3S4SB

Crystal structure of cd4 mutant bound to hla-dr1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
191
structure length
186
Chain Sequence
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 186
sequence length 191
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s4sB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3s4sB01
3QXAB 2HTKC 1P69B 2BSRB 1FZKA 1JUFB 4U1JA 4WWID 2EC9U 4XBGB 4R7NA 4BSWA 2EDWA 3HAEB 3OTTA 5F7WC 3O4LB 3KPOB 1UCBL 3LKOB 4ZUUA 5ISZA 3RWJB 1D3CA 1YEJL 4PJXB 3MRNA 5JXAL 2AW2A 2AK4A 4RCAA 2IQ9H 3S97C 2I07B 3U0TA 2Y07H 3RY6C 5GS0L 1A7RH 1I7UA 1QFOA 1G0XA 3T77B 2R1WB 5D71H 4PJ9C 5A1AA 3KNBA 4J6RL 5F3HA 1EMTL 1NCCH 3IB4A 3BE1L 3QDJB 1B90A 4ZSOA 3MR9B 4YHYB 4HIXH 4JQVA 1D5ZB 3IFNL 1JYNA 3TO4A 3VD4A 1QSEE 2DQCH 3K1KC 1QBML 1T0MB 2C1OB 1R3JB 3L3KB 1SHMA 1KGCE 3HZMB 4KVCL 5I1KL 1EHAA 1BZ7B 1U2CA 3D39E 3B9VA 2V7HA 4L8BB 5EOCH 3GKWL 5ABDE 4GXVL 2HAZA 3LQAC 1J05B 3AUVA 1BJ1J 5BRZA 1U58B 5EO1B 2BHZA 4JR9H 3MJ9H 4XP4H 3TBYA 4YK4C 5HDBF 4X9GA 2QADB 3QIWC 1JJUA 4IBLT 3PJSA 4NPYB 1EEZB 5JPNB 2ADIB 5EUOF 1BD2E 3VFOA 1FGNH 2MPAH 3IDIB 5DHXB 5HHMB 4WU7B 1A7PL 3E0GA 4G8EA 2B4CC 2Z92B 3VXUE 4OCXL 3VFTA 4ONOA 2BERA 3K2UL 4K3JL 2N56A 3TBSB 3GHBH 3PNWB 4PS4H 1A21A 1SBSH 3K0WA 5HI4C 5J56B 1CR9H 5HVWA 4PJ9D 5T1MA 5I18H 1VKXA 3SCMB 3DYPA 3LKNA 4OCWL 4TNVF 3T09A 5DEGB 5J6HA 4NCC2 2AGJH 1WZMA 4I4WB 4RAUB 3EBAA 4ZTPL 1Q72H 5CJQL 5GS1C 4WI4A 3WBDA 3SKJH 2WUCH 4RGOH 4H26A 2VDOH 3T0EC 4QHNB 5IW1A 4YZFE 1BWMA 1FNGB 2A9ML 3UTPE 5GRVK 1E4KC 3F8UB 3L5XL 3DVNB 4FQXC 3QNYA 4KRLB 1O7SA 1AQKL 5E8OA 4AQ1B 3CFDA 3RWFB 1R24B 3I6KA 3G6AA 4G8IA 2ZWLT 1A7NL 3QIWD 1RZFH 2LTQB 1IC7L 2HG5A 3ARPA 3QUKA 2VZVA 1F4YH 3ALWA 3EDJA 3ARDB 3LIZL 3V5KA 1JV5B 4YFLF 3FQTA 5C0DB 4DGIH 3V6ZB 2H6PB 1RU9H 2CH8A 1FH5L 3P4LA 3UJIH 4YBQC 4NQDD 1MVFA 1E4XH 2X1WL 3F7QA 3FB5A 3S37H 3V2AR 3TT1L 1RJLB 4UUJB 1U8JA 1F90H 1WEJL 1L6ZA 1KCUH 3G6DH 5DRNA 3B6SA 4XCFL 3ULVL 3SN6N 3GBML 1HHIA 1HOCA 2K7QA 2BVUA 2KDGA 2C3XA 4P9HH 5KSBA 2W9EH 1J5OH 2OXGA 2OI9B 5C0FB 2D7OA 3T0ED 4JY4A 1V7MH 3EOAB 3SO3B 3VXRA 2MQ0A 3WXVL 1CVSC 3KR3L 4IHOA 1IEAB 3MLYH 4FQXD 5CCKH 2HN7A 5TQ2L 2XY2A 2LU7A 3QISA 4MJ2A 1GZQB 1UACL 2YXMA 2BNQD 4N0CD 1AGCB 4POZC 5FV1L 2CLVB 1FVCA 3BZDA 3SGKA 2V9QA 5CS7A 4IRSD 1T7XA 4WWKB 1UWXH 1MHHB 4DQOH 1T2QH 5F7EH 5BV7B 1U8MA 3HB3C 4LNRB 3MA9H 5CEYB 1P9MA 5D1ZA 5DO2C 4NQVA 5BXFA 4MXQC 3BMWA 3FO0H 2A77L 2OMNA 1UM6L 5GZOC 3WIHL 4G6FD 4XPAH 3ZDZF 4EUPH 1NCWL 3WKML 4CNIA 2IALB 5FUCE 3LN5A 5IB1A 5ADPL 4YBQD 5E2VL 5JW4M 3BKCL 3BJ91 2AEWA 3F5WA 3QRFM 3BKMH 1NUNB 4LKXA 5HHNA 3KG5A 3GSNL 4Y5YB 5FO7B 3DBXA 4M6ML 4XP6L 1AHWC 5DZNA 4QEGA 32C2A 2X09A 3WLWC 1AC0A 2FECL 3EFDL 4KDTC 4M48H 4XVJH 4UQ3A 1MCCA 1FL3A 1BF8A 3H9HB 4CADB 3CMOH 1XR8B 3C5ZC 3O2DH 3VGGA 4JO1H 1NBZB 1I9RL 4FFVD 4WTXA 4POZD 2NLJB 1PLGL 4L8SB 5DSCA 1TCMA 3PWLA 5TE6L 4PRID 4KKLC 3RUGB 2AEIT 4WJ5B 5F9JA 2X1QA 3HB3D 3X3FH 3ZDYF 3FB6A 3GI9L 5DO2D 4HJGA 4MXQD 4O58H 5LGHH 3OF6A 5EB9A 1LWRA 1VFBA 4HH9B 1IAOA 4LHUB 2XNAB 2F53E 3LAFA 3OKMA 2DM4A 4HF5H 1EEYA 1YNTB 2AJVL 1AQDB 4YHNA 4ZD3H 2HJFB 4BZ2H 1MHCB 2WUBH 3LB6C 3N50A 2ZSWA 3AC0A 3CVHB 3K7UA 5SX4I 5ADOL 4BH7A 1WWAX 4MLSA 5INCB 4KKCD 4JVPA 2IMNA 3PHOB 4FXGB 4Q6IC 5JXEA 3MJ8B 5EA0H 2W65B 5IHBA 5DJYA 4X4YB 4M9OA 3PWPA 5BS0D 1T3FA 4KK6C 1FCCA 1P6FA 4R90L 3E8UH 4LARL 1YMMD 3RTQB 1OAXH 2HJLA 1YEFH 3P9WB 4NUJB 4DK3A 5J9PB 1TTUA 3C5ZD 2G5RA 4PJGF 3FJTA 5E9DD 1GAFL 3P11H 5I1AA 1RMFL 2R0WH 3SDDC 4KZEH 3HC3H 5FYKH 1A6PA 4JN2A 4GAGH 3MRJA 1UZ6F 4NQDE 1CBVH 4KKLD 5KAQF 4BQ9A 2UVEA 1ZHKB 4FQCL 2HJKB 4G9FD 5ALCL 4HIHB 1Z6JT 4OV5A 1NGWB 3WO4C 1JYWA 4P2YA 2NY5H 2X1OA 3TYFB 2R0KL 1N5AA 4LPCA 4F9LA 1VDGA 2AABH 4PTUB 3KPSA 2ICCA 4Z0XB 5DJZB 2N7AA 5F8QC 4FMFA 1EVUA 3T0EE 2OTWA 2WP3O 3LB6D 4ODWB 4PJBE 2XZZA 2EXYC 2XWJA 1FN4B 1KC5L 5CD3A 4XNMA 4DGYL 1MEXL 3G6JA 4TSCL 1NDMA 5LWYL 3QPQD 4CGTA 3MLWL 4NN6C 1P1ZA 1SJHB 2QSTA 4MVBC 5FO9A 4ELMB 4X6EB 3REVB 2HRPL 1GH7A 3IXAB 1TQBB 1FNHA 3CGTA 1R3IL 3CZJA 1U3HC 4GO6B 4KK6D 4O2CB 4M43L 2R1YA 1EZVX 4KY1H 3P0VL 2L4OA 1NGXB 2WMPA 2PF6A 1IGMH 1G0DA 4CDGC 1MJ8H 3MBXH 3ULVF 2NNAA 2VDPH 4U1NA 2PW2A 5HGAB 3U30C 5FDWB 3BEVB 3PGDA 2BC4A 3MLXH 4GRLC 1SEBB 1F97A 1D6VL 3GMPB 2P8LB 5FYKU 4PGZA 1BBJA 1OLZA 4L4TE 3MREA 4XMKH 1FG9C 1OWRM 3QCVL 1D5MA 5DK2A 1QRNE 3HNVH 2VLJA 1E27A 4TSBH 3VGEA 2NZIA 2YD1A 1BFOA 2BNRD 3DVGB 4MAUL 5I8OL 1QKZL 4Y5VB 1WVZA 5L88H 3A67H 5JQ6H 4YPJA 1A6AA 4FABL 5MEOA 1U91B 2V5YA 2W59A 2NX5A 4ZXBB 1U8OA 2AJZA 2MQ3A 4XNYH 3GB7A 1HCFX 4QHMB 4Z18A 4YHOL 2YSSA 3BX7C 1YN6A 3BDYL 4NNXA 3PDDA 3IS1X 4GXUN 5TE7H 1U3HD 1T0NB 2A2QT 1UZ8A 3MV7A 3D6GA 4PRIE 2X4UA 2KZWA 1M7DA 4P46C 2ZUUA 1AGFB 4WO4A 5L2KB 1BX2B 4DOHB 1F3JB 5FO8B 4OGXH 4RMUA 2FL5A 4U1GB 3QT2A 1ZLWK 3C6LB 2E6QA 2FD6H 3L5IA 1G6RA 2EKSA 3SDCA 1FSKB 3FQWA 1EX0A 4ZO6A 1C8PA 1E4XI 2XZCH 4GRLD 5HJ3B 4OCRL 3D2UD 2QSCH 3EDFA 1AO7A 2Q20A 4WW2F 2F74A 4FP8H 3D0VA 3OXRB 1MJUH 2G2RA 4NUGL 4P2OC 1KB5B 2VKWA 5T1KD 1EUTA 3G5YA 1QA9A 5GGSY 4R7DA 2ZCKL 1HQ4B 1SM3H 1IKNC 1B0GA 