3S68A

Rat comt in complex with sam and tolcapone at 1.85a, p3221, rfree=22.0
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
DTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol-O-methyltransferase in complex with substituted 3'-deoxyribose bisubstrate inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Catechol O-methyltransferase
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.1.1.6: Catechol O-methyltransferase.
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01596 Methyltransf_3 O-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3s68A00
3KQYA 4E2WA 4EVIA 2NXNA 4PNEA 3BZBA 5HEKA 2I6GA 3NDIA 3OE5A 4FR0A 3R0QA 4YV0A 2JHCA 2EG5A 2XVAA 4A6EA 1D2CA 1P1BA 4PYIA 5K0GA 3L8DA 4CTJA 3OZTA 3UJ7A 4O29A 4QQNA 2FYTA 4RWZA 2R6ZA 3MB5A 4HC4A 3SSMA 3ELWA 4DCMA 1G8SA 5LQRA 2YXDA 5DWQA 3QOXA 5C9ZA 2GA9A 3MAGA 3ER9A 3GGDA 1QYRA 3KQPA 1MJFA 3LBYA 4PYOA 2IFTA 1XJ5A 2C7PA 2PV0A 5FULA 3JWGA 5HILA 4HSGA 2HTEA 4MQ4A 5HIKA 4C03A 4GOLD 2JHAA 4R8RA 4KIGA 3P2EA 3UJAA 1M6YA 5BP7A 1IM8A 1NT2A 1PRYA 3BXOA 2OY0A 3SR4A 2PBFA 2PGXA 4E33A 1SKMA 3D2LA 2V74B 3ANXA 1Q0SA 4QDKA 1X1CA 1RJEA 5E8RA 2IIPA 1RJDA 4E2XA 3KQOA 1EG2A 2KW5A 2PX2A 2ZW9A 4KDRA 3FYCA 2WK1A 1RJGA 3KR0A 5FA5A 3P2IA 4RTKA 4PONA 3EVBA 2H1RA 3B3FA 4OBWA 5DM1A 3FTEA 3RIEA 2C7OA 4AZTA 4RVHA 2G72A 4HGYA 4RYLA 3VC2A 4YMHA 3TMAA 2HNKA 3AXTA 2B78A 2OO3A 2O0LA 3DXZA 3EGIA 1JTEA 2ESRA 1FP2A 4RX1A 4LG1A 3EVGA 4P7KA 5F2KA 5ICFA 2R3SA 3FZGA 2ADMA 3TM4A 1RI5A 4RTPA 1JG1A 3ORHA 3LDUA 3NVMB 5HIJA 1TW3A 4PIMA 2XYQA 3BGIA 1R18A 3HA7A 3LCUA 1BC5A 4EQZA 4EK9A 1EJ6A 1WXXA 1KPIA 4AX8A 3A27A 1SQFA 3M6UA 4IV8A 5FHQA 3UBTA 4PCLA 1D2GA 2AVDA 5BXYA 4M38A 4R8SA 3G7UA 4GC5A 4HGZA 3HCDA 1U2ZA 1SUIA 3GDHA 3MGGA 4ER6A 2IH4A 2CKDA 4X60A 5EKUA 5EC8A 1ZKDA 2BR4A 3MTEA 4E32A 5EGSA 1XDZA 4LWPA 4GEKA 4V0QA 1BHJA 3P9IA 5EMJA 3UJ8A 4IWNA 1RI3A 2QYOA 2I62A 5EHGA 2CL5A 2F8LA 2Y1WA 3V97A 1NE2A 4DA4A 2ZZNA 1VP3A 3SMQA 3VSEA 1L3IA 2P40A 4ER0A 5CVVA 2QE6A 2ORED 1TPYA 1DCTA 4CKCA 4QQKA 2QRVA 4X63A 4F86A 3SSNA 2UYCA 2UYQA 5E9WA 4PGGA 4KVZA 2V7EA 2WA2A 3OU7A 1L9KA 2K4MA 3NDJA 4QVGA 5DLYA 5DRYA 3UA3A 2PJDA 3QOWA 4HH4A 7MHTA 1JQ3A 3P71T 4KW7A 1NW5A 5LSAA 3EVFA 3CBGA 4RTMA 3MQ2A 1HNNA 2CWWA 4FGZA 3GJYA 5U4XA 1XCJA 2ERCA 3GO4A 4CKEA 2H00A 2PT9A 5DX1A 3I5UA 3PLAE 3LKZA 1XVAA 2PSSA 3KPUA 3C6KA 3UJ6A 1VLMA 2BR5A 3HCCA 3RODA 2ONZA 2GLUA 5HZMA 1H1DA 5LQNA 3T0IA 4YUWA 4ER7A 3TOSA 2UYOA 3GRZA 3LDGA 5B1SA 4F84A 2P41A 1T43A 3PFGA 5E1DA 2OB2A 5BW5A 2YXLA 4U7PB 5GIOE 2P3QA 3O31A 1O9HA 4DKJA 2B25A 3UJ9A 4C04A 1D2HA 4MIKA 2EJTA 1Z3CA 4KIFA 2OBFA 3LECA 3PS9A 5EMLA 2FRXA 3CCFA 2N47A 3EPPA 1QAQA 4PYKA 5IKMA 4WVLA 3LSTA 5DXJA 2ZZMA 1B42A 2XYVA 2C7RA 1SUSA 5G02A 3PT9A 4GOOD 4GUAA 3LGAA 4KWCA 1JG2A 4E31A 3OE4A 3FYDA 3IYLW 4V0RA 5EIFA 