3S5TA

Crystal structure of a member of duf3298 family (bf2082) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
257
structure length
253
Chain Sequence
KNTGALEFDSIQVNETAHLFGDTAKPACNLTINFAYPVKSTDNKLKDSLNSYFIAACFGEGYIGEKPAQVVKEYTEHYVKEYRTDLEPMYAEDEKNKSIGAWYSYYKGIESHVQLYYKNLLVYRINYNEYTGGAHGIYMTTFLNMDLINLRPLKLDDIFTGDYKEALTDLLWNQLMADKKVTTHEALEDMGYGSTGDIAPTENFYLDKDGITFYYNVYDITPYAMGPVEIKIPYEMMEHMLGSNPIIGEMKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Member of DUF3298 family (BF2082) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords DUF3298 family protein
total genus 65
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3s5tA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3s5tA02
4E72A 5JENA 2HHIA 3CYGA 3S5TA
chains in the Genus database with same CATH superfamily
1K8KA 2O1VA 1UY9A 4XE2A 4B1UB 5AFUH 3K99A 1NGEA 4CBXA 5EY4A 2XJJA 1AJ6A 3NMQA 4UROA 4EFUA 3ZXOA 3G7BA 1P8ZA 5FPDA 3A0YA 2YKIA 4GY2B 5AQZA 4A2BA 1NGCA 2V51B 4J8FA 1TILA 2BU5A 5GGZA 2P9PB 4RWTA 4EFHA 1BXDA 3DWLA 1UYEA 4BXIA 2BYHA 1NGDA 2HG1A 5FNFA 4B1ZA 2PAVA 1KIJA 1YT2A 3FV5A 1KZNA 2P9UA 1UY7A 2YE9A 3R91A 2P9IA 4KSHA 2WEPA 3IUCA 2IWXA 2VCJA 1U2VA 3EKSA 4H5RA 1UYDA 2D1KA 2XDKA 2YE3A 3HZ5A 1IXMA 1Y8PA 2ZBKB 3O6OA 4EMVA 3ATUA 5AQNA 4XD8A 1C0GA 3A0TA 1QQNA 4CWOA 2CH4A 2YI7A 2CCSA 2YE7A 3LPSA 4CZIA 3S5TA 4JQLA 3DGEA 1XQSC 3U2DA 5AQKA 4WUBA 2QF6A 4O07A 4CE3A 5M4MA 5JENA 4YKQA 4B6CA 1LCUA 4B9QA 3VHCA 4R3AA 2Q8FA 5M4NA 2YEGA 1NGBA 4O0BA 4V26A 1AM1A 1TC0A 2BU6A 3DXKB 2YKEA 1ATRA 1Z5BA 4FCQA 1YERA 1DKGD 4XCLA 4CWTA 3ZKDA 1QQOA 4K4OA 2XK2A 2YKBA 5M4EA 2UWDA 4W7TA 2XABA 5CPHA 3ATVA 1EA6A 3R92A 2ZKJA 2P9SB 2QW9A 2HMPA 2YEAA 1QY8A 2YE6A 3CRKA 1RGIA 3RLPA 1EI1A 1E4GT 4CBUA 1UYMA 4H0TB 4WYBA 3CJCA 2YEIA 1I5CA 2P9LA 4HWIA 1HX1A 4PRVA 5ADXH 3J8AA 1YXQA 4L90A 2O1WA 4DUHA 4JASA 4PL7A 2BSMA 1I5BA 2Q0RA 2Q36A 1BGQA 3TUHA 5I9EB 1YVNA 2YJFA 3FZHA 5M4HA 3MN7A 1BYQA 2ESAA 3T0ZA 3CWVA 4HY1A 5AQGA 4PKIA 4PL8A 1GJVA 4EGIA 2QFOA 2XX5A 2WI2A 4E02A 1MX0A 4AWOA 5J6AA 2FXUA 4FO0A 4KQVA 4HZ5A 2O1UA 4I3HA 1TH8A 4CWFA 3LNUA 3QTFA 1DEJA 2IWSA 4JHDB 2YKJA 3ULEA 