3S3XA

Structure of chicken acid-sensing ion channel 1 at 3.0 a resolution in complex with psalmotoxin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
404
structure length
401
Chain Sequence
VVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amiloride-sensitive cation channel 2, neuronal
publication title Structure of the Acid-sensing ion channel 1 in complex with the gating modifier Psalmotoxin 1.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Membrane protein
total genus 89
structure length 401
sequence length 404
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-05-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 3s3xA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 3s3xA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 3s3xA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 3s3xA02
3S3WA 2FB5A 2L35A 1WP7A 2QTSA 3N27A 4NTWA 4NTYA 3S3XA 4FZ0A 4NYKA 4FZ1A 1WP8A 4NTXA 3IJ4A
chains in the Genus database with same CATH superfamily
3A2FA 3JAMN 2ZCEA 1HW7A 4CS2A 3U11A 1P49A 1ZL8A 5JCOA 5J9PC 1AP5A 4FFBA 4HZ3A 3TCUA 3UKMA 2UUBO 3VBBA 4YJ2B 1VQ9V 4O4IA 2ZE8A 4IL6Z 1I7FA 2DN9A 3ZRSA 1PNLA 2DYRB 5B1AC 3CYOA 4FZ0A 3K03A 5JWPA 4CC5A 3K3WA 2UUBB 3ZBHA 4LC1A 2P06A 2ZT9B 2F4VO 5IY5B 1O9GA 5CA0A 1PP9H 3AG4C 1MOFA 3UCSC 2OCCC 1JR9A 3UQ8A 4DV3O 3I5DA 4IHJB 2QKSA 3ABKC 2W6IG 2A9HA 2HP8A 2F4VB 4NXNO 1OCRC 4HBNA 1WPBA 1ZWIC 1Y74A 3J80N 5GTHZ 2UXDO 4XBFA 4DV3B 2UU9O 1PM9A 2XTAA 1NZ6A 3FD9A 1JX9A 4CH6A 5D5QA 3JAWB 1M56B 5KHHA 1GMGA 3P30A 3WG7B 1NJIW 4O4JA 3K58A 3JATB 2UXDB 3CCVV 3HKDB 2UU9B 3OW2U 2UXBO 1RM1C 1B06A 1JQ0A 3ABMC 4DR5O 4PV1B 3CRQA 1H2KA 3AG7A 3HKEB 3JD1A 1XMOO 4C7UA 4QNHB 1BGYH 1VQLV 1V54B 1LUWA 1S5LZ 3K57A 4LF6O 2UXBB 3VQYA 4MT8A 1LNQA 4DR5B 1PPJH 4DR3B 4TT3G 4ICGA 4J9YB 1XMOB 4UCTA 2EZPA 4BIOA 4LF6B 3FB5C 1WJZA 1FPOA 4JZ2A 2V7QG 2EBOA 4X62O 1VQ6V 1GN3A 4TUYA 5KA5A 4DR6O 1GM7A 4KUMA 1BL8A 4FLTA 2QM7A 2W6JG 3LNMB 2YSUB 4JI0O 4GX0A 1VEWA 5K1XA 4X62B 4H37A 5B1AB 2Y0IA 4MTXA 2GHYA 4DR6B 3NXSA 2WWWA 2YICA 4JI0B 2R72A 3OGCC 4PA9A 3NR7A 3AG4B 2UUAO 2OCCB 1ZL8B 4JTAB 3BA8A 4GKKO 3ABKB 1US6A 2Y69C 5GTIZ 1NTZH 4B3SO 2N05A 2Y48A 3ZHQA 1OCRB 3IJ4A 2UUAB 1HR0O 3WB2A 4GKKB 4K8ZA 1WA8A 1L1FA 2QTSA 4B3SB 4PA4A 2YS8A 3RFRA 5HFMA 3AG2C 1NS1A 1WN7A 2EULA 3BAAA 2QWRB 1H2MA 5CBFA 1HR0B 1Y76B 4ASUG 2AGAA 1S72V 5LGUA 1MG1A 4L87A 2QM8A 3DC5A 1BS3A 1RM1B 1F7YA 3JD2A 3ABMB 1QVGU 3FKSG 3O65A 2CGNA 1XMQO 2Y0PA 2ITCC 3FAVB 1K3EA 4JYAB 3QNEA 4MVRA 1K4CC 3ZIAG 4O2AA 5A2QN 1I94O 2DJVA 2XAGA 2LO1A 4LFBO 1VMGA 1AI4A 2BTQA 3KZIZ 3AK2A 4UCSA 5LGTA 5LP6A 1G8MA 1XMQB 5BZBA 3P32A 2RMKB 5EZYB 1I94B 5J2UB 1TA8A 4LFBB 1PL0A 4WFHA 2PTMA 3ZCCA 1KKDA 1NT2B 5EBLC 1QNMA 1QVFU 2JIZG 4LWSA 2NR5A 4PJ0Z 1AJQA 3K04A 4NTWA 5KAIZ 3BHPA 1NR1A 4OPHA 3FFQA 2D3OW 2IH1C 1VQ4V 2CK3G 1VF6C 2QGNA 5KHJA 3MHSC 2YI8A 1SQVH 2KG7A 1N36O 1G1XB 1A32A 5ITZB 3ZMUA 2DMXA 5TISZ 5A9GA 3ZHSA 2Y69B 3F7VC 3RN4A 4X1IA 3THOA 1COWG 4DV1O 4OXSA 5CBHA 1N36B 3D36A 1VQNV 2CTRA 4B7KA 2P67A 1KYOF 5LA6A 1JVMA 3T1YO 1QQCA 4LFCO 3AG2B 4DV1B 4U3FH 3DXRA 2GV9A 3ZHTA 1KMIZ 1H2SB 2P6JA 3J81N 4K0KO 2K9PA 1FXKA 4TV9B 2JRIA 4E4EA 3T1YB 2YC0A 1S0VA 4LFCB 4MVMA 4X1KA 1UPGA 5KX5A 2W0FC 4K0KB 4DV4O 4LR3A 1JCHA 1FAFA 3STZC 2H3OA 4ZI7B 1NI8A 1Q3EA 4QIWF 2BOBC 2XT9A 3T4DA 2X6BA 4ZIBA 4D6TH 4DV4B 1YI2V 4JGSA 2OIGA 4UFZA 1FXKC 4BW5A 4UVAA 3QTCA 5LYJA 3CS5A 2MK3A 1QR9A 3AG3C 1Q86W 4EFBA 3B8NA 4LF8O 2WLIA 1N8RW 3RVYA 4GX1A 3SYPA 1GKFA 2ATKC 2QDOA 1S77D 2PUSA 4LF8B 5JVDA 3L70H 3CE2A 1K92A 2JGDA 3E22A 4X1YA 4K35A 5IJ0A 5EYPA 2LFRA 5C8YA 4MVZA 4KFMA 2NN4A 2Q7HA 5B3SC 3ASNC 4PA3A 3CC7V 3CCJV 2LGQA 3MD0A 5HFLA 5E79Z 2ZIOA 5BMVA 2YUAA 1KD1W 4EB6B 1YTFD 1GK9A 2XAJA 3LDCA 3HKCB 2KB1A 2YXYA 4JI3O 2Y4TA 4J42A 3N2KB 1SS3A 1K4DC 1SA0A 4X20B 2E74B 1QCEA 1YJ9V 2RNBA 2IW5A 