2GFBA 4UV4H 2F5BH 1YMME 4OCYH 3WYRA 1U95B 3PDOB 5EN2B 4F7PA 1PX3A 1W0VB 3F58L 3NMEA 1QLEH 3D5OF 2BCKB 5E9DE 3X3GL 1BAFH 5E99H 3WNNA 1RULL 4F8TA 5I19L 5GGTA 5ID0A 1FZOA 1MAKA 3EZJB 5IIEA 4GG8B 2PUQT 3FFCA 3MCLH 5EU5B 4QF1A 1FL6A 4S1RL 4XNXH 5HDLA 4F37F 4EN3A 2NW2B 2VLKA 4P46D 5F7UA 3QRGL 4AMKL 3B5GA 3IDJB 2NY0C 5IJVB 5J12C 1UH3A 4DKAA 4G9FE 1ZEAL 3UTOA 4OIAA 2MCG1 3BIAX 3QYCA 3AY4C 1S7WA 2BSRA 4RBPH 4NN7C 1JUFA 4L9LB 4XBGA 2UUDK 3HAEA 3IU4L 5IUSA 1YEJH 2IG2H 3O4LA 3KPOA 4WI2A 4TUOB 3LKOA 5BO1L 4A6YH 5JXAH 2OJZL 4K9EC 1RIVH 4P2OD 4PJXA 5GS0H 3BWUC 4MWFB 1CE6A 1T7VA 4K71C 2I07A 4XB8A 1M4KA 1Q8MA 4FTVE 4J6RH 1EMTH 3RNQB 1XF5B 3BE1H 4PD4K 4PJDE 3J7HA 3T77A 2R1WA 1NMCB 3IFNH 4R97B 3B4NA 2E7CA 3QDJA 4C54A 3INUL 3MR9A 2EYRB 1D5ZA 5E7FA 4ONHB 1U2HA 4H1LG 4R26L 2HT4C 1T0MA 4KVCH 4ODUB 2C1OA 1R3JA 3L3KA 5FYJL 5JMOC 2R29L 3HZMA 3MOAH 5D96C 1SY6L 2V2WB 4BA8A 5HHVL 4GXVH 4E0RB 1F3DH 4J2XA 1BZ7A 2EC8A 4L8BA 3HR6A 1J05A 5T3XD 2V9TA 4N68A 1KN4L 1U58A 2E6JA 1AKJB 3HFMH 4JZJA 4ZYKB 3IXTA 2G60L 3PL6C 4ENEC 3PQYD 2BNRE 2APBA 2W0FA 3ILPB 3HE6B 1N6UA 4FFWC 1R5VB 3QDGD 3V9FA 4NPYA 1EEZA 1OW0C 3RVUC 3OAZH 5T33H 5JPNA 2ADIA 1WUNT 1UVQB 1MIEL 2ADGA 4RFNC 3IDIA 1FP5A 5ESQB 1H8NA 3ESVF 4WU7A 4JPIB 2Z92A 1MRDH 2DQGL 1XH3B 2AQ3A 3S36X 4UQ2B 2HMID 3TBSA 3PNWA 1W0WA 4JAMB 4OV6F 4OCWH 3BD4A 5ACLA 3KHQA 5FGBA 1N8ZA 3SCMA 2ICWI 3FQXB 4ZTPH 5DEGA 1HHHB 2AKRB 5CJQH 3UTQB 4I4WA 4PJCB 4RAUA 5FM8A 1NFIB 3WJLC 4MZ3A 4XPHL 2FJGB 1IRAY 1OT1A 3S3SA 1MFBH 3QUYB 2A9MH 3VWJC 4NFBA 4OF3A 4QHNA 5DYOB 3WNKA 4NFCA 4PJFF 1FNGA 1AQKH 5HHPB 2YBRB 3DVNA 3DYOA 4LPXA 5I2IB 3D3VD 5D2LB 4ZAKC 3RWFA 1A7NH 1R24A 4ENED 4ZNCD 1I1YB 3QCUL 3WMSA 4FFWD 1B4RA 2EIEA 3LIZH 3RVUD 4I18C 2CUIA 4S10A 4XC3H 4JRYD 3QWRD 4LVHC 3DWTA 3ARDA 2P4AB 4XBEL 2D9CA 5DMJB 2NW3B 1JV5A 4F9PA 1QFUL 1CICB 2VRAA 4JN1H 5F89B 3VXSB 1CXLA 5C0DA 3UJTL 3V6ZA 3TT1H 4MMZC 2IAND 4M8QB 1GL4B 3HUJF 4N1EA 4XCFH 1JNLL 4UOW0 1RJLA 4UUJA 1PKQB 3CXHJ 3W5MA 2F54D 3ULUC 5K59F 2XTJC 3N9GL 1YPZF 3GJFH 3WXVH 5C0FA 3VWJD 5IFJB 3EOAA 5DEFB 5TQ2H 1NLBL 4PB0L 5TE4H 5L2JB 4QXTB 5D7JC 1UACH 5F6HJ 1B0RB 3O6FC 3EOTL 4V2CB 1T83A 4ZAKD 1GZQA 1AGCA 1DUYB 4P4KC 2CLVA 1NKRA 5T1LD 3VRLE 1RUML 4WWKA 1FG2B 5IVXE 1MHHA 5CD5D 1AJ7L 1I3RB 4NDMA 1FQ9C 2GQHA 4LNRA 4NQEB 5CEYA 3WIHH 4DUXA 3LN4A 1FHGA 4HK0B 1NCWH 2FYYB 2NY3C 4L3CB 3P0GB 1MCNA 1TJGL 5E2VH 1CE1L 3BKCH 3WHE0 2IALA 4HV8B 1TXKA 3V4PL 3NCJH 2CIIB 2F9BT 4YFLI 2P24B 3GSNH 3Q6GH 3ULUD 4HXAL 4XP6H 5FO7A 4Y5YA 2XTJD 3MXWH 4YDLC 5JIKA 5T3XE 5JIHA 5LGJB 2DQEH 2XIDA 3G08A 1YC8A 1EFQA 3QIBB 4IDJH 3STZB 4DK6A 5DVLA 3PQYE 2CDGB 3DSFL 4YFDB 1AXIB 3K74B 3QDGE 3H8NA 4PJ7F 1UH2A 4NKMB 2YK1H 4CADA 5D7JD 1JZ2A 4KMTH 1XR8A 3O6FD 5DUBB 3RWIA 2CKBB 3CFIC 3OKOB 3TH4T 2CLRB 4PR5B 4ZNEA 1PLGH 5I30H 1NBZA 1V05A 3OKDB 4K7FB 4X98B 2NLJA 4L8SA 3LSOB 1N2RB 3VG0L 3RUGA 1CL7L 4WJ5A 4EXPX 3D85B 1S9VA 4M4RA 4HX1B 1IZJA 1UB6B 4I0KA 5HY9B 2NY3D 5ICYB 3OV6A 4YE4L 4HH9A 1GOFA 4LHUA 4UAOC 2AJVH 3U1SL 1CS6A 2XNAA 4M9PA 1JGLH 1WTLA 3MA7B 5ADOH 1YNTA 1TZHB 1AQDA 2HJFA 1MHCA 4CVUA 5F71A 3BYTA 4GG6E 1J1XL 1P4LA 5INCA 4YK4B 5E4IA 3PHOA 3D3VE 4FXGA 3TCXA 5E8PB 3MJ8A 2W65A 3H7BB 1BECA 3QIWB 4RA3A 4R90H 5F97E 4KKAC 4LARH 3RDTC 3BP4B 4X4YA 1J0IA 1X5FA 3W0WD 1F45A 3RKPA 3VWKC 3RTQA 4GUPB 1GAFH 4JRYE 4NUJA 1A64A 2WLYA 1RMFH 5J9PA 2EKJA 1Z5LB 3L6FB 5IMMA 3EGSB 2UWEB 1NGQL 4NQDB 1A4JB 4WI9A 5JOPD 1GC1C 2IANE 3BYYA 1CFSB 3JWOC 3K81A 3SDAC 3LPFA 5ALCH 3ZYJA 1ZHKA 2VH5L 3MQIA 4MSWB 5TFSL 3MROB 3TJEL 4PBWD 2HJKA 2R0KH 5CEZL 2F54E 5DQJB 4HIHA 1NGWA 2FX8H 5GS1B 4RX4D 1AXTL 4RGMC 3OPZH 3TYFA 3V4VL 5ANMB 4OCMC 3T0EB 2FH8A 4PTUA 5IVOA 2F5AL 5BZDB 4Z0XA 4GLRI 5DJZA 1KC5H 1Y0LB 4FQXB 4ODWA 4DGYH 1KENL 5LWYH 4OQTA 1KJ3L 1K5NB 2BNQB 1HI6B 2HRPH 4Y8AA 3UROR 3I6GB 4D9RD 2VDNL 1R3IH 1SJHA 2J6EH 4X6EA 4KKAD 5GJTL 4M43H 4AIZB 4R4BB 1T5WB 1JPTH 4MS8C 1TQCC 5LG1A 4EQ2A 1LO4H 3VWKD 1CLZL 2OX5A 4O2CA 1IBGH 1J87A 4HC1H 2XZAH 4BFEA 2LAAA 1FORH 1NGXA 5FYLD 4KDVA 4NSKB 5I15H 4TPRL 3GSUB 2C3GA 3VE0B 5HGAA 3RZCD 3CDGB 5IVNA 1D6VH 1PFCA 3SDAD 3Q3GB 3BEVA 3N1PC 1MCDA 3BKJL 3GMPA 1BP3B 1RZKC 2P8LA 3QCVH 2RJMA 1PSKL 1JPST 2NPLX 2XTJE 3OKNB 3BSZH 4LL9A 1I1RA 4MAUH 4L8CB 5I8OH 2N7BA 1B2WH 3DTXB 1K2DB 1DUZA 3MV9B 4FABH 3DVGA 4JREC 4LIQL 4Y5VA 4JRXD 1OAQL 2B0SL 4LVEA 1N6QL 1EAJA 5JA9A 1U91A 3QXTA 4YHOH 1CIDA 2HH0L 4ZXBA 1MCLA 3BDYH 4Y2OA 5HBBA 4QHMA 2YPKB 2XA8H 3LS4L 3CH8A 1WCBB 2J8UE 2P43B 4MS8D 3O6KL 2O26U 3MRIB 5F7FA 1T0NA 3CXDH 3E1F1 1WBYB 2KPNA 3K4DA 1C5DB 5GQBA 1JPSL 1AGFA 1A6WL 1BX2A 5L2KA 1F3JA 5FO8A 4QT5B 3PABB 3MOBL 4BQBA 5FA3B 2HYMA 4HLZG 1HINL 1T7ZA 2C4FU 5JW4N 3C6LA 3QXVA 3JV4B 1UB5B 4IOFD 4LCWD 1AI1L 4WUUB 4OCRH 4M62L 2LU3A 5HJ3A 5EH1A 3MTRA 5CZXC 2GW5A 2VZTA 3UTSB 1T80A 3OXRA 4ZUVB 1G9ML 3T2OA 1AHWB 4Q58C 4XCCL 1KB5A 4WTZG 1F42A 3WXWL 5BS0B 5DJ8B 2VUOA 5DJ0B 3W0WE 1HQ4A 5TPWH 1TDQA 3A6CL 3DIFB 1CQKA 3C5ZB 5I8CB 2ICEB 3X3GH 2P48B 4DUWA 2K7PA 1U95A 5EN2A 4KTDL 5EZLB 5I19H 1W0VA 5F7LB 3EYOB 1FO0B 2BCKA 4BSJA 4MMXC 1VHPA 4D3CL 4LDLB 3JVGA 