3S5TA

Crystal structure of a member of duf3298 family (bf2082) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
257
structure length
253
Chain Sequence
KNTGALEFDSIQVNETAHLFGDTAKPACNLTINFAYPVKSTDNKLKDSLNSYFIAACFGEGYIGEKPAQVVKEYTEHYVKEYRTDLEPMYAEDEKNKSIGAWYSYYKGIESHVQLYYKNLLVYRINYNEYTGGAHGIYMTTFLNMDLINLRPLKLDDIFTGDYKEALTDLLWNQLMADKKVTTHEALEDMGYGSTGDIAPTENFYLDKDGITFYYNVYDITPYAMGPVEIKIPYEMMEHMLGSNPIIGEMKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUF3298 family protein
publication title Crystal structure of a Member of DUF3298 family (BF2082) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 65
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3s5tA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3s5tA02
5JENA 2HHIA 3S5TA 4E72A 3CYGA
chains in the Genus database with same CATH superfamily
3R4PA 4GGLA 1GJVA 2YGEA 2Q8GA 1K8KB 1ATSA 2P9PB 2YEBA 4K43A 3QDDA 3G7BA 1BYQA 5M4NA 3DWLA 4I6MB 3TPQA 3K99A 2CCTA 4FL9A 1QY8A 1E4GT 4X9LA 2H8MA 3A0WA 5L3JA 2YGAA 3M6GA 3A0TA 2V7YA 3A5LC 4YKQA 3A5NC 2YE8A 2XDUA 1KAZA 5FPMA 2HF3A 2EXLA 1U2VB 2V7ZA 1BGQA 4CZJA 2XDXA 1B3QA 1IXMA 1NGGA 2BU8A 2QWLA 2K5BA 2YK9A 3FFKB 2XX2A 2XDLA 2PNRA 4FSVA 1BA0A 1I5CA 3FZLA 3INXA 3TZ0A 2BREA 4CWPA 1HPMA 3D2RA 2HMPA 4FPPA 4GFNA 4XCJA 3A0XA 1QQOA 2PBDA 2P9NB 3MNRP 1BKNA 3GDQA 2VYPA 3EL2A 5M4KA 1Y64A 3LDPA 4ASBA 1NWKA 4RTFD 2QG2A 4XIQA 2BTFA 5BODA 4JNEA 4LWFA 4L90A 1EA6A 4BIZA 1ATNA 4HYPA 2O1WA 4HY6A 4NH8A 1ZWHA 3UKRB 4H85A 3L6QA 4H0YB 4E02A 3M1FA 3ZXQA 4O07A 3LDLA 3T0HA 3D2EA 2XABA 3C7NA 4XE2A 5AQPA 4EFHA 4H0TB 2IORA 1NGIA 4DZYA 1US7A 1KAXA 3LMMA 4I3HA 5AFUA 1A4HA 3J8AA 2YJXA 3DGEA 1BUPA 3M3ZA 4CZIA 3ZKBA 1NGJA 1YXQA 3A5MC 1UYGA 1H7UA 4BXIA 4PL7A 5FNFA 5IDJA 3H4LA 4BE7B 4ASAA 2E88A 3RLRA 1UYDA 4KTNA 5D7CA 4B1ZA 5AQXA 2YI7A 4P8OA 5F5RA 3CWVA 1JCFA 5JLHA 3B26A 4HXWA 4H5RA 5AQZA 4EGKA 2HCHA 3QFPA 1JM6A 3TTZA 4CWQA 3RLQA 3PEJA 4EFTA 3HZ1A 2WI6A 2XHRA 3QTFA 4LWGA 4W7TA 3LDQA 3T1KA 2OANA 3UKUA 2WI4A 4FMTA 1TC6A 3DAWA 3MN5A 3ULEB 2BUPA 2YJWA 2IWUA 3OW6A 2Q8HA 2YJEA 2WI3A 3TZ2A 3LDNA 1UYIA 2QWQA 5D6QA 3FZKA 2E0AA 2YE7A 4JAVA 2Q0UA 