2M7WA 1FFTB 1I08A 3SYQA 5KUMA 4JI3B 4FZ1A 1NVPD 2ODMA 4Z2WA 3JARA 3BVOA 3W7XA 4WCEV 1TUEB 2IJHA 4UB6Z 4X9QA 1YIJV 1YZBA 4MVSA 4O4HA 2ZE5A 1ORQC 1VQ5V 3OR7C 3RYFA 4RUEA 2FYUH 1BE3H 4FLZA 4J7JA 2UXNA 3JAKA 1Q7YW 3DTUB 3K5LA 1VQ7V 5L3FA 4HAMA 3N2GB 1KC8W 4BW9A 4IT5A 3JCUZ 2Q67A 5KA6A 2CTQA 1P7BA 2JK5C 3AG3B 3ETQA 1TVKB 2E3CA 4X1KB 3ZN0A 1FFXB 3SPCA 2N74A 1YVWA 1X59A 4G2KA 3L71H 2ZKOA 5EBWC 3ABTA 4DR4O 2R9IA 5JH7B 3I56V 2JGUA 3ZX6A 1BT8A 2R9AA 2WLJA 1ZX3A 1OCOC 4I0XA 1UJWB 3IAYA 5EC1C 1WP7A 4TV8A 4U3JB 2F43G 3ICXA 2ARHA 1JA8A 1XNRO 4DR4B 5LBQA 3JSLA 5B3SB 3ASNB 4PDLA 3RW0A 2ADPA 4CBCA 5CA1B 1XNRB 2QJ1A 4LFAO 1TUBB 4FLWA 4H13B 2EIMC 2A3QA 5EBMC 4DUYB 4ZOLB 4FM2A 1BHAA 1RP3B 2Q4PA 2EJ7A 1W59A 4LFAB 2O57A 5FNVB 2RJZA 1DGSA 3MDSA 3E22B 2JGDB 2VRZA 1K73W 2WLLA 5IJ0B 4MVOA 3ETDA 4PA6A 1HNXO 1DF4A 2XNDG 4AHCA 3A0BZ 3OMAB 1AROP 3K9SA 5LXTA 5LMNO 3R66A 1M93A 3CX5F 4B3MO 4LNUB 2P22C 3ZMZA 1U96A 1H2GA 3BA9A 1G4YB 3F7YC 1HNXB 4ZHQB 1RSOA 2L35A 3SJBC 1Y66A 5BXZA 4PDVA 1WLEA 4NYKA 5LMNB 4B3MB 2ZE7A 1F23A 3CJHA 2ZXWC 1RPOA 2JS5A 3OTFA 2GTSA 1Q5OA 1WPXA 1MNGA 1H2NA 2BSKA 4UXNA 2UUCO 1VIBA 2P7TC 1MSWD 1XOUA 1PL4A 3HKBB 5C93A 5LMUO 1SQXH 1XILA 1OCOB 4FLXA 2XAQA 1GN6A 2UUCB 2YEVA 3CB2A 3RWRD 1GM8A 5IJ9A 4YHHO 3CMAV 2BOCC 1NH2D 4WBNA 5KMGA 5LMUB 3K08A 4I50B 3CCQV 1H2LA 3CCEV 4RUFA 4DK1A 4YHHB 4I4TB 2JEUA 5FPRA 3T2MA 1U97A 2EIMB 5JCOC 2V4DA 2IJKA 1PNMA 2HLDG 2E5LO 1XNQO 4ZKIA 1MZEA 1MZFA 4JF3A 1SQGA 2E5LB 1XNQB 3GWKC 4NXNB 1M57B 1Q43A 4JTCB 5LHIA 4UVBA 4LF5O 2CH7A 3ASOC 2GSMB 3ZJZA 3SGIA 2QE7G 4ABMA 1P4RA 3O9OA 5KHGA 5LOVB 3WU2Z 3BCCH 3E8HA 1E1QG 4LF5B 1KP3A 3S3WA 3SYCA 2ZXWB 3L75H 3ABUA 4J41A 3OEHG 1I5XA 3ZRXA 1HNWO 2WLLB 1YJWV 4RO2A 5B66Z 3J7AU 3GVMA 1MABG 1HNWB 2F66C 4TOIA 4GT1A 4DR7O 1R6NA 3BRCA 3CHXA 1PV0A 1F4MA 2LQTA 2WLNA 1CP9A 4E2LA 4X89A 3TGUH 1FS0G 4DR7B 3QVNA 2QTOA 4UCRA 1HDJA 5IYZA 4JI5O 2P4VA 1JMKC 1MMMA 3CWBH 5CA3A 2PF4E 2G38A 4OPAA 2RCVA 1FJGO 3RYIA 4FFBB 4WFBV 1XREA 5L3BA 4JI5B 1L8DA 1EZJA 3ZHUA 1D5AA 3W7SA 1FD9A 5FPOA 4NTXA 4WFEA 5J2TA 4I9QA 4O4IB 5H6QA 3FB6C 1K8AW 3LSQA 2XUMA 2IJIA 4I55A 4CH5A 5IJ9B 2OTLV 1F4NA 1FJGB 5IDJA 1GN2A 2ZNJA 1NQTA 3E2EA 2P4KA 1J95A 2A7WA 1SZXA 3ASOB 3KCXA 3DC6A 5CA0B 3CC2V 2RN9A 5JJJB 3JALA 4YJ3A 4CC6A 4JAVA 1AB3A 5L3GA 1XHZA 2AZ2A 5DN6G 4PDMA 1R73A 1M1KW 2Z3YA 1Y74B 3ETEA 4FMTA 1M90W 5D5PA 2E75B 4J7KA 3QO5A 4DK0A 2XOKG 5B5EZ 4IYIA 3B8MA 1BMFG 3HB3B 2Q0AA 3T1CA 4O4JB 3LSUA 1Y67A 2FL4A 3K5NA 4TQDA 1M9NA 2PZSA 2LW7A 2XHBA 3PJSK 3CPWU 4IIJA 3M7MX 1NU1H 3S3XA 1B6QA 1K9MW 1AJPA 3A8TA 3K0GA 3BPZA 5DM6V 1H38A 4QE9A 5LP6C 4QPKA 4FJCC 2PYLA 1TAEA 1KU9A 2Q7EA 3G71V 4KP4A 2A06H 2DE0X 2XASA 4TQFA 3MAQA 3RVZA 4FLVA 4TUYB 1SERA 2NNUA 3CRAA 4H44B 3VOUA 3FYEB 5IE9A 3SJQC 3EXAA 5JJNB 1JJOA 2Q8VA 5B1BC 5FL7G 2BTOA 3GB7C 4HNAA 5B1NA 4JAUA 1QLNA 2F23A 1FYJA 3JASA 3QO7A 2DQ0A 1SF9A 5FLXN 4NKGB 2ILMA 2HEPA 1NTMH 3Q4HA 4JI1O 3B09A 3T4ZA 1CXZB 1XI1A 4X66O 3BEHA 2EIKC 3D36C 4TWKA 1I0HA 2OYQA 1XQ8A 1WA8B 2YIAA 2QKAA 2HG5C 1M5IA 4UVCA 4JI1B 3E89A 3X2QC 4X66B 4PDRA 2JJ2G 3QO8A 2HJFC 1PNKA 4NB5A 4DV2O 4FFKA 5H9CA 3F5WC 2Q73A 1XL4A 4MTFA 4P9PA 1AILA 3APOA 1Q81W 1Y6XA 1Z2GA 2GUZA 1SRYA 4FLUA 3K9AA 1FXVA 4QJFB 4I5SA 4UV9A 4O2AB 4DV0O 4DV2B 2HVKC 2LJ2A 3LDEA 2BTQB 4O2BA 1GO3F 3WFVA 3CCLV 5LP6B 3JYCA 1F51A 1YITV 4DV0B 4P30A 4UCOA 3CCRV 1EN5A 4NR1A 3VQVA 2YIBD 3QG5A 3RYHA 3H1KH 3ZRWA 3K79A 1K34A 5GONA 5CB4A 1VQOV 2LP7A 4F6RA 3RYCA 4LWSB 2OWOA 1JFFA 1O9HA 2DQ3A 5DECA 4GX2A 1ZUQA 5B1BB 1V55C 1Q6UA 3UT5A 3MHHC 4LF9O 4XDJA 2F1MA 2CDYA 2YDEA 2Z5UA 1YJNV 3SPJA 3HR0A 1YHQV 1OV9A 1XL6A 1R3LC 2YIDA 5H6RA 2KG7B 4DRXA 2ZIMA 2PYJA 3E8GA 3SPIA 2FTKA 1XEQA 4LF9B 1IX9A 4NVPA 5CN0A 4CH4A 3CRCA 4X1IB 2A0LA 2EINC 5JQGA 2WPDG 2QWPB 4L8JA 2EIKB 1JJ2U 3APQA 2YIBA 3CEIA 3LDDA 4JI8O 3G80A 4MSWC 2X7RB 3EVKA 1WNSA 