3S5TA

Crystal structure of a member of duf3298 family (bf2082) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
257
structure length
253
Chain Sequence
KNTGALEFDSIQVNETAHLFGDTAKPACNLTINFAYPVKSTDNKLKDSLNSYFIAACFGEGYIGEKPAQVVKEYTEHYVKEYRTDLEPMYAEDEKNKSIGAWYSYYKGIESHVQLYYKNLLVYRINYNEYTGGAHGIYMTTFLNMDLINLRPLKLDDIFTGDYKEALTDLLWNQLMADKKVTTHEALEDMGYGSTGDIAPTENFYLDKDGITFYYNVYDITPYAMGPVEIKIPYEMMEHMLGSNPIIGEMKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUF3298 family protein
publication title Crystal structure of a Member of DUF3298 family (BF2082) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 65
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3s5tA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3s5tA02
3CYGA 2HHIA 3S5TA 4E72A 5JENA
chains in the Genus database with same CATH superfamily
5FNCA 1UYEA 2A42A 1Y8OA 4KTNA 1K8KA 4RWTA 3HYZA 4XEIA 5AQIA 3GIFA 5EY4A 4FCQA 5M4NA 3INXA 5BN9A 5AQSA 3OPDA 5AQPA 5D7RA 1YVNA 2WEPA 4E02A 3CJCA 3LNUA 4CZFA 3QDDA 3B28A 2YEEA 3ATVA 1XQSC 3G7BA 2BTZA 2Q97A 4WYBA 4L91A 4HXWA 1TC6A 5C93A 2CG9A 1U2OA 4U93A 5AQNA 1YSRA 1HJOA 3UKUA 4BIUA 4GNIA 2XJJA 4O09A 1NGGA 4BECA 1GKZA 2QW9A 4CZGA 2YEIA 3B27A 4XCJA 1BKNA 4GT8A 5BPLA 2YE9A 2XX4A 4HXZA 4NH8A 4XC0A 1E4FT 5F0XA 3HHUA 4MBCA 3T1KA 4CE2A 3MMVA 4GQTA 3DXKB 1QZ5A 4ASBA 1YT2A 3HZ1A 4H0TB 3R91A 1U2VA 3TU5A 5JLHA 3PEHA 4LWIA 4XKKA 1Y8NA 2XHXA 4KBOA 3EKUA 1UY9A 2XX2A 5AQRA 3A0XA 3R4OA 4AWQA 4JAVA 2YEAA 4O07A 1U0ZA 2QG0A 3TZ2A 1DEJA 4CWOA 1UYFA 4PL9A 3MN9A 2P9UB 5EX5A 3OWBA 4YKTA 3A5OC 2YJFA 4R3AA 4CWNA 2P9NA 4JHDA 3K99A 4H81A 3L6QA 3CWVA 3U2DA 3U2KA 3LPSA 4JASA 3EKOA 1TBWA 2QG2A 4B7PA 2P9IB 5AQYA 5BPNA 1AH6A 4FL9A 4EGIA 4J8FA 3M3ZA 4XKOA 3MN6A 4PL7A 2IOPA 3D2FB 2FF6A 2YEHA 3WHAA 2O1UA 2P9PB 2YJEA 4A2BA 3ULEB 3CIPA 4FSVA 2P9LA 3A5MC 3LDOA 2FWYA 4W7TA 4AS9A 3O2FA 4PRVA 1BGQA 4LWGA 4KFGA 2FTKA 2EXLA 1UYKA 4KSGA 1TIDA 4FMTA 4EEHA 5M4HA 1THNA 2QWOA 1JCEA 1B3QA 1H7UA 3U8XA 4WUCA 4X9LA 3DXMB 3EHGA 1H7SA 2Q8FA 2YE6A 4JD2A 4HY1A 1NGAA 1C0FA 4FPPA 1I59A 5AFUA 3OW6A 2XCMA 2JJCA 5D6PA 3ZKBA 3WQ9A 1I5BA 4BQGA 4B1WB 1MU5A 3B24A 3VHAA 