3S5TA

Crystal structure of a member of duf3298 family (bf2082) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
257
structure length
253
Chain Sequence
KNTGALEFDSIQVNETAHLFGDTAKPACNLTINFAYPVKSTDNKLKDSLNSYFIAACFGEGYIGEKPAQVVKEYTEHYVKEYRTDLEPMYAEDEKNKSIGAWYSYYKGIESHVQLYYKNLLVYRINYNEYTGGAHGIYMTTFLNMDLINLRPLKLDDIFTGDYKEALTDLLWNQLMADKKVTTHEALEDMGYGSTGDIAPTENFYLDKDGITFYYNVYDITPYAMGPVEIKIPYEMMEHMLGSNPIIGEMKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Member of DUF3298 family (BF2082) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords DUF3298 family protein
total genus 65
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3s5tA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3s5tA02
2HHIA 4E72A 3CYGA 5JENA 3S5TA
chains in the Genus database with same CATH superfamily
1UY8A 4FPPA 1Y8PA 2YGEA 2FF3B 3ZKDA 1NMDA 2YKJA 4KFGA 4AWPA 5CTUA 1NGDA 2VCJA 4ZKIA 2HMPA 3HYYA 2BUPA 1Y4UA 5C93A 5CF0A 2V7ZA 4WUDA 1B63A 3SL2A 2Q97A 4JQLA 4XD8A 2V7YA 3A0TA 2QWNA 3UE5A 3ULEB 2YE2A 2WI2A 2QW9A 3CI5A 3K97A 4XDMA 1H1VA 2GFDA 1NGEA 4B1VA 1Y8NA 2FYPA 5FNFA 2P9SB 2P9NA 3EKOA 4K43A 1NGBA 4H0VB 1BGQA 3LDPA 3EKUA 4PKGA 3WQ9A 2C2AA 5AFUH 2Q1NA 4B1UB 4CI6A 5AQZA 5AQGA 2QWOA 4URMA 1UYLA 1BA1A 4I6MB 5I9EB 1AM1A 4R3MA 4O07A 5M4EA 3HEKA 3DWLA 5D6QA 4E01A 1E4FT 2K5BA 4R3AA 4K42A 2KHOA 4MBCA 4ASBA 4HY1A 2JJCA 4LWHA 1UYHA 2WI7A 3T1KA 2BYIA 4H81A 5IDMA 3M6GA 2XJJA 2YI7A 4LP0A 3C7NA 1S14A 2XHXA 2QWPA 3G75A 5AQUA 4O09A 4XC0A 2BTFA 4W7TA 5FPDA 3PEHA 4O0BA 4YKZA 4JN4A 4PRXA 3A8YA 4R1FA 4CZJA 4CBXA 3M1FA 3ZXOA 1D4XA 2PBDA 4XITA 4E00A 2PAVA 1ESVA 1EQYA 3DXKA 1TC0A 5M4MA 3G7BA 3QFPA 2YE4A 2YE8A 4XTJA 2CCSA 1I59A 1YSZA 4ASFA 4I6MA 3Q5JA 1NHIA 3INWA 5ADXA 2WUSA 1YS3A 5BOCA 3B27A 3U2KA 4L93A 2YJWA 4PL9A 2IWXA 4GEEA 1JM6A 4LWIA 3T10A 2QXLA 4H0YB 3CRKA 2FXSA 1HX1A 1YXQA 2BTZA 5AQKA 5AQRA 3L4IA 4I5SA 5E84A 1LCUA 4PL8A 3C0EA 3VHCA 2O1VA 5F0XA 5BN9A 1H7SA 1I5CA 2AKPA 1Y64A 4CWQA 2OANA 4CZEA 4H85A 5BN8A 4GGLA 3ZKBA 2XDUA 4JHDA 3UKRB 2WI4A 5AQOA 5FNDA 4U7OA 1AJ6A 1BA0A 2CGFA 4AWOA 1RDWX 3UKUA 3EHFA 1F51A 1KAXA 1U0ZA 3D2RA 3Q5KA 1NWKA 5JENA 