4GG8A 1FIEA 4S1RH 1Q94B 3QHFH 5JOPE 1PG7W 3BO8B 5EU6A 4CU7A 3QRGH 5DS8B 3MRFB 4NZUH 5EU5A 4AMKH 4RWHA 2YRLA 4TN9A 2HKHH 4JFQB 1KT2B 1EJOL 1ZEAH 2NW2A 3LD8C 3DECA 4KQ4H 5BQ7B 5KJRL 3IDJA 5IJVA 1OTUC 1A7QL 2LV4A 5GGVL 1CGUA 4Y16A 3VFSB 4AENB 3CFBB 3TLRA 4RFOL 3L5WB 1XAUA 3IU4H 4XI5C 1A9EA 4PV9B 5SWSD 4L9LA 3EO1A 4GKOA 3WCYA 2OJZH 4P59L 4Z7WF 3CLEL 4OLUL 4TUOA 5CZXD 3U82B 2P47B 1FNFA 5I66B 2X4QB 4W6XB 2B20A 4D9RE 4MWFA 3GRWA 5C07D 3VD3A 2FECI 3K80A 3KYKH 4OJFL 5AZEL 4U31A 3DPBA 1YNLH 2J12B 1DEEB 1XF5A 1NDGB 1WIPA 1PVHA 3INUH 2UV3A 4GQ9L 5FYLE 3PWNB 3SDDB 2EYRA 3P4OB 4D9QD 3BFOA 3VD5A 1HWGB 3KS0H 5FYJH 4ZPVB 4ONHA 2R29H 3LPWA 4LCCC 3SGEI 1SY6H 2HLAA 4ODUA 3HPLB 2R23B 4GAJL 1MF2H 2DM7A 5C08E 4AYFA 4KMLB 2V2WA 4K7PL 4E0RA 4KHXL 3WO4B 2FEDC 1OTUD 5AG8A 1KN4H 5HYEA 1S7RB 1A02N 3IJHB 2J8HA 4WGVB 4HCRA 3TJHD 5K93A 4Q9BA 1AKJA 3WS6C 4XI5D 4P23C 4ZYKA 2ICES 1XF3B 4RGNC 4YBLB 3ILPA 3HE6A 4ZOAA 1HXMB 4JRXE 1R5VA 2JCCF 2MCPH 3GBNL 1UVQA 4NN6B 1P7QB 2BFVL 1HNFA 4QWWD 2X44D 4JPIA 1XH3A 1D5XB 5CGMA 4MJID 2DI8A 4WTWA 2QR0B 4UU9B 4JAMA 2JE8A 3ESUF 1EGJH 1OSZB 4M6AA 2P1YA 2NY7L 4OCSH 4OD1L 3FQXA 1IFHL 3LV3B 5B3JE 3WDIA 1HHHA 1IGFL 4XPHH 6CGTA 2AKRA 3U30B 4BQ8A 3UTQA 4LCWE 4PJCA 1NFIA 3H9YA 5JR1L 4GRLB 1C08B 4P9HC 1A8JH 4HLJA 4LSTL 1MCFA 4EI6B 4X6CE 3QUYA 4JVUA 1FFQA 5FYJU 3IFPA 5DYOA 2FEDD 5T1KB 2ZPKH 5HHPA 2YWZA 1EEUA 5LAXB 4WUKL 3TC9A 1CU4L 3QCUH 5I2IA 3BN9C 4P23D 1OP5K 5KOVC 1LK2B 1EJ6A 3QA3B 1RJCA 4RGND 1I1YA 5DVOA 5EFIB 4ETYA 4X7FC 4XBEH 4OZHF 4FQQB 2WK2A 1J0JA 4GW4B 1JMZA 1JMXA 1QFUH 3DETC 5CGTA 5HHQB 3UJTH 4JO3H 4OZGF 5E6YA 5T3ZL 1FL5B 4D9LL 2NW3A 1IKFL 2DRUA 1CICA 5F89A 4OGAC 3VXSA 4XB7A 5D72L 3H9SE 1JNLH 4P46B 1CD1B 2QHLA 3C2AL 4M8QA 4PIRF 5E8EB 1RI8A 3L95B 2O5YH 3MGOB 3E6HB 4QGTA 4XPBH 2PETA 4OZIE 2PKDA 2OS7A 4NO0D 3CCHB 5CMAB 1PKQA 1SJVA 3N9GH 3CUPB 3NZHL 3GSWB 3ARBD 1MOEA 4Q74A 4WTZA 5SWSE 1JGEB 1NLBH 4KHTL 4PB0H 2VDKL 5IFJA 4HS3B 1C7SA 2YUWA 2J5LC 3EOTH 5L2JA 2DTSA 5HGHB 4QXTA 2XOTA 1BOYA 3FN9A 3HMWL 4RMWA 1N3NB 1RJYB 3ETBF 3EYSL 1B0RA 4PRHD 5C07E 3P4MA 3NH7L 3FZUD 4RIRB 1RUMH 4NRYB 1AGEB 1ES0B 2VISA 5SWZB 3BH8B 3ZO0A 1QYGL 4G8FB 1FG2A 3TN0D 1I3RA 2X10A 1D6EB 2DLIA 3L5JA 1I3UA 5KSAC 4NQEA 5B38B 1N0XL 1I3GL 1CE1H 1KACB 4D9QE 2X70B 4HK0A 3VXME 4RDQF 4L3CA 1QLRA 1UKQA 4X8JB 2EIDA 4XVTH 3DLQR 4HV8A 5D7IE 2NY0B 3T3PE 1MELA 1C16B 3HG1B 1F11B 4KTEL 2CIIA 4HXAH 3EIFA 3ZE1E 2P24A 3IFLL 3JTTB 3UJJL 5AD0B 4NN7B 2H9GA 5LGJA 4RISL 3DSFH 3TT3L 3BT2H 5ETUB 3QIBA 3STZA 1ACYL 5KW9L 1J1OL 1ZGLM 2Z93A 4PJIE 1WCQA 4O2FA 4NKMA 2XRAL 4KI5C 4K71B 3QQNA 4JFXB 5DUBA 3U0PB 4YWGH 3PWVB 5FECB 1DJSA 2CKBA 3OKOA 1IGIL 2CLRA 4K2UL 4JFFB 1ZXQA 3OKDA 4K7FA 2P42B 4X98A 2CKNA 3OGOE 3VG0H 5EORH 1CL7H 4MJIE 5E2UL 5CJ8A 3B8YA 3SO5A 3LSOA 2VOTA 5DQ9B 4NN5C 4YX2H 2R0LH 1YEKL 3D85A 4PLOB 1JIBA 3UYRL 3V6OC 1L0QA 4F2MB 4YE4H 4PYGA 3U1SH 4HX1A 3I84A 1M6OB 4Q2ZB 5JDSB 2R69L 5CP7B 3VMNA 1A3LL 2NZ9C 4I3SL 3MRHB 3MA7A 1TZHA 1XF4A 1QFWM 4QOKD 1N7ML 5C3TA 1FLRH 2HKFH 4ZFFB 1LO0L 4XT1C 3PL6B 1PAMA 3WNOA 2I5YL 4PBVC 1FZMB 5E8PA 4KQ3L 4RGNE 2R15A 2XFXB 3BP4A 1NC4B 2V6HA 1NFDE 4JRYB 4NFDA 5GISL 1ZHLB 4GUPA 4KI5D 4X8XA 1NGQH 4IOSD 4JGUA 4HMDA 3MPCA 5I1CL 4JQXC 3EGSA 2IANB 5FYKD 2UWEA 1WSST 1S7VB 4PD4J 4PJ5D 1IGTB 1DQML 1CFSA 2VH5H 3NCCB 4S11A 5TFSH 4QRPB 3KYOB 3RAJH 2H32H 5CEZH 4JDVB 2XPGB 4NGHL 4MSWA 3MROA 1JK8A 3UXFA 3V4VH 4M93C 4XVUC 4Y5XB 2F5AH 4LCYA 5GS1A 5ANMA 3VWJB 2I27N 1DQDL 2NZ9D 5DF0A 6FABL 5BZDA 4N0YL 1KENH 1MFAL 4PUBL 2AVGA 1Y0LA 1KEMH 2EE9A 3FQNB 3HNSL 1KJ3H 2Z91B 1FC2D 1X5IA 2HT2C 2AJSL 3DI2B 4JCMA 2VDNH 4OZFH 1QLFA 1K5NA 2BNQA 1HI6A 1ZLSL 3I6GA 2XQBL 5CWSB 4QTHB 5EWIH 5T1LB 3VFMB 1CLZH 1YZZA 4AIZA 4R4BA 2AXHA 4I18B 4HMCA 4X6FB 4Y19B 4CMMB 4LVHB 3QXDB 3FN0L 2Y4SA 5L6YL 5AUMB 2EECA 3MBEC 5DD1L 1PY9A 4I3GA 3GSUA 5DMIL 1K8IB 2PYED 3VE0A 5J0BA 4ONFH 3CDGA 3BKJH 4PY8I 1AR1C 4Y4HC 4JZNB 1UT9A 3Q3GA 4LOUC 4NNYB 1RZ8B 4S1QL 3ARZA 3CU7A 5C7XH 3UZEA 5L8JB 4DN4L 3TA3C 1GGYA 4AIOA 1J9CT 5F72S 4LHJB 4U49A 2WQRA 3OKNA 4NKIL 5C09D 2RB8A 4TULH 4L8CA 2FHCA 1T1XB 1OAQH 2B0SH 3DTXA 1K2DA 3G5XB 4ZMAT 1NBVL 2YOCA 4JDZA 4NM4L 3MV9A 1XCTB 3U36B 5D1QC 1S78C 2HH0H 3ILQC 3O6FB 1YNKH 2HT2D 2QHRL 2W9LA 2W1NA 3LS4H 1ZKAA 4P4KB 4KUCF 2J8UB 2JJSC 3NAAL 3LEXB 4HEME 4XNZB 5ILTH 1CDIA 1WCBA 3ZYOA 3MRIA 1P84K 1A6WH 4WY7L 5HHOA 1WBYA 3U7AA 3SDXE 1C5DA 3MOBH 4MAYB 1HINH 2NY3B 2YD2A 3SE8H 1AI1H 4LSQL 3PABA 3B8SA 5FA3A 3F12B 1QTYT 3S7GA 1DBBL 4M62H 5DMGC 4Z77B 4WVRA 5HYJB 3JV4A 1UB5A 3VFUB 5EZIL 1LO3H 4UTAL 4WUUA 3O8XC 4Y4HD 1AR1D 4LOUD 1K3ZA 2MNUA 2VDRL 4QOKE 4XCCH 3KVQA 4YDLB 1G7PB 3UTSA 4QRSB 3WXWH 4ZUVA 5BS0A 4R8WH 4QRQB 5DJ8A 3S4SG 3ZSSA 5DJ0A 5C0IA 3M1BB 2DDQL 1GVIA 3H2WA 4KTDH 5D1QD 3W11C 1S78D 3DIFA 3C5ZA 3ILQD 4X4ME 5I8CA 4U3CA 2ICEA 5EZLA 1IAIL 1CQYA 3EYOA 4BFIA 5MP6L 1FO0A 5IBUG 3LY6A 1GGUA 5FYKE 1UM4H 1ND0B 4Q9RL 1EJOH 4PJ5E 1G9NL 4G7YL 4IJ3B 5DS8A 3MRFA 3VW3L 5KJRH 1A7QH 4JFQA 5GGVH 5HVHB 5MERB 4F15C 1QSFB 5JUEL 3V6OE 4XMPL 5B38G 5BQ7A 2W0KA 1EAPB 4OF0A 5CHNB 2A74B 