1YC1A 4B1WB 4XDMA 4EM7A 2BYIA 1ATRA 1QYEA 3KVGA 5F3KA 2WEPA 2Q8IA 2BU6A 2Q0RA 2ZDXA 3U67A 2P9UB 3O6OA 1NGBA 5BN9A 4CZGA 1YESA 3A0RA 1Y8PA 3CRLA 3IEDA 4FCRA 1NMDA 1JCEA 2A41A 4CZEA 2YEJA 3QMLA 3EHGA 3G75A 4XCLA 4E72A 3TZ5A 3LDOA 1Y8NA 1ZXMA 2W00A 4I5SA 1UY8A 4PRVA 4JD2B 3HBTA 2KHOA 1PVGA 2BU5A 5CTUA 3CI5A 3GIGA 1B63A 3D2FB 3CHWA 5GGZA 5BPMA 2A40A 2QWPA 1NHIA 2QXLA 1DEJA 5AQMA 4B1VA 1I5BA 1B62A 2ZDYA 2BT0A 2WEQA 3Q5KA 4CE3A 3PEHA 1IJJA 2ZWHA 2FXSA 2H55A 4IO8A 3A0YA 4PU9A 3HZ5A 1Z5BA 4BQGA 2IOQA 4LP0A 2FTKA 3WHAA 1LOTB 2QFOA 5I9EB 1JCGA 3U8XA 4XD8A 1AMWA 4B9QA 2P9LA 2XHXA 5ADXA 2IWSA 1EI1A 4CZMA 4KSHA 3U2DA 4L8ZA 4CZHA 3FZFA 4URLA 4CBWA 4JHDA 2YKEA 5J71A 1HX1A 2YKCA 5AQLA 1YSZA 4XIRA 3R91A 4NH9A 2VW5A 3VHAA 4H5WA 5AQSA 4MP2A 5AQWA 2C1IA 2WERA 1AM1A 2WI5A 4URNA 2Q1NA 4CWFA 4XEIA 5CE3A 2YE5A 4O09A 3EKSA 1HLUA 3K98A 1THNA 1YT0A 1UY7A 1Z5AA 3EHJA 3O2FA 3OPDA 5CTYA 4BECA 3A0ZA 4R1FA 3FV5A 3ATUA 1GKXA 2AKPA 3D2EB 2Q36A 4CE1A 2YI6A 3T0ZA 2C1GA 4NH7A 1D4XA 3FZHA 4UROA 4WUBA 3A5OC 4MP7A 5BOCA 2CH4A 5D7RA 2A42A 1NGCA 4XTJA 1L0OA 3R4OA 5TKYA 5EXWA 4O0BA 1AH8A 4ASFA 1MDUB 5CTWA 2P9PA 2GQPA 2BZ5A 2WI7A 2CGFA 3FT5A 5BPNA 5AQVA 3EHHA 3FT8A 4I6MA 5AQFA 2O1UA 1UYEA 2D1KA 1S22A 2HF4A 2YE6A 4A2AA 1ESVA 1QQNA 1ZW9A 1SQKA 3CJCA 1Y4UA 4WYBA 4CBXA 3SJHA 1U0ZA 3GL1A 1UY9A 2IOPA 5AQIA 3OWBA 1TYQA 3GIFA 4H03B 3UKUB 1Z59A 2YGFA 3S5TA 5AFUH 1YUWA 2V52B 4YKRA 5AQGA 3O0IA 1UYFA 4U93A 2GFDA 3B24A 4BQJA 4GT8A 4CZKA 2WUSA 4R3AA 3B27A 4GQTA 1LCUA 1C0FA 3WEEA 1ZXNA 4P7AA 4YKUA 2QWNA 2P9NA 3ZM7A 2HG1A 4CWOA 3RSEA 1TC0A 2FWYA 3NMQA 3A8YA 5AQKA 2VCIA 4AWPA 4JN4A 4XKAA 5E84A 5AQHA 2XJJA 5IN9A 4URMA 3U9ZA 2VWCA 5AQRA 4H0VB 2XDKA 3BMYA 3JZ3A 4B1XB 4FO0A 5M4EA 4XIPA 2C2AA 3AY9A 5FPDA 2Q31A 5D7DA 1RGIA 4CWRA 4PL9A 5EX5A 3H80A 4CBUA 4BEBA 3GIGB 4AM7A 5AQJA 4E00A 3Q5JA 3FZMA 3RLPA 3FE1A 1BA1A 4GEEA 2P9KB 4M63C 4U7NA 1I59A 1NGAA 3UB5A 1I5DA 1YC3A 3OWDA 4R3MA 3SL2A 2VCPA 1DKGD 4RWTA 5F2RA 3D36A 2P9SA 4PRXA 3BM9A 4YKWA 1UYHA 3TU5A 4CE2A 3LNUA 3CQXA 2YJFA 1NGEA 3R4NA 2PAVA 2QG0A 2QWMA 1R62A 1YS3A 3U9DA 5BPLA 5M4MA 3DXKA 4LWEA 3R92A 3HEKA 2P9LB 2YEHA 1RDWX 