3INXA 2P9IA 4CZFA 3RLRA 3B26A 3TZ0A 4XIPA 2C1GA 2PNRA 3OW6A 1YERA 3A0ZA 2WEQA 2ZWHA 3ZM7A 3VADA 4CE1A 2C1IA 4A2BA 1OSFA 3MNRP 4O04A 3R4NA 4K41A 1TBWA 5M4PA 4BAEA 2BSMA 1YUWA 3KVGA 4E72A 4B1ZA 2Q0RA 4FL9A 4RTFD 3HHUA 4V26A 5FWKA 4AM6A 2XDKA 3FZHA 4UROA 1NM1A 1NLVA 3GIFA 5EVZA 1LOTB 5M4HA 2BRCA 1KXPA 2P9IB 1L0OA 2YKBA 1I5AA 1NGFA 4ASGA 3H4LA 4BIZA 3D0BA 4U7NA 2YJXA 4PKHA 1B3QA 1C0FA 3O2FA 3DXMA 3R92A 3G7EA 4KP4A 2ZBKB 4XKKA 5AQMA 1UYGA 2YEDA 2XDLA 4GFNA 3EHJA 5D7DA 2V52B 5AQLA 4BIUA 4MP7A 4H0TB 4B6CA 1QQOA 4YKXA 4H5TA 4GQTA 5AQFA 2BU2A 2CCUA 2Q31A 1RFQA 2WERA 1GJVA 2IOQA 1JCGA 2YI6A 2BREA 3U67A 2P9NB 2P9SA 3T0HA 4JHDB 2YE3A 2XHTA 1A4HA 4EFHA 4RWTA 3CQXA 1EA6A 1I58A 2YEBA 4EMVA 2YK9A 3D2EB 5FPMA 1MDUB 3CGZA 4LWFA 3TZ5A 1US7A 4GY2B 2XJGA 5AQSA 2ZDYA 1C0GA 4HYPA 4FCPA 1NGHA 1YT2A 1U2OA 4FO0A 4L90A 3IUCA 1BYQA 4MB9A 1T44A 2YKIA 3TUHA 4L91A 3RSEA 3ZXQA 3RKZA 2Q8IA 3EL2A 4MOTA 1WUAA 3DAWA 2JKIA 1JCEA 3ULEA 2O1UA 2XHRA 1YC1A 1UYIA 3HZ1A 3PEJA 2Q0UA 3OWDA 2XDXA 2YGAA 2BU6A 2XK2A 3R4PA 1QQMA 4EAHD 3C11A 4LPBA 4CZGA 5GGZA 2P9PA 2GQPA 5L3JA 1Z5AA 5CE3A 4JAVA 4EFUA 4CZKA 1UY7A 1NGAA 2WEPA 5BPNA 2VCPA 1I5DA 2CCTA 2FTKA 1SQKA 1YSRA 5AR0A 3W3DA 2QF6A 3HZ5A 4MPEA 3MN6A 1AH8A 4NH7A 4NH8A 1YT1A 1JCFA 1S16A 4B9QA 5D7RA 3FZLA 1ZW9A 4AS9A 4CWSA 1I5BA 2E8AA 4QPJA 2QWQA 2HCHA 2YJFA 3U8XA 1NHJA 3A0YA 2H55A 3Q5LA 1MU5A 2WI3A 4L8ZA 3FV5A 3S5TA 3TPQA 4Q20A 4HXWA 3JZ3A 3OWBA 1BUPA 3UKRA 3LDOA 2WI1A 2VWCA 1S3XA 2E88A 3DXKB 2YJEA 3MN9A 3KE6A 5FNCA 1YT0A 5D7CA 4H5WA 2UWDA 2YEEA 3GL1A 1KIJA 1UY6A 3TU5A 4JD2A 1RGIA 4U93A 1UYDA 1Z5BA 3CWVA 4H7QA 3R91A 4B7PA 4JD2B 2HF4A 1Y4SA 3A0RA 4YKQA 4H5VA 2BU5A 3CYGA 4LWEA 2XX2A 1IJJA 1ZXMA 5F2RA 4GCZA 1QY8A 2YEIA 1U2VA 2QWMA 1AMWA 5BODA 2Q8GA 4KSHA 4PKIA 3MMVA 3RSEB 3CJBA 3A0XA 5ADXH 3BM9A 4XJXA 2EXLA 2Q8HA 4BQJA 3L6QA 5F5RA 2FWYA 3TTZA 4FSVA 1MX0A 4P8OA 2P9LB 3K99A 5EX5A 2P9LA 2D1KA 3IEDA 1NGIA 1TYQA 1Z5CA 4URLA 1GKZA 3O6OA 4NH9A 1YVNA 4EGHA 3QFUA 4FCQA 3MN5A 2ASPA 1UYFA 3QTFA 2XX5A 3LDLA 1ATRA 2YE6A 5CTXA 3WEEA 4CZHA 4KTNA 1ID0A 3B28A 4Z94A 2IORA 2XABA 4KBOA 3D36A 4CBWA 4CBUA 2HG1A 4XCJA 2W00A 