3S5TA

Crystal structure of a member of duf3298 family (bf2082) from bacteroides fragilis nctc 9343 at 2.30 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
257
structure length
253
Chain Sequence
b'KNTGALEFDSIQVNETAHLFGDTAKPACNLTINFAYPVKSTDNKLKDSLNSYFIAACFGEGYIGEKPAQVVKEYTEHYVKEYRTDLEPMYAEDEKNKSIGAWYSYYKGIESHVQLYYKNLLVYRINYNEYTGGAHGIYMTTFLNMDLINLRPLKLDDIFTGDYKEALTDLLWNQLMADKKVTTHEALEDMGYGSTGDIAPTENFYLDKDGITFYYNVYDITPYAMGPVEIKIPYEMMEHMLGSNPIIGEMKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DUF3298 family protein
publication title Crystal structure of a Member of DUF3298 family (BF2082) from Bacteroides fragilis NCTC 9343 at 2.30 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 65
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11738 DUF3298 Protein of unknown function (DUF3298)
A PF13739 PdaC Deacetylase PdaC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.565.40 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Fervidobacterium nodosum Rt17-B1 like 3s5tA01
3.90.640.20 Alpha Beta Alpha-Beta Complex Actin; Chain A, domain 4 Heat-shock cognate protein, ATPase 3s5tA02
5JENA 3S5TA 3CYGA 4E72A 2HHIA
chains in the Genus database with same CATH superfamily
4MPNA 2P9PA 2E0AA 2Q2EB 3Q5KA 2ZDYA 4L93A 2YGAA 3A0ZA 3RLRA 4QPKA 5M4KA 2P9SB 2P9KA 1LCUA 2QG0A 4XEIA 5AQWA 3JXUA 4FSVA 5AQGA 4KTNA 4L91A 1J6ZA 4B1WB 5FPEA 1ZXNA 4PKGA 1QZ6A 5F2RA 2Q8GA 3ZM7A 2A41A 4PRVA 2WI5A 5E84A 1NGGA 4U7OA 5AQHA 3B24A 4CWRA 1U2VA 2BYIA 4V25A 1BKNA 3T0ZA 1NGHA 2XDSA 3C11A 3UKRB 2QG2A 2XX2A 2WI2A 2GQPA 1B3QA 3DXKA 4KQVA 3EKUA 3EL2A 5BODA 1Z59A 2FWZA 4O04A 1YT2A 1C0GA 1TIDA 3FFKB 5AQYA 5CTWA 4CWPA 3UKUB 4BECA 1I5CA 2XHXA 2ZKJA 3D2EB 4CZFA 4K4OA 3TZ2A 1HX1A 5M4MA 3W3DA 4X9LA 3LDOA 1NGBA 2YJEA 1JM6A 2A5XA 2QW9A 5JLHA 4FL9A 2BU5A 4L8ZA 2O1WA 4GNIA 3KE6A 4O05A 2XDKA 2CCUA 3HEKA 3ULEB 1ESVA 1HJOA 4HZ0A 3HBTA 1YESA 