2YI5A 4GCZA 4WUDA 4B1UB 1T44A 2P9IA 3CIPA 2BU2A 1AH6A 1S14A 4QPJA 4JHDB 4GNIA 4MB9A 3CGZA 2ESAA 2XJGA 3RKZA 4B6CA 1P8ZA 4V25A 1F51A 4EAHD 1KXPA 5AQQA 5F1XA 4MPEA 3MN9A 3ULEA 3CJBA 1UYMA 3DXMA 4PKHA 2WI2A 2QWRA 2XDSA 2ASOA 4J8FA 3HYYA 4KP4A 2FXUA 4K41A 1XQSC 3JXUA 2YKJA 4YKXA 1NGHA 5AR0A 5JENA 3HHUA 3KE6A 4CWNA 1QQMA 3TZ4A 4LPBA 4V26A 1UYCA 1GKZA 4KQVA 4CWTA 3W3DA 4JASA 1TILA 4YKYA 2GWKA 2FWZA 2YEGA 4K4OA 4L93A 3EKUA 2YKIA 5C93A 4CI6A 2XK2A 3L4IA 4FCPA 4ZVIA 1NGFA 1J6ZA 2YE3A 4JD2A 4Z94A 1MA9B 2HHIA 3D2FA 1Z5CA 3C0EA 4HWIA 5FPEA 3Q5LA 3ATVA 3C7NB 2CG9A 1YETA 4JAUA 2IWXA 4CWSA 3IUCA 3QB0A 3TUHA 4CZFA 3HYZA 3B28A 5D6PA 5AQNA 3EKRA 2XX4A 5BN8A 1H7SA 2YECA 1TYQB 3MMVA 5CPHA 3GIEA 1NLVA 2VCJA 4HZ5A 1K8KA 1E4FT 4L91A 3G7EA 1Y8OA 4JQLA 4XITA 2ZBKB 2YKBA 5FNDA 4BIUA 1MU5A 5EY4A 4EGIA 1HJOA 3D0BA 2ASPA 4KBOA 1KIJA 4L94A 2XD6A 4H5NA 5AQYA 4DUHA 4H5VA 1QZRA 1TH8A 2BYHA 5IDMA 5M4HA 5AQUA 2YE4A 2GWJA 3C11A 5AQTA 4KFGA 1H1VA 3WEEB 4E01A 3CYGA 4EFUA 2QWOA 3UE5A 2CCSA 1U2OA 2FF3B 1S16A 2YK2A 3RSEB 1KZNA 5AQOA 1EQYA 2XHTA 1U2VA 3R4MA 4KSGA 1NHJA 5CF0A 1UY6A 2XCMA 1NHHA 4XC0A 4MBCA 4YKTA 4EGHA 4HYMA 2V51B 3K60A 2XJXA 4H7QA 3ZKDA 1QZ5A 3VHDA 4PL8A 5F0XA 1S3XA 5J6AA 1BXDA 2JKIA 3CGYA 2UWDA 1I58A 4MPNA 3CRKA 3K97A 4O04A 2Q8FA 3MN6A 4XKKA 3VHCA 4ASGA 1C0GA 2YEIA 1TBWA 4H5TA 1YSRA 4QPKA 2A3ZA 2QF6A 1YAGA 2P9SB 3I33A 2HKJA 4YKZA 1WUAA 2YEFA 3OMUA 2BTZA 2XX5A 4PKIA 3UKRA 3DXKB 3QFUA 2YI0A 4ZKIA 1NM1A 1OSFA 3EHFA 3U4LA 5M4PA 2E8AA 2P9IB 4PKGA 1NGDA 2Q97A 4XJXA 4A2BA 3MN7A 5EVZA 1Y4SA 4MOTA 4AWQA 4CZLA 3WQ9A 3INWA 3LPSA 1YT2A 4HZ0A 1YVNA 2YE2A 2YEAA 2BSMA 4HY1A 3DXMB 2YEEA 4EEHA 2Q2EB 4FCQA 2A5XA 5JLFA 1TIDA 4BAEA 2ASMA 4Q20A 3HSCA 2FF6A 4MPCA 5FWKA 4K42A 2CCUA 2ZKJA 4H81A 4EMVA 4B7PA 5FNCA 4HXZA 4O05A 3T10A 2FYPA 1MX0A 3T2SA 4AS9A 3ZXOA 1RFQA 1AJ6A 1YC4A 5FPNA 1UYKA 4GY2B 4AWOA 4LWHA 1I5AA 2QW9A 4B1YB 2JJCA 2WI1A 2BU7A 3B25A 4LWIA 4H0XB 3BUZB 5CTXA 4WUCA 4AM6A 4XKOA 5ADXH 1YERA 1KAYA 1QZ6A 1UYLA 2P9KA 4U7OA 3EKOA 2O1VA 3U2KA 3VADA 1YT1A 2P9UA 2YEDA 2BRCA 2YE9A 1ID0A
chains in the Genus database with same CATH topology