3OG4B 4HDIB 3VFSA 4M7LL 2AJUL 1M05B 4AENA 3CFBA 1OPGH 5KAQG 2D7PA 4FHBD 3O8XD 4P59H 4K3HA 1AP2B 3CLEH 2CIKB 2BXZA 2R9HC 4PV9A 5C71A 4UNTA 4UIMB 2Q1EA 1GGCL 4XMLH 4XPTL 3QDMD 5HDBE 4P2QD 4WHTB 5I66A 2AERT 1BJ1H 4OJFH 4G9DA 3RDTB 2GJ6D 1MJ7L 4LLQB 3UPRA 4HQQL 4NKQB 4KTYA 3VWKB 3R06B 5EUOE 2OK0L 1WAAA 5GGRB 4ZG1A 3W11D 4GQ9H 2BVTA 1R5WB 1NDGA 5CJXC 3UDWC 2BMKB 4NBYB 2C7UB 2IC2A 3PWNA 3SDDA 2VZUA 3MRCB 3S5LB 4KVNH 3P4OA 1BHGA 3F7PC 2XV6B 4GAJH 2PYEE 1FFPB 1U8QB 3S88L 1QEWB 3BI9X 1IAIM 1CL7I 3HPLA 2R23A 4MA8H 1KELH 3I6LD 1LEGB 4KHXH 3IF1B 1T04B 5GGTL 3RFZC 1CFNB 4HFWB 3QUZB 4YHKL 4RGMB 4BQ6A 4MCYB 5I76B 1S7RA 3L3JA 3IJHA 1DQJB 1GJIA 1OLLA 5C09E 1JZ8A 3GFUA 1FIGL 2J4WL 4YBHA 2R9HD 1XF3A 3D87B 5C0EA 1WK0A 4LPVA 1B4JH 4LMQE 1B3JA 3GBNH 2R0ZL 4S1SH 1HXMA 1P5UA 1CDHA 3K4AA 1BFVH 3KYNB 4JPKH 4UILL 3VD7A 4XNUH 1P7QA 3DVIA 5KS9B 3LVEA 1NCDL 3B9EA 2VZSA 5M7QA 4J3XA 2ZUQC 1D5XA 2MSPA 5JLZB 3WFDH 2QR0A 4UU9A 1V5JA 2NY7H 4OD1H 1MSPA 1IFHH 4R2GC 4O02H 3ZT6A 4IRZH 1OSZA 2FNBA 1Q0XH 5FUOL 4JKWA 3GSXB 4EZMA 4PV8B 4XTRC 1MCOH 3U6RB 3LV3A 3QI9C 5JR1H 2X4SB 2I25N 2ZSVA 2JELL 4LSTH 4L4VD 1HYSC 2B1AH 4GRLA 5A43C 1C08A 4EI6A 3UZVB 5BCAA 1VERA 3VXOB 4PG2C 3S34L 4WUKH 2F8VA 4HZLB 1WIUA 1CU4H 1WC7B 1V3JA 3IS0X 1HSAB 2Q87A 4JPWH 5LAXA 1H15A 1DZBA 1LK2A 2SEBB 4M7JL 3QA3A 4NWUL 4MB3A 5F1NB 1Z9SA 5EFIA 2BSTB 4LBEB 3RVWC 5LQBL 2J2ZA 3G6JF 3OJDA 2FO4B 3SBWC 5T3ZH 4D9LH 5IB4B 4YNYB 1H3XA 2AJ3B 3UTTD 5HHQA 1FL5A 3G9AB 1DFBL 1KYOK 3MV8B 5B39B 1S3KL 5KVFL 4UTBL 3GJEA 1GGIH 2ZP0T 1CD1A 1JNJA 1IC1A 4TNWF 5J4MA 4OZIB 5DTFA 5E8EA 3L95A 4R2GD 1H5BB 1QFPA 3MGOA 3C09C 3EAKA 2PNDA 3NZHH 5HGGS 2XWBB 4JZOB 4XTRD 3CCHA 1S5IL 5CMAA 3QI9D 3HZYB 4HULB 3CUPA 4PG9B 1OWWA 5SWSB 1HYSD 5KVGL 3GSWA 2IBZX 3GUTB 4Z7VF 3H42H 1MI5A 3N85L 3WJJC 1JGEA 1OQXA 2XXMB 3S4SA 4OTXL 5DMKA 5EBLB 5F1SA 1CGSL 1Z3GH 4YUEL 3HMWH 4N9GB 4JDTL 2DI9A 2G5BB 3EYSH 4JPVH 2N1KA 3S37X 5HGHA 1EA9C 2RQ8A 3NH7H 4P2QE 5HGBB 3R8BB 1N3NA 1RJYA 4HIEB 2GJ6E 1RVFH 4X99B 4FQLL 5DK0B 4Y89A 4RIRA 1IKNA 1QYGH 1MRCL 4NRYA 3UP1A 4DKEL 3X17A 1AGEA 2RGSA 1ES0A 3X13B 5SWZA 3RVWD 3BH8A 1CGXA 4G8FA 5FOBA 5EDXA 1N0XH 1I3GH 1PG7L 1RD6A 3EOBB 2A9NL 2E7BA 4P99A 1D6EA 1OM3L 3ZKMD 5B38A 1K4DB 2X70A 3UEZA 1JZ3A 4X8JA 4KTEH 2GK2A 5SX5K 3LD8B 1AD9B 3I6LE 4M5ZL 2W9DL 3IFLH 1T5XB 2ZZUT 4MB5A 1C16A 3HG1A 1F11A 3BVNB 2Q6WB 1S7UB 5IOPB 3AY4A 3JTTA 1Z0MA 5AD0A 5I1GL 5HDQL 3RVTC 1ACYH 2BJML 3NACL 5H37H 2FBJL 2DYPD 5EPMB 5ETUA 5FK9B 4X6BA 5A2KH 2XRAH 1VENA 3IDYC 1OARL 3T0AA 3AU1B 4NCC1 3QDAA 5JORB 4D2NA 4CVXA 5JOFB 4K2UH 1U9KA 3QAZB 3EKCA 5L7XL 4JFXA 3PWVA 5FECA 3MJ6A 5E2UH 1HHKB 4HKXB 4JFFA 3LRGA 1TTGA 3FHAA 3OB0H 3W9EB 4PJGE 5I1HL 3UYRH 3CPLB 4MJ4A 5DQ9A 1WZ1L 1P7KB 1OGAE 3IDGB 3BP6B 2R69H 2A6KB 4F2MA 1MJJB 4OKDA 1A3LH 4L4JA 4LCCB 2UZIL 1M6OA 2EIZB 5AZ2L 2IFGA 4X5LA 5BV7L 1PEZA 2MTPA 2O5XH 3RY4A 1N7MH 3MRHA 1LO0H 3HC4L 1AIFA 2I5YH 1HNGA 1JNNL 1NJ9B 5IB2B 4ZFFA 4UNUA 3G5ZB 4KQ3H 3PL6A 5GRWA 3LMJL 3QUXB 5H35B 3DSNA 1FZMA 4IEFB 1U92A 1NFDB 1SEQH 2E9IA 2XFXA 5FKPB 1OW0A 1NC4A 4UI2A 1ZHLA 5MHSD 1EBPA 3GSQB 1XIWC 4Q7DA 3UTTE 4HK3J 2VC2L 2GIYA 4OI9A 1IT9L 1JRHH 1P2CB 1S7VA 2JB5L 3BH9A 5JHDA 1IGTA 1WF5A 4QRPA 3KYOA 3WFBL 4JDVA 5D6CB 1PDKA 2XPGA 5ITFB 3HI1B 5EOQL 4CW1B 2QJDA 5C0GB 3WJLA 2GYSA 4O5LL 1DQDH 4Y5XA 1JF6A 5FGCE 1T1YB 4N0YH 4QXWA 1MFAH 1MNUL 4PJ8C 3HNSH 4LHQB 1G7LB 2FWOB 4OKVB 3E2HC 3TBVB 3BRDA 1E4WH 3ARWA 2RBLA 4OF8A 3FQNA 2X4TB 4PRHB 1E6OL 3P2TA 5EUKB 2XQBH 4Z78B 2OP4L 1NMAL 1JHTB 5EZOH 3NA9L 5J7CC 1T89A 2E27L 5CWSA 4QTHA 5T1LA 3CVHL 3VFMA 1UEMA 5EU3B 3FN0H 4JM2C 4I18A 1P7HL 1FZJB 5L6YH 3B9DA 4X6FA 4Y19A 4CMMA 3QXDA 1UENA 4N0UB 1XIWD 5AUMA 5GRVL 2E8ZA 4V1DB 4J3SA 4NP4L 3ARUA 1C12B 4LCUB 12E8L 1K8IA 5B8CC 1RK1B 2FX7L 3JUYA 4S1QH 4JZNA 3HN3A 1OY3B 3H3BC 2DMCA 4DN4H 4FZEL 1KJVA 4NNYA 3ISWA 1RZ8A 1YJDC 4YLQT 4IRJB 2DJUA 4E9LA 5HHXL 4C55A 5FHAL 5DD3L 2ED9A 1FFOB 4LLMB 1NBVH 4PJ8D 3L9RB 2OR7A 1T1XA 2J5LB 3G5XA 2QHRH 4Y4FC 2O93L 1XCTA 3U36A 4HBQA 1DL7L 3MRRB 3GSVB 3NAAH 1RURL 1MCQA 4MNGE 2ZCLL 4P4KA 1OP9A 5FFLA 4JM2D 2QKIA 4OQTL 2BSSB 1U3YA 5KSAB 4AEHL 5F7KC 3UCRA 1QNZL 1X5ZA 2HFFB 1KN2L 4MAYA 1DBBH 4UT6H 3NFSH 4NYLB 2AJYL 3F12A 5HYJA 4Z77A 4P2RD 2LU4A 5J89A 4XVSL 3VFUA 4MXVF 4QGYA 2VDRH 1RIHL 1Y6NR 3ROOB 3G04B 1JNHB 1Z0NA 2WWKT 4K55A 5F44A 5DJCB 4R4NC 4QRSA 3IDXH 3UPAA 2J88L 3IVKB 2PO6B 1A3QA 1HHGB 2DDQH 5KVEL 1IC4L 4QRQA 4YHZL 3KGRA 3M1BA 2I26N 2A6IB 2JCCB 3RRQA 3V0WH 2C4XA 1IAIH 2E8YA 5MP6H 1EZVY 4HWBA 4W70A 5MHSE 3MYJB 1CWVA 1RK0A 3U48A 3VFVB 5KG9A 4RAHA 2FX9L 3BQUC 3NFPB 4GSDH 3RWDB 4DVRH 4NQXB 4G7YH 3VW3H 4C83B 1ND0A 4YXLL 4NN5B 5TQ0L 5JUEH 3KPMB 4J4PC 3PHSA 4M7KL 4GRWB 1J0HA 3WNLA 4M7LH 1QSFA 2AJUH 2VXSL 5MERA 4J3UA 2VR5A 2NY6C 3QCTL 1EAPA 3QQ9C 5CHNA 5IQ7L 2A74A 3T4AB 4HDIA 2EDXA 3F7YA 4M00A 1A2YB 1M05A 3O3DB 5GRJH 3O6LL 1DE4B 4WFED 2BNUB 4YEEA 1ED3A 1GGCH 1AP2A 3EYQC 1VEOA 1JZ6A 1AE6H 2DBJA 4UIMA 1INEL 4XPFL 1G6RH 3JWNC 4XPTH 5CUSL 4KV5F 4P3WA 5CKAA 1XZ0B 4R4ND 4GKZB 2QQKL 1MJ7H 4WHTA 2DF3A 1ZOXA 4HQQH 5D70L 