5GINE 3GRRA 4PCAA 3C6MA 3TKAA 3UWPA 2OYRA 5K0EA 1FBNA 2BR3A 2NXCA 5LQCA 4Y2HA 4HTFA 1N7JA 2YQZA 5EPEA 2HMYB 2NP7A 1R8XA 4NECA 5DX8A 9MHTA 5DM4A 3B3GA 2YR0A 4ISCA 3DXYA 4PYNA 4QDJA 3SX0A 4L7VA 5LR6A 1RJFA 2NXEA 2ZCJA 4FZVA 2G70A 2ZIFA 2PX5A 2ZVJA 3GCZA 5CVEA 3SGLA 3UA4A 3PTAA 1O9GA 2ZBPA 3EVAA 5CUQA 4RVDA 5CM2Z 2XVMA 4K6MA 4QPNA 5FTWA 3P2KA 3DULA 1NW6A 5EQJB 5LQAA 5EZQA 2P7IA 2IPXA 1VE3A 4KRGA 1P1CA 4BLWA 2G8NA 2ZWAA 3HCFA 3NWEA 3Q7EA 4QPPA 1JG3A 3VYWA 1YFJA 1KYZA 2DPMA 1KYWA 3C0KA 4LECA 3GU3A 4BLUA 3QV2A 3PB3A 2YVLA 4P58A 4QTUB 4RTOA 2VDWA 4HG2A 3DLIA 5C0OE 5K0BA 1V39A 4C07A 4ATNA 4MTLA 3HCBA 5F2OA 2ZLBA 1AF7A 5FWAA 5K0JA 3ELYA 1Q0TA 3ERCA 4OBXA 1NKVA 1VPTA 3UZUA 1QAMA 2O06A 2DULA 1NW3A 1JSZA 1IXKA 3ELUA 3G88A 3GXOA 3KQSA 4PYMA 4XUCA 2AN4A 3A7DA 2VDUE 2ZFUA 1YZHA 5EEHA 3FUTA 1YF3A 3GNLA 3LCVB 3O4FA 4RTQA 3MCZA 5BW4A 4AZVA 3SVZA 2EFJA 1R6AA 3FRIA 5LQKA 1M0EA 4BP3A 4E30A 4PYJA 3RW9A 1WXWA 1ZGAA 3G2MA 1X1BA 3FUUA 3KQWA 1ZQ9A 2P7HA 4QTTB 5K0LA 4CXMA 2IP2A 3M70A 1NW7A 1X1AA 3EGVA 1Y8CA 3CVOA 1VIDA 5EEGA 5DTRA 4DCGA 2AN3A 2IH2A 3G8AA 4PWYA 2YXEA 3BGVA 1SVUA 2FK8A 4MHTA 1UWVA 5FADA 4XUEA 2A14A 2LD4A 4C06A 1I9GA 3HP7A 2JHPA 1RI1A 4BP1A 5ICCA 5E1BA 5EMMA 4C05A 1R8YA 1EIZA 1G6Q1 3T7RA 5KVAA 5K01A 3EVEA 5FCDA 5H02A 4Y30A 4AUKA 5DSXA 1EQAA 5E8JA 5F2NA 3NMUF 2PY6A 5P8WA 2QRVB 3KQQA 2JJQA 5K8VA 3IHTA 2I7CA 2PKWA 3H2BA 2ZZKA 1P91A 2YUIA 3F4KA 3LBFA 5FWDA 3EMBA 5E2AA 4RTSA 3UJBA 4A6DA 2IGTA 5GOZA 4G56A 5FA8A 1SQGA 3A7EA 3FPEA 2GPYA 4GOND 3UJDA 2G71A 1YB2A 2OPBA 1JSXA 3FUWA 3DMGA 4B17A 1NBHA 4GC9A 2NNWB 2OKCA 1AV6A 2PX8A 3TR6A 2OB1A 3UFBA 2PXCA 3MCTA 4HTFB 3OCJA 2HR1A 5FHRA 1DL5A 3EEYA 1FP1D 4CTKA 4PIPA 3TKYA 5DPMA 5DT2A 4DMGA 1G8AA 1QAOA 3G2PA 3GRVA 3BWCA 1KP9A 5JR3A 2CMHA 2ZULA 4GBED 2XBMA 2NP6A 5DXAA 4ZTBA 3P8ZA 1IY9A 2BM9A 4OQEA 2AN5A 3FTCA 3Q87B 3CGGA 2NXJA 4AZWA 5DRTA 5ICEA 3I58A 2FHPA 1UIRA 3LPMA 5CD1A 1I4WA 3BGDA 4JXJA 5KQRA 5HIMA 3A25A 3LHDA 3TFWA 1NW8A 3WSTA 4GOMD 2ZIGA 5K0FA 3DH0A 4R05A 1ORHA 4POOA 4PYLA 4RTRA 1FPQA 1MHTA 2H11A 2BM8A 5E9JA 1YUBA 5EIWA 2JG3A 3DLCA 3TPZA 2PWYA 2AZTA 4YV2A 3GRUA 3CJRA 3S68A 1BOOA 3EVCA 1AQIA 4HRAA 3THSA 4E70A 1XXLA 3U81A 3C3YA 3PFHA 4M37A 1NV8A 1KPGA 2PWPA 1EJ0A 2GS9A 3FPJA 5T64A 4X61A 5CCXA 2I9KA 1F38A 3FUVA 4FT4A 2VDVE 2ZIEA 2B9EA 2ZBQA 2PVCA 1L3BA 3UJCA 1JQDA 1RI4A 3LCCA 4Z2YA 1VQ1A 3BWYA 4P7GA 4P7JA 4BY9E 1SG9A 5DX0A 1XDSA 1L3CA 2EJUA 5E2BA 3I9FA 4OQDA 1P39A 5EG5A 4BLVA 3HTXA 4FT2A 3AY0A 1X19A 3K6RA 2BH2A 4OA5A 2P8JA 4EKGA 2O05A 2HWKA 1M6EX 1ZGJA 2BZGA 2JH9A 4RVGA 3FTDA 1X1DA 3P97A 1G55A 3MHTA 1UFKA 3JWHA 2IDKA 1JR4A 1KPHA 5K05A 1BKYA 2AOUB 5DM0A 4LWOA 4MWZA 3EGEA 5K03A 1WG8A 3FPGA 1AQJA 2ONYA 4IKPA 4AZSA 3G5LA 4OA8A 4C4AA 2VZ9A 4YUZA 4WXHA 2HV9A 3G2QA 5MHTA 3PVCA 1R74A 1RI2A 1XCLA 3TQSA 4PGHA 5T6BA 1N7IA 3A26A 4XUDA 2AOWA 3E05A 3JWJA 3TLJA 3BT7A 3KQTA 1L1EA 5C1IA 5T67A 1DUSA 1PJZA 1ZHFA 2JH8A 2YTZA 3C3PA 3I53A 4ER3A 3FRHA 2AS0A 2FPOA 3NTVA 4RTNA 4KDCA 3ER8A 2PXAA 3AXSA 3HA5A 1QZZA 5GP1A 3LL7A 3NWBA 2VP3A 4GQBA 5LQUA 4X41A 2AOTA 5EMKA 3PX3A 1HMYA 3I64A 3T7SA 3G5TA 3O7WA 2YX1A 4EMSA 5K0CA 3B5IA 4RVFA 3ELDA 4YUVA 3TRKA 3EEOA 3SXJA 3BUSA 3HVIA 3P9NA 5CIYA 3FUXA 3KQVA 5FQOA 3KR2A 5FUBA 3KPWA 3OZSA 1N2XA 2OZVA 4GF5A 5FQNA 3CJTA 3DUWA 4RV9A 1KIAA 1FJXA 3ID6C 5M5BA 3SSOA 2AOXA 1G60A 3B3JA 5GIPE 3ME5A 5D1HA 4H0NA 1EAMA 3GIWA 3BKWA 1YFLA 2Z6AA 1JTFA 5LQJA 4FSXA 4DQ0A 5GM1A 4E2ZA 4M36A 2ZWVA 5K0NA 4YV1A 4UOEA 5E1MA 3KHKA 2ZSUA 3E8SA 3P9KA 2VS1A 1KXZA 4IV0A 4EKIA 4FS8A 3HEMA 5JUWA 2EX4A 1INLA 1OR8A 4CWAA 3HM2A 3DMHA 2AR0A 4YUYA 1WY7A 3CKKA 2AOTB 4U7TB 5E9QA 1F3LA 4E2YA 3HNRA 5EOVA 3OFKA 4RSRA 3IEIA 2PT6A 4R6XA 1VP9A 2PX4A 3OPNA 1KR5A 3BWBA 5DTMA 3KKZA 3FPHA 2Y1XA 3E7PA 3G2OA 3KU1A 4P7FA 4QVKA 3A4TA 4DZRA 5KYGA 3VC1A 2B3TA 1YZ3A 3P9CA 5EZSA 2PLWA 3R6TA 3KQMA 3DTNA 2GAFA 3KPYA 4XCXA 3EVDA 4CKBA 3NW9A 3T7TA 1WS6A 2AVNA 3K0BA 3G8BA 2GH1A 3DOUA 5DTQA 3GRYA 1TW2A 1VBFA 3DXXA 3KPVA 3MERA 2IH5A 3KR9A 5CVJA 3LKDA 1JG4A 3THRA 3M4XA 3SM3A 4YUXA 4DF3A 3KPJA 8MHTA 1QANA 5D1NA 4X1OA 1NV9A 3AJDA 3OU6A 3DR5A 4PYQA 5GWXA 2QY6A 3HCEA 3AWIA 3HCAA 5GM2A 3DP7A 5K09A 3HA3A 3GWZA 2P3LA 1NBIA 4YMGA 3KR1A 3R3HA 3R9XB 1O54A 5DM2A 1XTPA 3MTIA 3X0DA 2FK7A 4FP9A 1VL5A 5HOQA 3M6WA 2Z6UA 2C7QA 1G38A 2P3OA 3BWMA 5EKXA 2ZBRA 3EVZA 4F85A 3G89A 2UZ4A 2E5WA 2QM3A 2FCAA 4RTJA 2G1PA 3B7PA 5EVJA 2OXTA 1KHHA 1ZG3A 2Q41A 2GB4A 2XYRA 3B89A 4M7RA 5HIIA 2AOUA 1I1NA 5CVDA 3CC8A 3PX2A 5E1OA 3REOA 3M6XA 3M33A 3TM5A 5EHIA 3LX6A 2IBSA 2ZTHA 3NVKI 3NJRA 5CCBA 2P1DA 4C08A 4DM3A 5ERGB 2IBTA 3M6VA 10MHA 3EMDA 3HVHA 3FTFA 3DMFA 1XDUA 3CJQA 4RTLA 3E23A 3R24A 3LDFA 5IH3A 1R00A 3HVKA 5HFJA 1JQEA 3HVJA 3OFJA 3OZRA 4OX9Y 4PINA 2Z6QA 2IDJA 2CMGA 1ORIA 2WA1A 2P35A 5KQSA 5ICGA 3OU2A 2AOVA 4FSDA 5KS2A 1WZNA 2B2CA 2NYUA 3BKXA 2O07A 3FPFA 3IV6A 3JWIA 5CVUA 3V8VA 4ER5A 5DSTA 4R6WA 2PXXA 2O57A 2UYHA
chains in the Genus database with same CATH superfamily
2XCTB 1Q12A 4B6SA 2PTGA 1G0NA 1NE7A 2HQRA 1AHNA 1N75A 2IZ5A 1G9XA 2Z4TA 1P2GA 1XQWA 2I6UA 3FNIA 4EHBA 4LBVA 1H2ZA 1XR3A 3NEAA 2EQBA 2L18A 4KMMA 4DEYA 4HGQA 2A1IA 2HK9A 5JS8A 4JP2A 3STHA 5CM9C 3QVSA 4QSHA 1Y6JA 1KEEA 2OFFA 2WD8A 2XE7A 1YULA 4U9HS 3GJXC 3DTVA 1ZMXA 2HU2A 5F2EA 3ZW7A 3TAXA 5IC4A 1VDZA 4LX8A 3GELA 4QAJA 1HMPA 1YVDA 2BOVA 3LBYA 1XJ5A 1GNQA 4I36A 4J6FA 1KDYA 4DIEA 5LU9A 4RNCA 2VF4X 2VNHA 2F48A 5FWXA 3WL5A 5ELXA 2JHAA 3D2AA 1D03A 4C5BA 3MSXA 1IM8A 2CFTA 2JIPA 2UYYA 2VYQA 3P5SA 5EXXA 1GPNA 4B43A 2BFBB 1U3FA 3Q3GE 1KSGA 4MCJA 1S9HA 2PGXA 4RMNA 3W4KA 2EHJA 4UM9B 1FF9A 1DHRA 3FNQA 3I1FA 2H48A 4B6JA 1SZPA 2WK1A 2HA7A 4BVFA 2JKVA 