3WQ9A 4KSGA 4HXZA 3UKRB 5IDJA 1AMWA 4MBCA 4CBWA 3PEHA 2VWCA 4MPCA 3FFKB 2IWUA 1R62A 4P8OA 3B27A 3HHUA 4CWNA 3K98A 4U7OA 1UYFA 2ZWHA 4XC0A 3M6GA 5AQUA 4AWQA 1E4FT 3OPDA 1GKXA 3B25A 3FZMA 2QWRA 4LWGA 3TTZA 5AQVA 5CTWA 2XX2A 5D7RA 4HXWA 4CI6A 5BPLA 3VHAA 5BODA 3L4IA 3A0XA 2A40A 2P9NA 3CQXA 1TBWA 3DAWA 5D7CA 5IN9A 2YJXA 1MA9B 3HYZA 2Q31A 4CZJA 2XHTA 3LMMA 5AQMA 2P9KB 1US7A 2YE5A 1TYQA 2V7YA 3C7NA 1NGFA 4MP7A 3A5OC 4YKTA 2E8AA 1BA1A 4PKGA 3W3DA 1H1VA 1NLVA 3FT5A 1B3QA 2H8MA 4H5TA 3LDOA 1WUAA 4U7NA 4BIUA 4LP0A 2FWYA 5AQLA 5AQSA 3FZFA 5D6PA 2WI1A 4IO8A 4PRXA 1K8KB 4GT8A 3QFPA 4LPBA 4M63C 1YT1A 1UYIA 5L3JA 4A2AA 1LOTB 3WEEA 3OWBA 1Z59A 4NH8A 1BA0A 1NGHA 2WI5A 3QB0A 3A0WA 4XCJA 1AH6A 1U2VB 3B24A 3GDQA 3UE5A 4ASBA 4O04A 3AY9A 4B1XB 4XIQA 4I6MA 1L0OA 3Q5KA 4YKXA 1SQKA 2Q0UA 1MU5A 3EKOA 4GFNA 5JLFA 1NMDA 3FZLA 3ULEB 5C93A 4L93A 3D2EA 3UB5A 3R4OA 2XDUA 2P9UB 3TU5A 3CGYA 4L94A 1QYEA 4H5NA 4BEBA 3LDPA 2WI4A 4K42A 2ZDYA 4CE2A 1NHIA 1TYQB 3D2FA 3OWDA 5AQJA 4Q20A 4H0VB 3PEJA 4MPNA 3H4LA 2A42A 1YC4A 3D0BA 4XEIA 5FWKA 1I5DA 5D6QA 3RLRA 2FTKA 4CWQA 1YSRA 1UYGA 4KFGA 3TZ2A 5M4KA 1UYLA 3K97A 1Y4SA 3INXA 4ASGA 4QPKA 1S3XA 2EXLA 2YEDA 2WUSA 2PNRA 2HKJA 3EHFA 5AQWA 2QWOA 4EAHD 2XD6A 2VW5A 1TIDA 1Z5CA 1KAZA 3HYYA 2HF4A 3ZM7A 4B1WB 3T0HA 3FZKA 1ZWHA 4GQTA 4URMA 2QXLA 4CZEA 1UY8A 1YC3A 3SJHA 1Z5AA 3GIGA 1KAYA 3BMYA 2CGFA 4H0YB 4BIZA 2YE8A 3EHGA 3A0RA 4XKKA 5AQPA 5CTUA 1Y8NA 3EKUA 4K41A 1BUPA 4FCPA 3U67A 4CWSA 1J6ZA 4AM7A 4JHDA 3U2KA 2QWMA 5AQFA 1YAGA 2BTZA 3R4MA 1A4HA 4H81A 3VHDA 4FMTA 1F51A 2BT0A 3CHWA 2WI7A 5IDMA 4YKUA 2BTFA 3T1KA 1UYHA 2BZ5A 2YGEA 3HEKA 2Q8HA 1I58A 4NH7A 4FL9A 4H0XB 2FYPA 2CCTA 2WERA 2XDLA 4PU9A 1ATSA 5AFUA 3INWA 3A5NC 4BQGA 3H80A 4B1YB 1Y4UA 5AQHA 2CCUA 4GCZA 3DXMA 3FE1A 4CZFA 1Y64A 1PVGA 1YESA 4KP4A 4QPJA 4XIRA 4KBOA 1ID0A 3D36A 1YSZA 2A41A 3T10A 4GEEA 3SL2A 3A5MC 4P7AA 1U0ZA 1JCEA 5TKYA 4YKZA 2IOQA 4CE1A 4YKWA 3QFUA 1QZRA 2QWQA 2Q2EB 3B26A 4XKOA 4ASAA 5AQXA 4L91A 2P9IB 3C0EA 1HJOA 2XHRA 2HF3A 4AM6A 3WHAA 2C1IA 2YI5A 4Z94A 2P9PA 4CZKA 3HBTA 2Q1NA 1UY6A 4XJXA 2HHIA 4HY6A 2YEEA 3A0ZA 4JD2A 4HYPA 2BU2A 4E72A 