2X1PA 4XH2B 5D7SL 2OLDA 3RDTA 2OK0H 5KZCD 4LLQA 4PRNB 3R06A 4NWTH 4UT9L 5GGRA 5CILH 1P6AB 1R5WA 5IFHH 1CDJA 2BMKA 5K9JH 2C7UA 4HWNA 1L0XA 1R0AL 3BQUD 4G6AC 3QHTC 5EU7E 5DD5H 4OLXH 3MRCA 1G7QB 3S5LA 3B5HA 4YHIB 5FYJD 3T0WA 3V4UL 4G8GB 1KEGL 1FFPA 1U8QA 4EDXB 1QEWA 5F9WC 1UM5L 5GGTH 4J4PD 5E2TH 1TETL 1NFKA 1LEGA 4OBRA 4R0LC 3IF1A 4YHKH 1CDBA 4F7MB 1OAZH 1T04A 1NEZB 1CFNA 4HFWA 3QUZA 1OAYH 1MPAH 2NY6D 3QQ9D 4ZPTB 5CGYC 3BD3A 5C09B 5I76A 4MCYA 1FIGH 4L3ED 5E8DL 1DQJA 2J4WH 2H1PL 1YPZA 4R96B 1XGRB 1JI1A 2R0ZH 2YD6A 5F9AC 4PJFE 1KOAA 3BP7A 1NPUA 1YY8B 3UAJC 1CTOA 3ZHDA 4UILH 3QBTB 2UY6A 1X5AA 3HAEH 3QG6B 3KYNA 1YEIL 2R4SL 1NCDH 3Q6FA 2VDLL 4Z8FH 4ODTL 5C2BL 5KS9A 3K46A 1OSPL 3TH2T 4NHCH 4Z7QF 2X89D 3KDMB 2E9WA 5JLZA 5FUOH 4Y0GA 5C92A 3MBEB 1SJXA 4BK5A 4JFHD 4FA8A 4G6AD 1HKFA 2XZQL 4J3TA 2JELH 3GSXA 1EHLL 4PV8A 5E6IC 2X4SA 3CSGA 5JTWA 2RFXB 3HUJE 2YN3A 2WIIA 1IE5A 2FGWL 4Z95H 3S34H 3TA3B 2CRYA 3VXOA 1IAMA 4YAQB 5IF0B 4Y1AA 1X5KA 3MACL 43CAB 5CGYD 1I8IB 3OGCB 1YPZE 2X9XA 1JYVA 4HZLA 2WZPD 1WC7A 1OP3H 4M7JH 1HSAA 1RUQL 3HNTL 4NWUH 2H2SC 2M1KA 4WEMB 2SEBA 5LQBH 1UWGL 3GIVB 4JB9H 4PJ7A 5F1NA 2VXUL 4UT7L 4HCRL 2BSTA 1BFSA 4LBEA 3ZDXF 5H94B 2FO4A 3CH1A 5IB4A 4YNYA 3LRSA 1DFBH 2AJ3A 4ELMF 1IC5H 4PP2A 5B3NA 2V2XB 4ALAH 1Q38A 4UTBH 3OX8B 3OJVC 1X6NA 3MV8A 5B39A 1CXEA 4F7CB 5JW4Q 1YYML 1S5IH 5C0CD 1H5BA 1TMCB 4FFYH 2OR8A 4OM0L 1OOAA 5KVGH 2XWBA 4JZOA 5E6ID 4AEIH 3HZYA 3O8XB 2MOVA 3N85H 4X80H 4WFEE 4PG9A 3ZZ1A 4IMKC 3GUTA 4OTXH 1FNSH 1RIUH 1VA9A 1YC7A 1YEEH 1PEWA 5EBLA 1ZTXL 4U7SA 3QDMB 4N9GA 4P2QB 2G5BA 1RZJL 3I75A 15C8H 3DX7B 5HGBA 1NUDA 2APFA 4EQ3A 2H2SD 2D7TL 4HIEA 4DKEH 2MJWA 2XG5A 4X99A 5DK0A 5KANG 3DHJA 1PG7H 2A9NH 2YD5A 3AS3A 3MUY1 3X13A 1OM3H 3EOBA 1C5CL 1WBXB 1YYLL 4M8VA 4AM0B 1RUAH 2XKNB 4M5YL 1K4DA 5FYJE 1EXUB 1TENA 5IROC 1KCSL 4M5ZH 3RGVD 1P84J 2EDYA 3OSKA 2FGZA 1HKLL 4JG1H 1AD9A 1JE6A 5BVJB 3GO1L 2EDDA 1REIA 1T5XA 3BVNA 3K8MA 2Q6WA 1S7UA 5HDQH 5IOPA 1PYWB 2BJMH 3NACH 2FBJH 4R9HA 5ACZB 2APTA 2ZKHL 1IAKB 4L3EE 4LF3B 1X7QB 2BY2A 1TVBB 3WL9B 4B7IA 4LEXH 4A2MA 1Y18B 5EPMA 1DBML 5FK9A 4Q0XL 1WFTA 3IDNB 1JWSB 3AU1A 5L7XH 3KAAA 3MUHL 1OVZA 5JORA 1JBJA 4O00A 4OZFG 1BEYL 3U79A 1KTLB 5ITBH 1XGQA 5I1HH 1HHKA 2IWGA 4HKXA 4LSUL 5JPMA 1WZ1H 5C0AD 3NBNA 3W9EA 3HI6L 4HJJH 1IAII 4JFHE 3CPLA 1ODAA 3ZT7A 2Q86B 1CG9B 2CK0L 3EDEA 5AYQA 1PW3A 2UZIH 1DCLA 3IDGA 5IHUH 5MEND 4S0TD 2A6KA 3A0OA 5BV7H 4L4VB 1MJJA 1OAKL 4LCCA 4JG0L 2EIZA 5JW5B 2V5RA 3AXLB 4XHQA 2X40A 3AREC 3LEYL 3HC4H 3GSOB 1T4KB 5CBAB 4P5KB 3BUTA 2COQA 3CSPA 3LMJH 3L1OH 4EEEA 3N1FC 1NJ9A 4K8RL 4U1IB 3WS6A 5IB2A 1F00I 3JV6B 2FRGP 3G5ZA 3QUXA 5H35A 5TDNB 1T22B 1RZIB 2V7NB 2FH6A 5FKPA 4DCQB 3TIDB 5BVPH 3U9PL 5KTEH 3QQ4B 1WWWX 4A2LA 2VC2H 3GSQA 3DARA 3DRQB 4PY8J 3NOIA 1IT9H 2MKWA 2ZUQB 3ARTA 2JB5H 1Q0YL 4ELKB 3RJQB 2P7TB 2UYLB 1Q1JL 3WN5C 3OKKB 4R2GB 3WFBH 1I1FB 4YHPB 2CKBL 5EOQH 2CUHA 1RPQA 1UG9A 5TH2B 1EH9A 1MCHA 4PGCA 5C0CE 4CU6A 5CEZD 5E08H 3QI9B 5D6CA 4XCYB 5ITFA 3HI1A 4CW1A 1MNUH 5D7LB 2P5EB 5C0GA 1BJ8A 2Y23A 1T1YA 1XGTB 2QQQA 3DURA 1L7IH 3MXVL 1V3LA 3DXAE 3ARED 4UDUB 4F58L 5I1LB 4X6DE 2EYTB 5C0ND 4PP1C 1G7LA 2FWOA 1E6OH 3TBVA 4Z6AT 5IQ9B 1FBIL 2OP4H 4GBXC 1TNNA 3NA9H 4PRHA 1IL1B 2APXA 2HTLD 1S9YB 4I2XB 4Z78A 4YPGB 2GJZB 3CVHH 4FQIL 5FUZL 1R3HB 2NTSP 3QIUC 4G42B 1JHTA 5CJ5A 3VH8B 3LQAL 3QFJB 1FZJA 1QR1B 3SKMB 1FJ1B 4KMQA 1OTSC 2HA1A 5ERWB 2IPKB 2CUMA 2NXZD 4N0UA 1BLNB 4NQCB 4V1DA 1RUPH 2FX7H 1C12A 5HXMA 1WQVT 1RK1A 4H8WH 1ZVSB 2B4CL 3C09B 3MNZB 2VQ1B 4KROC 5IMLA 4XWGH 5DRWB 4RDQG 5FHAH 4IRJA 1NANI 4FQJL 3WD5L 1WWBX 4NO3B 1ORSB 1FFOA 4YZFF 4LLMA 4U05A 3L9RA 4M1CC 4ZDHB 1CXFA 4NCDA 5T5FL 1DL7H 5D1XC 5DRZB 4GBXD 1PGRB 3L7EB 1RURH 2ZCLH 3PXJA 3VFGL 3DOSA 5D2LF 1MQKH 3MRRA 1LDSA 4HIIB 4JY5L 4DGVL 2GEEA 5C0JA 4C56B 3QIUD 4PRPD 4CVWA 2OR9L 4OQTH 3W9DA 1ZLUK 4AEHH 3SPVB 4OF5A 5C0AE 1I85A 1QNZH 2BSSA 2YXFA 1KN2H 3KXFD 5KSAA 3AMKA 2IH1B 4JVWA 1FCGA 2HFFA 2AJYH 5MENE 2ZG3A 5E5RB 5F6IC 3NGBB 2FEEI 4XVSH 1KB9K 1GXEA 4GAYB 3AB0C 2Q3ZA 4I0PC 4NYLA 1RIHH 3IJSA 4F80A 1N0LA 1QBLL 5JMRA 4KROD 4P5TB 2BVEA 4M02A 4N9OB 1M71B 5E2WH 3ROOA 3G04A 3TZVB 1JNHA 4JFDB 2GAZA 2J88H 1FYTB 1X4YA 1D9KC 1JVKA 3B3IB 1P4IL 3IVKA 2PO6A 4YHZH 4Z7WE 4YHML 4FQPA 1HHGA 5IB3B 4WCYH 3GM0A 3IDYB 3GIZL 4H25B 2YPLD 1A4KB 5GIRA 1UC6A 2JCCA 2A6IA 4IM8A 4W68A 5I8KL 4X9BA 2FX9H 1WICA 1GGBL 3MYJA 3VFVA 2LQRA 2D31A 4Y88A 4YXLH 4ESKA 3NFPA 4NO5B 3ZYIA 3RWDA 1DBJL 4NQXA 1IM9B 4BFBD 4M7KH 2DWDB 3RIFK 1LP9E 3KPMA 3QCTH 2DN7A 5IQ7H 5CEZE 2EO9A 4YC2B 2WINB 1HH9B 2LAGB 3C60D 2CDFB 5FEBA 3QEGL 2DLFL 5EC1B 3D9AL 3PXHA 4I0PD 1A2YA 1DE4A 2R1XB 2BNUA 1I8LA 3M8OL 4D94A 1INEH 5IV2B 2J8OA 4XPFH 4EIZC 5CUSH 2X4PB 4HWUA 4ZS6C 3GK8L 2QQKH 2G9HB 5D70H 5D7SH 1NKOA 1XZ0A 1D9KD 4GKZA 1CT8B 4OI8A 1J8HB 1YEHL 4XH2A 1W72L 5GHWL 4UT9H 1KB5H 2Q7YB 4PRNA 3GMMB 4LFHG 3LKQB 2YD8A 3O3AB 3TCLB 3MJ7B 2I9LB 5KSUB 2IAMD 4ZFOB 4ODXB 1AY1L 3V4UH 5IKCB 2ARJQ 4AZ8A 3Q0HA 1G7QA 4OLVL 4YHIA 3ZKNC 1TETH 3CDFA 4G8GA 5IFAL 4KRPC 4EDXA 2JK5B 5IMKB 3ECBB 