3S4SG

Crystal structure of cd4 mutant bound to hla-dr1
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
178
structure length
176
Chain Sequence
KKVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNYGSFLWKGPSKLNDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEDQKEEVQLLVFGLTANSHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVVLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title Affinity maturation of human CD4 by yeast surface display and crystal structure of a CD4-HLA-DR1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 40
structure length 176
sequence length 178
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF05790 C2-set Immunoglobulin C2-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s4sG01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s4sG02
2UY6A 1KELL 1F11A 5KVDL 1U0QA 4BM7A 3LB6D 3DVNA 4DUXA 5H8DA 4BKLA 1PY4A 2B8OT 1YNTA 3EYVB 4U0RC 4FFVD 1NDGA 3VH8G 1Z3GL 1Y18A 1J7VR 4F9LA 1WTGT 3I6LD 4D9LH 1F4WL 3OJ2C 4YDJB 4I5BA 4X6CB 1KUMA 4OGXH 4P4KD 5D96C 1YEJH 2CIIA 3C8KB 2HWZH 3QNYB 4MZ3A 3PWPD 4NJAL 1WZ1H 2YD1A 2VDNH 4DTGH 5HHXH 1L6XA 3NIFE 4FG6C 1J5OL 4TQEL 4XVTH 3CZFA 3QXDB 4POYA 4YBLC 4X6CE 1PKQB 4TVSa 1XF3A 1L7TH 1DSFH 4I18C 2D0FA 3QNZA 5DD1H 4XNUH 5KSUA 5DEFB 3OKOB 4M02A 3RL2B 2BJMH 3KPPB 1RAMA 5EU3B 1PKQE 3BMWA 5FO8A 1FL6B 1KJVB 4JFDA 3GHBH 5DDHA 1N6QL 1IE5A 5SWZB 1D7FA 2W0PA 5HVHB 1A5FL 1CGSH 1LO0H 2WINB 1YN6B 1G7QA 4U1NB 4Z7VA 2X4UB 3IDYB 4JAMB 2LU3A 3O6FB 1DBBH 4ZS6C 2YRLA 4MWFB 4AM0B 5DMKB 4GRMA 3OJDB 5SWZE 2OJZL 1RZJC 3OF6D 1QBAA 2LTQC 4JPIB 4OGAC 2X1WL 1DQML 1DQQB 1NCUA 3G6DH 3T8XB 1Q94B 3N1MC 4LEXH 4P23A 5D2NA 2UWEF 4TNVF 3DYMA 4YXLH 3WEXB 1E27A 5HHPB 4FQHA 3OKMB 4IMLA 4PTUB 4U1IA 2ADJB 1FLRL 2JCCB 5IMOA 3T2QA 3HE7D 4KVNL 5LWYL 3JUZA 3K8KA 4XRCA 4KJWD 1MFDL 4MAYD 4PJFB 2ZUTA 1LEGA 1LP9A 2DQEH 1R3KB 3WHXA 2NY0C 2JCCE 1N8ZA 4I4WA 1PKOA 5C3LD 4HIIA 4P9HH 2FX7L 3KNBB 2RJMA 3HUJB 4PJFE 4KPHH 1JWSB 3TYGH 1NFDF 5DMYA 1U8IB 3LKRB 2JJVA 4NUJA 4M7LH 3ZKMC 2H8PA 2VQ1A 2DQTL 2EIBA 3RNKA 5DXWA 1I8MA 4NWTH 3GM0A 5GHWL 2HN7B 1OTSC 1YY8B 2NXZD 5DFTA 3SO5A 3HUJE 5BXFB 1TNMA 5I17A 4JRWA 3TO4B 2QQLH 1ED3A 3KLAA 2BY2A 5AD0B 2Y36L 3QHFL 4ONHA 5L0QB 4R26L 3E8UH 4V2BA 3X3FH 4NN5B 4G7VL 1FP5A 2PCPB 1JZ3A 4FNLL 3FT4A 2C3HA 4XAWL 4PJDF 1Q1JH 4J3OC 4PJIF 5IHUL 2ITCA 5IBLD 5SWQA 4JFPA 3RTQD 1WT5A 3AY4A 4HGKC 4PGZA 2VC2H 5CKGA 4WW2C 2XYCA 1MQKH 4JANB 5F88B 4D9LL 1TZIB 4OGXL 3MJ6A 1S9WA 5DD5H 3S5LG 1XCTB 2HWZL 3FZUD 4MZ2A 4GKSB 1ROWA 3DX6B 3SE4A 4DTGL 2VDNL 3MBEC 4HZLA 5I1LB 1L7TL 5FUCE 1DSFL 1L9MA 3BDYH 4G42A 1SBSL 3IXTA 1AGCA 2HFGH 3JTSB 3MO1B 2BJML 5C0BA 1QFOA 3GUTA 1FFQA 1MRCH 4JO1H 3UJJL 3SDAD 1I1YA 3I84A 5GGRB 4GAFB 1CGSL 1LO0L 5L88L 3MLWH 5GGUB 3I02A 1DBBL 1UCTA 2DKSA 2KQMA 2A73B 3QXVA 2BVEA 4P9MH 4JFHD 5F72S 3ULVH 1JI1A 1F42A 1BFOB 5C0AD 3SJVD 3MRIA 3P0GB 3V7AG 1QVOA 3TBYB 2VXVH 1WBZB 4LEXL 2E5EA 1ES0B 1RPQA 1S8DB 4JQVC 4NJ9H 4B41A 5C09A 4H26A 3U48A 4YXLL 1R3JB 3WNOA 5HYQB 4NT6B 3MV9B 5ALCH 4N0UE 3NTCH 4WW1A 1EDQA 2WUCH 1AC0A 3MFGB 5IQ9A 2C4FT 1ZT4B 3MLUL 2CH8A 4JO2H 1UZ6E 4XWOC 4P2OA 2WV3A 4OBSA 1JHTB 3KPSB 3PHOB 3OJMB 5CSBA 1UCBH 5DYOA 1O7VA 3ARFB 4U1MB 1HWHB 2H6PA 5IW1A 5CGTA 4P9HL 4BQCA 2VDKH 2ZZUT 1CDBA 4KPHL 3PGCB 2ZNWA 3KPSE 3BRGC 4XH2A 1F45A 2YC1A 5DEZA 4M7LL 5F6HI 1DN0B 4X99B 4LNRA 1SYVB 1MCHA 1S5IH 2B1HH 5C9JB 2X6MA 4PRAA 3JV6B 3V8OA 2OR7A 2EDBA 1XCQB 4XI5D 1DEDA 3S37X 1N2RA 1T21B 5F1IB 4PJHB 2QQLL 4TN9A 5LKNA 3GRWH 1CDCA 3GKZA 1MHCB 3X3FL 2OL3B 3MOAH 1U6AL 4YHIB 5D7IB 4H0HB 1MWAA 1Q1JL 4L29B 1YJDL 2DLIA 3CXDH 3BEWB 1JGEB 4PJHE 1ZVYA 3I6KB 2FRGP 4JG1H 2FD6L 1J88A 2NX5B 5EBGA 3MRCA 4J7RA 1MQKL 5I8KL 1ONQA 1UB6B 3V4PH 5DD5L 2MFNA 5IP4A 4FRWA 2DQJH 4M4PA 2NX5E 3SDDD 1UH2A 2RFXA 1P6AB 5CMAA 2EDHA 4YO0A 5E6ID 4EUPG 3DV6A 4XCNA 4C83B 3MJ9H 4D0CB 2PYED 3RWGB 1S3KH 5KBNC 4P5MB 4MLSA 5E5UB 3NGBC 5E95B 2HFGL 4HWUA 1C7SA 2AI0L 3DI3B 4WNQA 1AD0A 4IS6B 2WW8A 2P8MB 3EDKA 3GGWB 3MGTB 4JO1L 5F7HA 1EPFA 3G6AA 3H9HA 1H8OA 4HJGA 1A7RH 2FJFA 3NIFF 4QRSB 4ZPVB 1S7SB 4JZNB 4EQ2A 3MLWL 1AHWC 3TYFA 2GFBA 1JNLH 2VN4A 1ZWIB 1LMKA 4MLIA 4P9ML 1N7ML 4CU7A 5I1GH 3ULVL 1RUQL 1DUYA 1OT2A 5F7WC 3LKNA 5JXEC 5DD0H 5DURB 5CD5D 4O9HH 3U46A 3EJYD 4HGWB 4PRIB 2VXVL 4J8RB 4Z7QE 1XGUA 3DUSB 4NJ9L 1NLBL 2X1PA 2IAMB 3EOYG 2OR8A 2APTA 4LHUG 2PR4H 3U7WL 5ALCL 1MCWM 5HY9B 5I18H 1HYSC 3IFPB 3NTCL 3VFNA 3VE0B 2DQGH 4PRIE 2WUCL 3PL6A 5CZKA 3FB8B 5EBWB 3OGCA 3QIUD 3MOBL 2NY6B 4JO2L 5EOCJ 4WU5A 4KDWA 3S98A 3BDBA 2EE3A 5EPMA 3RDTD 5DO2D 3W11C 1UCBL 3IDIA 3IJYA 1QA9A 1MCNA 5B38B 4TSAL 1DBMH 4YXHH 3VXMD 4GG8B 2P45B 3T0BA 4LVNC 4O2CA 5JXAH 1B6DA 5IB4B 4LKCA 1QO3A 2G5BB 2CKBH 3FT3A 5CEYB 2FECI 1S5IL 2B1HL 1ZT7A 1A3RH 3ARYA 3O41A 5D96B 3EW3B 3OXSA 1OF2B 5CEXB 4PGCB 2JCCF 4X5WA 1I1AC 2P5WB 4NO2A 1MHPL 5HGHB 5EBLB 3AMLA 3T4AB 2IPTL 3GRWL 1KXVC 3D2UD 1I8LA 2C4XA 1XR8B 1GIGL 2IPKA 3ZKXB 3DGGA 5GJTH 4PJFF 2JIXB 4I18B 1HHIA 1T80A 5IB1A 3MJ7B 1E4WH 4NKQB 3G5VB 4NZRH 4PJ9C 2P5WE 4MJ4A 2E7MA 2Z4QB 3KYMB 2P24A 2YEZB 3I2CH 3EJZD 1QYGH 4I0PB 4MCZB 1U2HA 4JG1L 4DOHB 3T0VA 