1YT0A 2E0AA 1GKZA 3MMVA 2QWNA 5BN8A 4XIPA 1EQYA 2XHXA 2ZDXA 2ASOA 2Q97A 2V52B 3TPQA 3MN5A 4H5VA 1ZW9A 1NGGA 5AQRA 1QQMA 4XTJA 4YKRA 4URNA 2YE4A 3LDLA 4H5WA 1UYCA 3JXUA 3G75A 2YE2A 4FPPA 1ZXNA 5FNCA 2GWKA 3BUZB 4FSVA 4RTFD 1NM1A 4XITA 4U93A 2FF3B 3G7EA 2KHOA 1B63A 1RFQA 2WI6A 3GIGB 2C1GA 3Q5LA 4B7PA 3QMLA 1H7SA 4CWPA 5AQOA 4MP2A 1NGJA 1T44A 3L6QA 5AQIA 1OSFA 3B28A 4O05A 4E00A 1NGIA 2V7ZA 1I59A 3GIEA 2P9SA 3MN6A 1HPMA 3OMUA 2QWPA 3CYGA 2OANA 2IORA 5BPMA 4JAUA 2BU7A 3GIFA 1Y8OA 4LWFA 5CTXA 5F5RA 4BE7B 2FF6A 2YKCA 1MDUB 1JM6A 3CIPA 4AWPA 5F2RA 3RSEA 5FPMA 1NGAA 4WUDA 3CJBA 4CZLA 4NH9A 1ATNA 3D2RA 2HCHA 1S14A 4JAVA 3EL2A 5AQTA 3U4LA 1ESVA 3HSCA 5AQYA 2ASPA 5F0XA 4PL9A 3T2SA 5CF0A 1H7UA 4I5SA 5FPNA 2XDXA 2P9KA 3M3ZA 3ZXQA 1IJJA 2E88A 4B1VA 4ZVIA 3MN9A 3TZ0A 2JKIA 4WUCA 1YC1A 4KTNA 4H7QA 3VADA 5JLHA 4BQJA 2YGAA 3KE6A 1U2OA 2BRCA 2Q8GA 5M4PA 1ZXMA 2CG9A 2JJCA 1THNA 3LDNA 5EVZA 3TZ5A 3U8XA 2IOPA 2QG0A 3U9ZA 1KXPA 2YEBA 2PBDA 2XCMA 2VCPA 4XDMA 5E84A 4MOTA 2XDSA 1AH8A 3BM9A 3O2FA 3I33A 1NHJA 2YECA 4LWEA 2QWLA 4JNEA 4H03B 3C11A 3UKUB 2FWZA 5F1XA 4EEHA 1YS3A 2YK2A 4LWHA 4AS9A 2GFDA 3RSEB 1NWKA 2YGFA 3IEDA 4L8ZA 4EGHA 2XJXA 1YETA 3UKUA 3D2EB 2FXSA 4CZMA 4HZ0A 3RLQA 5BOCA 5CE3A 1YUWA 2WI3A 5AQQA 2YI0A 4ASFA 4URLA 4R1FA 1NHHA 4GGLA 5AR0A 2ASMA 3DXMB 2A5XA 2W00A 2YEFA 4I6MB 2BYIA 1BKNA 4LWIA 3ZKBA 2YJWA 1QZ6A 3O0IA 3A5LC 3GL1A 3U9DA 4V25A 4DZYA 5F3KA 5BN9A 2YK9A 1D4XA 3WEEB 3TZ4A 5FNDA 3R4NA 3R4PA 1S16A 2K5BA 5CTYA 4JN4A 5ADXA 2A3ZA 4CWRA 2VCIA 4PKHA 1S22A 2YJEA 3M1FA 4GNIA 2YEJA 1HLUA 3OW6A 5BPNA 5EX5A 2AKPA 3Q5JA 4CZGA 4JD2B 3MNRP 2GQPA 5D7DA 2XJGA 1UYKA 4BAEA 1RDWX 4O09A 1QZ5A 1B62A 2YI6A 5J71A 2BU8A 3FT8A 2WEQA 3KVGA 4CZHA 2BREA 3A8YA 2Q8IA 3LDQA 3D2FB 3K60A 2P9NB 3CGZA 1JCFA 3EHHA 3HZ1A 4MB9A 4K43A 2H55A 3JZ3A 4EFTA 3CI5A 4YKYA 1KAXA 3C7NB 2C2AA 3RKZA 5EXWA 4MPEA 4ZKIA 5FPEA 4HYMA 2P9LB 2QG2A 2VYPA 2YEHA 4EGKA 3CRLA 1C0FA 4R3MA 4E01A 4FCRA 2GWJA 3EKRA 4H85A 1JCGA 1TC6A 4EM7A 2BUPA 3EHJA 4XKAA 3QDDA 4BECA 3DXKA 3UKRA 2XX4A 4X9LA 1I5AA
chains in the Genus database with same CATH topology