1PVGA 3IEDA 4E00A 1UY7A 3HSCA 1NM1A 1S16A 4CZMA 5I9EB 3WEEA 4MPEA 3TUHA 1NHHA 2YJWA 4LPBA 4H03B 1L0OA 2WI2A 5AQJA 2WI4A 5EXWA 4L93A 5CPHA 1TYQB 3SL2A 5AR0A 4Z94A 5M4EA 1YC3A 5AQXA 2OANA 4NH9A 4H5TA 4K4OA 3TZ0A 2ZBKB 3C7NA 4I3HA 3DAWA 3FE1A 5F5RA 1QZRA 3A5LC 3BM9A 4XIPA 3W3DA 4ASFA 2YE3A 3UKRA 4XIRA 4E72A 4UROA 4CWTA 1S3XA 2BUPA 4GY2B 1AM1A 2ZKJA 1HX1A 1AJ6A 5M4PA 3KVGA 5M4MA 3QMLA 3EL2A 4JQLA 1NWKA 5J6AA 4PU9A 4YKWA 2QWMA 2HCHA 3SJHA 4H0YB 2VWCA 3CRKA 3ZXQA 3U9ZA 3T2SA 3C11A 4RTFD 3G7EA 4BE7B 5FWKA 1NGFA 4PKHA 2XD6A 3VHCA 1I58A 3EKRA 3GIEA 4ASGA 4BAEA 2UWDA 4B1YB 1UYCA 4CBUA 1H1VA 4MOTA 2FYPA 1YSZA 4XITA 1TH8A 2V7ZA 5AQTA 3GIGA 1NGHA 2FXSA 4B1UB 2BU8A 1NHJA 1UYIA 5CF0A 3Q5KA 3GDQA 1YT1A 2BTFA 4LP0A 2KHOA 2XJXA 1KAYA 3D2EB 5CTXA 3DXKA 4MP2A 3LDQA 4H5RA 2YGFA 3OMUA 3CGYA 4PL8A 1Y4UA 2XHRA 1Y64A 3VHDA 1F51A 3MN5A 4U7OA 2V52B 2XABA 2HF3A 2YEJA 3A0RA 1LOTB 5FPDA 1BYQA 1BXDA 2P9SA 2O1WA 2BU7A 4M63C 2YI0A 1YXQA 3R4PA 3HBTA 4EFUA 2P9UA 4BIZA 4BQJA 1K8KB 3ATUA 2WI5A 4WUDA 1MDUB 4GEEA 4E01A 2YE8A 1KIJA 3CRLA 1SQKA 4EFTA 2QWPA 2Q8HA 4GFNA 4EM7A 1YC1A 3ZKDA 2D1KA 5AQVA 2XDLA 1EA6A 4URNA 4QPJA 5FNFA 4AM6A 1BA0A 2CCUA 2IWSA 4O0BA 1ATRA 4CBXA 1S14A 2YI7A 3FT5A 2BYHA 3KE6A 4AWOA 1QY8A 4I6MA 4B6CA 3AY9A 5AQMA 1Z5AA 1TILA 2GWJA 2Q0RA 1US7A 3T0HA 3FV5A 5J71A 4H5WA 3QFUA 4K43A 4LWHA 2ZWHA 2V7YA 2YK9A 3K97A 5L3JA 4L90A 4CZEA 5CTYA 4B1XB 3GL1A 5ADXH 2YJXA 1ID0A 4LWEA 4XD8A 1C0GA 1U2VB 3QB0A 3K98A 3U67A 3MN7A 3HYYA 4PKIA 1NGIA 3M1FA 2E0AA 2PAVA 3RLRA 5AQOA 1IXMA 2VCPA 4FCPA 1Z59A 2YEFA 3RLQA 1UYGA 2YKIA 2ASPA 3H4LA 4L94A 4L8ZA 2WERA 2YKJA 2Q1NA 4KQVA 4MB9A 2P9NB 3EKSA 3A0YA 4JHDB 2YGEA 4IO8A 2BU2A 4V25A 1IJJA 3EHFA 5IDJA 4K41A 1Z5BA 4ZKIA 1T44A 3A0WA 2QF6A 2HG1A 5AQLA 1YETA 5D7CA 3UE5A 2GQPA 2QWNA 3CGZA 1NGCA 3TPQA 2P9LB 1JCFA 3R4MA 5AQQA 1DKGD 3FZMA 4EFHA 2YE4A 2XDKA 2XJGA 1HLUA 3S5TA 2CGFA 1ATNA 2IWUA 4XTJA 5FNDA 4CZIA 5IN9A 1QQNA 1UYMA 1QZ6A 5BN8A 2K5BA 5GGZA 4JAUA 3FFKB 4XCLA 3ZM7A 4JD2B 2BSMA 2FF3B 4R1FA 4CE3A 1Y8PA 4KSHA 3T10A 1BUPA 3LMMA 1YESA 2XDUA 4URLA 5AQKA 4K42A 2H8MA 2WI7A 2GWKA 2YKBA 2Q31A 3RSEB 4YKXA 3BUZB 2YEBA 