5DQJA 5IUSA 1FGVH 1PG7H 1T1ZA 4EVNA 1KPVB 3WFHA 3S97C 5EOTA 5IVZB 3QWRD 4M5ZH 4G6AC 4FA8A 4LGSB 5EIIB 4K7PY 3PV6B 4J3XA 5BS0D 4LSRH 4G8GB 1SBBA 4NQCB 3QYCA 1Q9WA 3IJSB 5LGKA 4ZXBC 3ALPA 4JDVB 1PY9A 4Y5VA 2XWJB 4N1CA 4RAHA 3MJ9L 4OUUB 1KCKA 2XWBA 4U1HB 3MRHA 5D1QC 4J3VA 4LLUA 3O9WB 2BVPA 4G8GE 1IEHA 4NQCE 1T2JA 3RL1B 5FYLE 1OAKH 4M93C 4HDIA 3STZA 1R5VB 4H5SB 4MDJB 1VGEH 2I24N 1A7RL 2XG4A 4TTDC 1IAIM 5IF0A 1JZ8A 1AKJB 4PS4H 1JNLL 3RVTC 4LP5A 2ATPB 1RZ8A 5I1GL 1U8PB 2Y06H 2DQDH 1I7UB 2NY0B 2HT3C 4E42B 5AAMA 5CIPA 1Z6JT 3J7HA 1NANH 1T6WA 3IGAB 4O9HL 3Q5YA 4EJ1C 1SEBB 3LCYA 4MD0B 4U3HA 1BOGB 3TBWA 3T09A 4P57B 3STLB 2D4FA 2PR4L 4BSVA 2NY1C 3SQOH 3TV3L 5GJSL 4P48A 2DQGL 2IBBA 3MV7A 4KRLB 5F9AC 4ZUTA 2WP3T 1K8IA 3V5DA 5IGXL 4P2QB 4M7ZC 3VCLA 4RNRA 2EE6A 3QFJA 5FM4A 2JJWA 4UDTB 2YD6A 4O51B 5GRVK 5HHMB 5T1LB 4JO3H 3KDMB 1LO4H 4NRYB 3ROLA 5J1AA 1DBML 3DARA 4YXHL 4KRPC 1ZT1B 5FV2A 4P2QE 3NAAH 2I25N 4DFIA 4G43B 4U6HB 1EEUA 1OAZH 3KPMA 1WBYB 4I3SH 5HHME 2WQ8A 1HHGB 4RX4A 2CKBL 3BKYH 4WW2B 1I8KB 3PABA 2WK2A 3GMMB 1A3RL 1UZ6F 3O4LD 5CCKL 2CXGA 1YNTB 4O5LH 1NDGB 2HT2D 2GSGA 1NCBH 2CKNA 1G6VK 3SOBL 4L8DB 2MWCA 3T77A 2V7NA 3HNVH 3MBEB 3JVGC 2F8OA 1EMTH 2CIIB 5C2UB 5GJTL 4AZ8A 4NZRL 2CLVA 5F71A 3ARDC 4OZGB 3CZFB 4PY8I 3I2CL 5F7LB 1XF3B 2V7HA 4GRLD 3TFKC 1NCAL 2R2EA 4HKJB 5HPMB 3IDGA 4GLRI 3MLZL 1D6EA 1FGVL 1PG7L 3BHBA 5EIQA 5FYKE 3HZVA 2D0GA 1AGFA 1GXEA 4OZGE 2GCYB 4RQQA 3ELAT 4M5ZL 5FO8B 3FQXA 2DIAA 1I3RB 4QT5B 1NC4D 4OKVB 5HGBA 3UMTA 4AIOA 1G7QB 4Z7VB 3EYUL 4JCMA 4YHNA 2VXUH 2BHZA 4PJHF 4AYFA 2EC9U 4L3EB 2HJFB 3VXUB 1ZV5A 5IV2B 1GOFA 1I3UA 4LGRB 4P5KB 3PGDA 1ACZA 4QRPB 4O2EA 4WI7A 5D7IF 4PFEA 2ZSWB 4CN4A 4LLQA 3TM6A 3WD5H 4Z7VE 1ETZA 5J3HC 2DOCA 5KN5A 4TVPE 2R29H 3WFDH 4L3EE 3VXUE 1FPTL 1OAKL 1OGAA 3K4AA 3SDCD 5K9OA 3LS5H 1L4IA 1A9BB 1RK1B 4QRPE 5FYJH 5E8OB 1VGEL 4NPYB 4P23B 1JWUA 5D2NB 4MS8C 1L0QA 4RGOH 3HZYB 3UBXI 4FQHB 4IMLB 4PS4L 3WYRA 2V9TA 3F7RA 3SDYH 4HWNA 2BY3A 3MQIA 3FCTA 3DTXA 3M1BB 1I1FB 4GQ9H 1H0DA 3LQAL 3BSZH 4NZTL 5D2NE 4XRCB 2DQUH 3UBXB 2HKHL 4JM2A 2BVUA 2NTSP 2OZ4A 3CC5B 1LEGB 4N0YL 4NQSA 3WHXB 1FZOB 2A9NH 3QHZH 1QBMH 3MCG1 3KYKH 5EA0L 1P7KB 2ZKHL 3NABH 3MRQB 1CLOH 3KR3H 5IJKC 4JR9H 4OF0A 4KZEH 2AK4D 1JWMA 2UVFA 2IMNA 1KB5H 1RZKC 2R0ZH 1S9YB 3B2UD 1CBVH 2BOBB 2ICEA 2HA1A 2X89A 3N1GC 2NYYC 4Z7QF 1LO4L 4ZUWA 1RK0B 4MJ2A 1ED3B 5L2KD 3VGEA 3KLAB 4RDQG 5KVEH 4LKXA 3FO0H 5CD3A 4N0FA 4HFWA 1BQHA 2FBOJ 1FO0L 1JN6A 5C0FB 3FT4B 4IHOA 1OAZL 1PZ5A 4I3SL 3CK0H 5HPOA 5IQ7H 2NY7H 1K5NB 1UG9A 3QG6B 1U8MA 4O5LL 3ZO0A 2YD5A 2X41A 2K1MA 4XPHH 2VLKD 4CKVX 5JZ7D 3FRUA 3BZFA 3O0RH 1EMTL 5SWSA 5ERWA 1OT1A 3L1OH 5CWSA 3M45A 5GSVA 4YPJA 5ELIA 4NHUB 3AAZB 4YBQD 4HZLB 4ZOAA 2EDQA 3LB6C 1CK0L 2DM3A 3CFKA 1NH6A 3SKNA 3GM8A 1JPSH 3V5HA 4F58H 1L0YA 2CQVA 4P4KC 43CAB 1MFNA 2EH8H 3LEXB 3CFBA 3EZ8A 4LCIH 4WFHE 1MCLA 4HUMB 3SCMA 3CSBA 1RURH 1KGCE 3U2SB 2VXUL 2R39A 5SX4H 3I02B 5JDSA 4WENB 4K7PX 5ACLA 1V5JA 2QLVB 5FCUH 4ERSH 4XNYH 2LQRA 2W91A 5GGQH 3L3JB 3BEVB 1RZGA 3WD5L 5GGSA 4F8TA 5KSBA 5KANG 5JDJA 1JP5A 2R29L 3WFDL 4ONGH 4LK4A 2BVQB 3IKCA 3O4OC 3LS5L 1A7NH 4P59H 4MNQA 1LNUB 3RWDB 5C92A 2P5ED 5FYJL 2ERJC 2XOTA 2Z8VC 3EYSH 5ANMA 1G7JA 1NBZB 4RGOL 3LQMA 3SDYL 3K8MA 5I8EA 4YUEL 3UO1H 2PETA 2A6KA 4GQ9L 1NDMA 3BSZL 3VXSD 3O2WH 5E08H 3P77B 5IQ9B 1T20B 3RJQB 1EH9A 4PGEA 1A2YA 2IWGA 4P2OB 3RVUD 4LVNB 1CFTA 2RCSH 3AU1B 4KROD 2A9NL 4Q7DA 4WI6A 1UWGH 1QBML 4PRHD 3KYKL 1T1WB 1TXKA 1G0DA 4KKAC 2EDOA 1CGVA 2P49B 5H2BB 3PIQB 4KUZH 1CLOL 2QSCH 3KR3L 1Q38A 2X1QA 2BMKB 1KB9J 4JR9L 5MENA 3C6LC 4KZEL 2J8UF 5ADOH 4L9DA 3HE7C 3PWJA 5GS2H 4NGHH 5L9DH 3TH4T 1KB5L 1I1AB 2R0ZL 5DRXA 2IBGA 4KJWC 1JCKA 2J3SA 3DX9A 4MAYC 2XXMB 4MHHI 3MFFB 4FXKA 1N6VA 3ZTJH 4NO3A 4U3CA 4AQ1B 3HRZA 4QRQB 2KZ1B 5HHOA 3F7QA 4UMGA 1KCRL 5KVEL 2DWEB 3FO0L 4BZ2H 2E6JA 3E0GA 3HB3C 4JRXA 2AJ3B 1ITBB 4GS7C 3CK0L 3I3EA 5IQ7L 4HUWA 3REWB 1W0VA 1A3QA 4X9IA 2ORBH 2NY2D 1EAPA 1UC6A 2VDPH 3P9MB 3VGGA 1MIEL 4XPHL 5HI5D 1A47A 1NBVH 1GZQA 3O0RL 4ZXBB 1AI1H 1ZA6A 2VR5A 2EDYA 2RB8A 3KXFA 1CQKA 2VDQH 5KOMC 4YO0B 3BJ91 3DV6B 4XCNB 5ISZD 2BERA 1JPSL 3LQZB 3RBGA 3QJHB 4WNQB 2D7QA 1NMBH 2WWKT 3OXRA 2EH8L 4WW2F 2CPCA 4Y4FA 4LCIL 3U82B 1ZVSB 3G6AB 3B8YA 2BSTA 3H9HB 3KPTA 2QSTA 3S35L 1AY1H 4LNVA 1RURL 2PF6A 5LJYH 1IM9B 3REVA 2GFBB 2EIZB 2X2YA 3VU2A 4YDLC 3UTSB 4LLVB 4HC1A 2QADD 4MJ6A 5FCSH 2Q8BH 5FCUL 4ERSL 4XNYL 4ORGB 4NN6C 4OT1H 1X4ZA 5GGQL 4HK3N 3MV01 3A6BH 1DUYB 1SY6A 5EZOL 2JKXA 5IIEA 1QSFA 5AZ2H 3VH8A 3MRDB 2IJ0C 4OQTA 3TN0A 2X9YA 3UTSE 4P59L 2NY1B 4IRSA 4EOWH 3IDUA 2ZNXA 1A8JH 3EYSL 2FIRT 2AJSH 2F5BH 3T0AA 2EXYC 3PP3H 5HDLA 4XCYB 3MR9A 5E1HB 3UO1L 1H8NA 3O2WL 4C58B 1BP3B 5JHDA 4Z7VF 3R4DA 4YC2C 4KRPB 4XP4H 4XPGH 4ODUB 1E4JA 4HV8B 3IDIB 2EEBA 3IJYB 1UWGL 1QA9B 2YA0A 5F7NC 1GJIA 3IXAA 3EHBD 1FNGA 4KUZL 3WFBH 1FG9C 4BQ6A 2QSCL 4O2CB 5ID1A 1R5IB 1IKFH 3JUYA 2I60L 5ADOL 2HP4A 3PP3K 4LKCB 1U92A 1E4KC 1QO3B 3QXUA 5L9DL 4X7EC 3ZDXF 5INCB 1XGRA 1FNFA 4P49A 4TUKH 3B9KC 4KMLB 1K8DA 2VL5B 1NCCL 3OXSB 5BV7L 3IDJB 1K2DB 1B88A 5HI3C 4X5WB 4JKKA 4Z0XA 4XAKE 1QACA 4NRXA 