2YE2A 3CGYA 2E88A 3CRKA 2Q8FA 4XDMA 2XHRA 2BU6A 5CTXA 3FV5A 4H7QA 2XJJA 5AQIA 4KSHA 3CI5A 2C1GA 4JASA 5M4PA 4CZEA 3TTZA 3D2FA 3A0WA 2ZWHA 2K5BA 2YE4A 3VHCA 1Y8PA 2HHIA 3DGEA 1BA0A 1YT1A 4CWTA 3WEEB 4I3HA 1NGAA 3RLQA 5L3JA 3EHHA 3INXA 2IORA 1JCEA 3RSEB 3T1KA 3L6QA 4YKZA 1DKGD 5BN8A 2BYHA 2QWOA 3A0RA 2VCIA 4YKTA 1Y4UA 3K98A 4JHDB 5I9EB 1Z5BA 4H0YB 3TUHA 3HYYA 2P9IB 3CQXA 3R91A 2BRCA 4HY1A 2FXSA 4K43A 3Q5JA 5FPMA 1KAYA 3GDQA 2WI1A 4AM7A 3TZ5A 2P9UB 2WI7A 3IEDA 5FNFA 1GKXA 1NLVA 1H7UA 1KAZA 1QQNA 2IWSA 1MU5A 2BU8A 3JZ3A 1EI1A 4EGKA 4H5NA 3CJBA 2XX4A 2Q97A 1UYIA 3GIGB 1TYQB 2ZDXA 3QFUA 4B1ZA 1DEJA 2YI5A 2BZ5A 3BUZB 2WI3A 5D7CA 2YEFA 4PKIA 1Z5AA 3VADA 2Q31A 2HF4A 3A0TA 5EXWA 1YSZA 2QXLA 4XC0A 2XX5A 1LOTB 2YE3A 3O6OA 3LMMA 4RTFD 5FPDA 2ESAA 3OW6A 4Q20A 4GT8A 4AS9A 1T44A 5JLFA 4QPJA 2XJXA 4I6MA 1YVNA 1ZW9A 3OMUA 3A5OC 1MX0A 2YEDA 2O1UA 1RDWX 5F1XA 1E4GT 1D4XA 3RKZA 1YS3A 4U7NA 3FZLA 3GL1A 3CWVA 1YUWA 4AWQA 1PVGA 1NHJA 4YKRA 3CGZA 3ZKBA 3DWLA 3DXMA 4FPPA 3FZFA 4RWTA 5FPNA 2KHOA 5AQPA 1A4HA 1I58A 3HYZA 4HY6A 3C7NA 2Q8IA 1Y8OA 5AFUA 4EAHD 2YK9A 2YJXA 5CTYA 4XCJA 4XKAA 2XDUA 4CZHA 2C1IA 1KIJA 5M4NA 3HZ1A 1WUAA 5IDJA 2YI6A 4E01A 4R1FA 4BQGA 1B62A 2P9NA 4UROA 4JD2A 2HKJA 2QWLA 3B26A 3MN5A 4H0TB 4YKWA 1JCGA 4XE2A 1GJVA 2P9LA 3ZXOA 4J8FA 4E00A 4B6CA 4H85A 1K8KA 2P9PB 3LDPA 4PU9A 4LP0A 4CBXA 5CE3A 3DAWA 1ATNA 3A8YA 2P9KB 3H80A 5D6QA 1QZ5A 4PRXA 4H5RA 3R4OA 1UYLA 4B9QA 4XJXA 2IWUA 3M1FA 4CZIA 4KFGA 3QTFA 4B1YB 4XKOA 2CCTA 3EHJA 2A42A 1UYKA 2VW5A 1UYHA 4CZMA 2VCJA 1YC3A 2YKEA 1IXMA 2ASOA 3QDDA 2GWKA 5J6AA 2XDXA 4GFNA 4XKKA 3B27A 1AMWA 1B63A 2W00A 4O0BA 4EM7A 1RGIA 2XCMA 1U2VB 5F5RA 2YGEA 3U8XA 1NWKA 1L0OA 4EFTA 2YGFA 2Q0UA 4CBUA 3O0IA 4H5TA 5EX5A 3LDNA 1S22A 3CRLA 3LPSA 3T10A 3CIPA 4P8OA 4ASBA 4E72A 3G75A 4FCPA 3ATUA 2YE7A 4URLA 2YE5A 3A5MC 3M3ZA 1YC4A 1YXQA 3DXKB 1AH8A 2YEJA 2YEEA 4EGHA 1RFQA 5EVZA 1NGDA 2V7YA 2Q1NA 