1T4CA 2JAUA 2X5XA 1CNFA 1IDN1 2NT4A 5ALXA 3B3FA 5DM1A 1LF0A 4FC6A 3WB2A 4RCVA 3TEMA 4BS9A 1ZD4A 2ZKLA 4KX3A 5B7QA 3V46A 4JLDA 2HR1A 4L2IB 4V38A 3RSQA 4KVGA 1FYEA 3OZ7A 3F1LA 4C0SA 3INGA 1YACA 4OLHA 4CM4A 3EVGA 1JA1A 3D6NB 4PXYA 1URPA 3DCNA 4C14A 1BEEA 3FZGA 1DTWA 1R0WA 3CZ4A 3FOBA 3WYNA 1NURA 1JG1A 1NNSA 5HIJA 4N8SA 5E0OA 3S1LA 2OHGA 4G9EA 3HA7A 5CG2A 3RF7A 1T5BA 1FSFA 4LVCA 4H1HA 1DP4A 3GB9A 5C5IA 4EGCB 4H0CA 1TT5A 1D2GA 4IYJA 3ZCTA 3KLNA 1V3TA 3UYLA 2MSCB 3JRNA 3KB6A 2IYPA 1GR0A 4FEGA 1E3SA 4BO8A 4XEHA 3DP9A 4GLJA 4G3XA 4JJIA 1C81A 4U0KA 4R1NA 4Y7CA 3HLTA 4WTOA 1MA3A 3UPDA 3FUCA 3M4YA 1WV0A 3GFFA 3R77A 4RV5A 4TRNA 5EMHA 1NASA 1JA0A 2Y0EA 2CNNA 3E0QA 4O02B 1N2ZA 4J49A 3VTFA 5JPDA 1Y33E 1P5FA 4HWPA 4KO8A 4RGVA 2G1KA 3NS7A 1SQ0A 1WB4A 2YZKA 2I2XB 4TXHA 1GV1A 4MK4A 4QNMA 5HKKD 1A96A 3U3JA 4POAA 3TR5A 5HK9A 1P3JA 5IYZA 3U19A 2GWRA 2WU4A 2F3UA 3GJ3A 1M2VA 3QNMA 4FEEA 4DUZB 1H0KA 4IIVA 4F8YA 3ABOB 1T9CA 1XKQA 1NW5A 1UMCA 2B8JA 3UWSA 3AESB 2X7HA 4RTMA 3BOSA 3MQ2A 4RHUA 4RS3A 5C52B 3X2SA 4FDUA 2BKEA 4IJQA 4S0XA 4DCJA 4FGJA 1A77A 3ZX4A 4ZZ3A 1B23P 2GARA 3AIMA 4YGXB 3I5UA 3DW3X 3QP9A 1HRKA 2H4WA 2DFTA 4UUBA 3KHUA 4I55F 5BYKA 4OAPA 1TI7A 3ZDDA 3E03A 5JFTA 1LW7A 1EXMA 1F60A 5K0TA 3RTAA 2BRUA 5AKZA 2J5BA 2PTHA 5I7VA 3G9TA 1A2KC 4XDYA 3RREA 3PV0A 4UHCA 1C0EA 4W1SA 3RRXA 1E4VA 1GPDG 3IIMA 4N6OA 5L6LB 2OBBA 3SDBA 4ZEWA 5ALPA 1N6HA 2ZJ5A 4KYIB 3S8EA 2P6UA 2GDJA 4FLFA 2WOJA 3LZ6A 4F38A 4DAOA 1CUBA 2ZB3A 1U2EA 1PL0A 1X9GA 2CF5A 4YJ3B 2I99A 4CMKA 2O1XA 2OQVA 4INAA 4CLRB 2JBHA 3UNXA 4F4IA 5JCJA 3IYLW 4E7PA 4KTTE 2FPLA 1ZVJA 3BIOA 4UFPA 4WOJA 3W0LB 4P0PB 2NX2A 1Q11A 1ZH2A 2FUG6 5KVSA 2FFBA 1UJ2A 3ADPA 1SHKA 4BO1A 4ZJZA 3GUCA 1R3DA 1ZVMA 2BFCB 3GJ7A 4P3OA 3UV3A 3I30X 5ALUA 4AY5A 4HP8A 4NNPA 1R4NA 2OECA 5BWMA 4F4FA 1ZSYA 3A1WA 1FNSA 9MHTA 4MV3A 1EQ2A 1DTWB 3C87A 1CZOA 2I33A 2QD3A 2H1OA 2MSLA 4PYNA 4A23A 5DNUA 1QUFA 4OLAA 5HCIA 1RJFA 1NVUQ 2EGGA 4OXYA 2O50A 3PTAA 3HBLA 4PVDA 4Y6SA 5GONB 1Z4PX 1Z7EA 1BHSA 1OLOA 2NUAA 4K6MA 3A3PA 3CXRA 3VAZA 1T2DA 1UK7A 5A2QA 4KKVA 2DJIA 3TLXA 4D5EA 1OX5A 4A8JC 3S2GA 4LJ5A 1S3SA 2YC2C 1T13A 5A71A 5H68A 3WNBA 2I6FA 3RARA 1T0JB 1SOWA 1IY0A 2QAGB 3DNFA 3IP1A 4GGPA 4M9SA 5IAOA 2NMVA 3RFVA 8OHMA 1TGYA 2X3FA 5C0OE 1V39A 1SMKA 1QG2A 4FJ1A 3BRQA 1H1TA 1WPXA 3FDFA 1E9VA 1BOFA 2V8BA 4L15A 1WHTA 3CR3C 4RY9A 5LZ7A 3STWA 3FB1A 1Y98A 4ETIA 5KYKA 3OQMA 1HK7A 1ZNXA 3HWWA 3QX8A 4KXNA 3TFOA 1AKWA 1QVAA 2J41A 2HUPA 1KO5A 1V9CA 2Q46A 2Y99A 3RFUA 3V4LA 1JAYA 3LKVA 3I09A 3CR7A 4MGIR 4UCXA 3B70A 4X44A 2RGDA 3K1TA 2DG2A 5H4GA 1JT9A 3TLZA 4GP7A 4O0LA 4WZZA 1EFUA 4MQUA 1N2OA 1N3IA 1V5GA 3NP9A 4RUKA 4XEUA 1AMOA 2QKYA 3FRIA 1WL8A 4M3NA 4QUHA 1H22A 5DO9A 3TIGA 2H4YA 2HIMA 1QE3A 5F52A 3RHFA 1X1BA 3FROA 3OD5A 4LOHA 5HS4A 1SUAA 4E5VA 5DYWA 1OFHA 