5JENA 2HHIA 3S5TA 4E72A 3CYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEN A;  2HHI A;  3S5T A;  4E72 A;  3CYG A; 
#chains in the Genus database with same CATH topology
 3R4P A;  4GGL A;  1GJV A;  2YGE A;  2Q8G A;  1K8K B;  1ATS A;  2P9P B;  2YEB A;  4K43 A;  3QDD A;  3G7B A;  1BYQ A;  5M4N A;  3DWL A;  4I6M B;  3TPQ A;  3K99 A;  2CCT A;  4FL9 A;  1QY8 A;  1E4G T;  4X9L A;  2H8M A;  3A0W A;  5L3J A;  2YGA A;  3M6G A;  3A0T A;  2V7Y A;  3A5L C;  4YKQ A;  3A5N C;  2YE8 A;  2XDU A;  1KAZ A;  5FPM A;  2HF3 A;  2EXL A;  1U2V B;  2V7Z A;  1BGQ A;  4CZJ A;  2XDX A;  1B3Q A;  1IXM A;  1NGG A;  2BU8 A;  2QWL A;  2K5B A;  2YK9 A;  3FFK B;  2XX2 A;  2XDL A;  2PNR A;  4FSV A;  1BA0 A;  1I5C A;  3FZL A;  3INX A;  3TZ0 A;  2BRE A;  4CWP A;  1HPM A;  3D2R A;  2HMP A;  4FPP A;  4GFN A;  4XCJ A;  3A0X A;  1QQO A;  2PBD A;  2P9N B;  3MNR P;  1BKN A;  3GDQ A;  2VYP A;  3EL2 A;  5M4K A;  1Y64 A;  3LDP A;  4ASB A;  1NWK A;  4RTF D;  2QG2 A;  4XIQ A;  2BTF A;  5BOD A;  4JNE A;  4LWF A;  4L90 A;  1EA6 A;  4BIZ A;  1ATN A;  4HYP A;  2O1W A;  4HY6 A;  4NH8 A;  1ZWH A;  3UKR B;  4H85 A;  3L6Q A;  4H0Y B;  4E02 A;  3M1F A;  3ZXQ A;  4O07 A;  3LDL A;  3T0H A;  3D2E A;  2XAB A;  3C7N A;  4XE2 A;  5AQP A;  4EFH A;  4H0T B;  2IOR A;  1NGI A;  4DZY A;  1US7 A;  1KAX A;  3LMM A;  4I3H A;  5AFU A;  1A4H A;  3J8A A;  2YJX A;  3DGE A;  1BUP A;  3M3Z A;  4CZI A;  3ZKB A;  1NGJ A;  1YXQ A;  3A5M C;  1UYG A;  1H7U A;  4BXI A;  4PL7 A;  5FNF A;  5IDJ A;  3H4L A;  4BE7 B;  4ASA A;  2E88 A;  3RLR A;  1UYD A;  4KTN A;  5D7C A;  4B1Z A;  5AQX A;  2YI7 A;  4P8O A;  5F5R A;  3CWV A;  1JCF A;  5JLH A;  3B26 A;  4HXW A;  4H5R A;  5AQZ A;  4EGK A;  2HCH A;  3QFP A;  1JM6 A;  3TTZ A;  4CWQ A;  3RLQ A;  3PEJ A;  4EFT A;  3HZ1 A;  2WI6 A;  2XHR A;  3QTF A;  4LWG A;  4W7T A;  3LDQ A;  3T1K A;  2OAN A;  3UKU A;  2WI4 A;  4FMT A;  1TC6 A;  3DAW A;  3MN5 A;  3ULE B;  2BUP A;  2YJW A;  2IWU A;  3OW6 A;  2Q8H A;  2YJE A;  2WI3 A;  3TZ2 A;  3LDN A;  1UYI A;  2QWQ A;  5D6Q A;  3FZK A;  2E0A A;  2YE7 A;  4JAV A;  2Q0U A;  1YC1 A;  4B1W B;  4XDM A;  4EM7 A;  2BYI A;  1ATR