1IJJA 1S16A 4BIZA 1AH6A 4MB9A 5AQQA 4JAVA 4BEBA 4V26A 4MOTA 4YKUA 4HWIA 2WI4A 5JENA 2OANA 2JKIA 3EHFA 3D2RA 3O2FA 4YKYA 5AQKA 1NGIA 2Q36A 5FWKA 1QQMA 1UYMA 1YC1A 2IOQA 1KAXA 4WUCA 3CHWA 2YEAA 2Q8HA 1YSRA 4KSGA 2YKBA 5CPHA 4O09A 1R62A 2YEHA 3SJHA 3G7BA 3K97A 2CCSA 1JCFA 1H1VA 2QWRA 1OSFA 1ATSA 2XK2A 2BREA 2ASPA 3EKSA 5M4HA 4NH8A 5D7DA 3INWA 3TU5A 4CWOA 4PKHA 2EXLA 4WUBA 3A5LC 3H4LA 5AQRA 5CF0A 1QYEA 3MMVA 1TC0A 1I5BA 2FTKA 2GWJA 5C93A 2V52B 2VCPA 2FF3B 3WQ9A 4XIRA 3D0BA 2VYPA 1Z5CA 2H8MA 2QFOA 4E02A 4H0VB 5BN9A 4EFUA 5AQNA 4ZVIA 4EGIA 3GIFA 2HF3A 1UYFA 2AKPA 5ADXH 2WUSA 4CE3A 4DZYA 4W7TA 3VHAA 1MA9B 4R3MA 4CZGA 3SL2A 4HYMA 3U9ZA 4LPBA 2CGFA 2A3ZA 4HXZA 4P7AA 4HXWA 4CWSA 1I59A 1EQYA 3HZ5A 4H0XB 1F51A 4XD8A 1UY9A 4I5SA 1ZWHA 1Y64A 2PNRA 3K99A 5GGZA 1AM1A 3QFPA 4CZJA 4FCQA 2XHTA 1QY8A 4NH7A 1THNA 4H5WA 3ZKDA 1MDUB 5AQMA 3EHGA 4FCRA 5CTUA 1QZRA 4I6MB 1BGQA 2HMPA 1XQSC 4A2AA 5BPLA 2V51B 5AR0A 1UY7A 2YECA 1ID0A 1GKZA 4MBCA 2P9SA 1I5DA 2WERA 4EEHA 2QWNA 5IDMA 1P8ZA 2CG9A 3B28A 3EKRA 3DXMB 5J71A 2Q0RA 3C7NB 3U4LA 2WEQA 1US7A 1BUPA 3U67A 4B1UB 5AQTA 4YKQA 3QB0A 2YEIA 1TILA 3J8AA 5BOCA 3NMQA 4XITA 3QMLA 4URMA 3U2KA 3FT5A 4ASAA 1UYCA 3R4NA 4BIUA 3FZMA 1YAGA 4H81A 2P9NB 3BM9A 4JD2B 3UKRA 5ADXA 5F0XA 5TKYA 2BTZA 4KP4A 1UYGA 3GIEA 2P9LB 4CWFA 2BUPA 2XD6A 1K8KB 3L4IA 2PAVA 3IUCA 2VWCA 4HYPA 1UYDA 1BYQA 4PL8A 2YKCA 4CE1A 4B1VA 1UY8A 3UKUA 2YE9A 4YKXA 1ATRA 3KVGA 3D2EA 4GCZA 3LDQA 2PBDA 5AQSA 2HCHA 3RLPA 2QWPA 4A2BA 4CI6A 3EKOA 5F3KA 1NGFA 2YI0A 5AQJA 2BU7A 1NHIA 3HSCA 4MPCA 2O1VA 2YEGA 5FNCA 3HHUA 3ULEA 4LWEA 4ZKIA 4XCLA 5AQZA 4ASGA 4BXIA 4CE2A 3TZ0A 3I33A 1TBWA 4M63C 5AQOA 2A40A 4BE7B 2YI7A 4B7PA 2QF6A 4MP7A 2BTFA 3M6GA 4EMVA 4MP2A 4K41A 4LWFA 3FZKA 4KBOA 1NHHA 1S14A 3WEEA 4BQJA 5FNDA 3R92A 4WUDA 1QQOA 2YJFA 2FXUA 4GEEA 4WYBA 3RSEA 4PL7A 2YE8A 3MN9A 2QWMA 4XTJA 3D2FB 5M4EA 1S3XA 2IWXA 3D36A 3BMYA 1ZXMA 4HZ5A 5AQFA 