5LA6B 5LHGA 1WP8A 2HFEC 3I55V 1VQMV 4IYHA 3F5TA 2IM9A 3X2QB 2QR4A 4JAAA 3DXRB 3H1JH 1AR1B 1Q82W 1E79G 1FXKB 4R50A 4JI8B 1VP7A 3SJAC 3FB7C 2OCHA 4BIZA 3E35A 2ZDIA 2ZR3A 4YJ2A 5KX5B 5EIBC 4LF4O 2WA3A 4YY3O 2AXTZ 3P3PA 1AJNA 4DR2O 3G6EV 2LW1A 4LF4B 1L0LH 4JI2O 4YY3B 3KKYA 4PD4F 5EK0A 4WFGA 3R65A 1DTOA 1L0NH 1IBKO 4IHJA 1UFIA 4A5UB 1SC5B 5LYJB 3ZRVA 3BY6A 3H1HH 4DR2B 4J9ZB 3VQXA 1X4TA 4JI2B 3CXCU 3L74H 4B3TO 4LCUC 1SQQH 2X6AA 1IBKB 2WLIB 1V55B 2QEXV 2BE3A 1K33A 2WSSG 5CMUA 4D7SA 4TSFG 3JAWA 4B3TB 3JATA 5JVDB 1B3QA 2HKOA 1VARA 2QWQB 3HKDA 4RQEA 4X1YB 3OM3B 4MVUA 4JI7O 5EYPB 1NBMG 3P3NA 5C8YB 1HNZO 2GTAA 4RWUA 3HKEA 4ZBMA 4EKWA 2EINB 4MW8A 5IYBO 2FMLA 2WAMA 1NR7A 4GLXA 5BMVB 3B40A 1YCIA 4HYOA 1HNZB 4EFEA 4MS2A 4JYBA 3CD6V 1SA0B 4FVMA 1ZLZA 2HHHO 1K5QA 2DYSC 2B5UA 3KG2A 4W4KA 1Q90D 4G27B 2ITDC 1HWYA 3H1IH 3G4SV 5IYDO 2HHHB 3ETGA 1IBMO 3JARB 1QU7A 4CS3A 1M4UA 3JCZA 1EN4A 2OIEA 3W7WA 1IVSA 2OTJV 1GAXA 4O4HB 4UV8A 3RYFB 2KKWA 1IBMB 3CXHF 4MVQA 2UXXA 3JAKB 4N23A 5H5NA 1J5EO 4FM0A 2HVJC 4GX5A 5B1OA 2XAFA 2ZINA 1YTFB 4QGPA 4PHZA 1SQPH 2EX3A 3EFFK 3L9DA 3LUTB 3UM7A 1J5EB 1R6TA 4X88A 2Q69A 2B1GA 2PI4A 2VWJA 3ZS8C 2ZE6A 5LGNA 1N4CA 1Q8IA 1OZ0A 1NVPB 1KP2A 1AI5A 1Y76A 4DYLA 4I0XB 4DUZO 3OGIB 4TV8B 5L3DA 4R6ZA 3CCUV 5LL6Y 1GTOA 3DSQA 4RQFA 4DO2A 4Q20A 5BR8O 1GRJA 3FAVA 1R3KC 3C90A 2V1DA 4DUZB 1MA1A 2Y4UA 3OD4A 4B3RO 3L73H 1H8EG 5K1PA 3A0HZ 5BR8B 1S76D 4W4LA 5EZYA 3B4SA 4KL1A 4JV5O 5J2UA 3ZN1A 1HP8A 4RAIA 1Y4MA 1N34O 2JDIG 3W7UA 1THZA 2A79B 3FB8C 4B3RB 1VQ8V 4B7EA 4LF7O 5IWAO 2DYSB 1P84F 4DV6O 4JV5B 2L6LA 4DR3O 5KHIA 1N34B 1SQFA 3IC7A 1ZAUA 1SZTA 3CP1A 3UO2A 1LR1A 3B77A 3TK1A 5LXTB 5IWAB 2DWEC 4LF7B 3AEIA 3DGEA 3CC4V 4PI0A 4DV6B 2XAHA 1IXMA 4CZZA 2LFSA 3JD4A 4QPJA 3SR2C 1N32O 3AG1C 1EM1A 1RSOB 1EN6A 4GZRB 4Z1MG 3T1HO 2IH3C 5ITZA 3WB0A 3G6BA 1S3JA 3CJHB 1GH6A 3CCMV 3BFRA 3EHBB 1ZTEA 3FYIB 3SYAA 1N32B 3ABLC 1RFYA 3AK3A 3ZHVA 2EILC 2Z0AA 3T1HB 2BSKB 4P9OA 5KAFZ 3C3TA 2CE4A 1DK1A 4BWAA 1CEZA 1WB7A 1XUQA 3RBZA 2IU0A 4LP8A 3PN1A 1XBLA 1MSDA 2B1IA 3STLC 1D5NA 2EZOA 1BSMA 1ZSPA 3ML0A 4KXRA 4MW3A 3D3IA 3TJTA 4TV9A 2YEVB 1EBOA 3SDLA 1N0NA 3OTOO 4OX9O 1KB9F 2R70A 3M8AA 1NTKH 3SJCC 4WBNB 3OMNB 4FPPA 5KMGB 3ZHRA 3U10A 2F95B 1AI7A 4DR1O 1IZ3A 1E1RG 1AR4A 2QWOB 2X6CA 4ZI7A 3OTOB 4U7NA 4H0LB 1B04A 4OX9B 5AG2A 1W0KG 1W0JG 3OFNG 4BIUA 3ZMSA 1QR8A 1DF5A 2AHYA 2IBZH 4FLYA 2GDSA 4FK5C 2YXLA 4MTGA 4DR1B 1WB8A 1SETA 2ZM6O 4JYAO 3N27A 1Q6HA 3SPGA 1IURA 5IYCO 2HR3A 4JZGA 1R6KA 4F6EA 4XDKA 1YXBA 1FXHA 1OCZC 4UUJC 5KHKA 1DLBA 2QWNB 2ZM6B 3JD0A 4QE7A 2CH7B 5BY1A 4I9WA 2RQ6A 3SPHA 3OUFA 1NH2B 2CUGA 1VF6A 1SESA 3AG1B 4J10A 3JSNA 2JS3A 1WAZA 4WF9V 4H33A 5LHHA 3CCSV 1ENVA 1QHTA 2KQXA 2VQFO 3OR6C 2VS0A 2DWDC 3ABLB 3GWOA 2EILB 1K5SA 1G6UA 5DEDA 4LH6A 1AP6A 1VQPV 2AW9A 2LGWA 3IFXA 4EB6A 2VQFB 3HKCA 2PY5A 3H9VA 3N2KA 4J7ZA 2VWKA 4NTYA 3U0ZA 4X20A 4XDLA 2W0XA 3OT7A 1BZKA 2MW2B 5KLVH 5GW7A 4BR6A 1PKXA 1PD3A 4R8CA 3TXSA 2NLJC 3E83A 2ZD9A 1N0JA 4O4LA 5IYZB 2M6YA 3FX7A 1S5JA 2HJDA 3LNNA 3A0RA 1K97A 2QA4V 4FM1A 3E8FA 2D2CB 4PELA 3RYIB 4Q6GA 2DW4A 4NXMO 2WLHA 2WLMA 5J2TB 1I5YA 3N2GA 1OCCC 4I55B 3CRMA 3ZMTA 2P5OA 1TVKA 1TGOA 1OCZB 4NXMB 4JYCA 4I7ZB 1FFXA 2CTPA 2YXHA 2H8PC 3D8CA 1EFRG 5JH7A 3UO3A 3M99B 1VQKV 1Z5WA 3K06A 1N33O 3JALB 4YJ3B 3OAAG 2PI5A 1KKCA 4JYYA 4U3JA 4P2ZA 4AILC 3QF7A 2BCCH 2EIJC 2ZR2A 3IGAC 1NKDA 4KHPO 3ZEDA 4B08A 1N33B 3LSSA 2CTWA 1YDXA 5CA1A 1XDCA 2F93B 2Q6AA 4LH7A 1TUBA 2C2AA 1KECA 1URFA 1R3JC 4KHPB 1OJHA 2JVDA 2B9ZA 4JI4O 2CGOA 1BQZA 4G28B 4ZOLA 3H1LH 1W2BU 2Q68A 3KCYA 2VQEO 4N21A 2K1EA 5EIBD 4IIJB 5FNVA 1V9PA 4FIPC 4DV5O 1VF7A 3OEEG 2ETNA 4JI4B 5F2VO 4CS4A 3D3QA 2EJRA 2CAZC 1VF5B 1ROPA 3K59A 5L3CA 2VQEB 1QBZA 3CMEV 4DV5B 4GUNA 4WFAV 4LNUA 5IT9N 1BQ0A 4ZHQA 1BCCH 3H01A 4YXWG 1CPYA 4Z1VA 2FB5A 2ADQB 2Q0OC 3K0DA 4UB8Z 3E8BA 