1Q7RA 2E6KA 4HRXA 1WX1A 4KIWA 1LKZA 4X91A 2GDZA 3O8OB 5AVZA 3IILA 1ISGA 4I14A 3NHAA 4IHJF 4QYXA 5EEGA 1Z5PA 4DA8A 3PZRA 2FSSA 2DSNA 2P2SA 3G8AA 3T35A 1T3SA 2YXEA 4Z3KA 3KE9A 3Q41A 4HAWA 1M1ZA 3O0DA 3HFGA 4RM2A 3FPCA 4UVIA 4AKSA 4QOGA 1UWVA 5CM8B 5DGTA 3E7FA 2QRJA 1Z2EA 2AK3A 4R8KA 5JARA 1I9GA 3DWGA 1GZ6A 5EJGA 5CLIA 4WUVA 1UJ5A 3OTWA 4FB4A 4EY3A 4AUKA 2QTGA 3HJAA 1K5HA 3EC1A 3NUGA 3ZU2A 4RELA 5DN9A 1VGQA 3ZY3A 3ZQJA 1GG2A 3UCEA 1T8SA 1F6BA 1AUXA 5LQMA 4L5JA 1IJBA 4Q1AA 4QUBA 5CCEA 4CDRA 4GZLA 2Q0HA 4KBYA 3EMBA 1N2BA 4ILKA 1D07A 4BVGA 1GGMA 1UPBA 3ICVA 1RP1A 2XKBA 2NOAA 3NFYA 5IDQA 4JS0A 2Q7OE 1K75A 4ZEOA 5KTKA 4JU9A 3DMGA 2IEZA 3NH6A 3UC5A 2NNWB 2CFIA 3KEOA 4RXTA 2O3SA 4TT8A 4C5AA 5GPBA 4FHGA 4TN5A 3ODPA 1GWNA 2IA5A 2FV8A 5D5PA 1J1ZA 3Q72A 3TBHA 4M1ZA 1OWLA 1VDMA 4BCCA 4ZYUA 1P4SA 5DEIA 5JCPA 2ZBDA 1EK6A 5KYXA 4GZ3A 4OQEA 4XM1A 3F8SA 4LZLA 1HX7A 3WGTA 1FRVA 3CGGA 2NXJA 5KEIA 4FN5A 4YRRA 4ZARA 2XTJA 3R7WB 3T9AA 2FHPA 2O2GA 1EUDB 2Q2NA 4IDEA 2BM0A 3DCYA 5IDYA 4I1PA 2A2ZA 5JAIA 1WKVA 1E1QD 5AKYA 2G17A 1GG5A 2D74A 4ZU6X 1X7WA 3TNDA 1O9BA 1QDLB 3DLCA 5AK4A 4B3DA 1Y6RA 4BGIA 2XXAB 3HY4A 4CM9D 1AUQA 4M2LA 4YV2A 3IAEA 3O3NB 1JWLA 1XF9A 3O6VA 3OFNA 1RJ9A 4CCAA 2FZLA 3EVCA 1AQIA 1WDLA 2FNAA 3ETDA 8AT1A 3SD7A 1X7WB 3U4HA 3TIVA 2YCBA 4EFNA 5HRUA 2JL1A 1SU7A 3SBOA 4OK5A 3CNHA 2PRZA 3O47A 4MUJA 3NXKA 2P9JA 4FT4A 3E6AA 3I42A 4FNGA 1E79A 1O5TA 4OQQA 5KOIA 2QV0A 5D7BA 1E2LA 2ZATA 3HO1A 1RI4A 1A9TA 2GK3A 4H3SA 5DX0A 2J3QA 1HM5A 3DZJA 5TT0A 2QTWB 2FW7A 4JC5A 3VV2A 3ZGYA 4AJLA 1G21B 4LW8A 4X8LA 3G23A 4WQMA 3EWSA 5C4GB 2DT5A 4Y6GB 1TTTA 3UTCA 2YXPX 4WNIA 1SKUA 4BJ3A 3AW9A 1M5RA 2O4UX 2P27A 4WBXC 4EY7A 4DMLA 2XE4A 3OCVA 4ALJA 5L3QB 5IKPA 4LWOA 1G7RA 3ND6A 5J1SB 3G5LA 4C4AA 4OX9B 3ZV7A 2LUOA 4CG3A 3UGTA 1FVFA 1LLQA 3KZNA 3V7YA 2JA1A 1DOHA 2HYDA 4D46A 4UCWA 5ESXA 2W70A 1SXHA 4E4YA 1JYEA 1SCQA 3WGLA 4A0FA 3W1EA 3BRSA 3DV0B 4DLTA 4U5XA 1NUUA 4LI3X 1WUHS 1ZM3A 3T4UA 2HDWA 5KPDA 1MC5A 2VQFB 2CZCA 1U2SA 3S7ZA 3L8EA 4KWEA 1AXGA 1M33A 1VFNA 3C6QA 3HA5A 2IUEA 3KOMA 4FHZA 4I4CA 4QXRA 4BX9A 3ANMA 4LHYA 4PQEA 1PKEA 2E4UA 1VHQA 4PSDA 3V8EA 5KYWA 5J4LA 1AJEA 3Q3IA 3DPIA 2SCUA 1JYSA 2C3OA 3FGZA 4PGMA 5BW6B 5CYFA 3D7NA 1W1UA 3BUSA 3DUFA 4J1TA 4PAWA 4BWGA 2J08A 4ON9A 2P9EA 3O2JA 3PNBA 1WZ2A 1GQOA 2VYCA 1J25A 1QO7A 4KQGA 4B40A 2R8EA 1TZKA 5FAXA 2QRLA 3OD1A 4YPFA 1G5RA 1YS4A 5KX5A 5F76A 2HKIA 1CW2B 4H0NA 3L6BA 3L9XA 2Q2OA 1VMKA 5HQ3A 4M1OA 1RSZA 4ENVA 5A3VA 2B1JA 2FFJA 2VSFA 3I05A 1GPWB 3LY5A 3AO0B 4J1SA 2C5AA 4NKRA 4E5SA 1MO4A 4ZI7B 1M2JA 1QVRA 4BAGA 1KI1A 2WKRA 1ZESA 1OT3A 2OAGA 4CFYA 4B0OA 4X90A 3M5DA 2DPHA 1NONA 1ZR4A 2Q4EA 5CCDA 4TV9B 2AEEA 3T34A 3RWMB 1N2CB 4B1FA 1GL7A 4G1BA 3FPHA 1GRRA 1V16B 2A4MA 3I45A 4L85A 1JFFB 3L05A 1EDEA 3HE3A 4CM9A 3R6TA 2GUGA 1B8PA 