2VQTA 4QY8B 3ARDB 1LQSR 4PP2B 3H9SA 3O3BB 4KUCF 2IPKB 1FL3B 1HHIB 5IB1B 4KH2A 1U93B 5ITBL 5FGCB 3KLDA 4WRLA 3VI3E 1Q9OA 1MJ8H 2KZWA 4LPVA 3WFCH 3O3DB 3SGKC 3OB8A 2O5ZH 3GMQA 4GBXC 2VDPL 4AEIH 1BVLB 4ENEC 3L3OA 5FGCE 3UYOD 3WKML 3WUZA 2QL1A 2ICES 1DVFA 3M17A 4C56D 5EOTB 1AI1L 3U4BH 4OF6A 3KPNA 4M7JL 4JGUA 3HI1A 4NHCH 4P0DA 2VDQL 1ZOXA 3QIWC 4ELKA 4M6OH 1X44A 2ADIB 5BOZG 5ESAA 2V2TB 1CIUA 4HKZA 4F33B 4NBXB 3MRHB 4GW5B 3P30L 1UYWH 3V0VA 2XTJD 2CMRH 3KS0H 4MNGA 3DVFA 1I9IH 3NPZB 3IU3B 3S3SA 1AY1L 1IC1A 1QR1A 1FGNL 1F3DH 1R3HB 5HVGB 4JZJA 1MUJA 2YPLB 3CXHJ 1ORQA 4HQQH 5IJVB 2Q8BL 1B4JL 4G6FD 4MB5A 4XNXH 4P9HC 4OT1L 1EHNA 3DRTA 3ARGC 3X12B 1KLGB 2CO6B 3LN5A 5AZ2L 3WLWC 1FNSH 2Z0BA 5CIPB 1CCZA 4QHKJ 1U3YA 2YPLE 1RU9H 4EIGB 3H9YA 1HE7A 5C70A 1EFXD 1T7XA 3S5LA 4JRYA 1MOEA 4TNVK 4ZO8A 2F5BL 3EO0A 2NW2A 1CE6B 1C5BL 3W39A 3ILQC 4QXWA 3C60D 2C3XA 3FN9A 3HMXA 5FXCH 4EN3A 1KTDB 4Y4HA 3RWJB 3MLYH 4ZUTB 5GZND 2YN3A 1K8IB 1DP0A 3BD4A 4QCIA 3CVHB 1S7UA 5CD5C 2NY3C 4OB5L 4RNRB 5J6HA 1FSKC 3GSNB 4XP4L 4XPGL 5FM8A 4LPWA 1N3NA 4APQD 2OI9C 3QISA 3CLFH 4RGND 4BZYA 1YMMA 4JPVL 2DLFH 4P5TA 1PLGH 3WFBL 5L6YL 5E99H 1QOKA 2HJLA 4ZFGH 3I9GH 4JQVA 4WDIB 1OD9A 4KRMB 5B39B 4J4PA 2LU4A 4W6WB 1X5GA 1FRGH 4N9OB 4PUBH 4P2YA 5E9DD 1U3JA 4XBGA 2X1OA 1IQDA 3CVIL 2B4CH 2FWOA 5GIRA 1AC6A 1WWBX 1BQLH 4DW2L 2OX5A 5ESVA 2V7NB 3TNMA 4N0RA 4OV5A 3U4EB 3GSWA 3FQWB 1RIHH 1QLFB 4KK5C 4I13B 4L9LA 2CXKA 4ZTOL 4L4TD 6CGTA 1NPUA 2CLVB 4JDTH 2FR4B 3BN3B 4P46D 1MJ8L 1MFCH 4HJ0C 4A6YA 2R2EB 4HIEA 3MRKB 4AEIL 2Q20A 3OMZA 3NBNA 2VLRA 2YR3A 3BHBB 4MNHA 2KDGA 3ULVC 3FAXA 3HZVB 1C5CH 2AABH 5E2UH 2EXWD 4RQQB 4Y5YA 1ZEAL 3MLXH 7CGTA 2EEAA 2V2XB 5DEGB 1UVQA 4U4BA 4N1EA 4M6OL 3QEHA 5DUPH 1I4FB 3PGDB 3LN4A 1E0OB 1J05A 2Y23A 5HJ3A 2J6EH 4O2EB 4MVBD 3O4OB 4PJ8A 2X05A 2C26A 5I9QB 5DZNA 5A40E 5DK0A 2CMRL 3BE1L 1I9IL 1OGAB 4POZC 1F8TH 4FABH 1MCQA 2YD4A 1OAYH 3EFFA 2WWKO 4GW4A 2W65B 5CJXC 3G5XA 3KHQA 1IGJA 4NQDD 5FUOL 1XF2A 4HQQL 4XNXL 4LOUC 1GAFH 3KYOA 3T1FA 5FECB 5T1DL 1BJ1H 3S6CA 5AG8A 3HI6H 2EC8A 3WS6C 1FNSL 1U41A 2Y07L 3QUXD 3VFVB 4JM2B 4Y1AA 2FO4A 2OTPA 4M00A 4KI5D 5F89B 4O02H 4IOIB 3IU4H 3TVMA 4HULB 1QG3A 3C6LB 4Q74A 4ISVA 4P2RB 4XNZC 4H20H 3VWKD 1VACA 2GEEA 5BW7C 4D0BA 1AXIB 4EUPA 1OD7A 5E2TH 1M7DA 2W07A 5KSAD 3MLYL 4X9BA 2W9EH 1CICD 1JWMB 2ED8A 2YKLL 2YZ8A 4PJ5B 1HOCA 2MCPH 5L8JB 5I6XB 1JJUA 4X83A 4P2RE 3BP5A 5J0BA 3VMOA 1C16B 2E3VA 2HVKB 3LHPH 1HINH 3O3EA 3FJTA 4X7CC 1TTGA 3CLFL 2AEIT 2GAZB 3MLSH 4E41A 1VA9A 1OTTD 3WE6B 4PJ5E 1PLGL 3MX0A 4S2SA 4XNQB 1BQHB 5E99L 4R0LB 3I9GL 1JN6B 1KN2L 2DJSA 2CUMA 4N0CD 3RWEB 1X5FA 4XC3H 5FUZL 2ZUYA 3MLTA 1FRGL 4UT6L 1MAKA 4MCYB 5KS9B 3NFPA 4LPUA 1G7IA 5DVKA 1T0PB 4HX1B 1F02I 2B4CL 1WFTA 4JY4B 2Y7QA 3C2AL 3D3VD 4XCCL 1BQLL 4K23H 3OWEA 4ZOBA 5SWSB 5KS9E 5ERWB 1QFWH 3GKWH 3KWWA 5GSVB 4FP8H 1A3LH 4QHLA 4AG4L 1XIWC 1OLLA 2DF3A 3D85B 4UBDC 4LHUA 3C2SA 5C0IA 4JDTL 2XN9A 2GITB 1I85A 1MFCL 3W81A 3I50H 3H7BA 2IH3A 3SKNB 5INDA 5D7JC 2Q1EA 2R4RL 1CXIA 3V5HB 1WCQA 1MRDL 4I2XA 3IDNA 3NFNA 1EK3A 1C5CL 4PY7A 2AABL 5E2UL 4Y88A 5JPNB 3LMJH 3QULA 4G8IA 3SCMB 3P4MA 3MLXL 3WBDA 5C0JA 5CZXC 3B43A 4QRRA 3QO0A 5JIIA 3BYTA 4GO6B 1QSED 4JDZB 3VI3F 5DJZB 5JDSB 1JPTL 5DUPL 3QDMB 2N7BA 3M8OH 4YHPB 1VGKB 1SHMA 1KXTB 5TGBB 4RWYL 5J12C 2JB6A 4N8PA 5GGSB 4MD5B 5KSBB 4V1DD 3DBXB 5HSFA 1CFNA 2GQHA 3DLQR 3VXRA 4AL8H 3IKCB 4WUUD 4FABL 5IM7A 5D6CB 3QDME 3DSFH 1BJ8A 1A6WH 1OAYL 2OJEA 4F3FA 5ANMB 2FL5A 1ZLUH 4YC2B 2BK8A 1QNZL 1U58B 3ARPA 3LKQB 3FT2A 4GKZA 4U2ZA 3WIFA 2A6KB 3MUGA 1NDMB 3VDCA 3HI6L 3GSUA 3DWTA 1I75A 5ANME 5D1QA 1A2YB 3TPUB 2QSQA 1XH3A 4O02L 4U1JB 3IU4L 5E56A 3AMKA 3ARVA 5CSGA 4H20L 4JCLA 3H42H 2PUQT 1MAJA 4DKEH 2QTEA 3B9KB 2GK0B 1H5BC 4MSWB 1ZLUK 2W9EL 3PWJB 1XGYL 3RP1A 4ZO9A 3DSNA 5JORB 2BXYA 1LILA 3GMLB 4K94L 1HINL 2EDRA 4NO3B 1G6RA 3GMPA 4K55A 3ZHLA 1ADQA 3MLSL 5BJTA 5DQ9B 3FRPA 4ZYKA 1OL0A 4G5ZL 4ZFZB 4E5XB 4LCWB 4LVEA 3N1PC 1H15B 3UTQA 3F7VB 1A4KA 3OHXA 4KWUA 4JRXB 4XC3L 5KTEL 1U8QB 3BPLC 4GBXB 1TJHH 1AGBB 3OTTA 4ZS7H 2DDQH 2PO6C 3KLSA 1YECL 4HUWB 3B2UC 2L4OA 1W0VB 4X4YB 1CXHA 3CFEA 3KPRA 4LCWE 1I7RA 3T0DA 1EAPB 4JG0H 4JRXE 4WHDA 1BIIB 2AXHA 4K23L 5HHQA 1GZQB 1HXMB 3QIWB 3BPOC 1QFWL 1TNNA 1SJHB 1KTLA 3GKWL 2EYTB 1A3LL 3KXFB 4FP8L 2AEWA 2VKXA 4BYHA 1NGWA 1A6AB 3Q1SH 3ARRA 3VFWA 4IRZH 4XCEB 5EB9A 4R7NA 1N64H 4ESKA 3JTTA 2XPGA 5DHYA 3I50L 3MRNA 1KEGH 2QKIA 3IJHA 3VMPA 4YHYC 1QRKA 1T89A 2E9JA 4D9QE 1QRND 2C3VA 3QCTH 3MRMA 3ARTA 2KPNA 4YXKH 5JZ7C 3FQNA 3QUMH 4UDUA 2V5SA 3LMJL 4KKBD 3LV3A 1RIUL 5E6ZA 3WMSA 1UXSB 1PG7X 2PXYD 1FYTD 5T1KA 2J4WH 2Z31C 5HYJB 4FQQA 3ARGB 4ODSH 2ZUQB 3TZVC 1TITA 1RULH 3MYZA 4RBPH 5IW6A 3MXVL 3W9EB 3RVWC 1FVEB 3M8OL 5TDOA 3CH1A 3UTPE 2JF1A 1G9EA 5DRZA 1QSFB 3T0EA 3RGVD 4PBXA 5HYJE 5EDXA 4Z18A 4NCC1 3VW3L 4HUUA 4S1DC 4AL8L 4Y16C 2R2HA 5DJDA 3TN0B 4G7YH 3DSFL 1A6WL 4DCQA 1CXKA 3WFEH 4X7SH 3GSXA 5DC4B 4ZAKC 1QSFE 2FB4L 3QDJD 1JF1A 3DX7A 5DZOA 2NY3B 1FSKB 3W2DH 4X4XA 3NZ8A 2C3WA 4RBPK 3BUTA 3LKOA 4NNPH 5AUMB 2IADB 3D5OF 4HF5L 3TA3C 4O4YL 5AAWA 2C5DC 3RNQA 3C09C 4HXAH 5E5RB 2F5AH 4DQOH 