WLK A;  4MTG A;  1UJW B;  5IWA O;  2LW1 A;  3I56 V;  2PF4 E;  2K1E A;  4DXW A;  4E2L A;  1QLN A;  3TK1 A;  2RDC A;  3TXQ A;  1ZWI C;  3UCS C;  1RSO B;  1XDC A;  4B3M B;  4DV6 B;  3OD4 A;  4P2Z A;  1J95 A;  5LGN A;  4HBN A;  3CXC U;  4FJC C;  4PA4 A;  3SJA C;  4JTD B;  3CX5 F;  3M7M X;  1BGY H;  4G27 B;  4H0L B;  3ZHQ A;  4U7N A;  3ICX A;  5GW7 A;  2AXT Z;  4G2K A;  2QWN B;  2R70 A;  1MZF A;  3K0G A;  4JYA O;  1EZJ A;  3B2E E;  3E22 B;  1GN6 A;  2MW2 B;  1MOF A;  1OCO C;  4LF6 B;  3RGB A;  1BQ0 A;  1S5J A;  5IWA B;  4FLV A;  3JAW B;  3ZMT A;  2CTW A;  3N2G B;  3L72 H;  1JJO A;  1K9M W;  5EC2 C;  3BVO A;  2JEU A;  1GM7 A;  4LF9 O;  3ZRX A;  2A3Q A;  2UUA B;  3ZIA G;  1FXV A;  2QTS A;  1NH2 D;  4JI2 O;  1K4C C;  2CGO A;  3J81 N;  1BS3 A;  4FM0 A;  3W7S A;  1V55 C;  2WLH A;  4ZHQ B;  1JX9 A;  2B1G A;  2E74 B;  2QWR B;  4YY3 O;  3LNN A;  1B04 A;  4DV1 B;  3ZMZ A;  3O9O A;  2RNB A;  3PN1 A;  4I0X B;  5DEC A;  4JI4 O;  3ZBH A;  5KMG A;  3JAL B;  4FZ1 A;  1K34 A;  4PA7 A;  3CME V;  2JEX A;  2YI9 A;  1NTM H;  1K4D C;  2AW9 A;  4JYY A;  1Q7Y W;  2W6J G;  3K3W A;  4U3J B;  1S76 D;  2EIL C;  4FFB A;  1XOU A;  4UCR A;  1ZLZ A;  1ZL8 A;  3CCE V;  4YIP A;  1K73 W;  4O4J A;  3ZX6 A;  3DC5 A;  1V54 B;  4P9P A;  3FX7 A;  3OR7 C;  4J7K A;  4DW0 A;  2H94 A;  1H2S B;  4TV9 A;  3L74 H;  2CGN A;  3RYH A;  4MTO A;  4TQF A;  1CPY A;  1DF5 A;  2PYL A;  4DR5 O;  2NLJ C;  3UO2 A;  1EN6 A;  2ZE7 A;  1H2G A;  3WU2 Z;  2V7Q G;  4NTX A;  4HAM A;  3CCU V;  5F2V O;  1KYO F;  4WBN B;  2E5L O;  4JI4 B;  1W0K G;  1YDX A;  2RCV A;  4W4L A;  2CDY A;  2EBO A;  4GLX A;  4LFB O;  1M4U A;  5ITZ B;  1EN5 A;  4TV8 A;  1NT2 B;  5E1A C;  4FM2 A;  3VQX A;  2AZ2 A;  5KLV H;  3ML0 A;  1KMI Z;  1MZE A;  2BSK B;  1QU7 A;  2OIG A;  2P6J A;  1TUE B;  5LMN O;  3SYP A;  3SYA A;  1N8R W;  1BQZ A;  4GT1 A;  1XMQ O;  3HR0 A;  2UUB O;  3IC9 A;  4DR5 B;  1SZX A;  1IDS A;  2JGD A;  2E5L B;  4UFZ A;  4BW9 A;  3MDS A;  4OX9 B;  1NVP B;  3U0Z A;  4JAA A;  4CZZ A;  2EZP A;  4J7J A;  3B09 A;  1N34 O;  3DGE A;  2QWP B;  4DV5 O;  1DLB A;  4LFB B;  4B3R O;  1Q43 A;  2QE7 G;  4UXN A;  4D7S A;  5IJ0 A;  