3WB1A 1QLEC 2JEXA 4F4LA 2H94A 1Q6IA 1OCCB 4JI6O 1IBLO 1LUVA 4HNAB 1AI6A 1GN4A 2QM4A 1YEWA 3VQWA 2JJ1G 4X64O 3OE7G 1P7GA 4O4LB 1T5EA 1RPRA 4J80A 2QSAA 3JASB 4JASA 4YIOA 2X0LA 2WLKA 4JI6B 1IBLB 1XHXA 4UCUA 5H2FZ 3AK1A 1R1BA 3TETA 4X64B 3HKBA 4OGQB 1D2DA 4YIPA 3Q4HB 5KUKA 4CH3A 3BABA 1EZVH 4LBEC 1AR5A 2EIJB 2E76B 4U7OA 2AZ0A 2P90A 4MTOA 3RGBA 4I50A 4J11A 4WFFA 2R9RB 3RT3C 4JPRA 4X8AA 2IJJA 1OHHG 3CSXA 4I4TA 3K5OA 4GCZA 1SQBH 3TXQA 5L3EA 1YF2A 2DOSA 3CRRA 5CBGA 1IXBA 3HPLC 2ZDIC 1FKAO 2ZNIA 2UXCO 4DV7O 4GKJO 2FKXA 2GUZB 4DXWA 4K8XA 2Q7GA 1BHBA 2WA4A 2AHZA 2DYRC 4UCVA 2KSDA 1YSCA 4GYCB 4O2BB 4D7TA 2UXCB 4AQYO 4DV7B 4GKJB 4DUYO 3C3SA 5IY5C 4PI2A 1H8HG 2QKCA 3G67A 1IDSA 1AVMA 5LOVA 3K5MA 2GBOA 3RYHB 3ZRWB 4AQYB 5GONB 3SYOA 4PA7A 5CB4B 4F6RB 4X65O 1JOYA 1S5HC 2IU3A 3RYCB 2N04A 1GM9A 1QLEB 1JFFB 2YI9A 1Z5VA 5JJEB 2OT5A 2RDCA 4JI7B 4IGGA 3L72H 3OUSA 3IC9A 3UT5B 1SKVA 1KBHA 1JPXA 3B2EE 4X65B 2Q9LA 3JD3A 5E1AC 1M57C 2ZQMA 1M56C 4K3AA 3WG7C 3ZMVA 4AI8A 1R3IC 4R7CA 2PGGA 4DRXB 3OMIB 3E86A 4JTDB 4DW1A 1K7DA 2Q5ZA 3W7TA 5EC2C 1V54C 4BAYA 1KUQA 5JQGB 4DW0A 4EEQA 1KQSU
chains in the Genus database with same CATH topology
3S3WA 2FB5A 2L35A 1WP7A 2QTSA 3N27A 4NTWA 4NTYA 3S3XA 4FZ0A 4NYKA 4FZ1A 1WP8A 4NTXA 3IJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S3W A;  2FB5 A;  2L35 A;  1WP7 A;  2QTS A;  3N27 A;  4NTW A;  4NTY A;  3S3X A;  4FZ0 A;  4NYK A;  4FZ1 A;  1WP8 A;  4NTX A;  3IJ4 A; 
#chains in the Genus database with same CATH topology
 3A2F A;  3JAM N;  2ZCE A;  1HW7 A;  4CS2 A;  3U11 A;  1P49 A;  1ZL8 A;  5JCO A;  5J9P C;  1AP5 A;  4FFB A;  4HZ3 A;  3TCU A;  3UKM A;  2UUB O;  3VBB A;  4YJ2 B;  1VQ9 V;  4O4I A;  2ZE8 A;  4IL6 Z;  1I7F A;  2DN9 A;  3ZRS A;  1PNL A;  2DYR B;  5B1A C;  3CYO A;  4FZ0 A;  3K03 A;  5JWP A;  4CC5 A;  3K3W A;  2UUB B;  3ZBH A;  4LC1 A;  2P06 A;  2ZT9 B;  2F4V O;  5IY5 B;  1O9G A;  5CA0 A;  1PP9 H;  3AG4 C;  1MOF A;  3UCS C;  2OCC C;  1JR9 A;  3UQ8 A;  4DV3 O;  3I5D A;  4IHJ B;  2QKS A;  3ABK C;  2W6I G;  2A9H A;  2HP8 A;  2F4V B;  4NXN O;  1OCR C;  4HBN A;  1WPB A;  1ZWI C;  1Y74 A;  3J80 N;  5GTH Z;  2UXD O;  4XBF A;  4DV3 B;  2UU9 O;  1PM9 A;  2XTA A;  1NZ6 A;  3FD9 A;  1JX9 A;  4CH6 A;  5D5Q A;  3JAW B;  1M56 B;  5KHH A;  1GMG A;  3P30 A;  3WG7 B;  1NJI W;  4O4J A;  3K58 A;  3JAT B;  2UXD B;  3CCV V;  3HKD B;  2UU9 B;  3OW2 U;  2UXB O;  1RM1 C;  1B06 A;  1JQ0 A;  3ABM C;  4DR5 O;  4PV1 B;  3CRQ A;  1H2K A;  3AG7 A;  3HKE B;  3JD1 A;  1XMO O;  4C7U A;  4QNH B;  1BGY H;  1VQL V;  1V54 B;  1LUW A;  1S5L Z;  3K57 A;  4LF6 O;  2UXB B;  3VQY A;  4MT8 A;  1LNQ A;  4DR5 B;  1PPJ H;  4DR3 B;  4TT3 G;  4ICG A;  4J9Y B;  1XMO B;  4UCT A;  2EZP A;  4BIO A;  4LF6 B;  3FB5 C;  1WJZ A;  1FPO A;  4JZ2 A;  2V7Q G;  2EBO A;  4X62 O;  1VQ6 V;  1GN3 A;  4TUY A;  5KA5 A;  4DR6 O;  1GM7 A;  4KUM A;  1BL8 A;  4FLT A;  2QM7 A;  2W6J G;  3LNM B;  2YSU B;  4JI0 O;  4GX0 A;  1VEW A;  5K1X A;  4X62 B;  4H37 A;  5B1A B;  2Y0I A;  4MTX A;  2GHY A;  4DR6 B;  3NXS A;  2WWW A;  2YIC A;  4JI0 B;  2R72 A;  3OGC C;  4PA9 A;  3NR7 A;  3AG4 B;  2UUA O;  2OCC B;  1ZL8 B;  4JTA B;  3BA8 A;  4GKK O;  3ABK B;  1US6 A;  2Y69 C;  5GTI Z;  1NTZ H;  4B3S O;  2N05 A;  2Y48 A;  3ZHQ A;  1OCR B;  3IJ4 A;  2UUA B;  1HR0 O;  3WB2 A;  4GKK B;  4K8Z A;  1WA8 A;  1L1F A;  2QTS A;  4B3S B;  4PA4 A;  2YS8 A;  3RFR A;  5HFM A;  3AG2 C;  1NS1 A;  1WN7 A;  2EUL A;  3BAA A;  2QWR B;  1H2M A;  5CBF A;  1HR0 B;  1Y76 B;  4ASU G;  2AGA A;  1S72 V;  5LGU A;  1MG1 A;  4L87 A;  2QM8 A;  3DC5 A;  1BS3 A;  1RM1 B;  1F7Y A;  3JD2 A;  3ABM B;  1QVG U;  3FKS G;  3O65 A;  2CGN A;  1XMQ O;  2Y0P A;  2ITC C;  3FAV B;  1K3E A;  4JYA B;  3QNE A;  4MVR A;  1K4C C;  3ZIA G;  4O2A A;  5A2Q N;  1I94 O;  2DJV A;  2XAG A;  2LO1 A;  4LFB O;  