3WEEB 2BREA 2CH4A 1S22A 2YECA 1ZW9A 1ZXMA 3Q5LA 4ASAA 1YAGA 2Q36A 3O0IA 4NH7A 1A4HA 5AQZA 2YKCA 2WEQA 3ZXOA 2QWLA 1NGJA 3C0EA 3FZLA 4YKZA 2IORA 1UY8A 1ESVA 4JNEA 4PKGA 5FPNA 4CZLA 3C7NB 1RFQA 1ZXNA 2A41A 4CZKA 4HY6A 2C1IA 3I33A 5AQHA 5F3KA 2QFOA 2BU6A 2C2AA 5F2RA 3U9DA 3UKRB 1HPMA 2W00A 2YGAA 3NMQA 2QWRA 1YC4A 4O04A 1NGDA 2FXUA 1UYDA 1RGIA 4BEBA 3H80A 3MNRP 4A2AA 1JM6A 3G75A 4JN4A 1I5CA 2QXLA 5ADXA 1NHIA 1GJVA 2FWZA 5JENA 4HZ0A 4AWPA 2P9KB 3M6GA 3HEKA 4YKQA 1OSFA 3TTZA 3TZ5A 4HYPA 1E4GT 4GGLA 2VCJA 5FPEA 4P8OA 4H0VB 4HZ5A 2C1GA 1QYEA 2PNRA 1I5AA 3LDNA 2BU5A 4DUHA 3DWLA 5IDMA 2WI6A 3FZHA 2A3ZA 1TC0A 4DZYA 1MX0A 3EHHA 3CJBA 3VADA 4XKAA 1NLVA 1BA1A 2P9IA 4CWSA 2VCIA 1J6ZA 2CCTA 1KXPA 3GIGB 1NGEA 2XK2A 5JLFA 3D2FA 5AQUA 3RLPA 3DGEA 4B1VA 2P9PA 2BZ5A 3D2RA 5CTWA 3ULEA 4EGHA 3HZ5A 4H0XB 3PEJA 2QWQA 2Q0UA 2O1VA 4AM7A 4PRXA 3UKUB 2YEGA 4U7NA 4XJXA 1Y4SA 3JZ3A 3CI5A 3FT8A 4CWPA 5D6QA 2P9SB 4CWQA 2WUSA 3DXMA 1LCUA 2GFDA 2YE7A 1KAXA 2HF4A 4HYMA 2YK2A 3A0ZA 1B63A 4CBWA 5AQWA 1NGBA 5FPMA 1I5DA 2XDSA 2BYIA 3D36A 1D4XA 2ASOA 3R92A 3TZ4A 5TKYA 1B62A 4EMVA 5EVZA 5E84A 2VYPA 3EHJA 5D7DA 1TYQA 5BOCA 1RDWX 2WI3A 2Q8GA 1UYLA 3LDLA 4H5NA 5F1XA 3CYGA 4XDMA 1YT0A 4B1ZA 3CHWA 3A8YA 3JXUA 4I6MB 2ZDXA 3J8AA 2HHIA 4V26A 3LDPA 2XDXA 3CQXA 3QFPA 2HKJA 3Q5JA 5CE3A 2E8AA 4B9QA 3INWA 4WUBA 5CTUA 5BPMA 2YE5A 4QPKA 1YS3A 2WI1A 3BMYA 3K60A 4I5SA 1AMWA 1UY6A 4H85A 5BODA 2YI6A 2PBDA 4O05A 2A5XA 4H5VA 3B25A 4YKYA 2YI5A 4CWFA 4KP4A 1YUWA 4CWRA 5AQGA 3RSEA 2BRCA 3U4LA 4R3MA 1EQYA 1WUAA 2XX5A 5M4KA 3D0BA 2XHTA 3O6OA 3L4IA 2YEDA 2Q8IA 4BXIA 4MP7A 4MPCA 3A5NC 1EI1A 2H55A 3R4NA 2ZDYA 1ATSA 2HMPA 3IUCA 4HWIA 4CZHA 2CCSA 5AQFA 4EGKA 1QQMA 2VW5A 4YKRA 2IWXA 2E88A 4GCZA 1MA9B 4P7AA 3RKZA 3QTFA 1KAZA 1Z5CA 2V51B 3FZKA 3T0ZA 1QQOA 1NMDA 4XE2A 4CE1A 1KZNA 4H7QA 1UYHA 1AH8A 1JCGA 4LWFA 1ZWHA 3A0TA 3D2EA 4FO0A 4URMA 4MPNA 1YERA 4CI6A 4CZJA 3OWDA 1GKXA 2BT0A 4YKUA 1P8ZA 1R62A 2IOQA 4XIQA 4EAHD 2JKIA 3FZFA 2ESAA 3UB5A 2P9KA 2Q2EB 2AKPA 4Q20A 4ZVIA 2YKEA 2YE2A 3B26A 4FCRA 2ASMA 5AFUH 2A40A
chains in the Genus database with same CATH topology