A;  1QYE A;  3KVG A;  5F3K A;  2WEP A;  2Q8I A;  2BU6 A;  2Q0R A;  2ZDX A;  3U67 A;  2P9U B;  3O6O A;  1NGB A;  5BN9 A;  4CZG A;  1YES A;  3A0R A;  1Y8P A;  3CRL A;  3IED A;  4FCR A;  1NMD A;  1JCE A;  2A41 A;  4CZE A;  2YEJ A;  3QML A;  3EHG A;  3G75 A;  4XCL A;  4E72 A;  3TZ5 A;  3LDO A;  1Y8N A;  1ZXM A;  2W00 A;  4I5S A;  1UY8 A;  4PRV A;  4JD2 B;  3HBT A;  2KHO A;  1PVG A;  2BU5 A;  5CTU A;  3CI5 A;  3GIG A;  1B63 A;  3D2F B;  3CHW A;  5GGZ A;  5BPM A;  2A40 A;  2QWP A;  1NHI A;  2QXL A;  1DEJ A;  5AQM A;  4B1V A;  1I5B A;  1B62 A;  2ZDY A;  2BT0 A;  2WEQ A;  3Q5K A;  4CE3 A;  3PEH A;  1IJJ A;  2ZWH A;  2FXS A;  2H55 A;  4IO8 A;  3A0Y A;  4PU9 A;  3HZ5 A;  1Z5B A;  4BQG A;  2IOQ A;  4LP0 A;  2FTK A;  3WHA A;  1LOT B;  2QFO A;  5I9E B;  1JCG A;  3U8X A;  4XD8 A;  1AMW A;  4B9Q A;  2P9L A;  2XHX A;  5ADX A;  2IWS A;  1EI1 A;  4CZM A;  4KSH A;  3U2D A;  4L8Z A;  4CZH A;  3FZF A;  4URL A;  4CBW A;  4JHD A;  2YKE A;  5J71 A;  1HX1 A;  2YKC A;  5AQL A;  1YSZ A;  4XIR A;  3R91 A;  4NH9 A;  2VW5 A;  3VHA A;  4H5W A;  5AQS A;  4MP2 A;  5AQW A;  2C1I A;  2WER A;  1AM1 A;  2WI5 A;  4URN A;  2Q1N A;  4CWF A;  4XEI A;  5CE3 A;  2YE5 A;  4O09 A;  3EKS A;  1HLU A;  3K98 A;  1THN A;  1YT0 A;  1UY7 A;  1Z5A A;  3EHJ A;  3O2F A;  3OPD A;  5CTY A;  4BEC A;  3A0Z A;  4R1F A;  3FV5 A;  3ATU A;  1GKX A;  2AKP A;  3D2E B;  2Q36 A;  4CE1 A;  2YI6 A;  3T0Z A;  2C1G A;  4NH7 A;  1D4X A;  3FZH A;  4URO A;  4WUB A;  3A5O C;  4MP7 A;  5BOC A;  2CH4 A;  5D7R A;  2A42 A;  1NGC A;  4XTJ A;  1L0O A;  3R4O A;  5TKY A;  5EXW A;  4O0B A;  1AH8 A;  4ASF A;  1MDU B;  5CTW A;  2P9P A;  2GQP A;  2BZ5 A;  2WI7 A;  2CGF A;  3FT5 A;  5BPN A;  5AQV A;  3EHH A;  3FT8 A;  4I6M A;  5AQF A;  2O1U A;  1UYE A;  2D1K A;  1S22 A;  2HF4 A;  2YE6 A;  4A2A A;  1ESV A;  1QQN A;  1ZW9 A;  1SQK A;  3CJC A;  1Y4U A;  4WYB A;  4CBX A;  3SJH A;  1U0Z A;  3GL1 A;  1UY9 A;  2IOP A;  5AQI A;  3OWB A;  1TYQ A;  3GIF A;  4H03 B;  3UKU B;  1Z59 A;  2YGF A;  3S5T A;  5AFU H;  1YUW A;  2V52 B;  4YKR A;  5AQG A;  3O0I A;  1UYF A;  4U93 A;  2GFD A;  3B24 A;  4BQJ A;  4GT8 