2YIC A;  3CCJ V;  1IXB A;  1X4T A;  1Y74 B;  4X66 O;  3EVK A;  2X7R B;  3OT7 A;  3K58 A;  1H2N A;  3CD6 V;  1KC8 W;  1XI1 A;  2QWO B;  3JAK A;  5JJN B;  3LNM B;  4I50 A;  3F7Y C;  3ZS8 C;  3CCR V;  4I9Q A;  3OW2 U;  2F95 B;  1TVK B;  5LMN B;  1QR8 A;  1PL0 A;  1XHX A;  2RN9 A;  2E3C A;  1SQG A;  1GH6 A;  2UUB B;  4LH7 A;  4ZOL B;  3K0D A;  4IIJ A;  3CPW U;  2R9R B;  1ORQ C;  4AQY B;  3ETE A;  3RYC A;  5FPO A;  3A2F A;  3CC7 V;  1F23 A;  2P90 A;  4DR1 O;  2JS5 A;  3JAR A;  1VEW A;  3K57 A;  1N34 B;  5LYJ B;  4RQE A;  1Q6U A;  1R6T A;  4IGG A;  4DV5 B;  4B3R B;  3SPI A;  2ZD9 A;  4FZ0 A;  3TJT A;  4RQF A;  4X64 B;  4RUF A;  4KHP O;  4X66 B;  2B9Z A;  2BCC H;  2IH1 C;  3VQV A;  1L0N H;  3JSL A;  1DF4 A;  1K7D A;  2D2C B;  4MT8 A;  2R9I A;  1Q82 W;  1Y6X A;  4X1K B;  1A32 A;  1GN4 A;  3CEI A;  1NU1 H;  3WG7 C;  4TQD A;  1Q6H A;  3FAV B;  2BE3 A;  3A0B Z;  3K9A A;  1NS1 A;  1VP7 A;  1M1K W;  3ZHT A;  1JJ2 U;  3D36 A;  3ASO B;  4QNH B;  4PJ0 Z;  2VQF O;  4DR1 B;  4NXM O;  5KHG A;  1G1X B;  4JI1 O;  2Z0A A;  5EBL C;  4I4T B;  5BMV B;  1SA0 B;  4QGP A;  3CCQ V;  3APO A;  2ZR3 A;  3OGC C;  3P3N A;  3ZJZ A;  3HKC B;  4X1Y B;  4OPH A;  4KHP B;  1WNS A;  3ZED A;  1WPX A;  2HJD A;  4PA9 A;  5IYB O;  5J9P C;  3E8B A;  5IY5 B;  4LF8 B;  4ZI7 B;  1FD9 A;  4YJ2 B;  1BE3 H;  4LFA O;  2G38 A;  1EM1 A;  4O4H A;  4JI0 O;  2RQ6 A;  2VWK A;  3ZHV A;  1Q5O A;  1Y66 A;  5B1B B;  2UXB O;  4PDM A;  1FAF A;  4PDL A;  3CRR A;  4NXM B;  3FB7 C;  3AG7 A;  3EFF K;  1SKV A;  3N2K A;  3H1J H;  4ZBM A;  5BXZ A;  3LDE A;  3ZRW A;  5LP6 A;  5J2U B;  2W0F C;  4OPA A;  4FPP A;  4TT3 G;  4I55 B;  1K97 A;  1K3E A;  2BTQ A;  3BY6 A;  5L3D A;  2AHY A;  3M8A A;  2HLD G;  2EIM C;  4MS2 A;  2QTO A;  1GN2 A;  3Q4H B;  1GM9 A;  1N33 O;  3W7T A;  4DR4 B;  1SS3 A;  1R3I C;  4LFC B;  1OJH A;  2L35 A;  4O4I B;  4JI0 B;  1RSO A;  4MTF A;  1ZAU A;  4ASU G;  2QGN A;  2B5U A;  4HZ3 A;  2YID A;  3RBZ A;  5LGU A;  3FD9 A;  3K5M A;  2Y0I A;  2N74 A;  2GSM B;  4FLX A;  1WA8 B;  5L3G A;  3K5L A;  2LP7 A;  3ABT A;  1L8D A;  4NTY A;  2EIM B;  4ZIB A;  4P9O A;  4JI6 O;  1UPG A;  3L9D A;  2HVJ C;  