1FNGB 1MFAH 3LD8C 4HK0A 3EOAB 4DKEL 3PHSA 1NFIA 5ID1B 3TC9A 3L5XH 3RIFF 4H88H 5EC2A 4RZCB 1V7NH 1SVZA 1T5WA 4I0CC 4NKMA 4K7FB 4PJ7B 2FJHA 1K8DB 1N26A 1JIBA 1NKOA 3IAQA 4LASH 4X6EB 1XMWA 3BO8A 4IMKA 3CAFA 4PJ7E 2R9HC 5EZIH 4JM2F 4NQXB 3SKMA 3EYFA 4LLMA 1TJHL 2V2WA 1GGCH 2JJTC 3P9LA 4ZS7L 2DDQL 2H32H 4HS8L 5DRNA 5CBAB 1J8HA 1Q9OB 2XV6B 1ZGLA 1EGJA 2QQNH 4OD1H 4FFYH 1OSZA 4HIHA 5CJBA 4GXVL 5SWZD 1UXWB 4UZGA 3HAEG 4JFFA 3MZGB 4RMRA 2Z8RA 4HD9A 2X4QA 3V6FA 1ERNA 3L3OB 3RU8H 4J23A 4U3XA 4HWEH 1MVUA 5F7UA 3M17B 1P5UA 3O6FD 4WWKC 2Q76B 4POUB 3ULVE 4KDVA 4LAJH 1AIFA 5JQ6L 3HN3A 3HI1B 4CVZA 3FONB 3Q1SL 5E00A 1ZGLM 4IRZL 2F53B 1N64L 3JWOH 1RD6A 2JTDA 5I1CL 3WHE0 1KEGL 5CGMA 5DQDH 2XKNB 4HKZB 2RBLA 1S7RB 2H3NB 5DI8B 5HI5C 2X10A 5FKAA 5GS0D 2AXFB 3KJ6H 4YH6A 4YXKL 4YFDB 2F53E 1NCDH 4D8PA 3I6GB 4NQVA 5KS9F 1N0LA 2EDNA 3TIEA 3VWJA 5JW3H 3BESR 1W72H 2H9GA 1JYXA 2J4WL 4R90H 3ZTNH 1HH9A 4J6RL 1KJ3H 4ZUSB 3PWNA 1RULL 1WAAA 1FVCB 1VKXA 1KOAA 5JOFB 4Q9RL 3R8BB 4Y4KC 2Y25A 1NQBA 4C59B 1KLUA 1GGYA 4D3CH 3CUPA 4G7YL 4P4KA 4XPBL 4W4OC 3WFEL 1Z0MA 4CN6A 5M7QA 4X7SL 3U30C 4JRYB 1JPFA 3RI5F 1NGYB 3WLBA 2VXQH 3EO0B 2NW2B 3QG7H 1G1YA 4EI5A 3W39B 5HYEA 1EEZB 3TO4D 4X4MA 1JTPA 4U1KB 2IPUG 5DJ8A 4JRYE 1CXLA 3QSKB 5J4MA 5IKCA 4PG9B 5EUOB 1QD0A 4XTRC 5DK2B 5FGSA 3NA9H 3LS4H 1S5HA 4HXAL 1VERA 4U1LB 2F5AL 2P8LA 4WEUD 5GZOD 5KJRH 5KSBF 5DC9B 1YEFH 2HJLB 2W60A 3EGSA 2WNGA 4JQIH 5MERB 5EUOE 1DQDH 1UJ3C 2D7TH 4H88L 5BZDB 4N5UA 1UACH 2E9BA 1AD9A 3OG4B 5DS8B 5IOPA 2EDXA 4EXKA 4Q97A 1FQ9C 5MHSE 1JNHA 3OF6A 5HHNB 3VFTA 2FWOB 1MCFA 3CZJA 5DC0A 5AYUH 4U0QB 2X4TA 3NIDE 4LASL 4U2YA 2BP3A 5E8EB 1CGTA 4OV5B 4GAJH 2V9RA 4HLZH 4AK1A 1T7YA 1IFHL 5D7JB 1CTOA 1GGCL 5LBSH 1JZ6A 4XP5H 1E28B 1V3JA 4OD1L 1EO5A 5GXBB 5FGBC 2YWYA 2VLRB 2I26N 3HR5A 4MNHB 5ILTL 4XPTH 2F15A 4HWEL 3BFOA 4UAOB 4YDVA 2R56H 4PGDB 3U9UA 4PJAB 3U6RA 4YGVB 1MCJA 2P44B 5D72H 1AR2A 1UVQB 2VLRE 4ZDHA 2D9QB 2OL3L 3JWOL 1PFCA 4YE4H 3WXWL 5BRZA 3ES6B 1M7XA 2Z8SA 3HLAA 5IVOA 3LN4B 1HQ4B 4PJAE 1N0XH 4KKCD 2XZQH 4L8CB 3KJ6L 1NAMH 4YAQA 2DMBA 1NCDL 3QXTA 1LE5B 3E6HB 2OTUA 4OSUH 1BBDH 3EFFB 4R90L 4ZSOA 3ZTNL 3ZTJG 3FAWA 1HIMH 1KJ3L 3QNXA 4OZHA 1RFDH 3EO9H 1XF2B 1IGJB 1H3TA 2BNRB 1O5DT 4QXUH 4PG2C 2CKBB 3KPSD 4W81A 4JLRA 8FABB 3KYOB 3QZWG 3ARFD 3T1FB 5J7CC 1QTYT 2XTJC 4OCXH 3RTQA 2ZUUA 2HLAA 3BVNB 3NIGF 1VADA 2GK2A 1WZMA 1D5BA 2BXZA 4D3CL 3QH3A 4L1HA 2BNRE 4JJ5B 1WCBA 3C5SB 5DJ0A 1U8LA 2Q87A 3L5IA 4HHAB 1M7DB 3D0LA 3G5ZA 4GMTL 3HCVB 1HOCB 4H1LG 3X14B 1QHPA 5HGGS 4FQJH 3BP6A 4NOFA 3O3EB 4UV7H 2YN5A 3LS4L 3QJFA 3SDAA 1EUUA 3V4UL 5DMGD 4IJ3C 2R1WB 3A6OA 4AIZB 5KJRL 2PO6B 2FGZA 4S2SB 1YEFL 4K3JH 2NX5D 3P4NA 4JQIL 1NGZA 3LPGA 1DQDL 2D7TL 2YXFA 1UB5A 5GGTA 1BPVA 1SMAA 5CP7A 5E8DL 5F44A 2BOCB 3IFNL 1BZ7B 1J8KA 1Y6NR 5C0AA 3SJVA 4MDIB 5J11C 3PGFL 4LLYB 1DEEA 1LO2H 2VDRH 4G8FA 5I16A 1H3PH 5IMLB 4RGNC 2AJYL 3B2VH 3OKNA 2FIKA 1BEYL 1KIPB 5MEPA 1T2QH 4GAJL 5C6TL 3H9ZA 2B20A 2LVEA 3TO2A 4YHYB 1VPOH 5C0IB 2PW2A 1S7WB 2XN9B 5LBSL 4PREB 4XP5L 2I9LB 2ICWI 4KGJA 5DJXA 4MQ7A 2XICA 3F5WB 1GSMA 4I2XB 3NCYP 4N8VG 4HMDA 3DUUB 3NFNB 5DVLA 2AGJH 5C0NC 5I0DA 1JNJA 4PY7B 5IG7B 1CGYA 1MJJA 3FB7A 2XN9E 3Q0HA 5F93C 4H25B 4DWHA 1X4YA 3BIBX 4M43H 1YNKH 2ICWB 3VRIA 1CFQA 3P4MB 5KZCB 3QO0B 5D72L 5J1TC 2FECL 1IGCH 4YE4L 5DURD 1B3JA 3RY5A 1IC5H 4NCC2 1YEDA 1LO5A 2IBZY 4PRID 1N0XL 4GSDH 5AYQA 1XT5A 4Z0BH 3B83A 2XZQL 2ICCA 1NAML 3BRFA 5F7MC 2IAMD 1RY7B 1DDHB 4ZAKB 3QDGA 3G5YA 2OSLA 1N59B 1T1YA 4ODHH 2VZ3A 1MH5A 4WHTA 4KVCH 4PJGA 5E6YA 2ITDA 3BP4B 1IEBA 4OLWL 3RGHA 5IK3A 1A9EA 1BBDL 3CFJA 4OSUL 2MKWA 4I0KA 1X6LA 2NY6D 4GLRH 2F19H 4QXUL 4HWZB 3TH2T 4NSKA 4G80A 2HRLA 3FT2B 1RZJL 3TA3B 3WIFB 4OCXL 3OGOE 3RX5A 1P7QB 5E4EB 3MA7B 3C09B 5DTFA 1OB1A 3H2WA 4M3KB 1KPUA 1U8KA 4ZNEA 5JW4N 3S88H 1BWMA 3F65A 2PTTA 5FOJA 1T83C 1IM3A 3RFZC 2B7DT 3SDDA 2AVGA 4M6MH 3CDFA 3UX9B 5E6IA 4CRPA 2ZUWA 1F90L 1NC2B 1T0MA 2P5WD 2PYEA 3KPLA 4XVUC 5T3ZE 3DIFA 1SQ2N 1YNLL 3EO1A 3L5JA 1J1OL 4FQJL 2R23A 1YEGH 4JZOA 2A6JA 3A67H 1XGQA 3MZTA 3JV5A 3S9DB 4ZYKB 1AP2A 1D5ZA 3VWKC 4S0SD 3ILPA 2F54E 3SE9H 4I0PD 4K3JL 1JL8A 4M5YH 3OHXB 1RHHB 4KRNA 1INDH 4UNUA 2GYSA 3W0WB 5EO9A 2H2PD 2Z35A 5CJQL 4TUOA 4LCUA 5FHBH 4Z5RA 5I2IA 4WWKB 3CFEB 4ZS6D 4JE4B 3KPRB 3FN3A 1LO2L 2VDRL 3C5JA 2SEBB 1A02N 4G8GD 1H3PL 3W0WE 4NQCD 3B2VL 1XZ0B 1JGLH 3ZE1F 4G6JL 5FYLD 4TNWK 1HKLH 2KUTA 1T2QL 4ZMAT 1EEYA 4OGAD 5IR1B 1PEZA 3NCCB 4D94A 4RISH 5JLZB 3KPRE 4OCRL 5EUOF 4LLWA 2DRUA 3O9WD 2XNAA 3JTTB 2XPGB 2NY4B 3MRNB 4NKOA 5FYJE 4QNPE 5KW9H 3QIUA 4MXQC 3I75A 2ZOLB 4OCWL 4HUKB 3QWOA 3OKDB 1F3JA 2Q6WA 2AGJL 5HGDB 4CVXB 3FQNB 3RDTA 1AKJD 2FBJH 2JJSA 1QFUH 1YNKL 1T6VN 4YHMH 4WHYH 1FVDA 3VXMA 4LL9A 2Z92A 5T1KB 1B0GA 2NY0D 2R1XB 3BX7C 3TBVA 4FQQB 1IGCL 1ZK9A 4Y4KB 1LGVA 1NSNH 4JB9H 4XBPA 3NOIA 2FJGA 1IC5L 2OTWA 2CLZB 1DBJH 1BX2A 3RAJL 1K6QL 1KACB 4Z0BL 5CBEA 4JN1H 3EFDH 2VOTA 5DRZB 4ZO7A 1WFUA 3ZKMD 1J0JA 4RIRA 1JRHI 1BWWA 4PB0L 1GRWA 2VAAA 3D39A 4KVCL 1TPXB 2F74B 3D2UA 4UQ3B 2X5PA 3GSXB 5DJ2A 4P2QD 2FX9H 4WJ5A 2XT1B 3DX7B 5LAXA 5IMKA 5HHMD 5T1LD 4PJAF 3D0VA 4TVPL 