4E72A 5JENA 2HHIA 3CYGA 3S5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E72 A;  5JEN A;  2HHI A;  3CYG A;  3S5T A; 
#chains in the Genus database with same CATH topology
 1K8K A;  2O1V A;  1UY9 A;  4XE2 A;  4B1U B;  5AFU H;  3K99 A;  1NGE A;  4CBX A;  5EY4 A;  2XJJ A;  1AJ6 A;  3NMQ A;  4URO A;  4EFU A;  3ZXO A;  3G7B A;  1P8Z A;  5FPD A;  3A0Y A;  2YKI A;  4GY2 B;  5AQZ A;  4A2B A;  1NGC A;  2V51 B;  4J8F A;  1TIL A;  2BU5 A;  5GGZ A;  2P9P B;  4RWT A;  4EFH A;  1BXD A;  3DWL A;  1UYE A;  4BXI A;  2BYH A;  1NGD A;  2HG1 A;  5FNF A;  4B1Z A;  2PAV A;  1KIJ A;  1YT2 A;  3FV5 A;  1KZN A;  2P9U A;  1UY7 A;  2YE9 A;  3R91 A;  2P9I A;  4KSH A;  2WEP A;  3IUC A;  2IWX A;  2VCJ A;  1U2V A;  3EKS A;  4H5R A;  1UYD A;  2D1K A;  2XDK A;  2YE3 A;  3HZ5 A;  1IXM A;  1Y8P A;  2ZBK B;  3O6O A;  4EMV A;  3ATU A;  5AQN A;  4XD8 A;  1C0G A;  3A0T A;  1QQN A;  4CWO A;  2CH4 A;  2YI7 A;  2CCS A;  2YE7 A;  3LPS A;  4CZI A;  3S5T A;  4JQL A;  3DGE A;  1XQS C;  3U2D A;  5AQK A;  4WUB A;  2QF6 A;  4O07 A;  4CE3 A;  5M4M A;  5JEN A;  4YKQ A;  4B6C A;  1LCU A;  4B9Q A;  3VHC A;  4R3A A;  2Q8F A;  5M4N A;  2YEG A;  1NGB A;  4O0B A;  4V26 A;  1AM1 A;  1TC0 A;  2BU6 A;  3DXK B;  2YKE A;  1ATR A;  1Z5B A;  4FCQ A;  1YER A;  1DKG D;  4XCL A;  4CWT A;  3ZKD A;  1QQO A;  4K4O A;  2XK2 A;  2YKB A;  5M4E A;  2UWD A;  4W7T A;  2XAB A;  5CPH A;  3ATV A;  1EA6 A;  3R92 A;  2ZKJ A;  2P9S B;  2QW9 A;  2HMP A;  2YEA A;  1QY8 A;  2YE6 A;  3CRK A;  1RGI A;  3RLP A;  1EI1 A;  1E4G T;  4CBU A;  1UYM A;  4H0T B;  4WYB A;  3CJC A;  2YEI A;  1I5C A;  2P9L A;  4HWI A;  1HX1 A;  4PRV A;  5ADX H;  3J8A A;  1YXQ A;  4L90 A;  2O1W A;  4DUH A;  4JAS A;  4PL7 A;  2BSM A;  1I5B A;  2Q0R A;  2Q36 A;  1BGQ A;  3TUH A;  5I9E B;  1YVN A;  2YJF A;  3FZH A;  5M4H A;  3MN7 A;  1BYQ A;  2ESA A;  3T0Z A;  3CWV A;  4HY1 A;  5AQG A;  4PKI A;  4PL8 A;  1GJV A;  4EGI A;  2QFO A;  2XX5 A;  2WI2 A;  4E02 A;  1MX0 A;  4AWO A;  5J6A A;  2FXU A;  4FO0 A;  4KQV A;  4HZ5 A;  2O1U A;  4I3H A;  1TH8 A;  4CWF A;  3LNU A;  3QTF A;  1DEJ A;  2IWS A;  4JHD B;  2YKJ A;  3ULE A;  3WQ9 A;  4KSG A;  4HXZ A;  3UKR B;  5IDJ A;  1AMW A;  4MBC A;  4CBW A;  3PEH A;  2VWC A;  4MPC A;  3FFK B;  2IWU A;  1R62 A;  4P8O A;  3B27 A;  3HHU A;  4CWN A;  3K98 A;  4U7O A;  1UYF A;  2ZWH A;  4XC0 A;  3M6G A;  5AQU A;  4AWQ A;  1E4F T;  3OPD A;  1GKX A;  3B25 A;  3FZM A;  2QWR A;  4LWG A;  3TTZ A;  5AQV A;  5CTW A;  2XX2 A;  5D7R A;  4HXW A;  4CI6 A;  5BPL A;  3VHA A;  5BOD A;  3L4I A;  3A0X A;  2A40 A;  2P9N A;  3CQX A;  1TBW A;  3DAW A;  5D7C A;  5IN9 A;  2YJX A;  1MA9 B;  3HYZ A;  2Q31 A;  4CZJ A;  2XHT A;  3LMM A;  5AQM A;  2P9K B;  1US7 A;  2YE5 A;  1TYQ A;  2V7Y A;  3C7N A;  1NGF A;  4MP7 A;  3A5O C;  4YKT A;  2E8A A;  1BA1 A;  4PKG A;  3W3D A;  1H1V A;  1NLV A;  3FT5 A;  1B3Q A;  2H8M A;  4H5T A;  3LDO A;  1WUA A;  4U7N A;  4BIU A;  4LP0 A;  2FWY A;  5AQL A;  5AQS A;  3FZF A;  5D6P A;  2WI1 A;  4IO8 A;  4PRX A;  1K8K B;  4GT8 A;  3QFP A;  4LPB A;  4M63 C;  1YT1 A;  1UYI A;  5L3J A;  4A2A A;  1LOT B;  3WEE A;  3OWB A;  1Z59 A;  4NH8 A;  1BA0 A;  1NGH A;  2WI5 A;  3QB0 A;  3A0W A;  4XCJ A;  1AH6 A;  1U2V B;  3B24 A;  3GDQ A;  3UE5 A;  4ASB A;  4O04 A;  3AY9 A;  4B1X B;  4XIQ A;  4I6M A;  1L0O A;  3Q5K A;  4YKX A;  1SQK A;  2Q0U A;  1MU5 A;  3EKO A;  4GFN A;  5JLF A;  1NMD A;  3FZL A;  3ULE B;  5C93 A;  4L93 A;  3D2E A;  3UB5 A;  3R4O A;  2XDU A;  2P9U B;  3TU5 A;  3CGY A;  4L94 A;  1QYE A;  4H5N A;  4BEB A;  3LDP A;  2WI4 A;  4K42 A;  2ZDY A;  4CE2 A;  1NHI A;  1TYQ B;  3D2F A;  3OWD A;  5AQJ A;  4Q20 A;  4H0V B;  3PEJ A;  4MPN A;  3H4L A;  2A42 A;  1YC4 A;  3D0B A;  4XEI A;  5FWK A;  1I5D A;  5D6Q A;  3RLR A;  2FTK A;  4CWQ A;  1YSR A;  1UYG A;  4KFG A;  3TZ2 A;  5M4K A;  1UYL A;  3K97 A;  1Y4S A;  3INX A;  4ASG A;  4QPK A;  1S3X A;  2EXL A;  2YED A;  2WUS A;  2PNR A;  2HKJ A;  3EHF A;  5AQW A;  2QWO A;  4EAH D;  2XD6 A;  2VW5 A;  1TID A;  1Z5C A;  1KAZ A;  3HYY A;  2HF4 A;  3ZM7 A;  4B1W B;  3T0H A;  3FZK A;  1ZWH A;  4GQT A;  4URM A;  2QXL A;  4CZE A;  1UY8 A;  1YC3 A;  3SJH A;  1Z5A A;  3GIG A;  1KAY A;  3BMY A;  2CGF A;  4H0Y B;  4BIZ A;  2YE8 A;  3EHG A;  3A0R A;  4XKK A;  5AQP A;  5CTU A;  1Y8N A;  3EKU A;  