5CBF A;  5D5P A;  3RYF B;  4O2A B;  4HNA B;  5B1O A;  4A5U B;  4DW1 A;  4N23 A;  4NYK A;  1BHA A;  3E22 A;  1PV0 A;  2QA4 V;  3DTU B;  4DK0 A;  1EN4 A;  5KA6 A;  2DMX A;  1SES A;  5IDJ A;  3JAW A;  2CUG A;  3CP1 A;  3N2G A;  1XQ8 A;  2Y4T A;  1P7G A;  2GTS A;  1N33 B;  1FXK C;  5KAF Z;  5B5E Z;  5BY1 A;  1VQ4 V;  2C2A A;  1WB7 A;  1LR1 A;  3EHB B;  2XAS A;  3NXS A;  5EZY B;  2LJ2 A;  2PYJ A;  3RWR D;  4BIO A;  5L3E A;  2EX3 A;  4K8Z A;  4FLT A;  4ZHQ A;  4FM1 A;  2KG7 B;  2HR3 A;  3MHS C;  3SR2 C;  5IYZ B;  1FXK B;  4I0X A;  2OTJ V;  4PV1 B;  5LA6 B;  2UUC O;  3JAL A;  5JCO C;  4K3A A;  4UCU A;  2ZM6 O;  1JR9 A;  2WAM A;  5KHI A;  3ZRS A;  1SQQ H;  4WFB V;  3LSS A;  4U3J A;  3T1H O;  4FLU A;  3G80 A;  3CS5 A;  1JPX A;  2DWD C;  1FFX B;  3OTO B;  2Q5Z A;  4U3F H;  4B7E A;  3ZRV A;  3IGA C;  4JTA B;  5IJ9 B;  3J80 N;  2WLL B;  4X20 B;  3G6B A;  4UCV A;  4CBC A;  4G28 B;  2XAH A;  2LO1 A;  4JZG A;  3ABL C;  3E8F A;  3ABK C;  3O65 A;  5CN0 A;  3CCV V;  4WBN A;  2UUC B;  1TAE A;  2P4V A;  2IBZ H;  2Z5U A;  1H2K A;  2ITD C;  2ZM6 B;  3KG2 A;  3ZHS A;  4LF7 O;  5ITZ A;  3QF7 A;  4GZR B;  1Q90 D;  5JQG B;  3T1H B;  1OCC B;  3AG4 B;  3H1L H;  3QO5 A;  4GCZ A;  1FYJ A;  3X2Q B;  5JJJ B;  5KX5 B;  3ZN0 A;  4Z1V A;  3K06 A;  4TOI A;  5TIS Z;  3E89 A;  1H2M A;  3ASN C;  1COW G;  3OMI B;  3BA8 A;  2UUA O;  1JCH A;  1GM8 A;  3UM7 A;  3D3I A;  3F7V C;  4BIZ A;  3UT5 B;  4MVZ A;  4DV1 O;  4GKJ B;  5BR8 O;  3RT3 C;  1E1R G;  4LF7 B;  4CC6 A;  1WJZ A;  1OV9 A;  3OAA G;  3ZN1 A;  4O4L B;  1YF2 A;  4L8J A;  2XTA A;  1S0V A;  2UU9 B;  1D5N A;  1Y74 A;  2Q68 A;  4LBE C;  1Y4M A;  4DV7 O;  1SZT A;  1F4N A;  3DXR B;  3H1I H;  3JSN A;  5FPR A;  1HNX O;  2W6I G;  5KUK A;  1S5L Z;  1XMO O;  1VF6 A;  1MSD A;  1AIL A;  1TVK A;  4J11 A;  1CXZ B;  4GKK B;  2UXC O;  5C8Y B;  5LHH A;  1RPR A;  1VQN V;  4ZOL A;  1JFF B;  2JJ1 G;  1Y67 A;  2AZ0 A;  2QSA A;  3IAY A;  1OCO B;  2DW4 A;  5FNV B;  3CMA V;  4MVM A;  1YSC A;  1J5E O;  2DJV A;  3OTF A;  5BR8 B;  1VF7 A;  3S3W A;  4GX1 A;  4UV8 A;  5LYJ A;  4W4K A;  1IBL O;  1VAR A;  2X6B A;  3VOU A;  1B3Q A;  3U11 A;  4LF4 