A;  4CZK A;  2WUS A;  4R3A A;  3B27 A;  4GQT A;  1LCU A;  1C0F A;  3WEE A;  1ZXN A;  4P7A A;  4YKU A;  2QWN A;  2P9N A;  3ZM7 A;  2HG1 A;  4CWO A;  3RSE A;  1TC0 A;  2FWY A;  3NMQ A;  3A8Y A;  5AQK A;  2VCI A;  4AWP A;  4JN4 A;  4XKA A;  5E84 A;  5AQH A;  2XJJ A;  5IN9 A;  4URM A;  3U9Z A;  2VWC A;  5AQR A;  4H0V B;  2XDK A;  3BMY A;  3JZ3 A;  4B1X B;  4FO0 A;  5M4E A;  4XIP A;  2C2A A;  3AY9 A;  5FPD A;  2Q31 A;  5D7D A;  1RGI A;  4CWR A;  4PL9 A;  5EX5 A;  3H80 A;  4CBU A;  4BEB A;  3GIG B;  4AM7 A;  5AQJ A;  4E00 A;  3Q5J A;  3FZM A;  3RLP A;  3FE1 A;  1BA1 A;  4GEE A;  2P9K B;  4M63 C;  4U7N A;  1I59 A;  1NGA A;  3UB5 A;  1I5D A;  1YC3 A;  3OWD A;  4R3M A;  3SL2 A;  2VCP A;  1DKG D;  4RWT A;  5F2R A;  3D36 A;  2P9S A;  4PRX A;  3BM9 A;  4YKW A;  1UYH A;  3TU5 A;  4CE2 A;  3LNU A;  3CQX A;  2YJF A;  1NGE A;  3R4N A;  2PAV A;  2QG0 A;  2QWM A;  1R62 A;  1YS3 A;  3U9D A;  5BPL A;  5M4M A;  3DXK A;  4LWE A;  3R92 A;  3HEK A;  2P9L B;  2YEH A;  1RDW X;  2YI5 A;  4GCZ A;  4WUD A;  4B1U B;  1T44 A;  2P9I A;  3CIP A;  2BU2 A;  1AH6 A;  1S14 A;  4QPJ A;  4JHD B;  4GNI A;  4MB9 A;  3CGZ A;  2ESA A;  2XJG A;  3RKZ A;  4B6C A;  1P8Z A;  4V25 A;  1F51 A;  4EAH D;  1KXP A;  5AQQ A;  5F1X A;  4MPE A;  3MN9 A;  3ULE A;  3CJB A;  1UYM A;  3DXM A;  4PKH A;  2WI2 A;  2QWR A;  2XDS A;  2ASO A;  4J8F A;  3HYY A;  4KP4 A;  2FXU A;  4K41 A;  1XQS C;  3JXU A;  2YKJ A;  4YKX A;  1NGH A;  5AR0 A;  5JEN A;  3HHU A;  3KE6 A;  4CWN A;  1QQM A;  3TZ4 A;  4LPB A;  4V26 A;  1UYC A;  1GKZ A;  4KQV A;  4CWT A;  3W3D A;  4JAS A;  1TIL A;  4YKY A;  2GWK A;  2FWZ A;  2YEG A;  4K4O A;  4L93 A;  3EKU A;  2YKI A;  5C93 A;  4CI6 A;  2XK2 A;  3L4I A;  4FCP A;  4ZVI A;  1NGF A;  1J6Z A;  2YE3 A;  4JD2 A;  4Z94 A;  1MA9 B;  2HHI A;  3D2F A;  1Z5C A;  3C0E A;  4HWI A;  5FPE A;  3Q5L A;  3ATV A;  3C7N B;  2CG9 A;  1YET A;  4JAU A;  2IWX A;  4CWS A;  3IUC A;  3QB0 A;  3TUH A;  4CZF A;  3HYZ A;  3B28 A;  5D6P A;  5AQN A;  3EKR A;  2XX4 A;  5BN8 A;  1H7S A;  2YEC A;  1TYQ B;  3MMV A;  5CPH A;  3GIE A;  1NLV A;  2VCJ A;  4HZ5 A;  1K8K A;  1E4F T;  