3LKOB 1MLCA 3RIAF 1JTTA 5CINH 3K8LA 2LV4A 4OF8A 3FOLA 4Y5XA 4BA8A 2MQCA 1FLTX 3MGAA 3OR7B 5BO1H 2B4CC 4YHOH 4ETYA 1FAKT 5EO1A 4M6ML 4JFZH 3PWVB 4HK0B 3NCJH 4P4RA 3WDJA 1UWEH 3MROA 4MJ5B 4WUKH 3WO4C 5TDPA 3OQ3B 5DJ6A 3NN8A 3OL2A 3MBED 5F9WC 2WLZA 2Z91B 1IL1A 4CW1A 3RWFA 3UTTE 1F6AA 2FJHB 3LEVH 1YEGL 1CFBA 2VDOH 3F12A 5SX4I 3S4SA 5FYKD 2OP4H 3WDIA 4AT6A 2Q7YB 5FAAA 4KJQC 4N8CH 4PP1D 2V5RA 3BO8B 1T5XA 5IFAH 4DKAA 4Z76A 4NC2B 1OCWL 4M5YL 3SKMB 5ADPH 2AJZA 3EYFB 1INDL 3SGJA 43C9B 2APBA 2V2WB 3P9LB 4OZFG 5FHBL 1Q8MA 4I3GA 4HT1H 1OSZB 5IMMA 4HIHB 3FOMA 4PTTB 1PJ9A 1RUMH 3H3KA 1RQ5A 3D18A 2D0HA 3V6FB 1RJLA 4FXGA 1M1SA 4TVPD 4L3ED 2I07B 3VXUD 1HKLL 5D7LD 5FOBA 2DN7A 1LE9B 1AIFB 4QRPD 4RISL 3KVQA 1VFAA 2NZIA 5IHZA 2ZUVA 4IIQA 2C1OA 5FO9A 5E00B 1ZHKA 4QOKB 1QSVA 4QRTB 1DBKL 4UT7H 1MWAH 3GK8H 3UDWA 5KW9L 5EO0B 3ARBC 4NWUL 4P23D 5FKAB 4F9PC 1BGXH 2F8VA 4YDIH 1NUDA 1WQVT 4GAYB 4QKXB 5IBTH 5DSCB 4QOKE 1LD9A 5F8RC 2FBJL 4Z6AT 2V5TA 2V17H 2EKSB 1FNHA 4YHML 3VWJB 4XWOD 2BHYA 3LEYL 3FB5A 2BRRH 2QQQA 1GGIH 3QXAA 3DMMC 1NSNL 4JB9L 4KUCD 5FYKU 3PWNB 5MEOB 1DBJL 4Q6IA 4JFYA 1VKXB 5C08B 3CMGA 3WXVH 4MB3A 1WTLA 3O4LA 4LSTH 4ELMA 1VHPA 1G9NH 2PKDA 1Z9LA 4QTHA 2VLLB 2XZCH 2EH7H 2PXYC 5TH2A 3LDBB 4LVHB 2MQ3A 4WFGE 2DAVA 5C08E 4XGZA 4UTBH 2EYSA 4P3CH 5CAYB 1JPFB 3HZMB 3UAJD 5KSVB 5IVXA 3R06A 2FX9L 4EI5B 1N4XH 4JHAH 1F3DJ 5GGRY 2DB8A 4QHUA 4ZG1A 4TSCL 3VGAC 1W8NA 4GRLA 4L5FH 3ORJA 5A2FA 5DJ8B 5CINL 1JZ5A 5E1AB 4OZIB 5IKCB 3FL7A 1JK8B 5BO1L 4ZFOA 2FX8H 3FQUB 1NC4A 1WEJH 2BC4B 5DF0A 3C08H 2IG2H 1I7ZB 4OZIE 2X4PB 1UWEL 4WUKL 4QGYA 5J11B 1FN4B 3HE6C 1AD9B 5A16B 3BZEB 3C5ZA 3G04A 3LEVL 5FDWB 3W9DB 4JN2A 2FLRT 4ZUVA 3VFTB 2OP4L 3GHEH 1D5XB 3G6JA 3F7YB 5J06A 2X4TB 4NRZA 3SDCA 1OWWA 5GRUH 3N85H 4N8CL 3IT8D 4WFHD 3L7FA 5IFAL 4KJYB 4IRJA 2YRPA 2Y4SA 3AREA 1TVHB 5ADPL 1TCMA 1NBYA 2DTML 4PV9A 1KGCD 3GBMH 1BD2A 3VRJB 3UROR 1KBGL 3K7UA 3HS0A 4Z7WA 1WICA 4HT1L 1XEDA 3LKPA 1MCBA 4CDHA 4KDTC 1P5VA 5E7BA 4U1GC 1MLBB 2ENYA 1ZA3A 1CF8H 1RUML 2BSED 2Q86A 5I8OH 5JA9A 2ZUXA 3LPFA 2NR6D 4FQXA 4YDVB 4YQXH 5B8CC 5F6IB 1V7ML 5D93B 2AV1A 5JXED 3U9UB 4OI8A 1KJ2B 3AS1A 4HG4K 3NFSH 4M1DH 1R3IL 4ZDHB 3WJLA 1T3FB 2R0LH 5BRZB 5TPWH 3HLAB 4UT7L 1MWAL 2AK4A 3GMNB 3GK8L 5H37G 1XF4A 5HVHC 1HYSD 3IDYC 1EO7A 1X7QB 2MCG1 1BGXL 3O6FC 1N5AB 5BRZE 3C6SB 2V17L 3CFIC 5L2JA 5L2KA 2GTWA 5E2WH 1TVBB 2BRRL 5SV4A 1YPZA 2EC9T 4ZSOB 3W11D 1GGIL 1IKNA 2X4SB 3VJ6A 2NXYB 3GIVA 4P2OD 5DWUH 4OF3A 4Z78A 2MTPA 4QNPF 3UJIL 4F7CB 3HI5H 3WXVL 4Q0XL 5HBBA 5I1EH 1R24A 2HLAB 4ZSOE 1NGQH 1BOYA 4H8WH 4BFIB 1G9NL 1IZKA 4XP1H 3WN5A 2DD8L 2VLKA 2EH7L 3RX8A 1P9MA 7FABL 1FFNA 3PDDA 5F3BA 1I1AD 5I1DA 2PW1A 4JHAL 1NMAL 3AUVA 3QO1A 3P2TA 4NKDA 2AP2A 5GS1A 3OX8B 4MA1C 4ETQB 1G1CA 2NLJB 4L5FL 3K0WA 1CD1B 4MJIE 4Y2DA 3SE3A 3T2OA 4L4JA 3WO3B 4S11A 3BP6B 2HJKA 2M26A 5CIPH 3DURB 3QJFB 4GXUN 2FX8L 5C0RH 4S1SL 1IMHC 4BZ1L 2V5MA 2IG2L 4O2FB 4HFUH 1K4CB 2MPAH 4KKLD 4JQXA 3P4NB 3TO4C 3N9GH 4PRNB 5CP7B 4WO4A 3QDHA 1PVHA 4G6KH 1MY5A 1FO0A 4ZXBD 5J9PA 3SJVB 1I9JL 1M7IB 3QUYC 3MRRA 4HAGA 3MRBB 4G8FB 1A0QH 1ZHLB 4OLZH 3N85L 5GZOC 2FIKB 2P5EA 4UUJA 5JPMB 3OAYH 1FNLA 3Q2CA 3BP7A 3L3KA 4WV1C 4DVRH 3CCHA 5DA4A 3SBWA 2DQFA 3TO2B 4QHMB 3DHJA 1W0YT 2PW2B 4TOYH 2VR9A 4TTDD 5I1AB 3Q6FB 2K9UA 3VXSA 1CF8L 3RVTD 2P47B 3JXAA 5FA3B 2GT9B 5IROA 2MNUA 5I8OL 4GW1A 3QEUB 4Q9BA 1IM9D 5D1XC 4YQXL 3MA9H 3UTSD 4PRHA 4Y8AA 3VRIB 2EDFA 2XY2A 4ORZC 2BVTA 4F7PA 3NFSL 4JGJA 3OAYK 2A0LC 4NM8H 3MYJB 4FFZH 2DBJA 1A6ZA 5GSRB 2R0LL 2WBJC 5TPWL 5CHNA 1M4KA 2OXGA 4OCYH 5C07B 4KHTH 1OP3H 4DEPC 1FZKB 1YEDB 2Q8AL 1MREH 1PW3A 5K33A 3TCLA 2NY1D 3BN9D 3V9FA 1PX3A 4LARL 5ICYA 2CDGB 4YLQT 3L3DB 3SQBA 3V5KA 3BH8B 3QDGB 4U6YA 2OSLB 2ATKB 2V6HA 5FO7B 5C07E 3WS3B 4R8WH 5E2WL 4DKFH 4OD2A 1A9EB 2YXMA 1FFRA 3NMEA 2GUOB 4KRPD 3QDGE 1IILE 2A74A 4HPYL 1J0KA 5D71H 3MSPA 1NGXA 5C8JB 1UQSA 4NN7C 2BVYA 5I1EL 1OP3K 3W82A 2LFGA 2VNCA 4PJIE 1NGQL 4H8WL 1RJZA 5DTFB 3HAEA 4XP1L 1KFAH 5B22A 1KPUB 1U8KB 3FFDA 2HG5B 4LAQH 5IFHL 5F7DA 3C87A 2VH5H 1L6ZA 1IM3B 4XAKD 1NCNA 4LRIA 3WO4B 4ZPTA 5M94B 5E2VH 3RVVC 4YR6B 4UTAL 5HDOA 5E6IB 3EOBB 1CDUA 5ISZA 2VITA 4BQ9A 1T0MB 2GJZA 3DIFB 3MRFA 3EO1B 3WNMA 2CRYA 3RY6C 3ARDD 1LDSA 1FE8L 5I1JL 4R2GC 1CD9B 3TJHC 3MV8B 3TFKD 3D6GA 2HH0H 1WAAF 3TBTB 3O3AA 1JZ4A 1UH3A 1XGQB 3PWLB 3INUH 4M1CD 2OZ4H 3ILPB 1URLA 2MPAL 4IDJH 5FFLA 3MV8E 2A9MH 5DD6A 5C86A 3N9GL 1UJTA 3D87B 4TUOB 1EO8L 4MQXC 2HFEA 3L6FA 1W0WA 4LCUB 3FFCB 4WU7B 3GMOB 1RUPH 3JWOC 3MV11 1EHXA 4NNXB 3PQYD 4GT7A 3C5JB 3CVHL 2KKQA 4XP9H 3V6OC 1MSPA 3OAUH 5J3HD 3FFCE 4WI5A 4DN3H 5F1NA 4DVRL 4OZIF 5EU6B 3LSOA 4XNMB 3KPQB 1ACYH 4LLWB 4PD4K 4OD3H 3JZ7A 4AENA 2UUDH 4X7DC 2RHEA 2BSRA 4MS8D 5IVNA 4CMHC 1CLYL 1HNGA 3QUKA 3C8HA 3MREB 3HA0A 4LU5H 3QIUB 3VGDA 4DK6A 2C7UB 5EU6E 3UZQA 1D9KB 3QWOB 1MHEA 2Q6WB 3S36H 3RWIA 3AM8A 2YPLD 3MA9L 4CL7A 4I3RH 1ZKAA 4Z95H 4P3WA 1WIUA 4BH8A 2Z92B 4U33A 1OAXH 1B0GB 4FFZL 2MMXA 4M62L 4OCYL 2FGWH 2FJGB 3FKUS 5JQHC 1CTNA 1MREL 1QLRA 2UUDK 3HZKA 1INQA 1ZS8A 5CBEB 5DGQA 1JNNH 4XMKL 5C0CB 2VABA 1A1OA 2E27L 1SYSA 5I75C 1NBQA 4I48B 