4JHDA 1U0ZA 5AQXA 2P9IA 5D6PA 2ASMA 1KXPA 3OPDA 4Z94A 1NMDA 3OWBA 3U2DA 2QWQA 4O07A 2FWYA 2IOPA 3PEJA 2P9UA 1Y4SA 3FZHA 4URNA 1NGEA 4AWPA 2XABA 2FYPA 3MN6A 3TPQA 2GFDA 1BXDA 4FO0A 1YT0A 5AFUH 3FE1A 2WI6A 3LDLA 5D7RA 3A5NC 4CWQA 4B1XB 2HG1A 1TH8A 4JQLA 4R3AA 1KZNA 2UWDA 1NGJA 5AQUA 3GIGA 4BAEA 2YE6A 3R4MA 4U93A 1TYQA 5EY4A 3A0XA 3C0EA 4L90A 4PL9A 4AWOA 3G7EA 3OWDA 3ATVA 4LWIA 3UB5A 1YERA 3CYGA 1BA1A 4CZLA 1SQKA 2XJGA 2E8AA 4IO8A 2YK2A 3K60A 3PEHA 2YKJA 1TC6A 1I5AA 2H55A 3U9DA 2BT0A 2WEPA 4CWNA 5AQLA 4XIQA 3S5TA 4CBWA 2BU2A 2YKIA 3LNUA 4GGLA 2YEBA 3ZXQA 2C2AA 1H7SA 1UYEA 3MN7A 4XIPA 1YETA 4JAUA 1NGCA 4DUHA 1Y8NA 4MPEA 4K42A 4LWGA 4NH9A 3Q5LA 2FF6A 3T2SA 1UY6A 3T0HA 3TZ4A 2D1KA 5BPMA 1EA6A 3B25A 3UE5A 2YJWA 1HPMA 4GQTA 1C0FA 1HLUA 4JNEA 2JJCA 3MNRP 2CH4A 2V7ZA 4H5VA 4ASFA 4CZKA 3A0YA 4L94A 3WHAA 5AQVA 1AJ6A 5BPNA 2XDLA 1NM1A 3FT8A 4LWHA 4GY2B 4JN4A 4FMTA 4AM6A 3R4PA 4EFHA 3CJCA 5IN9A 3VHDA 2ZBKB 1E4FT 3AY9A 2BSMA 1U2OA 4H03B
chains in the Genus database with same CATH topology
5JENA 3S5TA 3CYGA 4E72A 2HHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEN A;  3S5T A;  3CYG A;  4E72 A;  2HHI A; 
#chains in the Genus database with same CATH topology
 4MPN A;  2P9P A;  2E0A A;  2Q2E B;  3Q5K A;  2ZDY A;  4L93 A;  2YGA A;  3A0Z A;  3RLR A;  4QPK A;  5M4K A;  2P9S B;  2P9K A;  1LCU A;  2QG0 A;  4XEI A;  5AQW A;  3JXU A;  4FSV A;  5AQG A;  4KTN A;  4L91 A;  1J6Z A;  4B1W B;  5FPE A;  1ZXN A;  4PKG A;  1QZ6 A;  5F2R A;  2Q8G A;  3ZM7 A;  2A41 A;  4PRV A;  2WI5 A;  5E84 A;  1NGG A;  4U7O A;  5AQH A;  3B24 A;  4CWR A;  1U2V A;  2BYI A;  4V25 A;  1BKN A;  3T0Z A;  1NGH A;  2XDS A;  3C11 A;  3UKR B;  2QG2 A;  2XX2 A;  2WI2 A;  2GQP A;  1B3Q A;  3DXK A;  4KQV A;  3EKU A;  3EL2 A;  5BOD A;  1Z59 A;  2FWZ A;  4O04 A;  1YT2 A;  1C0G A;  1TID A;  3FFK B;  5AQY A;  5CTW A;  4CWP A;  3UKU B;  4BEC A;  1I5C A;  2XHX A;  