3CYGA 2HHIA 3S5TA 4E72A 5JENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CYG A;  2HHI A;  3S5T A;  4E72 A;  5JEN A; 
#chains in the Genus database with same CATH topology
 5FNC A;  1UYE A;  2A42 A;  1Y8O A;  4KTN A;  1K8K A;  4RWT A;  3HYZ A;  4XEI A;  5AQI A;  3GIF A;  5EY4 A;  4FCQ A;  5M4N A;  3INX A;  5BN9 A;  5AQS A;  3OPD A;  5AQP A;  5D7R A;  1YVN A;  2WEP A;  4E02 A;  3CJC A;  3LNU A;  4CZF A;  3QDD A;  3B28 A;  2YEE A;  3ATV A;  1XQS C;  3G7B A;  2BTZ A;  2Q97 A;  4WYB A;  4L91 A;  4HXW A;  1TC6 A;  5C93 A;  2CG9 A;  1U2O A;  4U93 A;  5AQN A;  1YSR A;  1HJO A;  3UKU A;  4BIU A;  4GNI A;  2XJJ A;  4O09 A;  1NGG A;  4BEC A;  1GKZ A;  2QW9 A;  4CZG A;  2YEI A;  3B27 A;  4XCJ A;  1BKN A;  4GT8 A;  5BPL A;  2YE9 A;  2XX4 A;  4HXZ A;  4NH8 A;  4XC0 A;  1E4F T;  5F0X A;  3HHU A;  4MBC A;  3T1K A;  4CE2 A;  3MMV A;  4GQT A;  3DXK B;  1QZ5 A;  4ASB A;  1YT2 A;  3HZ1 A;  4H0T B;  3R91 A;  1U2V A;  3TU5 A;  5JLH A;  3PEH A;  4LWI A;  4XKK A;  1Y8N A;  2XHX A;  4KBO A;  3EKU A;  1UY9 A;  2XX2 A;  5AQR A;  3A0X A;  3R4O A;  4AWQ A;  4JAV A;  2YEA A;  4O07 A;  1U0Z A;  2QG0 A;  3TZ2 A;  1DEJ A;  4CWO A;  1UYF A;  4PL9 A;  3MN9 A;  2P9U B;  5EX5 A;  3OWB A;  4YKT A;  3A5O C;  2YJF A;  4R3A A;  4CWN A;  2P9N A;  4JHD A;  3K99 A;  4H81 A;  3L6Q A;  3CWV A;  3U2D A;  3U2K A;  3LPS A;  4JAS A;  3EKO A;  1TBW A;  2QG2 A;  4B7P A;  2P9I B;  5AQY A;  5BPN A;  1AH6 A;  4FL9 A;  4EGI A;  4J8F A;  3M3Z A;  4XKO A;  3MN6 A;  4PL7 A;  2IOP A;  3D2F B;  2FF6 A;  2YEH A;  3WHA A;  2O1U A;  2P9P B;  2YJE A;  4A2B A;  3ULE B;  3CIP A;  4FSV A;  2P9L A;  3A5M C;  3LDO A;  2FWY A;  4W7T A;  4AS9 A;  3O2F A;  4PRV A;  1BGQ A;  4LWG A;  4KFG A;  2FTK A;  2EXL A;  1UYK A;  4KSG A;  1TID A;  4FMT A;  4EEH A;  5M4H A;  1THN A;  2QWO A;  1JCE A;  1B3Q A;  1H7U A;  3U8X A;  4WUC A;  4X9L A;  3DXM B;  3EHG A;  1H7S A;  2Q8F A;  2YE6 A;  4JD2 A;  4HY1 A;  1NGA A;  1C0F A;  4FPP A;  1I59 A;  5AFU A;  3OW6 A;  2XCM A;  2JJC A;  5D6P A;  3ZKB A;  3WQ9 A;  1I5B A;  4BQG A;  4B1W B;  1MU5 A;  3B24 A;  3VHA A;  1PVG A;  3IED A;  4E00 A;  1UY7 A;  3HSC