5AQXA 5EXWA 4MPNA 3EHGA 5AQPA 4YKRA 5CTWA 1QZ5A 3DXMB 2H8MA 3CRLA 4X9LA 2P9UB 1AH6A 4AM7A 3HYZA 4LWGA 4WUBA 4EEHA 3HBTA 4XCLA 2YI0A 1ATSA 1K8KB 3C7NB 3O0IA 4BEBA 3LMMA 3VHAA 4PL7A 4EFTA 3K60A 3D2FB 2VW5A 4H5NA 5F3KA 4P7AA 2ASMA 3R4OA 3BUZB 4DUHA 4K4OA 4KSGA 2A40A 3UKUB 4L94A 2P9PB 1THNA 3GIGB 3RLPA 4YKWA 3A5OC 2YE9A 1QQNA 3U2DA 4BECA 1MA9B 5AFUA 1UY9A 2QG0A 4CWFA 3WHAA 4PU9A 5BPMA 5M4KA 1UYCA 3CHWA 3TZ4A 4XIQA 3R4MA 3BMYA 5IN9A 1ATNA 4H5RA 5AQIA 1NGJA 1HJOA 2IWSA 2CH4A 1KZNA 2Q2EB 4CWRA 2YEHA 2XD6A 4HXZA 4J8FA 4CWTA 1PVGA 5AQNA 3D2FA 1IXMA 4JASA 1XQSC 1UYKA 2ESAA 3EKRA 2YKCA 1NGCA 1QYEA 4CE3A 1B62A 1ZWHA 3U9ZA 2YI5A 4XKAA 4I3HA 2V51B 4WYBA 4CE2A 2HKJA 3AY9A 4CWOA 4DZYA 1UYEA 2YEFA 2P9KB 1HLUA 5FPEA 1Z59A 4BQGA 3M3ZA 1H7UA 5J6AA 4BXIA 3NMQA 1KAZA 4IO8A 4ZVIA 4HZ5A 1QZ6A 2IWUA 2BYHA 4EM7A 3FFKB 3HSCA 5AQHA 2IOPA 3FZKA 2O1WA 4B1YB 2BU8A 2YEGA 3FE1A 3LNUA 4KQVA 2FXUA 5IDJA 3TZ2A 2GWKA 2E0AA 1BXDA 4BE7B 4PRVA 4AWQA 2CG9A 2A3ZA 1K8KA 4O05A 2HF3A 4GT8A 5FPNA 3FT8A 3CIPA 2ASOA 1EI1A 1YETA 4CWPA 2WI5A 4HWIA 4YKYA 2YECA 3MN7A 3GIGA 5AQJA 2BZ5A 3B24A 2YE7A 2YK2A 4CWNA 1DEJA 4H0XB 1QZRA 5D6PA 1YC4A 1Y8OA 3OPDA 1UYMA 1ZXNA 2BU7A 4XE2A 4JNEA 5AQVA 5AQWA 2A5XA 2WI6A 1R62A 4B1WB 1YESA 2Q36A 1U2VB 3T0ZA 4FMTA 4CZMA 3LDNA 3J8AA 1DKGD 2P9UA 1YAGA 3ATVA 4JAUA 3EKSA 3FT5A 4H03B 2BT0A 3WEEB 5EY4A 3U4LA 3UB5A 5TKYA 2VYPA 5M4NA 2YEJA 2XCMA 4ASAA 4FCRA 1S22A 2QG2A 4HY6A 4EGKA 2Q8FA 3FZFA 3K98A 3H80A 4URNA 3EHHA 2VCIA 5J71A 1KAYA 1GKXA 3D2EA 3A0WA 3ATUA 1J6ZA 4M63C 4GNIA 5JLFA 3RLQA 3U9DA 1TH8A 2A42A 3T2SA 1HPMA 1TIDA 4MP2A 3CJCA 4XEIA 4B1XB 4MPCA 4A2AA 2XDSA 4XKOA 5AQQA 3LDQA 3GDQA 1NGGA 3CGYA 2GWJA 4CZIA 1NHHA 2HHIA 2QWLA 3A5MC 3GIEA 2QWRA 4HYMA 5CPHA 3A5LC 4HZ0A 5F1XA 4EGIA 5AQTA 4V25A 2ZKJA 4XIRA 1TYQB 2ZDXA 2YEAA 5BPLA 2YKEA 3QB0A 2FF6A 4WUCA 4E02A 3QMLA 5JLHA 4CZLA 3FZMA 3OMUA 1BKNA 3QDDA 2A41A 2FWZA 3LPSA 5AQYA 2YE5A 3DGEA 3B25A 2P9KA 1E4GT 3JXUA 2YGFA 1P8ZA 3VHDA 2XX4A 1TILA 4YKTA 3A5NC 3I33A 3SJHA 1TC6A 2XJXA 4QPKA 4YKUA 5CTYA 1YC3A 2QFOA
chains in the Genus database with same CATH topology