2ZKJ A;  3D2E B;  4CZF A;  4K4O A;  3TZ2 A;  1HX1 A;  5M4M A;  3W3D A;  4X9L A;  3LDO A;  1NGB A;  2YJE A;  1JM6 A;  2A5X A;  2QW9 A;  5JLH A;  4FL9 A;  2BU5 A;  4L8Z A;  2O1W A;  4GNI A;  3KE6 A;  4O05 A;  2XDK A;  2CCU A;  3HEK A;  3ULE B;  1ESV A;  1HJO A;  4HZ0 A;  3HBT A;  1YES A;  2YE2 A;  3CGY A;  2E88 A;  3CRK A;  2Q8F A;  4XDM A;  2XHR A;  2BU6 A;  5CTX A;  3FV5 A;  4H7Q A;  2XJJ A;  5AQI A;  4KSH A;  3CI5 A;  2C1G A;  4JAS A;  5M4P A;  4CZE A;  3TTZ A;  3D2F A;  3A0W A;  2ZWH A;  2K5B A;  2YE4 A;  3VHC A;  1Y8P A;  2HHI A;  3DGE A;  1BA0 A;  1YT1 A;  4CWT A;  3WEE B;  4I3H A;  1NGA A;  3RLQ A;  5L3J A;  3EHH A;  3INX A;  2IOR A;  1JCE A;  3RSE B;  3T1K A;  3L6Q A;  4YKZ A;  1DKG D;  5BN8 A;  2BYH A;  2QWO A;  3A0R A;  2VCI A;  4YKT A;  1Y4U A;  3K98 A;  4JHD B;  5I9E B;  1Z5B A;  4H0Y B;  3TUH A;  3HYY A;  2P9I B;  3CQX A;  3R91 A;  2BRC A;  4HY1 A;  2FXS A;  4K43 A;  3Q5J A;  5FPM A;  1KAY A;  3GDQ A;  2WI1 A;  4AM7 A;  3TZ5 A;  2P9U B;  2WI7 A;  3IED A;  5FNF A;  1GKX A;  1NLV A;  1H7U A;  1KAZ A;  1QQN A;  2IWS A;  1MU5 A;  2BU8 A;  3JZ3 A;  1EI1 A;  4EGK A;  4H5N A;  3CJB A;  2XX4 A;  2Q97 A;  1UYI A;  3GIG B;  1TYQ B;  2ZDX A;  3QFU A;  4B1Z A;  1DEJ A;  2YI5 A;  2BZ5 A;  3BUZ B;  2WI3 A;  5D7C A;  2YEF A;  4PKI A;  1Z5A A;  3VAD A;  2Q31 A;  2HF4 A;  3A0T A;  5EXW A;  1YSZ A;  2QXL A;  4XC0 A;  2XX5 A;  1LOT B;  2YE3 A;  3O6O A;  3LMM A;  4RTF D;  5FPD A;  2ESA A;  3OW6 A;  4Q20 A;  4GT8 A;  4AS9 A;  1T44 A;  5JLF A;  4QPJ A;  2XJX A;  4I6M A;  1YVN A;  1ZW9 A;  3OMU A;  3A5O C;  1MX0 A;  2YED A;  2O1U A;  1RDW X;  5F1X A;  1E4G T;  1D4X A;  3RKZ A;  1YS3 A;  4U7N A;  3FZL A;  3GL1 A;  3CWV A;  1YUW A;  4AWQ A;  1PVG A;  1NHJ A;  4YKR A;  3CGZ A;  3ZKB A;  3DWL A;  3DXM A;  4FPP A;  3FZF A;  4RWT A;  5FPN A;  2KHO A;  5AQP A;  1A4H A;  1I58 A;  3HYZ A;  4HY6 A;  3C7N A;  2Q8I A;  1Y8O A;  