A;  1NM1 A;  1S16 A;  4CZM A;  5I9E B;  3WEE A;  4MPE A;  3TUH A;  1NHH A;  2YJW A;  4LPB A;  4H03 B;  1L0O A;  2WI2 A;  5AQJ A;  2WI4 A;  5EXW A;  4L93 A;  5CPH A;  1TYQ B;  3SL2 A;  5AR0 A;  4Z94 A;  5M4E A;  1YC3 A;  5AQX A;  2OAN A;  4NH9 A;  4H5T A;  4K4O A;  3TZ0 A;  2ZBK B;  3C7N A;  4I3H A;  3DAW A;  3FE1 A;  5F5R A;  1QZR A;  3A5L C;  3BM9 A;  4XIP A;  3W3D A;  4ASF A;  2YE3 A;  3UKR A;  4XIR A;  4E72 A;  4URO A;  4CWT A;  1S3X A;  2BUP A;  4GY2 B;  1AM1 A;  2ZKJ A;  1HX1 A;  1AJ6 A;  5M4P A;  3KVG A;  5M4M A;  3QML A;  3EL2 A;  4JQL A;  1NWK A;  5J6A A;  4PU9 A;  4YKW A;  2QWM A;  2HCH A;  3SJH A;  4H0Y B;  2VWC A;  3CRK A;  3ZXQ A;  3U9Z A;  3T2S A;  3C11 A;  4RTF D;  3G7E A;  4BE7 B;  5FWK A;  1NGF A;  4PKH A;  2XD6 A;  3VHC A;  1I58 A;  3EKR A;  3GIE A;  4ASG A;  4BAE A;  2UWD A;  4B1Y B;  1UYC A;  4CBU A;  1H1V A;  4MOT A;  2FYP A;  1YSZ A;  4XIT A;  1TH8 A;  2V7Z A;  5AQT A;  3GIG A;  1NGH A;  2FXS A;  4B1U B;  2BU8 A;  1NHJ A;  1UYI A;  5CF0 A;  3Q5K A;  3GDQ A;  1YT1 A;  2BTF A;  4LP0 A;  2KHO A;  2XJX A;  1KAY A;  3D2E B;  5CTX A;  3DXK A;  4MP2 A;  3LDQ A;  4H5R A;  2YGF A;  3OMU A;  3CGY A;  4PL8 A;  1Y4U A;  2XHR A;  1Y64 A;  3VHD A;  1F51 A;  3MN5 A;  4U7O A;  2V52 B;  2XAB A;  2HF3 A;  2YEJ A;  3A0R A;  1LOT B;  5FPD A;  1BYQ A;  1BXD A;  2P9S A;  2O1W A;  2BU7 A;  4M63 C;  2YI0 A;  1YXQ A;  3R4P A;  3HBT A;  4EFU A;  2P9U A;  4BIZ A;  4BQJ A;  1K8K B;  3ATU A;  2WI5 A;  4WUD A;  1MDU B;  4GEE A;  4E01 A;  2YE8 A;  1KIJ A;  3CRL A;  1SQK A;  4EFT A;  2QWP A;  2Q8H A;  4GFN A;  4EM7 A;  1YC1 A;  3ZKD A;  2D1K A;  5AQV A;  2XDL A;  1EA6 A;  4URN A;  4QPJ A;  5FNF A;  4AM6 A;  1BA0 A;  2CCU A;  2IWS A;  4O0B A;  1ATR A;  4CBX A;  1S14 A;  2YI7 A;  3FT5 A;  2BYH A;  3KE6 A;  4AWO A;  1QY8 A;  4I6M A;  4B6C A;  3AY9 A;  5AQM A;  1Z5A A;  1TIL A;  2GWJ A;  2Q0R A;  1US7 A;  3T0H A;  3FV5 A;  5J71 A;  4H5W A;  3QFU A;  4K43 A;  4LWH A;  2ZWH A;  2V7Y A;  2YK9 A;  3K97 A;  5L3J A;  4L90 A;  4CZE A;  5CTY A;  4B1X B;  3GL1 A;  5ADX H;  2YJX A;  1ID0 A;  4LWE A;  4XD8 A;  1C0G A;  1U2V B;  