2HHIA 4E72A 3CYGA 5JENA 3S5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHI A;  4E72 A;  3CYG A;  5JEN A;  3S5T A; 
#chains in the Genus database with same CATH topology
 1UY8 A;  4FPP A;  1Y8P A;  2YGE A;  2FF3 B;  3ZKD A;  1NMD A;  2YKJ A;  4KFG A;  4AWP A;  5CTU A;  1NGD A;  2VCJ A;  4ZKI A;  2HMP A;  3HYY A;  2BUP A;  1Y4U A;  5C93 A;  5CF0 A;  2V7Z A;  4WUD A;  1B63 A;  3SL2 A;  2Q97 A;  4JQL A;  4XD8 A;  2V7Y A;  3A0T A;  2QWN A;  3UE5 A;  3ULE B;  2YE2 A;  2WI2 A;  2QW9 A;  3CI5 A;  3K97 A;  4XDM A;  1H1V A;  2GFD A;  1NGE A;  4B1V A;  1Y8N A;  2FYP A;  5FNF A;  2P9S B;  2P9N A;  3EKO A;  4K43 A;  1NGB A;  4H0V B;  1BGQ A;  3LDP A;  3EKU A;  4PKG A;  3WQ9 A;  2C2A A;  5AFU H;  2Q1N A;  4B1U B;  4CI6 A;  5AQZ A;  5AQG A;  2QWO A;  4URM A;  1UYL A;  1BA1 A;  4I6M B;  5I9E B;  1AM1 A;  4R3M A;  4O07 A;  5M4E A;  3HEK A;  3DWL A;  5D6Q A;  4E01 A;  1E4F T;  2K5B A;  4R3A A;  4K42 A;  2KHO A;  4MBC A;  4ASB A;  4HY1 A;  2JJC A;  4LWH A;  1UYH A;  2WI7 A;  3T1K A;  2BYI A;  4H81 A;  5IDM A;  3M6G A;  2XJJ A;  2YI7 A;  4LP0 A;  3C7N A;  1S14 A;  2XHX A;  2QWP A;  3G75 A;  5AQU A;  4O09 A;  4XC0 A;  2BTF A;  4W7T A;  5FPD A;  3PEH A;  4O0B A;  4YKZ A;  4JN4 A;  4PRX A;  3A8Y A;  4R1F A;  4CZJ A;  4CBX A;  3M1F A;  3ZXO A;  1D4X A;  2PBD A;  4XIT A;  4E00 A;  2PAV A;  1ESV A;  1EQY A;  3DXK A;  1TC0 A;  5M4M A;  3G7B A;  3QFP A;  2YE4 A;  2YE8 A;  4XTJ A;  2CCS A;  1I59 A;  1YSZ A;  4ASF A;  4I6M A;  3Q5J A;  1NHI A;  3INW A;  5ADX A;  2WUS A;  1YS3 A;  5BOC A;  3B27 A;  3U2K A;  4L93 A;  2YJW A;  4PL9 A;  2IWX A;  4GEE A;  1JM6 A;  4LWI A;  3T10 A;  2QXL A;  4H0Y B;  3CRK A;  2FXS A;  1HX1 A;  1YXQ A;  2BTZ A;  5AQK A;  5AQR A;  3L4I A;  4I5S A;  5E84 A;  1LCU A;  4PL8 A;  3C0E A;  3VHC A;  2O1V A;  5F0X A;  5BN9 A;  1H7S A;  1I5C A;  2AKP A;  1Y64 A;  4CWQ A;  2OAN A;  4CZE A;  4H85 A;  5BN8 A;  4GGL A;  3ZKB A;  2XDU A;  4JHD A;  3UKR B;  2WI4 A;  5AQO A;  5FND A;  4U7O A;  1AJ6 A;  1BA0 A;  2CGF A;  4AWO A;  1RDW X;  3UKU A;  3EHF A;  1F51 A;  1KAX A;  1U0Z A;  3D2R A;  3Q5K A;  1NWK A;  5JEN A;  3INX A;  2P9I A;  4CZF A;  