5AFU A;  4EAH D;  2YK9 A;  2YJX A;  5CTY A;  4XCJ A;  4XKA A;  2XDU A;  4CZH A;  2C1I A;  1KIJ A;  5M4N A;  3HZ1 A;  1WUA A;  5IDJ A;  2YI6 A;  4E01 A;  4R1F A;  4BQG A;  1B62 A;  2P9N A;  4URO A;  4JD2 A;  2HKJ A;  2QWL A;  3B26 A;  3MN5 A;  4H0T B;  4YKW A;  1JCG A;  4XE2 A;  1GJV A;  2P9L A;  3ZXO A;  4J8F A;  4E00 A;  4B6C A;  4H85 A;  1K8K A;  2P9P B;  3LDP A;  4PU9 A;  4LP0 A;  4CBX A;  5CE3 A;  3DAW A;  1ATN A;  3A8Y A;  2P9K B;  3H80 A;  5D6Q A;  1QZ5 A;  4PRX A;  4H5R A;  3R4O A;  1UYL A;  4B9Q A;  4XJX A;  2IWU A;  3M1F A;  4CZI A;  4KFG A;  3QTF A;  4B1Y B;  4XKO A;  2CCT A;  3EHJ A;  2A42 A;  1UYK A;  2VW5 A;  1UYH A;  4CZM A;  2VCJ A;  1YC3 A;  2YKE A;  1IXM A;  2ASO A;  3QDD A;  2GWK A;  5J6A A;  2XDX A;  4GFN A;  4XKK A;  3B27 A;  1AMW A;  1B63 A;  2W00 A;  4O0B A;  4EM7 A;  1RGI A;  2XCM A;  1U2V B;  5F5R A;  2YGE A;  3U8X A;  1NWK A;  1L0O A;  4EFT A;  2YGF A;  2Q0U A;  4CBU A;  3O0I A;  4H5T A;  5EX5 A;  3LDN A;  1S22 A;  3CRL A;  3LPS A;  3T10 A;  3CIP A;  4P8O A;  4ASB A;  4E72 A;  3G75 A;  4FCP A;  3ATU A;  2YE7 A;  4URL A;  2YE5 A;  3A5M C;  3M3Z A;  1YC4 A;  1YXQ A;  3DXK B;  1AH8 A;  2YEJ A;  2YEE A;  4EGH A;  1RFQ A;  5EVZ A;  1NGD A;  2V7Y A;  2Q1N A;  1IJJ A;  1S16 A;  4BIZ A;  1AH6 A;  4MB9 A;  5AQQ A;  4JAV A;  4BEB A;  4V26 A;  4MOT A;  4YKU A;  4HWI A;  2WI4 A;  5JEN A;  2OAN A;  2JKI A;  3EHF A;  3D2R A;  3O2F A;  4YKY A;  5AQK A;  1NGI A;  2Q36 A;  5FWK A;  1QQM A;  1UYM A;  1YC1 A;  2IOQ A;  1KAX A;  4WUC A;  3CHW A;  2YEA A;  2Q8H A;  1YSR A;  4KSG A;  2YKB A;  5CPH A;  4O09 A;  1R62 A;  2YEH A;  3SJH A;  3G7B A;  3K97 A;  2CCS A;  1JCF A;  1H1V A;  2QWR A;  1OSF A;  1ATS A;  2XK2 A;  2BRE A;  2ASP A;  3EKS A;  5M4H A;  4NH8 A;  5D7D A;  3INW A;  3TU5 A;  4CWO A;  4PKH A;  2EXL A;  4WUB A;  3A5L C;  3H4L A;  5AQR A;  5CF0 A;  1QYE A;  3MMV A;  1TC0 A;  1I5B A;  2FTK