3QB0 A;  3K98 A;  3U67 A;  3MN7 A;  3HYY A;  4PKI A;  1NGI A;  3M1F A;  2E0A A;  2PAV A;  3RLR A;  5AQO A;  1IXM A;  2VCP A;  4FCP A;  1Z59 A;  2YEF A;  3RLQ A;  1UYG A;  2YKI A;  2ASP A;  3H4L A;  4L94 A;  4L8Z A;  2WER A;  2YKJ A;  2Q1N A;  4KQV A;  4MB9 A;  2P9N B;  3EKS A;  3A0Y A;  4JHD B;  2YGE A;  4IO8 A;  2BU2 A;  4V25 A;  1IJJ A;  3EHF A;  5IDJ A;  4K41 A;  1Z5B A;  4ZKI A;  1T44 A;  3A0W A;  2QF6 A;  2HG1 A;  5AQL A;  1YET A;  5D7C A;  3UE5 A;  2GQP A;  2QWN A;  3CGZ A;  1NGC A;  3TPQ A;  2P9L B;  1JCF A;  3R4M A;  5AQQ A;  1DKG D;  3FZM A;  4EFH A;  2YE4 A;  2XDK A;  2XJG A;  1HLU A;  3S5T A;  2CGF A;  1ATN A;  2IWU A;  4XTJ A;  5FND A;  4CZI A;  5IN9 A;  1QQN A;  1UYM A;  1QZ6 A;  5BN8 A;  2K5B A;  5GGZ A;  4JAU A;  3FFK B;  4XCL A;  3ZM7 A;  4JD2 B;  2BSM A;  2FF3 B;  4R1F A;  4CE3 A;  1Y8P A;  4KSH A;  3T10 A;  1BUP A;  3LMM A;  1YES A;  2XDU A;  4URL A;  5AQK A;  4K42 A;  2H8M A;  2WI7 A;  2GWK A;  2YKB A;  2Q31 A;  3RSE B;  4YKX A;  3BUZ B;  2YEB A;  3WEE B;  2BRE A;  2CH4 A;  1S22 A;  2YEC A;  1ZW9 A;  1ZXM A;  3Q5L A;  4ASA A;  1YAG A;  2Q36 A;  3O0I A;  4NH7 A;  1A4H A;  5AQZ A;  2YKC A;  2WEQ A;  3ZXO A;  2QWL A;  1NGJ A;  3C0E A;  3FZL A;  4YKZ A;  2IOR A;  1UY8 A;  1ESV A;  4JNE A;  4PKG A;  5FPN A;  4CZL A;  3C7N B;  1RFQ A;  1ZXN A;  2A41 A;  4CZK A;  4HY6 A;  2C1I A;  3I33 A;  5AQH A;  5F3K A;  2QFO A;  2BU6 A;  2C2A A;  5F2R A;  3U9D A;  3UKR B;  1HPM A;  2W00 A;  2YGA A;  3NMQ A;  2QWR A;  1YC4 A;  4O04 A;  1NGD A;  2FXU A;  1UYD A;  1RGI A;  4BEB A;  3H80 A;  3MNR P;  4A2A A;  1JM6 A;  3G75 A;  4JN4 A;  1I5C A;  2QXL A;  5ADX A;  1NHI A;  1GJV A;  2FWZ A;  5JEN A;  4HZ0 A;  4AWP A;  2P9K B;  3M6G A;  3HEK A;  4YKQ A;  1OSF A;  3TTZ A;  3TZ5 A;  4HYP A;  1E4G T;  4GGL A;  2VCJ A;  5FPE A;  4P8O A;  4H0V B;  4HZ5 A;  2C1G A;  1QYE A;  2PNR A;  1I5A A;  3LDN A;  2BU5 A;  4DUH A;  3DWL A;  5IDM A;  2WI6 A;  3FZH A;  2A3Z A;  1TC0 A;  4DZY A;  1MX0 A;  3EHH A;  3CJB A;  3VAD A;  4XKA A;  1NLV A;  1BA1 A;  2P9I A;  4CWS A;  2VCI A;  1J6Z A;  2CCT A;  1KXP A;  3GIG B;  1NGE A;  2XK2 A;  