3RLR A;  3B26 A;  3TZ0 A;  4XIP A;  2C1G A;  2PNR A;  3OW6 A;  1YER A;  3A0Z A;  2WEQ A;  2ZWH A;  3ZM7 A;  3VAD A;  4CE1 A;  2C1I A;  4A2B A;  1OSF A;  3MNR P;  4O04 A;  3R4N A;  4K41 A;  1TBW A;  5M4P A;  4BAE A;  2BSM A;  1YUW A;  3KVG A;  4E72 A;  4B1Z A;  2Q0R A;  4FL9 A;  4RTF D;  3HHU A;  4V26 A;  5FWK A;  4AM6 A;  2XDK A;  3FZH A;  4URO A;  1NM1 A;  1NLV A;  3GIF A;  5EVZ A;  1LOT B;  5M4H A;  2BRC A;  1KXP A;  2P9I B;  1L0O A;  2YKB A;  1I5A A;  1NGF A;  4ASG A;  3H4L A;  4BIZ A;  3D0B A;  4U7N A;  2YJX A;  4PKH A;  1B3Q A;  1C0F A;  3O2F A;  3DXM A;  3R92 A;  3G7E A;  4KP4 A;  2ZBK B;  4XKK A;  5AQM A;  1UYG A;  2YED A;  2XDL A;  4GFN A;  3EHJ A;  5D7D A;  2V52 B;  5AQL A;  4BIU A;  4MP7 A;  4H0T B;  4B6C A;  1QQO A;  4YKX A;  4H5T A;  4GQT A;  5AQF A;  2BU2 A;  2CCU A;  2Q31 A;  1RFQ A;  2WER A;  1GJV A;  2IOQ A;  1JCG A;  2YI6 A;  2BRE A;  3U67 A;  2P9N B;  2P9S A;  3T0H A;  4JHD B;  2YE3 A;  2XHT A;  1A4H A;  4EFH A;  4RWT A;  3CQX A;  1EA6 A;  1I58 A;  2YEB A;  4EMV A;  2YK9 A;  3D2E B;  5FPM A;  1MDU B;  3CGZ A;  4LWF A;  3TZ5 A;  1US7 A;  4GY2 B;  2XJG A;  5AQS A;  2ZDY A;  1C0G A;  4HYP A;  4FCP A;  1NGH A;  1YT2 A;  1U2O A;  4FO0 A;  4L90 A;  3IUC A;  1BYQ A;  4MB9 A;  1T44 A;  2YKI A;  3TUH A;  4L91 A;  3RSE A;  3ZXQ A;  3RKZ A;  2Q8I A;  3EL2 A;  4MOT A;  1WUA A;  3DAW A;  2JKI A;  1JCE A;  3ULE A;  2O1U A;  2XHR A;  1YC1 A;  1UYI A;  3HZ1 A;  3PEJ A;  2Q0U A;  3OWD A;  2XDX A;  2YGA A;  2BU6 A;  2XK2 A;  3R4P A;  1QQM A;  4EAH D;  3C11 A;  4LPB A;  4CZG A;  5GGZ A;  2P9P A;  2GQP A;  5L3J A;  1Z5A A;  5CE3 A;  4JAV A;  4EFU A;  4CZK A;  1UY7 A;  1NGA A;  2WEP A;  5BPN A;  2VCP A;  1I5D A;  2CCT A;  2FTK A;  1SQK A;  1YSR A;  5AR0 A;  3W3D A;  2QF6 A;  3HZ5 A;  4MPE A;  3MN6 A;  1AH8 A;  4NH7 A;  4NH8 A;  1YT1 A;  1JCF A;  1S16 A;  4B9Q A;  5D7R A;  3FZL A;  1ZW9 A;  4AS9 A;  4CWS A;  1I5B A;  2E8A A;  4QPJ A;  2QWQ A;  2HCH A;  2YJF A;  3U8X A;  1NHJ A;  3A0Y A;  2H55 A;  3Q5L A;  1MU5 A;  2WI3 A;  4L8Z A;  3FV5 A;  3S5T A;  3TPQ A;  4Q20 A;  4HXW A;  3JZ3 A;  3OWB A;  1BUP A;  