2QLLA 3ESRA 5DYTA 1GAEO 2TMDA 4G5SA 3FIUA 4OYRA 1L5HA 3LUBA 3GEIA 2VC2B 4D3DA 1SOMA 1FTSA 1CZKA 2VDLB 2C2XA 2ZCUA 4TMFA 1ZA1A 2VJYA 1XQYA 1U8ZA 4IGAA 1KAEA 1K6MA 1FZQA 2NQ8A 4EG8A 4CEIA 2C8JA 4N3AA 5EZYA 2REQB 4Q7KA 1NV9A 3AJDA 2GILA 4PYQA 4C22A 4JROA 1YKGA 4V0NA 4M8IA 4O63O 2IHYA 2CVZA 1Y3FE 2HHAA 5FB3A 5TMDA 2HJWA 2OXFA 1YUNA 2I78A 3DE2X 3DL7A 3PNLA 1NBIA 3P9SA 1I36A 2ZWPA 3QW4B 2NUAB 3WAJA 4FGSA 4FWTA 5L3ZA 2O6LA 3PHGA 5C5DA 621PA 1QG4A 1R4ZA 1YB4A 3CLRC 1JX6A 1O87A 1Q57A 1W5SA 3EUFA 3F71A 5AJYA 3RK1A 4L5IA 3ZHOA 4WBNA 4WPGA 5LQDA 1UBGA 4UTXA 4EX7A 4HD8A 1S9DA 4QFCA 2XB9A 4YACA 2VUSA 1LJUA 1GITA 1U2DA 1BEUB 1OLXA 3N3AC 2PSFA 5FPTA 2CY0A 3HM9A 3GZNA 2F8TA 4GMDA 1P2UA 1Z0AA 1IG0A 2BMWA 2RG1A 3HDQA 4IKEA 1XDWA 4I55A 4EMTA 4YCMA 3KWMA 1H8HD 2DR0A 4IZIA 4NWIA 2BFMA 5F9MA 4C08A 4D3YA 4YJ2A 2IBTA 4HBZA 1NQ5A 3F9CA 2Q2QA 4LOLA 3FNGA 1EG7A 2VJPA 3AFGA 3DMFA 3LDFA 3HSKA 4CLRA 2WI8A 2DUMA 2D2FA 3LF2A 3P2JA 2G83A 1QRSA 1LVHA 1XZEA 1SVKA 1BXGA 1JDZA 3C15C 4PLVA 2MCFA 3SHFA 3VR2A 2VDPB 2I76A 2P35A 3E1SA 4DG8A 3LVRE 1CG6A 4B7XA 5HUHA 5I9LA 4BNMA 2I1LA 1IK6A 3BMCA 1Q3TA 4RD6A 2BSXA 2VPZA 1W9HA 4R6WA 3TTTA 2YMPA 3W5HA 4AYXA 4F1KA 1N6KA 2ZP1A 1E1LA 1MAAA 1YVUA 5IPFA 1O8BA 4IIEA 1M2FA 4ZI3A 2CD7A 1M6WA 4US2R 3OE5A 5ECWA 4LTDA 4JBIA 2V59A 4D9GA 2H1IA 3H6HA 1T6ZA 1XCBA 3ZDFA 2ZBGA 3L8DA 4FUTA 2K7FA 4OHBA 1IEVA 4K26A 2QMOA 2GCEA 1N1GA 4L0QA 5JLJA 5FUQA 3O7MA 1H6DA 1Z6GA 4DJ5X 4RK4A 1X7XA 1N36B 1CLEA 3QX7A 5B1EA 2FZ4A 3L7KA 3ZE9A 4NJEA 4CV1A 4IH9A 3H8JA 1DE0A 3HADA 4O4IA 4TV8F 3BBPA 3WG9A 1AN0A 1QYRA 4L9SA 1Q22A 1U0EA 1UK8A 1YTLA 2IFTA 1K7YA 2A33A 4HJRA 3MAJA 1VTKA 1XZBA 4K9OA 4P22A 5ED0A 3U56A 1EVIA 3BGWA 4C0LA 2Z5LA 3U2QA 3LC7O 1G19A 2R1TA 1KVTA 4C21A 4FCTA 3CMCO 2ID4A 1IL0A 1FS4A 5FL7D 4WINA 1UKBA 2Q0QA 4EA7A 2V54A 5A4KA 1UP4A 2UZIR 2CXNA 3KVNA 1YJCA 5F78A 4XJSA 2XNDD 1XXHB 1WXHA 1UCFA 2ZR0A 1NVWQ 5C18A 1FA9A 4GKVA 2E82A 4AW9A 2XMBA 4KO1S 4X7MA 2IHKA 4H17A 4LA4A 4N3BA 2CLFB 1NM5A 3L1HA 3UG6A 3TMAA 4AZ0A 5J2UF 1Z5UA 2I0FA 3E2IA 1J0EA 3RD5A 3MTBA 1KYXA 4YREA 3TTVA 3V4ZA 5IT9A 3KKPA 4MPJA 4BCDA 2YNMD 1RWOA 3JQBC 3JQGB 2UZ1A 1QG6A 3BMNB 4J3FA 1U28C 4PIMA 2EF1A 3LCUA 2IU4A 4EQZA 1BC5A 1BE8A 1OFVA 2X5JO 3U4MA 1WXXA 1IBCA 4PO9A 1SQFA 3VHRA 3JVEA 1GKLA 2XSZA 2EW1A 2CUNA 4NATA 3RIMA 2PSDA 3OEHD 2A1UA 2DLNA 5FPQA 1OAOA 2WJPA 1XRNA 2X22A 5REQA 4OI1A 1X7DA 3Q9LA 3ORQA 1R9JA 3UT5B 3MPOA 3QUTA 4KPFC 3F46A 4EPTA 2CKDA 3NLLA 3PQ5A 4ZDJA 2WRZA 4R2LA 2IT1A 4E51A 2F9MA 3DTVB 3BL5A 2ZR9A 3W5DA 2R00A 3ESYA 3KQHA 3RAPR 1A8PA 4JZKA 4C7OB 1FK8A 5BY2A 3CT6A 2ZZNA 3V1YA 1ESMA 5JSZB 2Y4OA 3JQ7B 1S6YA 1XKTA 1DCTA 3K09C 4DJFC 1SIOA 1NDHA 2AUNA 1DT5A 1SC6A 1Q21A 2VRNA 4FCWA 4OK6A 4ZEVA 4UHHA 1JU3A 4YASA 5DLDA 5YASA 4AF8A 2KQUA 1A8IA 1C0LA 2AF3C 3KG2A 3L3BA 3LG2A 1V8PA 