4RFOH 2H1PH 3LN9A 3D39B 3IB4A 4R8WL 5I76A 5DMJB 4DKFL 25C8L 5DFVC 1ORSB 2NYYD 2O61A 5DJCA 3VGAB 5AWNL 1MCOL 5C0CE 5CS7A 3PNWB 4DZ8A 5D71L 5B21A 1IBGH 5FIEA 3D39E 1AO7B 4AH2B 1CFSA 2IAMC 4HLZG 4ZUUB 3PHQB 1XF5A 1JVKA 4AEHH 4X7TA 1KFAL 3VDAA 5K9QG 1JZ2A 1CDJA 4P3DB 3FOLB 2VH5L 1LEIB 2FYYB 4C56A 4HKBA 1AO7E 3HE6B 3HC0B 5D9SB 3RI5K 1KSRA 1OTUC 1WUNT 1HCFX 3CFDA 5DUBB 1R0AL 2GJJA 3O2DL 4P4RB 4UU9A 4Z77A 3VFSA 4PLNC 3NN8B 5TE6H 4KK8C 4PG2A 3MCKA 1F00I 4FXLA 3GBNH 3HG1B 4CW1B 1U95A 2JK5A 4DUVA 1N5YH 1GC1H 3U83A 4ZOCA 2FDBP 2HH0L 3F12B 3S4SB 3BUYA 1R3LA 4YEFA 3I85A 3INUL 1BM3H 2DIJA 2XTLA 3WJJA 3BPCA 5ETUB 1S7QA 3O81A 3HG1E 1S9XA 4Z76B 4IDJL 2NW3A 2A9ML 5K9KB 1PG7W 4OCSL 2AJZB 4R4ND 4JFXB 4U1GB 3THMH 3QZWA 3ZDZE 1TMCB 5I1HH 3G9AB 1KPRA 5B8CB 4UIKL 3ZKXC 5IMMB 2B1AH 4AQOA 4GUPB 5I1IH 2ED9A 1ZAGA 1XR9B 3D18B 4PJBA 3FO1A 3HPLB 4XP9L 4FXGB 1AH1A 4I0PC 1H3GA 3OAUL 1JHLL 5CEZH 4DN3L 3U0PA 2CDEA 4EZMA 1ACYL 2H2PC 3VMNA 5IHZB 4IIQB 1NEZA 1V05A 4OD3L 2IALA 2D31A 3JBG7 3C60A 4NQEA 1OQXA 1MFEH 5GRYA 3NCBB 4LU5L 5IFJA 4H1LA 1BVKA 3DRQA 1RV6X 4LCCC 1C12A 2Z8WC 3S36L 1ULVA 4APQA 1KT2A 3EDJA 4WEBH 3Q5TA 1H3UA 1OAQH 4I3RL 3GDBA 4JY6A 1LHZA 4Z95L 2RR3A 3QUZC 3O9WC 3Q3GB 5HGAA 1GCFA 1GH7A 2ZP0T 3QXAB 1G7LB 5F7KC 1FFPA 4NO5A 4HH9A 4KKAD 4QEGA 4JM2D 2FGWL 4JFQB 5IT2H 1G0YR 2LAGB 4Q6IB 4JFYB 3DVGB 4X6DB 4OAWA 3C6LD 4GAGH 4LF3B 1X5HA 4R4BA 3RPIB 5CZVL 3SGEI 4ELMB 2XY1A 4P2RD 1A6TB 4XMPH 3S96B 3T1WA 4R4FH 4CU6A 3DROA 4L8SA 4QTHB 2ZCKH 3VGFA 1MCPH 3AXLA 4CVWA 4X6DE 4OV6F 1FNEA 3L5HA 3DX8B 4PJ5D 4MA1B 4DVBA 3VXOB 1EXUB 2YD7A 1KC5H 5EU4B 4L4TA 1YN7A 1ND0A 1SJVA 4P46A 4XP6L 4QHUB 1DQJB 1MQ8A 3HB3D 2Y5TA 4GRLB 2APWA 4LIQH 4HC1H 4AEHL 1FV1A 2JELH 4F2MB 3N50A 4N8VA 5ACZA 3MRPA 1SY6H 1TETH 2NMSA 1D5MB 4UQ2A 4HWBA 5JO5A 4OQTH 3LRSA 1T22B 5DJAB 2MHAB 5HYSB 4LSQL 1MI5B 3BRDA 4PGJA 2AV7A 1IGYA 4K2UL 2GY5A 3ESVF 3QUYB 5A3IC 1Q0YH 5EFIB 5TE6L 1U3HA 1J9CT 3F6IA 4GXUM 3VXNA 1U8HA 4LFHD 4LLDB 4K8RH 3ZKNC 1N5YL 1GC1L 3C5ZB 3G04B 4CDGC 1MI5E 3VFPA 3D85D 4L4VB 3QUMB 4JN2B 4WV1B 4ZUVB 3GSOA 4X5LA 4NRZB 4QYOB 5DVNA 3FO2B 1CT8B 5A2LH 1YEJL 2BNUB 4IRJB 3AREB 3C9NA 1NCTA 1WZ1L 3WCYA 1B6UA 1NBYB 4NQDA 4PV9B 4L4VE 4F9LC 4BELD 1BD2B 5HHXL 3L5WA 3THML 3HMWH 4UIMA 4Z7WB 4XVTL 4X5XB 4RA0C 1U8JA 3TP4A 1IEAA 5I1HL 1EJ6A 2OR9H 5D1XB 4PJXB 2B1AL 2EIDA 3QA3A 1UH4A 3CX5J 3SCMD 3B9AA 3QUXA 5DD1L 4XNUL 5FA4B 5CKAA 5K59F 3B8SA 1BD2E 5SX5H 4LBEB 4PP1C 1YMHB 4FQXB 4NQTA 5C3TA 4Z7WE 1CL7H 3TBSB 5CEZL 2WBJB 5T1MA 1TDQA 3QDMD 2KBGA 4PJXE 4DEPB 2GHWB 3GHBL 3IETA 5GRZA 1MY7A 3VFRB 3VWKA 5I8CB 2E7BA 3VFMB 2A2QT 3BMVA 3KYNB 2D9CA 1B90A 1PQZA 3LIZH 5KSAA 1CICA 2EXYD 4HIJA 2DYPB 4NO0B 4MA3A 1MRFH 3FN0H 4BJLA 1HQRA 3VXPA 4JHWH 3MGOA 4R7DB 5TDNA 5DUMH 4WEBL 3L3IA 2DKUA 2EDDA 2VUYA 5SX5K 1DL7H 1E6JH 3RRQA 2HFFA 4QF1A 4KMTH 2GTWB 3BW9B 3ZE0E 3G6DL 4I9WE 1WFNA 4NN7B 5FF6B 4NQUA 3H0TB 1CQYA 4KTEH 3LKSA 4PJEB 4DZBB 2UWEA 1NUFA 3RWHA 3UBXG 3UYRH 3GIVB 5IEHB 4ODVH 4Z78B 5IT2L 4HUVA 5FB8A 5J6GB 2P7TA 4P23C 5D2NC 3X11A 2DLEA 4PJEE 4F57H 2A6IB 5LGJA 3D3VA 3E6FA 3N0PB 3WN5B 3ZHKA 2VLKB 4BK4A 2ZCKL 3B9KD 3MV9E 1T2XA 2DQEL 1OLZA 1FJ1B 1FFNB 4J3SA 4F7EA 4OIIH 1E4XI 4YHLH 5HI3D 4ZFFB 3NCMA 4TRPH 5I1DB 5F9JA 3UPAA 3AC0A 1KC5L 3K3QA 4YHZH 2H32B 4R2GB 1CG9A 1HI6B 2CDFA 3VFOA 3TYGL 2FATH 4LIQL 3KHOA 1QUNA 1NFDA 4Y2DB 4NCDA 1QZ1A 4Y19B 3K1DA 4NWTL 4LCWD 1SY6L 1MNUH 2XKUA 4JRXD 2ZPKH 3GJEA 4ODXA 5C9KA 3DO3A 4GBXD 2JB5H 3I3DA 3UAJC 1JMXA 1G7HB 4ENED 1U9KA 1HYRC 2VIRA 3EBAA 5EOCH 4Y19E 4PRBB 3E8UL 4XHQA 4MXWH 1QSEA 3FTGA 2ADGA 2YMXH 1Q0YL 3UJTH 3MRGB 4WHYG 3GJFA 3L9RA 4WO4B 2X70A 1SJXA 1ZLWH 3QIWD 5CP3A 4K8RL 2CLRA 3HMXH 2BNQB 1FG2B 4HPOH 5E94B 4D9QD 2F8XC 4V1DA 2VC2L 4XWGH 4NDMA 4R3SA 5D7IE 2AAVA 4M8QA 4WUUA 1W72B 2D4DA 2KH2B 1QFPA 1WT5C 3AY4C 3V6OE 2BNQE 1SJEA 4CMHB 3CCHB 4RAUA 3WNLA 1P84K 5F3HB 3HFMH 3HMWL 1G7MA 5EC1A 2DM4A 5BVJA 4M1GH 1CDIA 1L7IH 2OR9L 2AKRA 3BDYL 3UTPD 3VXSB 3SE4C 1ZLWK 4KQ4H 5AZEH 5HYJD 1I3GH 3ARGD 3X13B 1T04A 1WC7B 3WLWD 4G9FA 3VXTB 1MRCL 4PR5A 2XQYG 3NZHH 2B2XH 1GHFH 2D7NA 4F7PB 1HSAB 3P4OA 4RFEA 2K7PA 3BQUA 1QSFD 1A6ZB 4CMMA 1Y0LB 2G9HB 3ZDZF 2XFXA 3LIZL 3SPVA 4M03A 1CZ8H 3TN0D 1KCUH 5I75B 4E9LA 3ILQD 4WTWA 1MRFL 4OLYH 2NR6C 1FH5H 4A6YH 1OPGH 4JHWL 3V5KB 5ABDE 3L3HA 2EE9A 1KIRA 4U6YB 2NY3D 1E6JL 2E7CA 4KMTL 4X0KA 4OD2B 5E5MA 1QBBA 5C0EB 4OM0H 3WFZA 4KTEL 1NCWH 3QFDB 4FTVB 3UYRL 4X8JA 5D6DA 1EJOH 4ODVL 4M6AA 4OZFA 1NGXB 3ZL4H 5JNYA 1S7XB 2IQ9H 1BBJA 3OSKA 4JFOA 1RJZB 5IWLA 3QI9A 4GG6B 4F57L 2X7LB 3FFDB 2P4AB 4FTVE 3Q5OA 4Q2ZA 1CR9H 1Z5LA 4Q9CA 1RJYA 3T2PA 4M7KH 5C0GB 4YHLL 4TRPL 1QQDA 1AXSA 4G9DA 4P2OC 4YHZL 4GG6E 2VDKL 4PY8J 5ISZB 2ESVB 3CLEH 3EYQC 4KK5D 3QEQB 3RIAK 1MHHA 2EDEA 1QRNA 3T65B 1A6PA 4MHHG 5FKPB 4M9PA 1MNUL 4HJ0D 4MX7A 1EVTC 4UOW0 1A7PH 3L95A 3BIKB 2ESVE 4X6DF 5CSZA 4F7TB 3QEQE 3ULVD 1FYTA 1TTFA 2WIIB 1NEUA 4MYWB 4ELMF 1HSBA 4MXWL 3MOAL 1F4XH 2YMXL 5DD6B 5BQ7A 3UJTL 3ISWA 1VENA 2QADB 3DGCR 3V95A 3CXDL 2HFEB 4L8BB 4EUPH 4HEPG 1NAMB 5IVXF 4HPOL 3CDGA 3RGVA 1G7PB 3O45A 4XWGL 5E8PA 2E6PA 1PYWA 5IW3A 2F53D 5A2KH 3QQNA 2F9BT 