1AGDB 5DGQA 3U7YH 3PP4H 2QQNL 5E00B 4F7MA 1NEZA 5E8DH 3NTCL 2H1PH 2KZ1B 4YXKL 2YD4A 4ZPTA 5MI0C 4PLJC 4PJ8B 4WI7A 4W4OA 4Z7VB 4XZUB 4CAGA 4R96A 2Q76B 4LSRL 3E2HB 1XGRA 4D0BB 4NQTA 1YY8A 2W0LA 4ZS6D 1YEIH 4MQXD 2MHAB 2VDLH 2H45A 4ODTH 2G75A 3QG6A 4MNQB 3JXAA 5ISZD 1CGTA 1YECL 4PRPE 4EBQL 3Q5YA 4WHCA 4KXZH 4JM2B 4QHKJ 1JGUL 1LK3L 2AK4D 4OZHE 3KDMA 3GRWH 1ZT7B 4OZGE 3KXFE 3MBEA 1EHLH 2CR3A 5D2NB 5J6GB 4Z0BL 2UWEF 5B8CB 4P2RB 3ELAT 3VGAC 2FGWH 3VFWB 3ZKND 4CL7A 2RFXA 2VERN 4KRPD 4L29A 4NRZB 1LD9B 3MACH 3SJVB 1KPVB 3TA3A 2P5WE 3WLBA 1HEZB 4YAQA 5IF0A 1BVLB 1O5DT 1RUQH 43CAA 3ARSA 1I8IA 1RAMA 4CU8A 3FB7B 1UWGH 3KPRE 2VXUH 4UT7H 4EI5B 2NXYD 4HCRH 4Y4FB 4GKSB 5H37G 4UMGA 2OM5A 4JGJA 5BRZD 4YHLL 1FNLA 3GIVA 2VYRE 4LU5L 5L0QC 2B1HH 4PRBA 2YUZA 4UV7L 1KPRB 3RQ3A 5H94A 2Y06L 5L9DL 1RJZB 3FCTB 2V2XA 3QNZB 4HKJB 3EO0B 3DUUB 4L3AA 4PGEA 5CSBA 2WW8A 2R2BB 4F7CA 4OM0H 5CIPB 5ALBL 4LRIA 2PXYB 5DHYB 2FIKA 2LVCA 3VFPB 1HN1A 5TGBB 3O41B 2FCBA 2FSEB 2Y7QB 3O8XA 1ADQA 1UYWH 4RZCA 2DQJL 1SVCP 1ZTXH 5E7BA 1GCFA 3QQ3B 1RZJH 3MCKB 2LABA 2NCMA 3BEWB 3QDMA 4GRMB 1Q9LB 2ERJC 1ZLWH 1ZT1A 4LASL 4WV1A 5KZCB 4XCEB 2RHEA 3DX7A 3T8XB 3QPXL 2QV2A 4S2SB 3B2VH 5LJYH 1JGVL 2ADFL 1C5CH 4TSAH 4FZ8H 3BQUB 3SGKC 4YR6B 1DR9A 5AYUL 4M5YH 2IADB 3IFOB 5HDOA 2ZJSL 1KCSH 1IGCL 1MRFL 2NY2C 2XA3A 4PJEB 2O5ZL 2XKNA 4BSVB 4MDJB 3RI5K 1P9MC 1EXUA 2DMBA 5I16B 3GO1H 1BGXL 1VACB 4HLZH 3UMTA 4W81A 4PREB 2NY6B 5BVJA 2CSPA 1KJ2L 1TJHH 3VXPB 3CDCA 4YXHL 2I9TB 1PYWA 5ACZA 3O2VL 1V3KA 1IAKA 4LF3A 4DKFL 1X7QA 1DBMH 2C3HA 4Q0XH 3OB8A 1DQQB 1I7TB 5E1HB 4Z7UB 3WL9A 3P9MB 1Y18A 3BZ4A 3IDNA 2B2XL 3WHE1 1MCPL 2P44B 3HHRB 4NT6B 1JWSA 4HWZB 3AS2A 5I17B 1J0KA 5LKNA 1BEYH 3VXRD 5I1IL 5ISZE 5DJ2B 1I7ZA 4LSUH 4AY0A 1KTLA 4H5SA 4MNHB 2UUDH 2AK4E 4MB4A 3HI6H 2IJ0C 3UDWA 5HYSB 3GMRB 2ESVB 4Q97A 4JKLA 2Q86A 1CG9A 1OAKH 1EO8L 4DTGL 4JG0H 3WNPA 1RSFA 5F9WB 2NY2D 4L4VA 4U2ZA 5IR1A 1FDLH 4ZSOE 3LEYH 4LDOB 5DJ6B 4R0LB 3HS0B 2WIMA 5JW5A 1S7QB 2X42A 2W38A 2JTDA 3HC0B 1KCVL 1T4KA 3D69B 5GSVA 4K8RH 5CBAA 4P5KA 4KK5D 2F53D 2H2PC 4ODBD 2M8XA 3FHQA 2BHYA 4ERSL 4U1IA 5I75C 4G7VL 4HUMB 5BRZE 4QRRB 5TDNA 1T22A 1DANU 2CLZB 5T3XL 1RZIA 1I7RB 4X5XB 4DCQA 5K33A 3TIDA 2MMXA 4J1UB 5T1DL 1LO5B 5T3ZE 4N0CC 3T3MF 1J0ZA 1Q0YH 3DRQA 2WBJA 2QSVA 4IRSC 1Q1JH 4K9EL 2DQTL 4PJDF 1WAAF 1S9XA 3MLPA 2DAVA 3L3DA 4ELKA 2CKBH 2P7TA 2UYLA 3FONB 3GSRB 3BPNC 3OKKA 1KTRL 1UXWB 1X4ZA 1I1FA 4AJ0A 4JKPH 1MWAL 4YHPA 3HZKA 5TH2A 5D5MB 3QI9A 4XCYA 2WBKA 5D7LA 2P5EA 4LNVA 1VPOL 4F58H 1OF2B 1XGTA 2X9YA 3VXNB 2B39A 3OF6D 2A1WH 1FBIH 1IMHC 2ZUXA 2EYTA 4KK9D 2H3NB 1FNEB 2OTUA 5IQ9A 4FQIH 2H2PD 5FUZH 3A6OA 3QHZL 1IL1A 4Y4KA 5I8EB 4I2XA 3W81A 1TZGL 4OFKA 4YPGA 2GJZA 1ZLVK 4G42A 3VH8A 4LQFL 4G6KH 5I6XC 4X5WB 3KHOA 2N4IA 2ZG2A 3ZT5A 4APQB 5GRXG 5JXED 3SBWA 3QFJA 2BVOB 2Y36L 1U8IB 1M7IB 3FO1B 2IEPA 4FFVC 4L5FL 5FGRA 1QR1A 3PWPD 1FJ1A 3SKMA 4RMTA 5GS3A 2IPKA 2NY1D 1FPTH 2EDRA 1BLNA 4NQCA 5D7KD 2CJUH 3MLZL 1VSCA 4HEPG 2M26A 3WUWB 4KXZI 3O3UN 3O3EB 3QXWA 1Q9WB 2L0DA 4NO2B 4BQCA 1ZVSA 2VQ1A 3WDJA 2EDTA 5JIPA 3HTLX 4FQJH 3WD5H 5DRWA 1A22B 3IU3B 2VLRB 3HRZA 5IMOB 4GMSL 5F1IB 5T5NF 1ORSA 1CXKA 3WJJA 3AM8A 1DQTA 4L4TD 4ZDHA 5C0BB 4KKCC 1VFOA 1NC2B 3KPSD 5KSBE 3DMMA 2PW1B 5DRZA 4JY5H 3QNXB 1QRND 3MLUL 4DGVH 3VXRE 2CR6A 2NY4B 2OR9H 1DQLL 3CMGA 4HIIA 1P53A 4C56A 1Z9MA 2R2HB 3KWWB 3QJHA 5FXCH 2DKUA 3SPVA 1U8LB 3BJLA 3OZ9L 1NMBL 3WKNA 2IH1A 2CGRH 5GRYA 5E4EC 4HKBB 2XI9A 4JJHA 4BUGA 1S9WB 4WO4C 1QBLH 3DV6A 4EOWL 4GAYA 5ACMA 2GSIB 2AQ2A 4KZDL 2AV1B 3FAXA 4HS6B 2JIXD 4P5TA 4YDKH 1M71A 1U8NB 3STBA 3VRJB 3TZVA 1BQHB 4JFDA 3PP3K 4U1SB 4JFEB 1QP1A 3QO0A 3SOBH 1FYTA 3RGHA 1MCJA 1CK0H 3B3IA 4WFGD 1NCTA 3ULUL 5I8KH 5IB3A 3QULA 1I3VA 2ENSA 1CDGA 1L7TH 4H25A 3TEUA 4Z7NE 1A4KA 2VLJD 3ZL4L 4Z5RB 4FG6C 3QPQC 3W2DH 4Y8DC 3HR5B 1SYVB 1N4XH 3DUHA 3HAEG 1DBJH 1WISA 5FHBL 3RWGB 2APVA 4ZUTB 1MQ8A 2NX5D 2ZOKB 4NO5A 4PJAB 5D9SA 1T03L 1OCWH 1JZ7A 1IM9A 4FOMA 1LP9B 1MCEA 2DWDA 5F96L 3I50H 1EIBA 2DBLH 3QEGH 4PJHB 3D9AH 3NCBB 3MV7D 1HH9A 4E41A 2CDFA 4EN3C 4K23L 1UH4A 2X4RB 3M8OH 4WO4D 5EC1A 1LHZA 5D93C 2X7LB 4F7EB 3AREB 2R1XA 2Z35B 3O6ML 2BK8A 3GK8H 4TQEH 4KJWC 5IV2A 1W2KT 2X4PA 3BGFB 5I1JL 1ORQB 2G9HA 3LHPL 4KJPC 5IBTL 1KTKE 1AO7D 1F58L 1R3LB 1CT8A 3A6BH 1J8HA 4U1LB 1H0DB 3EJZD 4R4FL 1HE7A 1V8HA 2Q7YA 1NGPL 1URLA 2MQCA 3VJ6B 3GMMA 3MNVB 3LCYA 4FG6D 3O3AA 4XX1G 3TCLA 1AY1H 2GUOA 4JM4L 2RCSL 3MJ7A 5EBGA 1F02I 3PWPE 1I4FB 2I9LA 4ZFOA 4ODXA 5D7KE 5IKCA 4PYHA 2VN7A 4FTVD 5IFAH 2BXYA 3WN5B 3VI4F 1K4CA 1MFNA 3RL1B 3FT2B 4HWBL 1FO0H 2JK5A 5IMKA 3ECBA 1AGDA 1BQLL 2FATH 4YXKH 3FFCD 4E41E 2VXVL 2XICA 3GEWB 3U7WL 3VRIB 4EN3D 2VLKD 4LVOC 4Z7VA 1RZGB 4PRDB 3VCLB 3VXQB 3RPIB 2Q76A 4KJWD 4S1DC 4D0BA 2E6PA 4JZJC 3JSSA 3KPSE 2Y25A 4O4YL 5LCVL 4XXCA 4K7PX 2OYPA 1YECH 2MHAA 3QIUB 3O4LD 4KJPD 2QADC 4PRPB 4JO4L 3V52H 4MNQA 1MAJA 1AFVH 4NNPL 3V5HB 4U1KB 1LK3H 2R56L 3T65B 3PUCA 3G6JE 1CCZA 4M1GL 1UJ3C 2DQHL 2JLLA 4QKXB 1TCRB 1ZT7A 4Z0BH 1G7HB 1SMAA 1YQVL 1XT5A 4WW1B 5D2NA 5J6GA 2WLZA 4HGWB 