4L91 A;  3G7E A;  1Y8O A;  4JQL A;  4XIT A;  2ZBK B;  2YKB A;  5FND A;  4BIU A;  1MU5 A;  5EY4 A;  4EGI A;  1HJO A;  3D0B A;  2ASP A;  4KBO A;  1KIJ A;  4L94 A;  2XD6 A;  4H5N A;  5AQY A;  4DUH A;  4H5V A;  1QZR A;  1TH8 A;  2BYH A;  5IDM A;  5M4H A;  5AQU A;  2YE4 A;  2GWJ A;  3C11 A;  5AQT A;  4KFG A;  1H1V A;  3WEE B;  4E01 A;  3CYG A;  4EFU A;  2QWO A;  3UE5 A;  2CCS A;  1U2O A;  2FF3 B;  1S16 A;  2YK2 A;  3RSE B;  1KZN A;  5AQO A;  1EQY A;  2XHT A;  1U2V A;  3R4M A;  4KSG A;  1NHJ A;  5CF0 A;  1UY6 A;  2XCM A;  1NHH A;  4XC0 A;  4MBC A;  4YKT A;  4EGH A;  4HYM A;  2V51 B;  3K60 A;  2XJX A;  4H7Q A;  3ZKD A;  1QZ5 A;  3VHD A;  4PL8 A;  5F0X A;  1S3X A;  5J6A A;  1BXD A;  2JKI A;  3CGY A;  2UWD A;  1I58 A;  4MPN A;  3CRK A;  3K97 A;  4O04 A;  2Q8F A;  3MN6 A;  4XKK A;  3VHC A;  4ASG A;  1C0G A;  2YEI A;  1TBW A;  4H5T A;  1YSR A;  4QPK A;  2A3Z A;  2QF6 A;  1YAG A;  2P9S B;  3I33 A;  2HKJ A;  4YKZ A;  1WUA A;  2YEF A;  3OMU A;  2BTZ A;  2XX5 A;  4PKI A;  3UKR A;  3DXK B;  3QFU A;  2YI0 A;  4ZKI A;  1NM1 A;  1OSF A;  3EHF A;  3U4L A;  5M4P A;  2E8A A;  2P9I B;  4PKG A;  1NGD A;  2Q97 A;  4XJX A;  4A2B A;  3MN7 A;  5EVZ A;  1Y4S A;  4MOT A;  4AWQ A;  4CZL A;  3WQ9 A;  3INW A;  3LPS A;  1YT2 A;  4HZ0 A;  1YVN A;  2YE2 A;  2YEA A;  2BSM A;  4HY1 A;  3DXM B;  2YEE A;  4EEH A;  2Q2E B;  4FCQ A;  2A5X A;  5JLF A;  1TID A;  4BAE A;  2ASM A;  4Q20 A;  3HSC A;  2FF6 A;  4MPC A;  5FWK A;  4K42 A;  2CCU A;  2ZKJ A;  4H81 A;  4EMV A;  4B7P A;  5FNC A;  4HXZ A;  4O05 A;  3T10 A;  2FYP A;  1MX0 A;  3T2S A;  4AS9 A;  3ZXO A;  1RFQ A;  1AJ6 A;  1YC4 A;  5FPN A;  1UYK A;  4GY2 B;  4AWO A;  4LWH A;  1I5A A;  2QW9 A;  4B1Y B;  2JJC A;  2WI1 A;  2BU7 A;  3B25 A;  4LWI A;  4H0X B;  3BUZ B;  5CTX A;  4WUC A;  4AM6 A;  4XKO A;  5ADX H;  1YER A;  1KAY A;  1QZ6 A;  1UYL A;  2P9K A;  4U7O A;  3EKO A;  2O1V A;  3U2K A;  3VAD A;  1YT1 A;  2P9U A;  2YED A;  2BRC A;  2YE9 A;  1ID0 A; 
#chains in the Genus database with same CATH homology
 5JEN A;  2HHI A;  3S5T A;  4E72 A;  3CYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...