1VMG A;  1AI4 A;  2BTQ A;  3KZI Z;  3AK2 A;  4UCS A;  5LGT A;  5LP6 A;  1G8M A;  1XMQ B;  5BZB A;  3P32 A;  2RMK B;  5EZY B;  1I94 B;  5J2U B;  1TA8 A;  4LFB B;  1PL0 A;  4WFH A;  2PTM A;  3ZCC A;  1KKD A;  1NT2 B;  5EBL C;  1QNM A;  1QVF U;  2JIZ G;  4LWS A;  2NR5 A;  4PJ0 Z;  1AJQ A;  3K04 A;  4NTW A;  5KAI Z;  3BHP A;  1NR1 A;  4OPH A;  3FFQ A;  2D3O W;  2IH1 C;  1VQ4 V;  2CK3 G;  1VF6 C;  2QGN A;  5KHJ A;  3MHS C;  2YI8 A;  1SQV H;  2KG7 A;  1N36 O;  1G1X B;  1A32 A;  5ITZ B;  3ZMU A;  2DMX A;  5TIS Z;  5A9G A;  3ZHS A;  2Y69 B;  3F7V C;  3RN4 A;  4X1I A;  3THO A;  1COW G;  4DV1 O;  4OXS A;  5CBH A;  1N36 B;  3D36 A;  1VQN V;  2CTR A;  4B7K A;  2P67 A;  1KYO F;  5LA6 A;  1JVM A;  3T1Y O;  1QQC A;  4LFC O;  3AG2 B;  4DV1 B;  4U3F H;  3DXR A;  2GV9 A;  3ZHT A;  1KMI Z;  1H2S B;  2P6J A;  3J81 N;  4K0K O;  2K9P A;  1FXK A;  4TV9 B;  2JRI A;  4E4E A;  3T1Y B;  2YC0 A;  1S0V A;  4LFC B;  4MVM A;  4X1K A;  1UPG A;  5KX5 A;  2W0F C;  4K0K B;  4DV4 O;  4LR3 A;  1JCH A;  1FAF A;  3STZ C;  2H3O A;  4ZI7 B;  1NI8 A;  1Q3E A;  4QIW F;  2BOB C;  2XT9 A;  3T4D A;  2X6B A;  4ZIB A;  4D6T H;  4DV4 B;  1YI2 V;  4JGS A;  2OIG A;  4UFZ A;  1FXK C;  4BW5 A;  4UVA A;  3QTC A;  5LYJ A;  3CS5 A;  2MK3 A;  1QR9 A;  3AG3 C;  1Q86 W;  4EFB A;  3B8N A;  4LF8 O;  2WLI A;  1N8R W;  3RVY A;  4GX1 A;  3SYP A;  1GKF A;  2ATK C;  2QDO A;  1S77 D;  2PUS A;  4LF8 B;  5JVD A;  3L70 H;  3CE2 A;  1K92 A;  2JGD A;  3E22 A;  4X1Y A;  4K35 A;  5IJ0 A;  5EYP A;  2LFR A;  5C8Y A;  4MVZ A;  4KFM A;  2NN4 A;  2Q7H A;  5B3S C;  3ASN C;  4PA3 A;  3CC7 V;  3CCJ V;  2LGQ A;  3MD0 A;  5HFL A;  5E79 Z;  2ZIO A;  5BMV A;  2YUA A;  1KD1 W;  4EB6 B;  1YTF D;  1GK9 A;  2XAJ A;  3LDC A;  3HKC B;  2KB1 A;  2YXY A;  4JI3 O;  2Y4T A;  4J42 A;  3N2K B;  1SS3 A;  1K4D C;  1SA0 A;  4X20 B;  2E74 B;  1QCE A;  1YJ9 V;  2RNB A;  2IW5 A;  2M7W A;  1FFT B;  1I08 A;  3SYQ A;  5KUM A;  4JI3 B;  4FZ1 A;  1NVP D;  2ODM A;  4Z2W A;  3JAR A;  3BVO A;  3W7X A;  4WCE V;  1TUE B;  2IJH A;  4UB6 Z;  4X9Q A;  1YIJ V;  1YZB A;  4MVS A;  4O4H A;  2ZE5 A;  1ORQ C;  1VQ5 V;  3OR7 C;  3RYF A;  4RUE A;  2FYU H;  1BE3 H;  4FLZ A;  4J7J A;  2UXN A;  3JAK A;  1Q7Y W;  3DTU B;  3K5L A;  1VQ7 V;  5L3F A;  4HAM A;  3N2G B;  1KC8 W;  4BW9 A;  4IT5 A;  3JCU Z;  2Q67 A;  5KA6 A;  2CTQ A;  1P7B A;  2JK5 C;  3AG3 B;  3ETQ A;  1TVK B;  2E3C A;  4X1K B;  3ZN0 A;  1FFX B;  3SPC A;  2N74 A;  1YVW A;  1X59 A;  4G2K A;  3L71 H;  2ZKO A;  5EBW C;  3ABT A;  4DR4 O;  2R9I A;  5JH7 B;  3I56 V;  2JGU A;  3ZX6 A;  1BT8 A;  2R9A A;  2WLJ A;  1ZX3 A;  1OCO C;  4I0X A;  1UJW B;  3IAY A;  5EC1 C;  1WP7 A;  4TV8 A;  4U3J B;  2F43 G;  3ICX A;  2ARH A;  1JA8 A;  1XNR O;  4DR4 B;  5LBQ A;  3JSL A;  5B3S B;  3ASN B;  4PDL A;  3RW0 A;  2ADP A;  4CBC A;  5CA1 B;  1XNR B;  2QJ1 A;  4LFA O;  1TUB B;  4FLW A;  4H13 B;  2EIM C;  2A3Q A;  5EBM C;  4DUY B;  4ZOL B;  4FM2 A;  1BHA A;  1RP3 B;  2Q4P A;  2EJ7 A;  1W59 A;  4LFA B;  2O57 A;  5FNV B;  2RJZ A;  1DGS A;  3MDS A;  3E22 B;  2JGD B;  2VRZ A;  1K73 W;  2WLL A;  5IJ0 B;  4MVO A;  3ETD A;  4PA6 A;  1HNX O;  1DF4 A;  2XND G;  4AHC A;  3A0B Z;  3OMA B;  1ARO P;  3K9S A;  5LXT A;  5LMN O;  3R66 A;  1M93 A;  3CX5 F;  4B3M O;  4LNU B;  2P22 C;  3ZMZ A;  1U96 A;  1H2G A;  3BA9 A;  1G4Y B;  3F7Y C;  1HNX B;  4ZHQ B;  1RSO A;  2L35 A;  3SJB C;  1Y66 A;  5BXZ A;  4PDV A;  1WLE A;  4NYK A;  5LMN B;  4B3M B;  2ZE7 A;  1F23 A;  3CJH A;  2ZXW C;  1RPO A;  2JS5 A;  3OTF A;  2GTS A;  1Q5O A;  1WPX A;  1MNG A;  1H2N A;  2BSK A;  4UXN A;  2UUC O;  1VIB A;  2P7T C;  1MSW D;  1XOU A;  1PL4 A;  3HKB B;  5C93 A;  5LMU O;  1SQX H;  1XIL A;  1OCO B;  4FLX A;  2XAQ A;  1GN6 A;  2UUC B;  2YEV A;  3CB2 A;  3RWR D;  1GM8 A;  5IJ9 A;  4YHH O;  3CMA V;  2BOC C;  1NH2 D;  