4P3CL 5B8CA 1DBAL 1LNUB 3QDJD 1U6AL 5FYLL 1H3VA 2BRRL 3KPTA 4KROB 3NCFB 4NRZA 25C8H 4LAQL 1LD9A 3SJVA 1KPVA 5B21A 4Q6YA 1GC1L 1N64H 5HYQB 4KC3B 4DWHA 3JWOL 1HEZA 1BVLA 4TOYL 1ZHBB 5C0RL 3LKSB 4K3DL 4YHLH 3FB7A 4LU5H 4WFGE 2XN9A 1E6JL 4EI5A 2YPLB 2E7HA 4LLWB 4X9IA 4S1DD 4GKSA 4Y4FA 5D1XB 1JZ4A 2I60L 3NCYP 2FR4B 4OFYA 2VLJE 2Y06H 5L9DH 4QTIH 1XR9B 1KPRA 1MUJB 2QADD 1CF8L 3QEQB 3PWJB 2LTQC 5I0ZA 3L7FB 4WFHE 4ZQKA 4MJ6A 3FCTA 3PIQB 4N8CL 2NX5E 3QNZA 4HKJA 3D25B 3UO1L 4N0RA 3TBTB 3LDBC 5HHMD 5ALBH 3DUUA 1EFXD 2HRLA 5GJSL 4B5EA 2R2BA 5B4MC 2Y5TB 3U4BH 1ETZB 2PXYA 1T2XA 5DHYA 4NJAL 1X9QA 4U6TA 3MV7E 3VFPA 3AB0B 5EZJB 4EVNB 5TGBA 2YUVA 3O41A 1VEPA 5DT1L 1R5IB 2DQJH 2VKXA 1BVZA 1A7BA 4O9HL 3SCMD 2FSEA 3WE6B 2Y7QA 1F4HA 2GCYA 3QXAA 3ULUF 3H3PL 1H3PL 3QQ3A 3MCKA 1D9KB 4LASH 4WDIB 1X5JA 1ZSDB 1UCBH 3BEWA 3QPXH 1NL0L 4GRMA 1Q9LA 1VGEL 3SO3C 1AO7E 3T1FB 1RZKL 4XCEA 3T8XA 4IMLB 1PX4A 3RWJA 4S2SA 1IGJB 4I0CC 4NQSB 2PTTB 4ZFGL 4KKBD 4E42B 4Y2DB 5IWLC 4CJ1A 5ESVB 2OZ4A 4LAJH 2ZJSH 3BQUA 4F33B 1IGCH 1MRFH 4YR6A 1KLUB 2J8UF 2O5ZH 3V7AG 2IADA 3IFOA 2HMIC 5D6DC 4ORZC 2EEAA 4PJEA 3ARDD 4BSVA 4MDJA 5I16A 1QBMH 1QSEB 2VN4A 2GK0B 3LEVL 5BOPA 3EHBC 5B4MD 3FFCE 4PREA 1WBZB 4JY6B 3O2VH 5I1KH 4DKFH 1KB9J 2VLKE 4GLRH 3VXPA 1NH6A 2I9TA 3D39B 1CDUA 1G1CA 3GKWH 3RKDC 4F7TB 4LLDB 1DQQA 2B2XH 1I7TA 1MCPH 4KDWA 1KF9B 2JJTC 4KPHL 4Z7UA 3P9MA 4H88L 3U46B 5AWNL 4LHUG 5EO1A 1BQHG 1LEKB 4HWZA 5I17A 1ZAGA 3O4LE 1A6ZB 5DJ2A 2Z8WC 2AK4B 1BD2B 3S98A 4PJXE 1EK3A 4MNHA 3R0NA 1A7PH 2D2OA 3U0TB 4OCXH 3K2UH 3VXUB 2HVKB 4K3JH 1S5HB 2H8PB 1EO8H 5HYSA 5J13C 2Y07L 3GMRA 2ESVA 4L8SC 4DJMA 4QHUB 4ZSOB 4KRPB 5D71L 5LGKA 3QDJE 3BUYB 2JKXA 2IBZY 4R0LA 1VFAB 3HS0A 1S7QA 1KCVH 1CDYA 2DQCL 3EHBD 3HC0A 4ETQB 3D69A 4ERSH 4GS7C 3UBXB 4G7VH 1FVDB 2E7LC 3RKDD 3JWDC 3L5XH 5F7MC 2CK2A 5EOCL 5GZND 5A2JH 4QRRA 1I8MB 1TPXB 2CLZA 5HSFA 5T1DH 1I7RA 3CZFB 4X5XA 2FIRT 3MJ9L 2DKMA 4J1UA 1IC7H 4K9EH 4TRPL 3VFOB 3RTQC 4IIQC 1MLBB 3OXSB 4G8EB 1GGTA 1EBAA 1X4XA 5CD5C 1FGNL 3BGAA 5HHME 5DUML 4H8WC 1FNAA 3FONA 3GSRA 3LS5L 1KFAL 1CVRA 1UXWA 4YGAB 4O51B 5JHLL 1FH5H 3BOVA 3PE9A 1JWUB 1ZGLB 1WJ3A 3VGAB 2H6PA 1VPOH 4KI1A 4ORGB 4HMEA 5K9KB 4U1MB 1WEJH 3ULVH 4NC2B 1OF2A 3D0LB 1K3IA 3VXNA 2F8OA 3GBMH 5E2JA 3QHZH 4H26B 2H3NA 3MODL 1Q72L 1KPUB 1FNEA 1TZGH 3SKJL 2ZUSA 4RGOL 3O81A 3KR3H 2PTVA 4CBPA 1IEBB 4WU5B 1AR2A 4LQFH 2DI7A 1H3UA 1KNOB 1WT5C 5L0QB 1IEAA 3I6KB 1WFUA 1JTTA 4TUKL 3SE4A 4L5FH 4X5WA 3RWEB 4APQA 3OWEA 4J23A 2BVOA 1AXSB 1U8IA 1M7IA 1QBBA 3FO1A 2VITB 5DA4A 4X7SL 1PZ5B 5KS9F 3MLZH 1BF2A 2WQ8A 3WEXB 1ACZA 3RTQD 5DFVC 1FYHB 3JUZA 1F4YL 3IRZA 1HK6A 2X4NB 3Q48A 1TNMA 2A77H 1UM6H 2EDOA 1Q9WA 4NO2A 4X7DC 3WKMH 4DGIL 4J12A 1ZE3C 5ADPH 5KOMC 4WFFD 1BFTA 4GMSH 3UJIL 3OKYA 3WHXB 3IU3A 4MXVE 2FO1A 4X6CF 2VLRA 5IMOA 1KCUL 4BZYA 2JJWA 4M6MH 3U4EB 1WZLA 1LILA 2K3TA 2EZ0C 2C3WA 4EKXA 5C0BA 3EUUA 1NC2A 4K94C 1QD0A 2PW1A 1DQLH 3EFDH 3QNXA 1J5OL 4F57L 3R0MA 1NGYB 3M17B 4Y5VC 3KWWA 5IJKC 5MEQB 5CCKL 4JHWL 3H9HA 1FGVL 1A6UL 1I9RH 4WI5A 2W60B 1BQSA 3BHBB 5TF1L 1U8LA 3VGHA 1OB1B 5FCUL 5TE6H 3SGEH 2DQFB 4M61B 4HKBA 4PJ9B 3HA0A 5DFVD 5IROA 5I0DA 4NQVB 3GI9H 3LN9A 1S9WA 4KZDH 1KIUA 3ARXA 2DICA 4OZIF 2GSIA 4CKVX 4CNIB 4U2YA 4YQXL 5CZVL 1KCRL 2AV1A 4OBSA 4XPAL 1JGDB 4HS6A 1VCAA 2F53B 3DVFA 1U8NA 3VRJA 1BQHA 4LKXB 5HHNB 4U1SA 4JFEA 3HI5L 3WV0A 1OD7A 4OZ4B 1A6VL 3ULUH 1II4E 5HI3D 2V17L 4OF6A 3BPLC 3CVHA 4KV5E 3ZL4H 4DN3L 1IJ9A 1BJMA 2EZ0D 3ORJA 1XGPB 5IM7B 1EO5A 1KTDB 4Z5RA 3TF7C 1J86A 2A73B 4CUCA 3HR5A 1SYVA 3IT8D 1RFDL 4M48L 3LKRB 4XVJL 4M3KB 4LSSL 1T03H 4TYUA 3RWGA 3CMOL 4ZUTA 3BZEB 2B8OT 2ZOKA 5DZOA 4PJAA 5F96H 4ZXBD 4ZNEE 3H3KA 5E6ZA 4JO1L 4MX7B 3DRTB 3JVGC 3IAGC 4PJHA 4LEOB 4NBZB 3CD4A 3RUGE 3RZCC 3RBGA 5EO9B 2X4RA 4FMKA 3O6MH 4FQCH 3WDHA 2DQUL 3KLSA 4LRNL 4F7EA 3ZE1F 3AREA 4P5MB 4Y16C 3SGDH 5I1JH 1CTNA 3Q2CA 4ZO7A 2Z35A 3CSBA 4H20L 1I8KB 4I3RL 5IBTH 5JIIA 1INDL 3PF2A 2WV3A 3DYMA 1F58H 1ORQA 3QH3B 4L9LC 5I75B 1FC1A 2DL9A 3FN3A 4DZBB 4GT7A 4PJBB 1TLKA 1R3LA 3SHSA 1NGPH 4NC0B 4OQ1A 4PJIF 1MEXH 4TSCH 4U1LA 1H0DA 1FN4A 3VJ6A 3MLWH 4JM4H 2RCSH 5DJYB 3MNVA 1NQBA 1WITA 4IRSB 1I4FA 4ELMA 2B5IC 2HFEB 3REVA 4Z7QE 4OT1L 3IXAA 3E8UL 3P0VH 4HWBH 2A0LC 3WN5A 3BPNB 1BQLH 3QO1B 2R4RL 2EDFA 3RL1A 3RBSA 3FT2A 4OSUL 2VXVH 4G6FB 3SGJC 1HDMB 1WV7T 3HC3L 5E8NB 3H7LA 5EU6D 1UADC 3MLVL 4WFFE 4IOFC 3VRIA 3CIQA 4YGVB 5C08D 5IW6B 5FDWA 2KQMA 4CRPA 1RZGA 4PRDA 1SEBA 4Y16D 4L4TB 3VCLA 5F9DC 3VXQA 1H3GA 3RPIA 1CFQB 4O4YH 3MO1B 5LCVH 2VB5A 1QRNB 1DLHB 4JO4H 2AABL 2PR4L 4EIGB 1QKZH 2R56H 3QIUA 4NQUA 2VWEC 1AH1A 5A2LH 2ZOLB 3V5HA 4U1KA 4M1GH 1NFDF 3T65A 2DQHH 3EZ8A 4M3JA 1YQVH 4K07A 4HGKC 1G7HA 3P4NB 1NCBL 1DBAH 4WW1A 1NAMB 4PRIB 5GGQL 3OJMB 4HGWA 4MCZB 2A0LD 2BRRH 3MJGX 2QTEA 1LNUA 4LAQH 2Z8VC 4L8DB 3RPKA 2JIXB 1GC1H 5HVGB 3JWOH 2YA2A 2VDPL 1VEMA 4TOYH 1ZA6B 3PHQB 5HYQA 3CLFL 4GAFB 3QUYC 3MLXL 3MREB 1A6TB 1AGBB 1W72B 4DUVA 4NUGH 3RL2B 2YPLA 3W39B 1KLFA 4LLWA 2CRIA 5D1XA 2BVYA 1IGYB 1AKJD 2FR4A 3BGMB 3F6LA 2H26B 3HNVL 1CF8H 1XR9A 