A;  2GWJ A;  5C93 A;  2V52 B;  2VCP A;  2FF3 B;  3WQ9 A;  4XIR A;  3D0B A;  2VYP A;  1Z5C A;  2H8M A;  2QFO A;  4E02 A;  4H0V B;  5BN9 A;  4EFU A;  5AQN A;  4ZVI A;  4EGI A;  3GIF A;  2HF3 A;  1UYF A;  2AKP A;  5ADX H;  2WUS A;  4CE3 A;  4DZY A;  4W7T A;  3VHA A;  1MA9 B;  4R3M A;  4CZG A;  3SL2 A;  4HYM A;  3U9Z A;  4LPB A;  2CGF A;  2A3Z A;  4HXZ A;  4P7A A;  4HXW A;  4CWS A;  1I59 A;  1EQY A;  3HZ5 A;  4H0X B;  1F51 A;  4XD8 A;  1UY9 A;  4I5S A;  1ZWH A;  1Y64 A;  2PNR A;  3K99 A;  5GGZ A;  1AM1 A;  3QFP A;  4CZJ A;  4FCQ A;  2XHT A;  1QY8 A;  4NH7 A;  1THN A;  4H5W A;  3ZKD A;  1MDU B;  5AQM A;  3EHG A;  4FCR A;  5CTU A;  1QZR A;  4I6M B;  1BGQ A;  2HMP A;  1XQS C;  4A2A A;  5BPL A;  2V51 B;  5AR0 A;  1UY7 A;  2YEC A;  1ID0 A;  1GKZ A;  4MBC A;  2P9S A;  1I5D A;  2WER A;  4EEH A;  2QWN A;  5IDM A;  1P8Z A;  2CG9 A;  3B28 A;  3EKR A;  3DXM B;  5J71 A;  2Q0R A;  3C7N B;  3U4L A;  2WEQ A;  1US7 A;  1BUP A;  3U67 A;  4B1U B;  5AQT A;  4YKQ A;  3QB0 A;  2YEI A;  1TIL A;  3J8A A;  5BOC A;  3NMQ A;  4XIT A;  3QML A;  4URM A;  3U2K A;  3FT5 A;  4ASA A;  1UYC A;  3R4N A;  4BIU A;  3FZM A;  1YAG A;  4H81 A;  2P9N B;  3BM9 A;  4JD2 B;  3UKR A;  5ADX A;  5F0X A;  5TKY A;  2BTZ A;  4KP4 A;  1UYG A;  3GIE A;  2P9L B;  4CWF A;  2BUP A;  2XD6 A;  1K8K B;  3L4I A;  2PAV A;  3IUC A;  2VWC A;  4HYP A;  1UYD A;  1BYQ A;  4PL8 A;  2YKC A;  4CE1 A;  4B1V A;  1UY8 A;  3UKU A;  2YE9 A;  4YKX A;  1ATR A;  3KVG A;  3D2E A;  4GCZ A;  3LDQ A;  2PBD A;  5AQS A;  2HCH A;  3RLP A;  2QWP A;  4A2B A;  4CI6 A;  3EKO A;  5F3K A;  1NGF A;  2YI0 A;  5AQJ A;  2BU7 A;  1NHI A;  3HSC A;  4MPC A;  2O1V A;  2YEG A;  5FNC A;  3HHU A;  3ULE A;  4LWE A;  4ZKI A;  4XCL A;  5AQZ A;  4ASG A;  4BXI A;  4CE2 A;  3TZ0 A;  3I33 A;  1TBW A;  4M63 C;  5AQO A;  2A40 A;  4BE7 B;  2YI7 A;  4B7P A;  2QF6 A;  4MP7 A;  2BTF A;  3M6G A;  4EMV A;  4MP2 A;  