4WBN A;  5KMG A;  5LMU B;  3K08 A;  4I50 B;  3CCQ V;  1H2L A;  3CCE V;  4RUF A;  4DK1 A;  4YHH B;  4I4T B;  2JEU A;  5FPR A;  3T2M A;  1U97 A;  2EIM B;  5JCO C;  2V4D A;  2IJK A;  1PNM A;  2HLD G;  2E5L O;  1XNQ O;  4ZKI A;  1MZE A;  1MZF A;  4JF3 A;  1SQG A;  2E5L B;  1XNQ B;  3GWK C;  4NXN B;  1M57 B;  1Q43 A;  4JTC B;  5LHI A;  4UVB A;  4LF5 O;  2CH7 A;  3ASO C;  2GSM B;  3ZJZ A;  3SGI A;  2QE7 G;  4ABM A;  1P4R A;  3O9O A;  5KHG A;  5LOV B;  3WU2 Z;  3BCC H;  3E8H A;  1E1Q G;  4LF5 B;  1KP3 A;  3S3W A;  3SYC A;  2ZXW B;  3L75 H;  3ABU A;  4J41 A;  3OEH G;  1I5X A;  3ZRX A;  1HNW O;  2WLL B;  1YJW V;  4RO2 A;  5B66 Z;  3J7A U;  3GVM A;  1MAB G;  1HNW B;  2F66 C;  4TOI A;  4GT1 A;  4DR7 O;  1R6N A;  3BRC A;  3CHX A;  1PV0 A;  1F4M A;  2LQT A;  2WLN A;  1CP9 A;  4E2L A;  4X89 A;  3TGU H;  1FS0 G;  4DR7 B;  3QVN A;  2QTO A;  4UCR A;  1HDJ A;  5IYZ A;  4JI5 O;  2P4V A;  1JMK C;  1MMM A;  3CWB H;  5CA3 A;  2PF4 E;  2G38 A;  4OPA A;  2RCV A;  1FJG O;  3RYI A;  4FFB B;  4WFB V;  1XRE A;  5L3B A;  4JI5 B;  1L8D A;  1EZJ A;  3ZHU A;  1D5A A;  3W7S A;  1FD9 A;  5FPO A;  4NTX A;  4WFE A;  5J2T A;  4I9Q A;  4O4I B;  5H6Q A;  3FB6 C;  1K8A W;  3LSQ A;  2XUM A;  2IJI A;  4I55 A;  4CH5 A;  5IJ9 B;  2OTL V;  1F4N A;  1FJG B;  5IDJ A;  1GN2 A;  2ZNJ A;  1NQT A;  3E2E A;  2P4K A;  1J95 A;  2A7W A;  1SZX A;  3ASO B;  3KCX A;  3DC6 A;  5CA0 B;  3CC2 V;  2RN9 A;  5JJJ B;  3JAL A;  4YJ3 A;  4CC6 A;  4JAV A;  1AB3 A;  5L3G A;  1XHZ A;  2AZ2 A;  5DN6 G;  4PDM A;  1R73 A;  1M1K W;  2Z3Y A;  1Y74 B;  3ETE A;  4FMT A;  1M90 W;  5D5P A;  2E75 B;  4J7K A;  3QO5 A;  4DK0 A;  2XOK G;  5B5E Z;  4IYI A;  3B8M A;  1BMF G;  3HB3 B;  2Q0A A;  3T1C A;  4O4J B;  3LSU A;  1Y67 A;  2FL4 A;  3K5N A;  4TQD A;  1M9N A;  2PZS A;  2LW7 A;  2XHB A;  3PJS K;  3CPW U;  4IIJ A;  3M7M X;  1NU1 H;  3S3X A;  1B6Q A;  1K9M W;  1AJP A;  3A8T A;  3K0G A;  3BPZ A;  5DM6 V;  1H38 A;  4QE9 A;  5LP6 C;  4QPK A;  4FJC C;  2PYL A;  1TAE A;  1KU9 A;  2Q7E A;  3G71 V;  4KP4 A;  2A06 H;  2DE0 X;  2XAS A;  4TQF A;  3MAQ A;  3RVZ A;  4FLV A;  4TUY B;  1SER A;  2NNU A;  3CRA A;  4H44 B;  3VOU A;  3FYE B;  5IE9 A;  3SJQ C;  3EXA A;  5JJN B;  1JJO A;  2Q8V A;  5B1B C;  5FL7 G;  2BTO A;  3GB7 C;  4HNA A;  5B1N A;  4JAU A;  1QLN A;  2F23 A;  1FYJ A;  3JAS A;  3QO7 A;  2DQ0 A;  1SF9 A;  5FLX N;  4NKG B;  2ILM A;  2HEP A;  1NTM H;  3Q4H A;  4JI1 O;  3B09 A;  3T4Z A;  1CXZ B;  1XI1 A;  4X66 O;  3BEH A;  2EIK C;  3D36 C;  4TWK A;  1I0H A;  2OYQ A;  1XQ8 A;  1WA8 B;  2YIA A;  2QKA A;  2HG5 C;  1M5I A;  4UVC A;  4JI1 B;  3E89 A;  3X2Q C;  4X66 B;  4PDR A;  2JJ2 G;  3QO8 A;  2HJF C;  1PNK A;  4NB5 A;  4DV2 O;  4FFK A;  5H9C A;  3F5W C;  2Q73 A;  1XL4 A;  4MTF A;  4P9P A;  1AIL A;  3APO A;  1Q81 W;  1Y6X A;  1Z2G A;  2GUZ A;  1SRY A;  4FLU A;  3K9A A;  1FXV A;  4QJF B;  4I5S A;  4UV9 A;  4O2A B;  4DV0 O;  4DV2 B;  2HVK C;  2LJ2 A;  3LDE A;  2BTQ B;  4O2B A;  1GO3 F;  3WFV A;  3CCL V;  5LP6 B;  3JYC A;  1F51 A;  1YIT V;  4DV0 B;  4P30 A;  4UCO A;  3CCR V;  1EN5 A;  4NR1 A;  3VQV A;  2YIB D;  3QG5 A;  3RYH A;  3H1K H;  3ZRW A;  3K79 A;  1K34 A;  5GON A;  5CB4 A;  1VQO V;  2LP7 A;  4F6R A;  3RYC A;  4LWS B;  2OWO A;  1JFF A;  1O9H A;  2DQ3 A;  5DEC A;  4GX2 A;  1ZUQ A;  5B1B B;  1V55 C;  1Q6U A;  3UT5 A;  3MHH C;  4LF9 O;  4XDJ A;  2F1M A;  2CDY A;  2YDE A;  2Z5U A;  1YJN V;  3SPJ A;  3HR0 A;  1YHQ V;  1OV9 A;  1XL6 A;  1R3L C;  2YID A;  5H6R A;  2KG7 B;  4DRX A;  2ZIM A;  2PYJ A;  3E8G A;  3SPI A;  2FTK A;  1XEQ A;  4LF9 B;  1IX9 A;  4NVP A;  5CN0 A;  4CH4 A;  3CRC A;  4X1I B;  2A0L A;  2EIN C;  5JQG A;  2WPD G;  2QWP B;  4L8J A;  2EIK B;  1JJ2 U;  3APQ A;  2YIB A;  3CEI A;  3LDD A;  4JI8 O;  3G80 A;  4MSW C;  2X7R B;  3EVK A;  1WNS A;  5LA6 B;  5LHG A;  1WP8 