2ZCKH 4MDIB 3HE6D 3QEQA 4N8CH 3UO1H 1YMMB 4W6YB 3PWJA 3L7FA 3A67L 5JQ6L 4PGBB 3F58H 3PIQA 5GJSH 3D25A 1UKTA 5E9DB 3AS1A 1RULH 3TBTA 5ECJE 3PDOA 4XNYL 3MX0A 5L8KB 4NJAH 1KXTB 1CICC 5E4EB 3D48R 1JTPA 2Y5TA 1ETZA 5DT1H 1MFEL 1IQWL 1SQ2N 3H9SD 4EVNA 4P49A 3ULSB 5TF0A 1R5IA 5L2KE 4DOHE 3WE6A 4AT6B 4G9FB 4U4BA 3QWOB 5CFHA 3H3PH 1H3PH 1TITA 3RP1A 1S9KC 4C57C 1U0QA 4LKCB 4PGJA 5HPMB 3TJHC 1NL0H 4I13B 2E3VA 4RWYL 3GMNB 1D9KA 1RZKH 4WDIA 3C8KB 2F74B 3QUYD 1ZSDA 5BO1H 4LGRB 4B50A 2GI7A 2CQVA 4NKDB 3T1FA 2ZG1A 4ZFGH 4FP8L 4ZTOL 1MJUL 3WFZA 1IGJA 4NQSA 2PTTA 4Q6IB 2Y9RT 4E42A 4Y2DA 3BXNB 5ESVA 4QWWC 4M6NL 3ARYA 5FF6B 4FTVB 1SM3L 1KLUA 5C3LD 3BRGC 4ZFZB 4PJDB 3OMZA 3RNQA 4OCYL 3BD5A 3CK0L 5EU4B 3MSPA 5DC0A 3K2MC 3LEVH 1QLEL 4QNPF 3DGCR 4LSVL 1DVFC 5E99L 4R26H 3QXUA 1QSEA 2CRZA 1BQUA 1CICD 4RMQA 3VXSD 2GK0A 1FL6B 5EU6E 4QRTB 1I9IL 3VXMD 1IARB 5MEPB 1J1PL 2C1PB 1WBZA 4JY6A 1PG7X 5HHVH 3C8HA 3D39A 4KPHH 3ZKXC 4H88H 3FT3B 2GHWB 5AWNH 4F7TA 1S7WB 4LLDA 4LPYA 5KVMC 3U46A 2G60H 3QIBC 1ADQL 2BNRB 1LEKA 2IG2L 2QBWA 2BVPB 4A6YL 1A6ZA 1Z9LA 1MIEH 1RIVL 1BD2A 1CE6B 4KI5F 1FV1B 1DTUA 2DQGH 3VXUA 2HVKA 1S5HA 2H8PA 5ESQA 5DVKA 5FGSA 1U3HB 1Z9OA 1KXVC 1D5BB 4UQ2A 4G3YL 5JW3L 4QHUA 3CC5B 3V6FB 4BH8B 1MY5A 4NQED 3BUYA 3SDYL 1DVFD 5DHVB 1VFAA 4GRWF 3OAYK 3JBG7 3ARBC 4K8RD 4ETQA 1QOKA 4LVOB 3UBXA 3MOAL 2FJGA 3D2UB 4G43B 2HTKD 1FVDA 3DV4B 5D4QA 3TYGL 4CN4A 4JZJB 5K9QI 3SGDI 3I2CL 5IESL 3IXTB 1G0YR 1I8MA 1SJEB 2YBRA 2W0FB 3HFML 3QIBD 3CZFA 4TRPH 5D2LA 3FFDB 1T2JA 3FZUC 2VWEE 1VGKB 3TWCL 2ADGB 4AG4L 1HH6B 1UJ3B 5DUMH 3VI3F 1MLBA 5T33L 3OXSA 1EFXB 1KFAH 3LS5H 3NIDE 2Y5EA 3TN0C 1G7JB 5JHLH 3BPCB 2C3VB 1W0WB 4I1NB 1MRDL 4O51A 4P3DB 1J88A 1JWUA 3MYZA 1MVUB 1KJ2B 3ARVA 1N8ZB 3NIGE 1ZGLA 1ZT4B 4ORGA 3AVEA 3SE3C 1LMKA 3SQOL 4U1MA 3D85D 5IEHB 5K9KA 2MKLC 4BZ1L 3P0YL 5AAWA 3D0LA 3MODH 3K8LA 4PJCE 3N1MC 1MCIA 2BOCB 1KPUA 3G5VB 5DFTA 3T0DA 3RZWA 1MFBL 1IEBA 3ZE2E 4AEEA 1SMOA 4WU5A 4TUKH 1KNOA 5DEFA 5KSVB 4P2OB 2E5EA 1GYAA 1C1EL 4X7SH 4KRMB 1XF2B 5D2LE 2DQDL 5ENWB 3RWEA 5DJDB 1AXSA 3QUMB 2VITA 1PZ5A 1DUYA 1E0OB 1AJ7H 5IVXB 3WEXA 3LDBB 1GIGL 4XC3L 2BZDA 1WFNA 2X4NA 5EG6C 3MRMB 1PD6A 1TJGH 3VXSE 5HI4D 4JN1L 4YIQB 3NIFF 2DLHA 2FYYA 2XQYK 2JJVA 3V4PH 2X5PA 2VMFA 3O9WC 3WHXA 4WIQA 3TO2B 5J12B 4JKKA 1T21B 3J8F7 1PKQE 5BOZG 2IPTL 3HCVB 3U4EA 1MY7A 1JWMB 4HBCL 4F57H 2AXGB 3PQYB 4CJ0A 1LGVA 3TBWB 5A2IH 2LVEA 3QDGB 1NGYA 4JHWH 1XMWA 3M17A 2CDGA 5EIIB 1FGVH 1A6UH 5TE4L 1B0WA 5FM5O 5MEQA 1P4BL 5TF1H 5FCUH 3V6BR 2W60A 3BPOC 3S8WA 1MWAB 3BHBA 4HUXB 3RY6A 4PR5A 1OB1A 2DQFA 4NDMB 1YN7B 4XXDB 4M61A 3I85A 4PJ9A 3LN4B 2DB8A 3UYOD 1F2XK 2VJXA 4NQEE 1N2RA 2VAAB 4YQXH 1KCRH 5CZVH 1BWWA 1J0YA 3B9KC 1G7IB 4LLUB 1JGDA 1UB6A 5HY9A 3HI5H 2F53A 5ICYA 2NY5C 1L9MA 1A6VH 2K1MA 1G1YA 3O9WD 2QSQA 1Q9OB 5D96B 3KJ4C 5DQDL 3NCJL 2V17H 4JFZL 4OZ4A 1NBYB 4DN3H 2GT9B 2Y6SC 3Q6GL 4GG6B 1J1XH 3UC0L 1DEDA 3G08B 2OJEB 5I1DB 4FQHB 1W0YT 5SX5H 3ROLB 3MXWL 3D3VB 1XGPA 2DQEL 1RFDH 5IM7A 3S35L 1RZ7L 1KTDA 5JO5B 4LSSH 4IDJL 4K3EL 2A73A 4ZOBA 3MV9D 3H7BA 3QIWA 5J06A 3LKRA 4WHDA 3RWIB 3VA6A 2YK1L 3EYUL 3BZEA 4KMTL 4RFNB 5FB8B 2DJSA 3L3OB 4X9FA 5F7DB 5J13B 4H1LB 4UB0L 5SWQB 5I30L 4MX7A 3G9VA 3KPQB 1RUKL 1Z5LA 3L6FA 3DRTA 3KPLB 5E24E 3VDCA 4NQDA 2RAMA 4LEOA 1A4JA 2DQUH 5HHOD 1S9VB 4LRNH 2AK1L 4HUVB 3HKFA 3TJEH 1DN0B 5EO9A 3KPPB 4H20H 5GZOD 2F54B 4I3RH 4P5MA 1JPGB 3ALPA 2FJFB 3B9KD 1AXTH 1I8KA 1INDH 5DQJA 4GS7B 2BDNL 4WUUD 3H6JA 3V0AC 1INQB 4OCNC 3QH3A 3T0EA 1JGLL 4DZBA 3HPJB 1P4LB 2Y6SD 4PJBA 1E4KA 4FQXA 4M03A 4N1CA 3UTSD 4P4RB 4YJZL 4JHAL 3F62A 3WLWD 4ZAKB 3KLDA 5DVMA 4KAQL 5GJTH 2EEBA 1CI5A 4JLRB 4OAWB 4OT1H 4IIQB 1CFTB 4IRSA 2A6JB 1UWEL 5CLTA 3VG9C 2HFEA 2ITCB 2YRZA 1T5WA 2R4RH 3UX9B 3MFGB 5EOTB 5IMMB 4OSUH 3QO1A 3T0VA 4OI7A 4TPRH 4QLRA 5F8RC 3MLVH 3V8CA 4U3HA 3FAWA 3KJ6L 4NSKA 2UWEE 5F7YC 1HDMA 5E8NA 2EH7L 4PRAB 5GGRY 2VO5A 1NBQA 2EDKA 2WSKA 4GRWH 4YGVA 4XNQB 5IW6A 1FRGL 4OFDA 4WHYG 1PSKH 2C4FT 4L4TA 2XTJB 1MFCL 1N26A 1CFQA 3TH3T 2ORBL 1RHFA 2FX8L 3MO1A 2PR4H 4U33A 5ANME 1QRNA 3OPZL 1DLHA 4AK1A 4LIQH 4YBLC 5DI8B 5T5NG 4OD2B 1N6QH 4NJ9L 3IDMB 2ZOLA 5D7JB 1LO2L 4M4PA 3QG7L 2BNQE 1YQ2A 3PV6B 5CSZB 1NCBH 3D18B 3O6KH 2J6EL 5GGQH 2YPKA 1JHKL 1JPTL 3P4NA 3EO9L 5E95B 1NAMA 5K9OB 4PRIA 1LO4L 1JPSH 4MCZA 1IBGL 5DJAB 4HC1L 2XZAL 1FORL 3SDDD 4JQIL 4FFZL 4L8DA 2C5DC 3M07A 4ZFOL 5I15L 1E28B 2JIXA 4TVPL 4QT5A 1ZGLP 1TFHA 3CLFH 3STLB 1ZA6A 3PHQA 1A6TA 1CGWA 4WRLA 1AGBA 1W72A 4ONGL 1G9MH 3HRPA 3RL2A 3W39A 5F3BB 3BSZL 1IGYA 2X6MA 5BMFL 1DUZB 1AHWA 3BGMA 2H26A 3C8DA 7CGTA 5GS0C 1B2WL 2D0GA 4ISVB 1DSFL 4KDTA 3MV9E 4MDIA 1CZ8L 1YEDB 3W0WB 2EXYD 3A6CH 2R2EB 4G6JL 1YMMA 4LPTA 4HJ0C 5CKGA 3DI3B 3FO2B 2M2DA 4PGBA 1P7QD 1HHJB 4MVBD 5E9DA 4D3CH 3FTGB 1MCWW 2XA8L 1MFEH 3F65A 1IQWH 4KRNA 1Q94A 3CXDL 5HHOE 3BO8A 3GHEL 3ULSA 1KT2A 3U9UB 4AT6A 4QYOB 4G9FA 4QHLB 3QWOA 5HTSA 4U6VL 4RFOH 1ONQB 4RWYH 4UAOB 4LKCA 4WUUE 5HPMA 1YEGL 1NAKL 3L5WA 1MFDL 3GMNA 5J3HC 2PYFB 3C8KA 4OLUH 4ZTOH 4ODSL 5IVZB 3BPLB 5M94B 1X5LA 1MHEB 4NKDA