5JLF A;  3D2F A;  5AQU A;  3RLP A;  3DGE A;  4B1V A;  2P9P A;  2BZ5 A;  3D2R A;  5CTW A;  3ULE A;  4EGH A;  3HZ5 A;  4H0X B;  3PEJ A;  2QWQ A;  2Q0U A;  2O1V A;  4AM7 A;  4PRX A;  3UKU B;  2YEG A;  4U7N A;  4XJX A;  1Y4S A;  3JZ3 A;  3CI5 A;  3FT8 A;  4CWP A;  5D6Q A;  2P9S B;  4CWQ A;  2WUS A;  3DXM A;  1LCU A;  2GFD A;  2YE7 A;  1KAX A;  2HF4 A;  4HYM A;  2YK2 A;  3A0Z A;  1B63 A;  4CBW A;  5AQW A;  1NGB A;  5FPM A;  1I5D A;  2XDS A;  2BYI A;  3D36 A;  1D4X A;  2ASO A;  3R92 A;  3TZ4 A;  5TKY A;  1B62 A;  4EMV A;  5EVZ A;  5E84 A;  2VYP A;  3EHJ A;  5D7D A;  1TYQ A;  5BOC A;  1RDW X;  2WI3 A;  2Q8G A;  1UYL A;  3LDL A;  4H5N A;  5F1X A;  3CYG A;  4XDM A;  1YT0 A;  4B1Z A;  3CHW A;  3A8Y A;  3JXU A;  4I6M B;  2ZDX A;  3J8A A;  2HHI A;  4V26 A;  3LDP A;  2XDX A;  3CQX A;  3QFP A;  2HKJ A;  3Q5J A;  5CE3 A;  2E8A A;  4B9Q A;  3INW A;  4WUB A;  5CTU A;  5BPM A;  2YE5 A;  4QPK A;  1YS3 A;  2WI1 A;  3BMY A;  3K60 A;  4I5S A;  1AMW A;  1UY6 A;  4H85 A;  5BOD A;  2YI6 A;  2PBD A;  4O05 A;  2A5X A;  4H5V A;  3B25 A;  4YKY A;  2YI5 A;  4CWF A;  4KP4 A;  1YUW A;  4CWR A;  5AQG A;  3RSE A;  2BRC A;  3U4L A;  4R3M A;  1EQY A;  1WUA A;  2XX5 A;  5M4K A;  3D0B A;  2XHT A;  3O6O A;  3L4I A;  2YED A;  2Q8I A;  4BXI A;  4MP7 A;  4MPC A;  3A5N C;  1EI1 A;  2H55 A;  3R4N A;  2ZDY A;  1ATS A;  2HMP A;  3IUC A;  4HWI A;  4CZH A;  2CCS A;  5AQF A;  4EGK A;  1QQM A;  2VW5 A;  4YKR A;  2IWX A;  2E88 A;  4GCZ A;  1MA9 B;  4P7A A;  3RKZ A;  3QTF A;  1KAZ A;  1Z5C A;  2V51 B;  3FZK A;  3T0Z A;  1QQO A;  1NMD A;  4XE2 A;  4CE1 A;  1KZN A;  4H7Q A;  1UYH A;  1AH8 A;  1JCG A;  4LWF A;  1ZWH A;  3A0T A;  3D2E A;  4FO0 A;  4URM A;  4MPN A;  1YER A;  4CI6 A;  4CZJ A;  3OWD A;  1GKX A;  2BT0 A;  4YKU A;  1P8Z A;  1R62 A;  2IOQ A;  4XIQ A;  4EAH D;  2JKI A;  3FZF A;  2ESA A;  3UB5 A;  2P9K A;  2Q2E B;  2AKP A;  4Q20 A;  4ZVI A;  2YKE A;  2YE2 A;  3B26 A;  4FCR A;  2ASM A;  5AFU H;  2A40 A; 
#chains in the Genus database with same CATH homology
 3CYG A;  2HHI A;  3S5T A;  4E72 A;  5JEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...