3UKR A;  3LDO A;  2WI1 A;  2VWC A;  1S3X A;  2E88 A;  3DXK B;  2YJE A;  3MN9 A;  3KE6 A;  5FNC A;  1YT0 A;  5D7C A;  4H5W A;  2UWD A;  2YEE A;  3GL1 A;  1KIJ A;  1UY6 A;  3TU5 A;  4JD2 A;  1RGI A;  4U93 A;  1UYD A;  1Z5B A;  3CWV A;  4H7Q A;  3R91 A;  4B7P A;  4JD2 B;  2HF4 A;  1Y4S A;  3A0R A;  4YKQ A;  4H5V A;  2BU5 A;  3CYG A;  4LWE A;  2XX2 A;  1IJJ A;  1ZXM A;  5F2R A;  4GCZ A;  1QY8 A;  2YEI A;  1U2V A;  2QWM A;  1AMW A;  5BOD A;  2Q8G A;  4KSH A;  4PKI A;  3MMV A;  3RSE B;  3CJB A;  3A0X A;  5ADX H;  3BM9 A;  4XJX A;  2EXL A;  2Q8H A;  4BQJ A;  3L6Q A;  5F5R A;  2FWY A;  3TTZ A;  4FSV A;  1MX0 A;  4P8O A;  2P9L B;  3K99 A;  5EX5 A;  2P9L A;  2D1K A;  3IED A;  1NGI A;  1TYQ A;  1Z5C A;  4URL A;  1GKZ A;  3O6O A;  4NH9 A;  1YVN A;  4EGH A;  3QFU A;  4FCQ A;  3MN5 A;  2ASP A;  1UYF A;  3QTF A;  2XX5 A;  3LDL A;  1ATR A;  2YE6 A;  5CTX A;  3WEE A;  4CZH A;  4KTN A;  1ID0 A;  3B28 A;  4Z94 A;  2IOR A;  2XAB A;  4KBO A;  3D36 A;  4CBW A;  4CBU A;  2HG1 A;  4XCJ A;  2W00 A;  5AQX A;  5EXW A;  4MPN A;  3EHG A;  5AQP A;  4YKR A;  5CTW A;  1QZ5 A;  3DXM B;  2H8M A;  3CRL A;  4X9L A;  2P9U B;  1AH6 A;  4AM7 A;  3HYZ A;  4LWG A;  4WUB A;  4EEH A;  3HBT A;  4XCL A;  2YI0 A;  1ATS A;  1K8K B;  3C7N B;  3O0I A;  4BEB A;  3LMM A;  3VHA A;  4PL7 A;  4EFT A;  3K60 A;  3D2F B;  2VW5 A;  4H5N A;  5F3K A;  4P7A A;  2ASM A;  3R4O A;  3BUZ B;  4DUH A;  4K4O A;  4KSG A;  2A40 A;  3UKU B;  4L94 A;  2P9P B;  1THN A;  3GIG B;  3RLP A;  4YKW A;  3A5O C;  2YE9 A;  1QQN A;  3U2D A;  4BEC A;  1MA9 B;  5AFU A;  1UY9 A;  2QG0 A;  4CWF A;  3WHA A;  4PU9 A;  5BPM A;  5M4K A;  1UYC A;  3CHW A;  3TZ4 A;  4XIQ A;  3R4M A;  3BMY A;  5IN9 A;  1ATN A;  4H5R A;  5AQI A;  1NGJ A;  1HJO A;  2IWS A;  2CH4 A;  1KZN A;  2Q2E B;  4CWR A;  2YEH A;  2XD6 A;  4HXZ A;  4J8F A;  4CWT A;  1PVG A;  5AQN A;  3D2F A;  1IXM A;  4JAS A;  1XQS C;  1UYK A;  2ESA A;  3EKR A;  2YKC A;  1NGC A;  1QYE A;  4CE3 A;  1B62 A;  1ZWH A;  3U9Z A;  2YI5 A;  4XKA A;  4I3H A;  2V51 B;  4WYB A;  4CE2 A;  2HKJ A;  3AY9 A;  4CWO A;  4DZY A;  1UYE A;  2YEF A;  2P9K B;  1HLU