3BQNB 3Q5GA 1ZGBA 1EK2A 3IPRA 1HNWB 1GP2A 3EIXA 1U3CA 3P71T 3DKIA 2Q6KA 3CNOA 5DE3A 1CEXA 2B1GA 2C5FA 2IPMA 2J9XB 4KLRA 3SYLA 2D3WA 2VPTA 1JEYA 4PBTA 4H16A 3JATA 4CKEA 4KVAA 4UXHA 4F04A 3JQEA 1U0GA 4EFLA 1J97A 1RM5A 1WQ3A 3TE7A 1F9EA 1ZD5A 2ISSD 3PRKE 4MKFA 4J3NA 1C4KA 3AJ9A 4AULA 1WO8A 4YUWA 1Z8NA 4ER7A 1B8UA 4UAGA 1W87A 1YR3A 3QVKA 1AKEA 4UDYX 4P5PA 1M34A 2HSWA 4UU1A 1SC4A 3GX1A 2B4AA 3KUXA 3PRHA 1U0LA 2Q4RA 4F84A 1AQUA 5FOQA 2AL7A 2RGWA 3K96A 5CHEA 4ZVKA 1R6UA 3ABRB 4QYTA 3RGGA 2XAUA 3MJTA 3GYGA 2B94A 1J1IA 2GM9A 4WY8A 4Y2PA 2RI6A 5IABA 3I01M 3UGKA 2VAPA 2ALJA 3A3YA 4GX1A 4WVLA 3V2UA 4ETNA 5HF6A 4JQOA 3BPSA 2ZZMA 4NK4A 2GBLC 5EKDA 2F3TA 2G9VA 4REQA 2OESA 3TUJC 3WTCA 4QJBA 1ZC4A 4R5MA 3RIHA 1FFGA 2QM7A 3IAAA 5EPOA 1S2GA 3VPAA 1IY8A 5AO9A 4BEVA 4HQLA 1SUCA 3ESAA 1VLZA 4MV1A 2FPKA 2CV2A 3QKSA 4ESEA 1U1IA 4L8YA 4A7PA 1ML3A 1FS5A 3LT4A 2YZMA 1R6DA 2NO4A 1CX9B 2X7JA 2FPWA 3LM8A 2Q0XA 4LYHA 4UTZA 2YWXA 4HMPA 4PLZA 3SX0A 4WEOA 1JJVA 1FVOA 3EE6A 1A8HA 1E2UA 2UXBB 3B1VA 4NS1A 3HUEA 1G20E 2BAGA 2H63A 4II3A 3I1JA 3IUJA 4I66A 1SBCA 3U80A 4EDFA 2IPXA 5DMXA 4EHLA 3OLWA 1GPLA 2P2ZA 2ZWAA 4V1CI 2Z5FA 1KYZA 4RE6A 3IKJA 4WLVA 4II2A 1Z0IA 2H85A 4OJMX 2YVLA 4Q7QA 4JEHA 4R1TA 2XOXA 5FBRB 5K0BA 1GU0A 5SZHB 4GAEA 3CLUC 1YVEI 2ZLBA 3FF4A 3ERCA 1KVQA 3OM1A 1BGWA 2QSJA 3O95A 4M8KA 2HEIA 4F12A 3SJAA 4YTEA 1TM1E 3G79A 4GKAA 3GT3A 2F4VB 3QIAA 3M3PA 1YQDA 1CEQA 2GN0A 2Q6IA 1CQIA 5EEHA 4F9TA 1FFXB 2EFYA 4KB5A 4QQFA 1IVSA 2HXGA 1TKRA 3SQWA 4P36A 2P5UA 5NULA 4DDHA 3NIBA 1HR0B 5ELMA 4JL6A 1GLGA 1UJBA 3BRWA 1YS2X 3SEZA 2ZGVA 1X9IA 2MMGA 4ROTA 4E21A 1O6GA 1JECA 1PJAA 2EP7A 3V7WA 2OBLA 3Q3CA 4TLEA 5BNZA 3BXFA 2IQ5A 4CXMA 1IIBA 5A5GA 1NW7A 4ZZ1A 4H7FA 1X1AA 3PUJA 4QBKA 4JUFA 3AYXB 3FKQA 1LRLA 1KRXA 1NT4A 3I9LA 3QUCA 5TMBA 3AHFA 3S28A 3RE1A 3V2GA 5I4CA 4B44A 2H7CA 3IQZA 2QX4A 3FVQA 1ZOSA 3ZCQA 2ZTVA 5E7JA 2BMVA 3AI1A 4MS3B 5FADA 5FYQA 1Z06A 1P6XA 1K5GA 4JLVA 2EBUA 3WP0A 3K9NA 4F45A 2ECPA 2X1MA 1CUJA 2IHTA 3OCWA 1XPRA 3U7HB 2P91A 1NN0A 1XZLA 1FFWA 3DEYX 2ACEA 1EXWA 5H02A 2ZSDA 2DC1A 1XMSA 3ZI0A 4PYRA 3WYGA 2I54A 5E6SA 2CB0A 1MQ9A 3H3XA 4FMDB 5TQ2B 4S35A 4W7SA 5JH7A 3B7WA 2PKWA 1P91A 1KQNA 5B3AA 3J7AC 2DYKA 4M83A 4BRZA 1E99A 5FA8A 4TMYA 1NR1A 4G5OA 4PS1A 3ZVNA 2VPWA 3TOXA 2ZBUA 1GRQA 2PGAA 3R5XA 4QOHA 3GDOA 4EUHA 4Z8XA 2OLEA 3WGKA 2Y05A 1AV6A 1FDOA 2ZT7A 4N5NA 1I6LA 5L3SA 2DPGA 4D8XA 1I0LA 3OCJA 4Q1DA 3WGHA 1F6DA 3TGLA 1QGUA 2R6AA 2CYCA 2VRBA 4BBJA 5HKAA 2ZSKA 1HE2A 2BFBA 2G0NA 5DGCA 1IBLB 1I4DD 2J9RA 2PLRA 2C92A 3P0IA 1QAOA 5LB2A 4KFTA 1HDRA 4QXQA 1JR3D 1J70A 1Q1ZA 1HOXA 2CMHA 4HDKB 5FP0A 2CBXA 5FUWA 5T3YA 3ROGA 3DMPA 2JIDA 3AKZA 3A2KA 1SUPA 4C7OA 1RWMA 3VPSA 4MA0A 3MBKA 1IY9A 1XDGA 3H11A 3JD0A 1P0FA 3O9ZA 1SWVA 2A1TS 4HVAA 1KDRA 4BVHA 2YV2A 3SC4A 1U9IA 5AHOA 