O;  1V55 B;  3THO A;  2PI4 A;  1VQ8 V;  1NH2 B;  2YI8 A;  3E35 A;  1VQ9 V;  1IBK O;  1N0J A;  4DV7 B;  1RM1 C;  4K0K O;  1I5X A;  2F66 C;  3SPG A;  1QLE C;  1LUW A;  5A2Q N;  1HNX B;  4FLY A;  3UQ8 A;  1XMO B;  2DWE C;  4KP4 A;  1SQP H;  4LWS B;  3G71 V;  5H5N A;  3G6E V;  4X1K A;  4AHC A;  1JVM A;  1MA1 A;  2UXC B;  2PGG A;  2F1M A;  3QO8 A;  2DQ3 A;  3CSX A;  5JJE B;  2CAZ C;  3A0R A;  3EXA A;  2ZXW C;  2FTK A;  3FAV A;  3LDC A;  3OEE G;  4IHJ B;  4KFM A;  1J5E B;  3S3X A;  2EIL B;  4BW5 A;  3ABM C;  2FL4 A;  2F93 B;  3E8H A;  1R1B A;  4BIU A;  4I4T A;  1IBL B;  1L0L H;  5BMV A;  5CB4 B;  2K9P A;  5LOV B;  1SA0 A;  4IT5 A;  1P7B A;  4OX9 O;  1GN3 A;  1M90 W;  4WFF A;  4LF4 B;  2ARH A;  3T2M A;  3HKC A;  4X1Y A;  2HHH O;  2XAQ A;  1IBK B;  1IZ3 A;  4RAI A;  1ZTE A;  4K0K B;  4F6R B;  2MK3 A;  5L3F A;  4P30 A;  2P22 C;  3H01 A;  4CC5 A;  4ZI7 A;  3AG1 C;  4YJ2 A;  2XAJ A;  5HFM A;  5B1A C;  3BHP A;  4JI7 O;  5K1X A;  1VQ7 V;  4TSF G;  2XT9 A;  5IT9 N;  4FIP C;  1SQV H;  4DR6 O;  3QG5 A;  1MNG A;  1PL4 A;  4AQY O;  2LGQ A;  1FXH A;  4UB8 Z;  2YIA A;  2LFR A;  1NBM G;  3WB1 A;  2IM9 A;  1E79 G;  3L71 H;  1OZ0 A;  4EKW A;  4YXW G;  2PTM A;  3QO7 A;  4JZ2 A;  3BPZ A;  5J2U A;  2YEV B;  1VQP V;  2HHH B;  4I55 A;  2Q69 A;  2ZDI A;  3P30 A;  4JAU A;  1VQO V;  4X64 O;  3ZMV A;  4JV5 O;  2ZE5 A;  3Q4H A;  4TWK A;  2QM8 A;  5E79 Z;  3CXH F;  1MMM A;  1VMG A;  4O4I A;  1XL6 A;  1URF A;  4JI7 B;  4JI8 O;  1XEQ A;  3FYI B;  4UUJ C;  2HJF C;  2IJH A;  1WA8 A;  2QR4 A;  3OGI B;  5GTI Z;  1NI8 A;  5L3B A;  4DR6 B;  3IFX A;  3CYO A;  1EFR G;  3JAM N;  5JH7 A;  1YJN V;  2YXY A;  3C90 A;  2PZS A;  3RYF A;  4O2A A;  4HNA A;  2A0L A;  3CCM V;  2Q6A A;  2KSD A;  3FB6 C;  4OXS A;  2IU0 A;  4B08 A;  3B8N A;  2BTO A;  2AHZ A;  1QVG U;  1DK1 A;  2M6Y A;  4X65 B;  1WN7 A;  1TA8 A;  1SC5 B;  1D5A A;  3R66 A;  1VQ5 V;  5EC1 C; 
#chains in the Genus database with same CATH homology
 4NTX A;  1WP7 A;  2L35 A;  3IJ4 A;  2QTS A;  1WP8 A;  4NTW A;  4FZ0 A;  4NTY A;  3S3W A;  3S3X A;  4FZ1 A;  4NYK A;  2FB5 A;  3N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...