4K41 A;  1BUP A;  4FCP A;  3U67 A;  4CWS A;  1J6Z A;  4AM7 A;  4JHD A;  3U2K A;  2QWM A;  5AQF A;  1YAG A;  2BTZ A;  3R4M A;  1A4H A;  4H81 A;  3VHD A;  4FMT A;  1F51 A;  2BT0 A;  3CHW A;  2WI7 A;  5IDM A;  4YKU A;  2BTF A;  3T1K A;  1UYH A;  2BZ5 A;  2YGE A;  3HEK A;  2Q8H A;  1I58 A;  4NH7 A;  4FL9 A;  4H0X B;  2FYP A;  2CCT A;  2WER A;  2XDL A;  4PU9 A;  1ATS A;  5AFU A;  3INW A;  3A5N C;  4BQG A;  3H80 A;  4B1Y B;  1Y4U A;  5AQH A;  2CCU A;  4GCZ A;  3DXM A;  3FE1 A;  4CZF A;  1Y64 A;  1PVG A;  1YES A;  4KP4 A;  4QPJ A;  4XIR A;  4KBO A;  1ID0 A;  3D36 A;  1YSZ A;  2A41 A;  3T10 A;  4GEE A;  3SL2 A;  3A5M C;  4P7A A;  1U0Z A;  1JCE A;  5TKY A;  4YKZ A;  2IOQ A;  4CE1 A;  4YKW A;  3QFU A;  1QZR A;  2QWQ A;  2Q2E B;  3B26 A;  4XKO A;  4ASA A;  5AQX A;  4L91 A;  2P9I B;  3C0E A;  1HJO A;  2XHR A;  2HF3 A;  4AM6 A;  3WHA A;  2C1I A;  2YI5 A;  4Z94 A;  2P9P A;  4CZK A;  3HBT A;  2Q1N A;  1UY6 A;  4XJX A;  2HHI A;  4HY6 A;  2YEE A;  3A0Z A;  4JD2 A;  4HYP A;  2BU2 A;  4E72 A;  1YT0 A;  2E0A A;  1GKZ A;  3MMV A;  2QWN A;  5BN8 A;  4XIP A;  1EQY A;  2XHX A;  2ZDX A;  2ASO A;  2Q97 A;  2V52 B;  3TPQ A;  3MN5 A;  4H5V A;  1ZW9 A;  1NGG A;  5AQR A;  1QQM A;  4XTJ A;  4YKR A;  4URN A;  2YE4 A;  3LDL A;  4H5W A;  1UYC A;  3JXU A;  3G75 A;  2YE2 A;  4FPP A;  1ZXN A;  5FNC A;  2GWK A;  3BUZ B;  4FSV A;  4RTF D;  1NM1 A;  4XIT A;  4U93 A;  2FF3 B;  3G7E A;  2KHO A;  1B63 A;  1RFQ A;  2WI6 A;  3GIG B;  2C1G A;  3Q5L A;  4B7P A;  3QML A;  1H7S A;  4CWP A;  5AQO A;  4MP2 A;  1NGJ A;  1T44 A;  3L6Q A;  5AQI A;  1OSF A;  3B28 A;  4O05 A;  4E00 A;  1NGI A;  2V7Z A;  1I59 A;  3GIE A;  2P9S A;  3MN6 A;  1HPM A;  3OMU A;  2QWP A;  3CYG A;  2OAN A;  2IOR A;  5BPM A;  4JAU A;  2BU7 A;  3GIF A;  1Y8O A;  4LWF A;  5CTX A;  5F5R A;  4BE7 B;  2FF6 A;  2YKC A;  1MDU B;  1JM6 A;  3CIP A;  4AWP A;  5F2R A;  3RSE A;  5FPM A;  1NGA A;  4WUD A;  3CJB A;  4CZL A;  4NH9 A;  1ATN A;  3D2R A;  2HCH A;  1S14 A;  4JAV A;  3EL2 A;  5AQT A;  3U4L A;  1ESV A;  3HSC A;  5AQY A;  2ASP A;  5F0X A;  4PL9 A;  3T2S A;  5CF0 A;  1H7U A;  4I5S A;  5FPN