A;  2HFE C;  3I55 V;  1VQM V;  4IYH A;  3F5T A;  2IM9 A;  3X2Q B;  2QR4 A;  4JAA A;  3DXR B;  3H1J H;  1AR1 B;  1Q82 W;  1E79 G;  1FXK B;  4R50 A;  4JI8 B;  1VP7 A;  3SJA C;  3FB7 C;  2OCH A;  4BIZ A;  3E35 A;  2ZDI A;  2ZR3 A;  4YJ2 A;  5KX5 B;  5EIB C;  4LF4 O;  2WA3 A;  4YY3 O;  2AXT Z;  3P3P A;  1AJN A;  4DR2 O;  3G6E V;  2LW1 A;  4LF4 B;  1L0L H;  4JI2 O;  4YY3 B;  3KKY A;  4PD4 F;  5EK0 A;  4WFG A;  3R65 A;  1DTO A;  1L0N H;  1IBK O;  4IHJ A;  1UFI A;  4A5U B;  1SC5 B;  5LYJ B;  3ZRV A;  3BY6 A;  3H1H H;  4DR2 B;  4J9Z B;  3VQX A;  1X4T A;  4JI2 B;  3CXC U;  3L74 H;  4B3T O;  4LCU C;  1SQQ H;  2X6A A;  1IBK B;  2WLI B;  1V55 B;  2QEX V;  2BE3 A;  1K33 A;  2WSS G;  5CMU A;  4D7S A;  4TSF G;  3JAW A;  4B3T B;  3JAT A;  5JVD B;  1B3Q A;  2HKO A;  1VAR A;  2QWQ B;  3HKD A;  4RQE A;  4X1Y B;  3OM3 B;  4MVU A;  4JI7 O;  5EYP B;  1NBM G;  3P3N A;  5C8Y B;  1HNZ O;  2GTA A;  4RWU A;  3HKE A;  4ZBM A;  4EKW A;  2EIN B;  4MW8 A;  5IYB O;  2FML A;  2WAM A;  1NR7 A;  4GLX A;  5BMV B;  3B40 A;  1YCI A;  4HYO A;  1HNZ B;  4EFE A;  4MS2 A;  4JYB A;  3CD6 V;  1SA0 B;  4FVM A;  1ZLZ A;  2HHH O;  1K5Q A;  2DYS C;  2B5U A;  3KG2 A;  4W4K A;  1Q90 D;  4G27 B;  2ITD C;  1HWY A;  3H1I H;  3G4S V;  5IYD O;  2HHH B;  3ETG A;  1IBM O;  3JAR B;  1QU7 A;  4CS3 A;  1M4U A;  3JCZ A;  1EN4 A;  2OIE A;  3W7W A;  1IVS A;  2OTJ V;  1GAX A;  4O4H B;  4UV8 A;  3RYF B;  2KKW A;  1IBM B;  3CXH F;  4MVQ A;  2UXX A;  3JAK B;  4N23 A;  5H5N A;  1J5E O;  4FM0 A;  2HVJ C;  4GX5 A;  5B1O A;  2XAF A;  2ZIN A;  1YTF B;  4QGP A;  4PHZ A;  1SQP H;  2EX3 A;  3EFF K;  3L9D A;  3LUT B;  3UM7 A;  1J5E B;  1R6T A;  4X88 A;  2Q69 A;  2B1G A;  2PI4 A;  2VWJ A;  3ZS8 C;  2ZE6 A;  5LGN A;  1N4C A;  1Q8I A;  1OZ0 A;  1NVP B;  1KP2 A;  1AI5 A;  1Y76 A;  4DYL A;  4I0X B;  4DUZ O;  3OGI B;  4TV8 B;  5L3D A;  4R6Z A;  3CCU V;  5LL6 Y;  1GTO A;  3DSQ A;  4RQF A;  4DO2 A;  4Q20 A;  5BR8 O;  1GRJ A;  3FAV A;  1R3K C;  3C90 A;  2V1D A;  4DUZ B;  1MA1 A;  2Y4U A;  3OD4 A;  4B3R O;  3L73 H;  1H8E G;  5K1P A;  3A0H Z;  5BR8 B;  1S76 D;  4W4L A;  5EZY A;  3B4S A;  4KL1 A;  4JV5 O;  5J2U A;  3ZN1 A;  1HP8 A;  4RAI A;  1Y4M A;  1N34 O;  2JDI G;  3W7U A;  1THZ A;  2A79 B;  3FB8 C;  4B3R B;  1VQ8 V;  4B7E A;  4LF7 O;  5IWA O;  2DYS B;  1P84 F;  4DV6 O;  4JV5 B;  2L6L A;  4DR3 O;  5KHI A;  1N34 B;  1SQF A;  3IC7 A;  1ZAU A;  1SZT A;  3CP1 A;  3UO2 A;  1LR1 A;  3B77 A;  3TK1 A;  5LXT B;  5IWA B;  2DWE C;  4LF7 B;  3AEI A;  3DGE A;  3CC4 V;  4PI0 A;  4DV6 B;  2XAH A;  1IXM A;  4CZZ A;  2LFS A;  3JD4 A;  4QPJ A;  3SR2 C;  1N32 O;  3AG1 C;  1EM1 A;  1RSO B;  1EN6 A;  4GZR B;  4Z1M G;  3T1H O;  2IH3 C;  5ITZ A;  3WB0 A;  3G6B A;  1S3J A;  3CJH B;  1GH6 A;  3CCM V;  3BFR A;  3EHB B;  1ZTE A;  3FYI B;  3SYA A;  1N32 B;  3ABL C;  1RFY A;  3AK3 A;  3ZHV A;  2EIL C;  2Z0A A;  3T1H B;  2BSK B;  4P9O A;  5KAF Z;  3C3T A;  2CE4 A;  1DK1 A;  4BWA A;  1CEZ A;  1WB7 A;  1XUQ A;  3RBZ A;  2IU0 A;  4LP8 A;  3PN1 A;  1XBL A;  1MSD A;  2B1I A;  3STL C;  1D5N A;  2EZO A;  1BSM A;  1ZSP A;  3ML0 A;  4KXR A;  4MW3 A;  3D3I A;  3TJT A;  4TV9 A;  2YEV B;  1EBO A;  3SDL A;  1N0N A;  3OTO O;  4OX9 O;  1KB9 F;  2R70 A;  3M8A A;  1NTK H;  3SJC C;  4WBN B;  3OMN B;  4FPP A;  5KMG B;  3ZHR A;  3U10 A;  2F95 B;  1AI7 A;  4DR1 O;  1IZ3 A;  1E1R G;  1AR4 A;  2QWO B;  2X6C A;  4ZI7 A;  3OTO B;  4U7N A;  4H0L B;  1B04 A;  4OX9 B;  5AG2 A;  1W0K G;  1W0J G;  3OFN G;  4BIU A;  3ZMS A;  1QR8 A;  1DF5 A;  2AHY A;  2IBZ H;  4FLY A;  2GDS A;  4FK5 C;  2YXL A;  4MTG A;  4DR1 B;  1WB8 A;  1SET A;  2ZM6 O;  4JYA O;  3N27 A;  1Q6H A;  3SPG A;  1IUR A;  5IYC O;  2HR3 A;  4JZG A;  1R6K A;  4F6E A;  4XDK A;  1YXB A;  1FXH A;  1OCZ C;  4UUJ C;  5KHK A;  1DLB A;  2QWN B;  2ZM6 B;  3JD0 A;  4QE7 