A;  5FPE A;  1Z59 A;  4BQG A;  3M3Z A;  1H7U A;  5J6A A;  4BXI A;  3NMQ A;  1KAZ A;  4IO8 A;  4ZVI A;  4HZ5 A;  1QZ6 A;  2IWU A;  2BYH A;  4EM7 A;  3FFK B;  3HSC A;  5AQH A;  2IOP A;  3FZK A;  2O1W A;  4B1Y B;  2BU8 A;  2YEG A;  3FE1 A;  3LNU A;  4KQV A;  2FXU A;  5IDJ A;  3TZ2 A;  2GWK A;  2E0A A;  1BXD A;  4BE7 B;  4PRV A;  4AWQ A;  2CG9 A;  2A3Z A;  1K8K A;  4O05 A;  2HF3 A;  4GT8 A;  5FPN A;  3FT8 A;  3CIP A;  2ASO A;  1EI1 A;  1YET A;  4CWP A;  2WI5 A;  4HWI A;  4YKY A;  2YEC A;  3MN7 A;  3GIG A;  5AQJ A;  2BZ5 A;  3B24 A;  2YE7 A;  2YK2 A;  4CWN A;  1DEJ A;  4H0X B;  1QZR A;  5D6P A;  1YC4 A;  1Y8O A;  3OPD A;  1UYM A;  1ZXN A;  2BU7 A;  4XE2 A;  4JNE A;  5AQV A;  5AQW A;  2A5X A;  2WI6 A;  1R62 A;  4B1W B;  1YES A;  2Q36 A;  1U2V B;  3T0Z A;  4FMT A;  4CZM A;  3LDN A;  3J8A A;  1DKG D;  2P9U A;  1YAG A;  3ATV A;  4JAU A;  3EKS A;  3FT5 A;  4H03 B;  2BT0 A;  3WEE B;  5EY4 A;  3U4L A;  3UB5 A;  5TKY A;  2VYP A;  5M4N A;  2YEJ A;  2XCM A;  4ASA A;  4FCR A;  1S22 A;  2QG2 A;  4HY6 A;  4EGK A;  2Q8F A;  3FZF A;  3K98 A;  3H80 A;  4URN A;  3EHH A;  2VCI A;  5J71 A;  1KAY A;  1GKX A;  3D2E A;  3A0W A;  3ATU A;  1J6Z A;  4M63 C;  4GNI A;  5JLF A;  3RLQ A;  3U9D A;  1TH8 A;  2A42 A;  3T2S A;  1HPM A;  1TID A;  4MP2 A;  3CJC A;  4XEI A;  4B1X B;  4MPC A;  4A2A A;  2XDS A;  4XKO A;  5AQQ A;  3LDQ A;  3GDQ A;  1NGG A;  3CGY A;  2GWJ A;  4CZI A;  1NHH A;  2HHI A;  2QWL A;  3A5M C;  3GIE A;  2QWR A;  4HYM A;  5CPH A;  3A5L C;  4HZ0 A;  5F1X A;  4EGI A;  5AQT A;  4V25 A;  2ZKJ A;  4XIR A;  1TYQ B;  2ZDX A;  2YEA A;  5BPL A;  2YKE A;  3QB0 A;  2FF6 A;  4WUC A;  4E02 A;  3QML A;  5JLH A;  4CZL A;  3FZM A;  3OMU A;  1BKN A;  3QDD A;  2A41 A;  2FWZ A;  3LPS A;  5AQY A;  2YE5 A;  3DGE A;  3B25 A;  2P9K A;  1E4G T;  3JXU A;  2YGF A;  1P8Z A;  3VHD A;  2XX4 A;  1TIL A;  4YKT A;  3A5N C;  3I33 A;  3SJH A;  1TC6 A;  2XJX A;  4QPK A;  4YKU A;  5CTY A;  1YC3 A;  2QFO A; 
#chains in the Genus database with same CATH homology
 2HHI A;  4E72 A;  3CYG A;  5JEN A;  3S5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...