3V4PL 1P1ZB 4KKLC 1R5WB 3GEWB 2DQJL 3LSOB 4OBRA 4POZD 5F1OB 4DOHE 3QDJA 3HFML 1OOAA 2XQBH 2X44D 2FEEI 4AENB 4LCCB 1L7IL 4HBCH 4QGTA 1WVZA 4U7KA 5SV3A 2E8ZA 1S3KL 4KQ4L 4NBZB 4LOUD 4URTB 3L7EB 4LCYB 4TUJB 5AZEL 1MHEB 3QUZB 4YZFE 3U36A 2C9AA 3RQ3A 4NKIH 1G9NC 3FB6B 3BZ4A 3NZHL 4OLEA 2WWMC 2V9QA 2B2XL 2J8UB 1GHFL 1KV3A 2CJUH 2W0LA 2HT4D 3D9AH 3O6KH 4BH8B 4ZOEA 6FABH 3G6JF 2UZIH 1IVLA 3ABZA 1CZ8L 3BXNB 2YOCA 1KCUL 4X6CA 1JGUH 1INQB 3C8KA 4OLYL 1OY3B 2BVOA 2J8UE 1QPPA 3QNYA 4JRYD 1FH5L 4A6YL 1OPGL 1UEMA 2VABB 1HKFA 1A1OB 4Z7WF 5DD0L 1SYSB 5D1ZA 2G2RB 5AG9A 5DJYA 1S9VA 5A1AA 3QXDA 5GRWA 4PJXF 2VTFA 5I76B 1PKQA 3LVEA 3WUWA 5GGVH 2X4OB 4OM0L 3K2MC 5DJCB 5E8NB 3V79C 1NCWL 3B6SB 4HLJA 4KV5E 1T7ZA 3OKOA 1YEEH 3RL2A 2W0FB 3DXAA 5I18L 3BN9C 1EHLH 1XGPA 5EU3A 1FL6A 1KJVA 4YX2H 5JIPA 5FGRA 4Q9QH 5SWZA 4X7TB 1RZ7H 5MHSD 4ONFH 2WINA 5D70H 1I9RH 4RMVA 3RHWK 1DZBA 2AJVH 4JAMA 1LVEA 3O6FA 3PL6C 4M7KL 3ZE0F 4C56B 4HKBB 2J12B 4AM0A 5DMKA 3OJDA 2VAJA 4U6TA 2H45A 4M6NH 4EI6A 4JPIA 4UU9B 5JXAL 3VFSB 1XIWD 3CLEL 4UBDD 3G08B 4JFEB 1IGIH 1DQQA 3NVQA 5TE4H 1AQDA 1YPZF 3T8XA 1U95B 2JK5B 1F11B 4PJEF 4FZEH 3UYPA 4ALAH 1P6FA 3DVNB 4BKLB 3WEXA 5HHPA 1A7PL 4OF5A 3OKMA 4PTUA 3BUYB 5D7JD 1R3LB 1Y18B 2ADJA 4JFEE 4I5BB 1OM3H 5T3ZH 1J0YA 2NW3B 3RA7H 4FFWC 1F4XL 3VRLF 3AROA 2VLRD 5CZXD 1UFUA 2CR6A 1E4WL 1R3KA 3O8XA 1I8LC 1QYGL 5HYFA 3QNZB 1BIHA 5KSUB 3FO1B 3HUJA 4M1CC 3K4ZA 1JWSA 3LKRA 2CGRH 4YHKH 1G6RH 2CDEB 4OQ1A 1ADQH 4JFDB 4MA7H 4Q6YA 1HWGB 1WISA 5DDHB 4JGMA 2XQBL 1NEZB 2HN7A 4LSRL 1YY8A 2IALB 5BXFA 4NQEB 4EKXA 5AD0A 5IFJB 5L7XH 1G9MH 4K3EH 1LK3H 4FN0A 4JFDE 3BKCH 4GRMB 3DJ9A 4Y5VC 3TF7C 3PJSA 4NKIL 2BNRD 2BFVH 4H8WC 3NPSC 4HS6A 4NQEE 3BGFB 3O6KL 6FABL 2UZIL 3UCRA 1FFPB 1E27B 2R15A 1TZIA 4U1IB 1JGUL 1V3LA 2Y06L 2DQDL 1FAIH 1XCTA 4OAWB 4R4BB 3MLVH 5IMOB 3ZDXE 4GKSA 3DX6A 3OAZH 5GRVL 5DZLA 2OXHA 2BY1A 3DROB 1KXQE 4UNTA 3T2NH 1LP9B 2X9WA 2DI7A 2I9TA 5GGVL 1N8ZB 4I4WB 3B9EA 2AEQH 4HIIB 3JTSA 3MO1A 2CIKA 4PLKC 3SQOL 2K3TA 2OLDA 1LP9E 4YX2L 4NUJB 5GGRA 5TQ0H 2H8PB 1FV1B 2VQ1B 3MMEA 2NNAA 2PO6D 5D70L 1I9RL 2J8OA 3RNKB 1I8MB 2AJVL 3OAZK 2X09A 4JO3L 5B39G 5I17B 4UQ2B 5GGSY 1DQTA 5FDYA 1SMOA 4G3YH 4PRPA 1BFOA 4ONHB 3RZCA 1H8SA 3VGHA 4M6NL 3NAAL 4QHNA 5H35A 1T66C 1GPOH 1IGIL 1U3HB 4N0UA 1JRHH 5TE4L 3BKYL 3TBYA 2YD8A 3CDYA 1A7OH 4HEME 2ITCB 1ES0A 1S8DA 4FZEL 3EIFA 4ALAL 3PXJA 5SWQB 4JFPB 2HTKC 1R3JA 1FZJA 3GSOB 4NT6A 3U0TA 1NCBL 2XN9D 4HZAA 1OM3L 4DN4H 1SM3H 3GSRA 3HNVL 1S9WB 1CDHA 5T3ZL 4G6MH 4GG6F 2VZTA 3RA7L 1WZKA 1ZT4A 1JTOA 2FCBA 4HH8A 3L5WB 3WSQH 3MLRH 1JHTA 3KPSA 3PHOA 2Z31D 1U8JB 2QHRH 3ARFA 4U1MA 35C8H 3TZVD 3V0AC 4LQFH 4G42B 3P0YH 5KZCD 4ODWA 3RVWD 2QBWA 1AGCB 3IXTB 3CJJA 2ADFH 3PGCA 2X40A 5EZJA 5C0BB 3B5HA 3GUTB 4RGMB 4EDXA 2CGRL 2D7PA 4YHKL 1G6RL 1DN0A 1W2KT 4S1DD 1ADQL 4RA3A 4X99A 5D4QA 3F58H 4R4NC 1I1YB 4A2LA 4Y16D 1SYVA 5C9JA 1HH6A 3JV6A 2AJUH 1CD8A 4ZAKD 2B0SH 2Y72A 4PJHA 5C0BE 5KSAB 4ZO6A 4HIJB 5L7XL 1G9ML 5JOPE 3BKCL 1MHCA 1HQRB 2OL3A 3NA4A 4YHIA 3VXPB 3MGOB 3CIQA 5TDNB 4L29A 1JGEA 3MRIB 4MMZC 3ZKSD 2HFFB 4QF1B 1KG0A 1JF6A 1QVOB 1Y6MR 3TA3D 5I9QC 1TTUA 5DLMH 1P7QD 3I6KA 2NX5A 2XWTA 3LKSB 2J8HA 5C09B 4KC3B 4H26B 2WLYA 3RWHB 2YD3A 5MP6H 4HUVB 5FB8B 5T5NG 3IKKA 5T3ZD 2HVJA 1FAIL 4WW1B 2CO7B 1F5WA 3MLVL 4ODTH 1FL5A 4YZFF 1WIPA 2IMMA 5C09E 2DQUL 5LGJB 2W9LA 2E7LA 1WFOA 5F1SA 4D0CA 1NC2D 5DYOB 4P5MA 3QHZL 3TJEH 2F54D 5B4MC 2AEQL 4JM2C 3NABL 2H6PB 5IW1B 2VISA 3QT2A 4YJZL 4IS6A 3ZYIA 2R9HD 2P8MA 1CG9B 4XH2B 2VDLH 4GRWH 3O2VH 4MA8H 2YC1B 4LNRB 4LDOB 4OJFH 1WK0A 1BQHG 1CBVL 3CFCH 4QRSA 2M2DA 4ZD3H 1S7SA 4PRAB 2XG5A 3BKJH 3W0WD 3GJEB 2WP3O 1N2RB 1KF9B 5I0ZA 4KKNA 5I6XC 5FEBA 4G3YL 4UI2A 2VIRB 5LXGH 4KV5F 4K3HA 4TSBH 1Q9LA 4WWKD 2M8XA 3FTGB 4M48H 1T1XA 5EU7C 3IFOA 5DRWA 5JW5A 1MWAB 1R6VA 1IGTA 3L9RB 5C1MB 1JRHL 2ZSVA 3AVEA 4HGWA 4PRIA 3LPWA 3DUSA 5FYJD 2NY7L 4LFHG 1A7OL 1IAMA 4R0LC 4NM4H 1I9EA 3IDXH 2E6QA 2IAMA 1FNAA 3BYYA 3OBAA 3MRCB 5HY9A 4NZJA 3DETC 3QIBA 4DN4L 1SM3L 1ONQB 2NY4D 3E1F1 3ULUE 4G6ML 5IB2A 3FB8A 3ARQA 3L1OL 4ZQKA 5EBWA 1SJEB 2H41A 5DT1H 4XXDA 1JYNA 3MLRL 1YY9C 5EC1B 2QHRL 2RFXB 5CMAB 2WZPD 35C8L 4LQFL 4GG8A 4F58L 5T1KD 4RRPA 5IB5A 2NZ9C 2CD0A 1UADC 1REIA 4Y4KD 2ADFL 1AD0B 3VA6A 2VYRE 1T04B 5IB4A 4G9FB 1QSZA 2G5BA 2P43B 2D3VA 4QO1A 1KELH 3F58L 5CEYA 4RFEB 2E9IA 4HJGB 3BQUB 2FJFB 2AJUL 2IANA 4CMMB 5CEXA 4PGCA 3TYFB 5CJOH 4XXCC 2P5WA 4N90E 4G9FE 5EBLA 1F4WH 3SCMC 3T4AA 2ID5A 2LABA 4WIQA 3WV0A 4IOFD 1XR8A 5CFHA 4IOSD 4Z7OF 1DUZA 4NJAH 4I18A 3LKNB 3RKDD 1KIRB 3G5VA 1P2CA 4ONGL 1J5OH 2EIEA 3U46B 1N6UA 1A7NL 2YEZA 5FYJU 4BFEA 1XGUB 2GJ6A 4XTRD 4I0PA 5DLML 4MCZA 3S36X 4BUHA 1JV5A 1KJ2H 2VERN 1KPVA 5MP6L 4LDEB 3VFNB 1ITCA 5IVZA 4BFGA 4LSPH 5JIHA 1BBJB 4ODTL 3PL6B 5I74C 5E08L 3D48R 5EIIA 3OGCB 3UTTD 3QI9B 1A5FH 5JUEH 1F6LL 4NQCA 5F7YC 4JDVA 4WU5B 2ZG3A 1GC1C 2XWJA 1RJYB 2RCSL 5EPMB 4RWHA 4OUUA 4X7FC 3GSQA 4WTXA 3TJEL 4LEOA 4U1HA 1T7VA 1WBXA 3A0OA 3WKNA 4FQ2H 2VDLL 4X9HA 3O2VL 2CRMA 4NGHL 1MHHB 1G0XA 3FT3B 1R5VA 4JKLA 4H5SA 4MDJA 3P0VH 3CFCL 1ZT7B 4ZD3L 4OF7A 3O41B 3PUCA 4MX7B 1F4YH 3CXHK 