A;  2XDX A;  2P9K A;  3M3Z A;  3ZXQ A;  1IJJ A;  2E88 A;  4B1V A;  4ZVI A;  3MN9 A;  3TZ0 A;  2JKI A;  4WUC A;  1YC1 A;  4KTN A;  4H7Q A;  3VAD A;  5JLH A;  4BQJ A;  2YGA A;  3KE6 A;  1U2O A;  2BRC A;  2Q8G A;  5M4P A;  1ZXM A;  2CG9 A;  2JJC A;  1THN A;  3LDN A;  5EVZ A;  3TZ5 A;  3U8X A;  2IOP A;  2QG0 A;  3U9Z A;  1KXP A;  2YEB A;  2PBD A;  2XCM A;  2VCP A;  4XDM A;  5E84 A;  4MOT A;  2XDS A;  1AH8 A;  3BM9 A;  3O2F A;  3I33 A;  1NHJ A;  2YEC A;  4LWE A;  2QWL A;  4JNE A;  4H03 B;  3C11 A;  3UKU B;  2FWZ A;  5F1X A;  4EEH A;  1YS3 A;  2YK2 A;  4LWH A;  4AS9 A;  2GFD A;  3RSE B;  1NWK A;  2YGF A;  3IED A;  4L8Z A;  4EGH A;  2XJX A;  1YET A;  3UKU A;  3D2E B;  2FXS A;  4CZM A;  4HZ0 A;  3RLQ A;  5BOC A;  5CE3 A;  1YUW A;  2WI3 A;  5AQQ A;  2YI0 A;  4ASF A;  4URL A;  4R1F A;  1NHH A;  4GGL A;  5AR0 A;  2ASM A;  3DXM B;  2A5X A;  2W00 A;  2YEF A;  4I6M B;  2BYI A;  1BKN A;  4LWI A;  3ZKB A;  2YJW A;  1QZ6 A;  3O0I A;  3A5L C;  3GL1 A;  3U9D A;  4V25 A;  4DZY A;  5F3K A;  5BN9 A;  2YK9 A;  1D4X A;  3WEE B;  3TZ4 A;  5FND A;  3R4N A;  3R4P A;  1S16 A;  2K5B A;  5CTY A;  4JN4 A;  5ADX A;  2A3Z A;  4CWR A;  2VCI A;  4PKH A;  1S22 A;  2YJE A;  3M1F A;  4GNI A;  2YEJ A;  1HLU A;  3OW6 A;  5BPN A;  5EX5 A;  2AKP A;  3Q5J A;  4CZG A;  4JD2 B;  3MNR P;  2GQP A;  5D7D A;  2XJG A;  1UYK A;  4BAE A;  1RDW X;  4O09 A;  1QZ5 A;  1B62 A;  2YI6 A;  5J71 A;  2BU8 A;  3FT8 A;  2WEQ A;  3KVG A;  4CZH A;  2BRE A;  3A8Y A;  2Q8I A;  3LDQ A;  3D2F B;  3K60 A;  2P9N B;  3CGZ A;  1JCF A;  3EHH A;  3HZ1 A;  4MB9 A;  4K43 A;  2H55 A;  3JZ3 A;  4EFT A;  3CI5 A;  4YKY A;  1KAX A;  3C7N B;  2C2A A;  3RKZ A;  5EXW A;  4MPE A;  4ZKI A;  5FPE A;  4HYM A;  2P9L B;  2QG2 A;  2VYP A;  2YEH A;  4EGK A;  3CRL A;  1C0F A;  4R3M A;  4E01 A;  4FCR A;  2GWJ A;  3EKR A;  4H85 A;  1JCG A;  1TC6 A;  4EM7 A;  2BUP A;  3EHJ A;  4XKA A;  3QDD A;  4BEC A;  3DXK A;  3UKR A;  2XX4 A;  4X9L A;  1I5A A; 
#chains in the Genus database with same CATH homology
 4E72 A;  5JEN A;  2HHI A;  3CYG A;  3S5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...