4K41 A;  4LWF A;  3FZK A;  4KBO A;  1NHH A;  1S14 A;  3WEE A;  4BQJ A;  5FND A;  3R92 A;  4WUD A;  1QQO A;  2YJF A;  2FXU A;  4GEE A;  4WYB A;  3RSE A;  4PL7 A;  2YE8 A;  3MN9 A;  2QWM A;  4XTJ A;  3D2F B;  5M4E A;  1S3X A;  2IWX A;  3D36 A;  3BMY A;  1ZXM A;  4HZ5 A;  5AQF A;  4JHD A;  1U0Z A;  5AQX A;  2P9I A;  5D6P A;  2ASM A;  1KXP A;  3OPD A;  4Z94 A;  1NMD A;  3OWB A;  3U2D A;  2QWQ A;  4O07 A;  2FWY A;  2IOP A;  3PEJ A;  2P9U A;  1Y4S A;  3FZH A;  4URN A;  1NGE A;  4AWP A;  2XAB A;  2FYP A;  3MN6 A;  3TPQ A;  2GFD A;  1BXD A;  4FO0 A;  1YT0 A;  5AFU H;  3FE1 A;  2WI6 A;  3LDL A;  5D7R A;  3A5N C;  4CWQ A;  4B1X B;  2HG1 A;  1TH8 A;  4JQL A;  4R3A A;  1KZN A;  2UWD A;  1NGJ A;  5AQU A;  3GIG A;  4BAE A;  2YE6 A;  3R4M A;  4U93 A;  1TYQ A;  5EY4 A;  3A0X A;  3C0E A;  4L90 A;  4PL9 A;  4AWO A;  3G7E A;  3OWD A;  3ATV A;  4LWI A;  3UB5 A;  1YER A;  3CYG A;  1BA1 A;  4CZL A;  1SQK A;  2XJG A;  2E8A A;  4IO8 A;  2YK2 A;  3K60 A;  3PEH A;  2YKJ A;  1TC6 A;  1I5A A;  2H55 A;  3U9D A;  2BT0 A;  2WEP A;  4CWN A;  5AQL A;  4XIQ A;  3S5T A;  4CBW A;  2BU2 A;  2YKI A;  3LNU A;  4GGL A;  2YEB A;  3ZXQ A;  2C2A A;  1H7S A;  1UYE A;  3MN7 A;  4XIP A;  1YET A;  4JAU A;  1NGC A;  4DUH A;  1Y8N A;  4MPE A;  4K42 A;  4LWG A;  4NH9 A;  3Q5L A;  2FF6 A;  3T2S A;  1UY6 A;  3T0H A;  3TZ4 A;  2D1K A;  5BPM A;  1EA6 A;  3B25 A;  3UE5 A;  2YJW A;  1HPM A;  4GQT A;  1C0F A;  1HLU A;  4JNE A;  2JJC A;  3MNR P;  2CH4 A;  2V7Z A;  4H5V A;  4ASF A;  4CZK A;  3A0Y A;  4L94 A;  3WHA A;  5AQV A;  1AJ6 A;  5BPN A;  2XDL A;  1NM1 A;  3FT8 A;  4LWH A;  4GY2 B;  4JN4 A;  4FMT A;  4AM6 A;  3R4P A;  4EFH A;  3CJC A;  5IN9 A;  3VHD A;  2ZBK B;  1E4F T;  3AY9 A;  2BSM A;  1U2O A;  4H03 B; 
#chains in the Genus database with same CATH homology
 5JEN A;  3S5T A;  3CYG A;  4E72 A;  2HHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...