5IBUB 2E8YA 4NO2B 5CSZB 1U8PA 5LXGL 4IM8A 4TNWF 4WEMB 1I7UA 4KVNH 1H9VA 4E42A 1AR1C 5FV1L 4M48L 4BZ2L 3DGGB 2YUVA 3MUZ1 4R96A 3IGAA 5BQ7B 1VFOA 3BWAA 1LP9F 1SEBA 2J7LA 1KYOJ 1X5AA 5ICZA 2P24B 1TJGH 1BOGA 3NCFB 4NM4L 3QBTB 3CDGB 4P57A 2ORBL 3STLA 1BLNA 4K71C 5DQJB 1T1ZB 4QOKD 5I15H 4EVNB 1NBVL 3WFHB 4OCLC 1IAII 2DWDA 5DT1L 3MUJA 3SY0A 5BCAA 4P2QA 2ZOKA 4O51A 1Q9WB 5T1LA 4ACPA 2NY5H 3KDMA 4Y5VB 4NRYA 1OP9A 5GGTH 5D2LA 5HI4D 2XWBB 3NPSB 4QXGH 1PDKA 4I77H 4LLUB 2BVPB 3U36B 4FNLH 1NMBL 4OI7A 4XAWH 1Q0XH 1HHJA 1WBYA 5GS2D 1HHGA 1UKTA 2B5IC 1K4DA 4WW2A 1I8IA 1I8KA 2WM0A 12E8H 2VZUA 4WFGD 5C08D 4HDIB 3STZB 3GMMA 4NZDA 4Y4FC 5CJOL 5IF0B 1CDGA 4L8DA 4EXPX 5DD3H 3MBEA 4Z7NE 1RZ8B 2O93L 1CLZH 2BVOB 3R0NA 1CI5A 1XFPA 3A6BL 1FORH 1NL0H 3HC3H 2ZUQC 2FLBT 5D1ZB 4EI5D 5DJYB 1S9VB 4EBQH 4OZGA 1QR4A 5J89A 5C6WH 4EOWL 4KQ3H 3WUWB 4O58H 4HKJA 5HPMA 3TBWB 1SBSH 2AJSL 1KJ2L 4KI5F 3TN0C 4BSVB 3DXAB 1F4HA 4IRSC 1JE6A 3IAGC 1EIBA 1XGPB 2GCYA 5KAQF 4LSPL 3UJJH 3ZMRA 3IFLH 3MV7B 1WWCA 4QT5A 1I3RA 4OKVA 3V5DB 2YUXA 5D7SH 5JUEL 3VCLB 5L88H 3QFJB 4FZ8H 4JPWH 3VA2C 2B39A 3ESUF 4K8RC 4XX1E 4L3EA 2HJFA 3VXUA 3DXAE 5D7LA 5IV2A 5TQ2H 1X5XA 4P5KA 4OFPA 4QRPA 3E2HC 3MV7E 3ROLB 5J1AB 4TULH 2AS5M 2ZSWA 2EO9A 4EI6B 3QFJE 1MELA 1IKFL 4FQ2L 3MACH 3KPMB 1W8OA 1AQDB 3ECBA 1A9BA 1RK1A 3ARZA 5E8OA 4NPYA 3PABB 2Q3AA 3P0VL 3TH3T 4TUKL 3TIDA 1F4YL 3UEZA 3HZYA 3CSPA 4F8QA 4W6XB 2GSGB 4B5EA 4GOSA 3T77B 5BZWA 5C0ND 3M1BA 1I1FA 1RSFA 4H0GA 3MLUH 3UBXA 1WJ3A 4GQPH 3U79A 3CC5A 2VLJA 3F8UB 3O8XB 1FZOA 1TJGL 1BZ9A 2ZG2A 2V7HB 1Z9SA 3WFCL 1P7KA 2VZOA 3IDGB 3MRQA 2O5ZL 1D6EB 1IGMH 2KL6A 4PB9H 5I15L 3TGXA 5BRZD 1AGFB 4PYHA 3O3UN 3BISA 4M3JA 1ZSDA 4PYGA 2Z93A 1J18A 3FQXB 5GS3A 3U4BL 5HGBB 1S9YA 2BOBA 4NHCL 1DVFC 4YHNB 1HHKA 2NY5L 1XF1A 3MRJA 1RK0A 1IARB 1B2WH 5GGTL 5JOEA 5EG6C 2D2OA 4QXGL 4TPRH 3VXQA 3WDHA 4QWWD 4I77L 1UYWL 1U6AH 1BHGA 1CS6A 4LLQB 4S10A 5C0FA 1ETZB 1Q0XL 3PJSB 2NXYD 5D5MA 4J12A 5KN5B 3ULUF 1YJDH 4HS6B 2IC2A 3VDBA 12E8L 4K9EH 5K9OB 1K5NA 2X9XA 1MIMH 2FD6H 1JWUB 3QG6A 3O6LH 1ZE3C 5I8KH 2VE6A 5DD3L 2O5YH 1OGAE 1CLZL 1T0NA 3FCTB 3DTXB 4MJID 1FORL 3AB0B 4Y2OA 1H0DB 1NL0L 3HC3L 4JZJC 4XVUD 3EKCA 4NHUA 3AAZA 1CD0A 5EUKA 4EBQL 1RU9L 3S8WA 2HT4C 4NQSB 4OFYD 4KQ3L 2I9TB 4O58L 4KHXH 4C57C 2EE2A 5GGVY 3LH2H 2AI0H 4JVWA 1ZVHA 2CIKB 1RI8A 1JPGA 43CAA 2O26U 3LEXA 1MAMH 1AHWA 3IFLL 4NFDA 3SHSA 5D7SL 3MMEB 2NNAB 4FZ8L 2ICEB 4JPWL 3U2SA 4EN3C 4QTIH 4Y4HC 5TQ2L 1NUGA 5JXEA 4ZUWB 2Q3ZA 5LQBH 1N7MH 1NKRA 3KLHD 2DLFL 3FO9A 1RUQH 3L3JA 4TULL 4LKXB 4PRPB 3BEVA 2VXSH 3RZCB 5CD3B 4N0FB 4HFWB 1ZHNA 4BUGA 5ENWA 4ZFGL 4QHNB 5H35B 3K81A 2E9WA 1H3WM 3MACL 2BVQA 2RIKA 4IHOB 4MXVF 1PZ5B 4IEFB 5HD8D 4N0UB 1LNUA 4P5TC 5EU7E 5F96H 3RWDA 4HGMA 1DBAH 3VD5A 4PUBL 3DOSA 4YDKH 1NLBH 4PRPE 4LP4A 4HBQA 1NBZA 4J4PC 1U8MB 4MXQD 1FZJB 3U0TB 3U7WH 4B50A 4R6UA 2P8PA 1L9NA 1X9QA 3GSRB 3FRUB 3BZFB 3P77A 5CWSB 1T20A 1RIHL 4LRNH 3MOBH 4DKDC 4XB8A 3AU1A 4X4ZA 2UV3A 1T1WA 4KTDH 5SWSE 4TSAH 4PGBA 2A83A 3CFKB 5H2BA 4L9LC 3PIQA 4ODWB 4PB9L 1IGML 1TQCB 2BMKA 3P40A 5EZJB 5C07D 4EDXB 3CFBB 2YRZA 1YC8A 1I1AA 2CK2A 5E70A 3MFFA 1HH6B 2VKWA 4UAOC 4HCRA 1BZQK 3WIIH 3QDGD 4QRQA 4Y5YC 4CNIA 1B2WL 3PWUA 4BK5A 1MHPH 2IPTH 4PJ9A 4TPRL 2DWEA 2J6EL 4LSVH 3V7MA 1GIGH 1QEWA 2MQ0A 1RZGB 1OP5H 2AJ3A 3QPQC 3AS0A 1F8TL 4K9EL 4PJ8C 3TEUA 4JM4H 1KG0B 4LGPB 4MNQB 3REWA 5MI0C 4W68A 4HKXA 4HMEA 1MIML 1KENH 2XWTB 3H3PH 3O6LL 3P9MA 1G7JB 5I74B 1J0IA 5KSBE 4FMFA 1GAFL 2O5YL 5I8EB 4W70A 3TT1H 4ZXBA 2HVJB 4MNQE 1FL5B 4YIQA 1T4KA 2H2SC 3HR6A 5EZLA 4PGEB 1BQUA 1OP5K 1CFTB 4KHXL 1VESA 3LQZA 3LH2L 4KY1H 3QJHA 4KJQD 2LAAA 3MV8D 2VISB 4IBLT 4JPKH 5F70A 5MENB 3TVMC 1MAML 4MD4A 4Z7NF 3BGMA 4JKPH 5E2TL 1X3DA 1ZVSA 3NCYS 2APVA 5DRXB 2MCPL 1PEWA 3DX9B 1IM9A 3LHPL 4FXKB 3WIHA 4QTIL 1D5IH 4AEEA 2EIZA 4X6CF 3HRZB 1VFBA 3UTSA 1HEZA 4LLVA 5MENE 4JHBA 4ORGA 5T3XE 5LQBL 5DHVA 3FFCD 5HHOB 3G9VA 5E2JA 4KJPD 2VXSL 1O0VA 1Q9LB 1T1XB 1YUHA 3MRDA 3IFOB 3SGEH 1MFBH 5DRWB 5JW5B 1HDMA 2C3GA 1IGTB 2EDWA 5CEZE 4K71B 1X5YA 2ZSVB 3LZFH 5F96L 4X6FA 1U36A 1DBAL 5HHOE 4YDKL 5HHVH 5EU6D 1QKZH 3PXHA 3ARBD 1HILA 4XCYA 3TV3H 5GJSH 3QIBB 2VB5A 1INEH 5IB2B 4ZQKB 1ZA6B 4X9FA 4LRNL 5IGXH 1X5LA 3P11H 1D9KD 1P84J 4XXDB 1VDGA 5K9QI 1X5ZA 4ODUA 1JHKH 4HV8A 4W6YB 3DMMD 3FHQA 3EUUA 3PG2A 4KTDL 5IESH 3R1GH 2YD9A 4WGVB 2B5IB 4EEEA 3KXFE 5IB5B 3NIGE 1R5IA 1I85C 5GQBA 3OXRB 3CD4A 4Y4FB 1F13A 4U0RB 3DECA 5INCA 2BSTB 4LQ1A 3JVGA 2VL5A 5C0CD 2CK0H 2IANB 5CCKH 3IVKA 3WIIL 3IDJA 1K2DA 3REVB 1IC4H 3SOBH 1UM4H 4ZNCD 3D39D 4MJ6B 4QY8A 4DUWA 2WAHA 3ARDA 3BH9A 4PP2A 1DN2A 4GKOA 3O3BA 4YBLB 1DUZB 4LSVL 5KOVC 1BREA 5IIEB 1FL3A 2IANE 4F7MA 1U93A 3VH8B 2YA2A 1P2CB 3R8QA 2AERT 4LIQE 2YZ1A 4WVRA 4JM4L 1AO7D 2GJ6B 4IRSB 1DR9A 5EN2A 1TCRA 1NCAH 3O3DA 1KENL 1J1XH 1JV5B 3H3PL 3MLZH 3HUJF 1BVLA 3TWCH 1DE4A 4XZUA 2ARJQ 1QHOA 3MR9B 3TT1L 2HKFH 1NJ9A 3HE6D 3PQYA 2GJ6E 1CVRA 5JHDB 3CGTA 3E2HB 2I27N 3EYUH 2WIMA 2WSKA 2LTQB 2ADIA 2V2TA 4LPCA 5E4EC 3X3GH 3GSQB 2N4IA 4F33A 5J1SC 4LEOB 3HG1D 3IXAB 4GW5A 4KY1L 1CN4A 1FDLH 5JHDE 3CSYA 2BZDA 1WBXB 3H42L 4JPKL 5CLWA