A;  2CH7 B;  5BY1 A;  4I9W A;  2RQ6 A;  3SPH A;  3OUF A;  1NH2 B;  2CUG A;  1VF6 A;  1SES A;  3AG1 B;  4J10 A;  3JSN A;  2JS3 A;  1WAZ A;  4WF9 V;  4H33 A;  5LHH A;  3CCS V;  1ENV A;  1QHT A;  2KQX A;  2VQF O;  3OR6 C;  2VS0 A;  2DWD C;  3ABL B;  3GWO A;  2EIL B;  1K5S A;  1G6U A;  5DED A;  4LH6 A;  1AP6 A;  1VQP V;  2AW9 A;  2LGW A;  3IFX A;  4EB6 A;  2VQF B;  3HKC A;  2PY5 A;  3H9V A;  3N2K A;  4J7Z A;  2VWK A;  4NTY A;  3U0Z A;  4X20 A;  4XDL A;  2W0X A;  3OT7 A;  1BZK A;  2MW2 B;  5KLV H;  5GW7 A;  4BR6 A;  1PKX A;  1PD3 A;  4R8C A;  3TXS A;  2NLJ C;  3E83 A;  2ZD9 A;  1N0J A;  4O4L A;  5IYZ B;  2M6Y A;  3FX7 A;  1S5J A;  2HJD A;  3LNN A;  3A0R A;  1K97 A;  2QA4 V;  4FM1 A;  3E8F A;  2D2C B;  4PEL A;  3RYI B;  4Q6G A;  2DW4 A;  4NXM O;  2WLH A;  2WLM A;  5J2T B;  1I5Y A;  3N2G A;  1OCC C;  4I55 B;  3CRM A;  3ZMT A;  2P5O A;  1TVK A;  1TGO A;  1OCZ B;  4NXM B;  4JYC A;  4I7Z B;  1FFX A;  2CTP A;  2YXH A;  2H8P C;  3D8C A;  1EFR G;  5JH7 A;  3UO3 A;  3M99 B;  1VQK V;  1Z5W A;  3K06 A;  1N33 O;  3JAL B;  4YJ3 B;  3OAA G;  2PI5 A;  1KKC A;  4JYY A;  4U3J A;  4P2Z A;  4AIL C;  3QF7 A;  2BCC H;  2EIJ C;  2ZR2 A;  3IGA C;  1NKD A;  4KHP O;  3ZED A;  4B08 A;  1N33 B;  3LSS A;  2CTW A;  1YDX A;  5CA1 A;  1XDC A;  2F93 B;  2Q6A A;  4LH7 A;  1TUB A;  2C2A A;  1KEC A;  1URF A;  1R3J C;  4KHP B;  1OJH A;  2JVD A;  2B9Z A;  4JI4 O;  2CGO A;  1BQZ A;  4G28 B;  4ZOL A;  3H1L H;  1W2B U;  2Q68 A;  3KCY A;  2VQE O;  4N21 A;  2K1E A;  5EIB D;  4IIJ B;  5FNV A;  1V9P A;  4FIP C;  4DV5 O;  1VF7 A;  3OEE G;  2ETN A;  4JI4 B;  5F2V O;  4CS4 A;  3D3Q A;  2EJR A;  2CAZ C;  1VF5 B;  1ROP A;  3K59 A;  5L3C A;  2VQE B;  1QBZ A;  3CME V;  4DV5 B;  4GUN A;  4WFA V;  4LNU A;  5IT9 N;  1BQ0 A;  4ZHQ A;  1BCC H;  3H01 A;  4YXW G;  1CPY A;  4Z1V A;  2FB5 A;  2ADQ B;  2Q0O C;  3K0D A;  4UB8 Z;  3E8B A;  3WB1 A;  1QLE C;  2JEX A;  4F4L A;  2H94 A;  1Q6I A;  1OCC B;  4JI6 O;  1IBL O;  1LUV A;  4HNA B;  1AI6 A;  1GN4 A;  2QM4 A;  1YEW A;  3VQW A;  2JJ1 G;  4X64 O;  3OE7 G;  1P7G A;  4O4L B;  1T5E A;  1RPR A;  4J80 A;  2QSA A;  3JAS B;  4JAS A;  4YIO A;  2X0L A;  2WLK A;  4JI6 B;  1IBL B;  1XHX A;  4UCU A;  5H2F Z;  3AK1 A;  1R1B A;  3TET A;  4X64 B;  3HKB A;  4OGQ B;  1D2D A;  4YIP A;  3Q4H B;  5KUK A;  4CH3 A;  3BAB A;  1EZV H;  4LBE C;  1AR5 A;  2EIJ B;  2E76 B;  4U7O A;  2AZ0 A;  2P90 A;  4MTO A;  3RGB A;  4I50 A;  4J11 A;  4WFF A;  2R9R B;  3RT3 C;  4JPR A;  4X8A A;  2IJJ A;  1OHH G;  3CSX A;  4I4T A;  3K5O A;  4GCZ A;  1SQB H;  3TXQ A;  5L3E A;  1YF2 A;  2DOS A;  3CRR A;  5CBG A;  1IXB A;  3HPL C;  2ZDI C;  1FKA O;  2ZNI A;  2UXC O;  4DV7 O;  4GKJ O;  2FKX A;  2GUZ B;  4DXW A;  4K8X A;  2Q7G A;  1BHB A;  2WA4 A;  2AHZ A;  2DYR C;  4UCV A;  2KSD A;  1YSC A;  4GYC B;  4O2B B;  4D7T A;  2UXC B;  4AQY O;  4DV7 B;  4GKJ B;  4DUY O;  3C3S A;  5IY5 C;  4PI2 A;  1H8H G;  2QKC A;  3G67 A;  1IDS A;  1AVM A;  5LOV A;  3K5M A;  2GBO A;  3RYH B;  3ZRW B;  4AQY B;  5GON B;  3SYO A;  4PA7 A;  5CB4 B;  4F6R B;  4X65 O;  1JOY A;  1S5H C;  2IU3 A;  3RYC B;  2N04 A;  1GM9 A;  1QLE B;  1JFF B;  2YI9 A;  1Z5V A;  5JJE B;  2OT5 A;  2RDC A;  4JI7 B;  4IGG A;  3L72 H;  3OUS A;  3IC9 A;  3UT5 B;  1SKV A;  1KBH A;  1JPX A;  3B2E E;  4X65 B;  2Q9L A;  3JD3 A;  5E1A C;  1M57 C;  2ZQM A;  1M56 C;  4K3A A;  3WG7 C;  3ZMV A;  4AI8 A;  1R3I C;  4R7C A;  2PGG A;  4DRX B;  3OMI B;  3E86 A;  4JTD B;  4DW1 A;  1K7D A;  2Q5Z A;  3W7T A;  5EC2 C;  1V54 C;  4BAY A;  1KUQ A;  5JQG B;  4DW0 A;  4EEQ A;  1KQS U; 
#chains in the Genus database with same CATH homology
 3S3W A;  2FB5 A;  2L35 A;  1WP7 A;  2QTS A;  3N27 A;  4NTW A;  4NTY A;  3S3X A;  4FZ0 A;  4NYK A;  4FZ1 A;  1WP8 A;  4NTX A;  3IJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...