3EXAA 5ICEA 2CDBA 3I58A 1CIPA 5C1DA 5GMOA 2O9JA 5BW8A 2QB5A 1F2UB 2BCJQ 5JASA 3MJSA 1HG1A 2FPGA 2GYUA 1X74A 4D4IA 4CCYA 4DMMA 2H08A 3ASZA 4AICA 5KTPA 3NAGA 4R05A 4AVYA 1E1NA 1HLGA 2MSNA 2RGXA 1TM5E 4RIHA 4ZQFA 1YUBA 4ZOLB 1EVJA 2HQ1A 2ZRLA 3RHZA 2PS0A 3EQ7A 1PNOA 1FMLA 2AE1A 1KQ3A 2GA8A 1QCZA 2DHDA 1G5QA 4EARA 1BYIA 1MORA 1N4AA 4ALMA 5FLKA 3LA6A 4CF7A 5JHGB 3PFBA 3V8NA 1SZJG 5CEEA 5B6PA 1L5ZA 4KWIA 5EE3A 1U7XA 3VHXA 4BJ1A 2ZSFA 1AKTA 3H65A 3OC0A 3T3NA 5ARBA 1OHHD 1C41A 2PR7A 1YRQA 1I30A 5A4IS 3CQ9A 3IFSA 3MRXA 5AJXA 1VQ1A 4P7GA 5KYUA 2ZBFA 3BRWD 3V3TA 3ZW8A 3QFHA 2DWUA 4W5RA 1E5QA 1Q0RA 4IVRA 3HJTA 3UKDA 4RTRA 2P0YA 1PHRA 3DOEA 1TAHA 1QX3A 4P2GA 3WGZA 5JC8A 3B2EA 1U94A 3C7TA 1UOEA 2R6DA 2B0CA 4HLUA 5K20A 1O96A 4F6RB 4MVJG 4NESA 4RGBA 1LPNA 2OQIA 2RK6A 2YVKA 4LWQA 2TS1A 1EQUA 3WZMA 4IQ0A 2M1XA 2VZ9A 1RMTA 4FHDA 5JDCC 4EVRA 3IP3A 4LYDA 1P7PA 4ZVLA 3AEXA 2FRDC 2W2KB 4RENA 1YAHA 3GLTA 1I6MA 1PL8A 4DB2A 4XQ0A 3K8OE 1PVVA 2F7SA 4TL8A 2O20A 3DEKA 2BI8A 2JATA 2VBGA 1BN6A 3HC7A 1QZZA 2B6NA 3CVJA 4D8VA 2FR0A 3DE6X 1ZJYA 2QQEA 4FR5A 1UBTS 5G1OA 3ZD6A 1SQ6A 3S2ZA 4DLSA 4JX8A 4MS4B 3T7SA 4ZDIA 2Q7XA 2OILA 5DTJA 4RVFA 4OHOA 4RMHA 1VLLA 3HZHA 1MB3A 3UB4A 1CZRA 3GLQA 3K15A 4B6RA 1S2LA 1KDVA 2WE7A 1N2XA 2OZVA 3O4IA 4PLGA 3SHQA 3IO5A 4QM7A 3M1IA 3NKVA 3PE3A 4NSNA 2ZITA 3KHSA 3IDQA 4AS3A 3PUVA 1FJGB 1G60A 2AB0A 2GX6A 2HK8A 4WIAA 3WAKA 4HNTA 3DZHA 2MSKA 3AZPA 2O1WA 2ZYSA 4GI1A 5C34B 2Z6AA 2CLDX 2J33A 3ROQA 3O5AA 3MM4A 4K9NA 4L28A 1W5BA 2Z2ZA 3VU9B 1E3QA 2MSDB 5ALRA 3ZGLA 4FFSA 2O4CA 4UOEA 3DOOA 5DB4A 3E8SA 3P9KA 4XVCA 3DUFB 4QX6A 4Y2YA 4YN3A 2NN3C 4ESOA 2G67A 5JUWA 1INLA 2UZ3A 1T9KA 2B20A 4MQFA 4WV3A 1OBVA 1GTSA 2ODTX 2GEUA 4O4IF 4TV8A 3RUFA 1GKIA 3F0TA 3IEIA 5AUNB 1Y5MA 1WDMA 1TEVA 3ZQ6A 1N5MA 1B6GA 3ESXA 4P7FA 4D8WA 4Z9YA 4LZJA 1HDOA 3WGOA 2W8ZA 4MUHA 4XW2A 4Y18A 1K4KA 1QSGA 3A6EA 3GQVA 3DL2A 1WHSA 3M3HA 4EW1A 4F9FA 3M2PA 2Z9CA 2ES4A 1NGSA 3NW9A 1JBQA 2XLCA 2BFEA 3LQ1A 3DOUA 2D3TA 2V7QD 2JGLA 3FJYA 2XTMA 4H1TA 1NBWB 2WJZB 1KSJA 3PYLA 1HXHA 3Q7IA 1DPFA 3C16C 3AYZB 3E9RA 2QR3A 1P33A 4BE4A 4EHFA 4Q9JA 5GWXA 3DR5A 4R31A 2HHJA 2GJSA 2AW3A 4BO7A 4KNYA 2AG1A 1O1YA 1OGYA 2ORYA 4G37A 5LJIA 3R41A 2XUOA 1GRVA 3PPIA 3D4OA 5CFRA 3Q3EA 1SBTA 2FPUA 3HI4A 5IEJA 3VBEA 4FQ8A 3V4FA 4PBSA 4XWGA 4D43A 1PR0A 3KXKA 4EI7A 3VISA 4DT1A 1TZJA 2FCAA 1E3JA 1DAGA 1NF9A 3HXTA 4PG4A 1DIOB 2R1ZA 4IJMA 1U8UA 3F7MA 1PL6A 5B1HA 1NRWA 1ZG3A 2I3BA 3GW8A 1NZDA 4PICA 3SFZA 2IEYA 4C87A 4HT3B 4TVSA 3NAMA 2I91A 3N2LA 5DNEA 3NXSA 5CVDA 5HRCA 3JASA 2AJ8A 1QKKA 5B64A 4TMTA 3GGCA 3ZD8A 3K5WA 1H23A 1HL7A 4J4TA 1UBFA 5AXCA 1YS7A 1GFWA 4HKTA 4WGGA 1JAIA 2PLNA 4MVXA 3HFJA 1XK6A 1JNXX 1UC9A 2AX4A 5T4BA 4HQRA 3LX5A 3E23A 1JIJA 2W58A 2GCOB 4NYJR 4Q7JB 1NC3A 4MDEA 4CODB 3MGAA 2I1QA 4NV0A 1AV7A 3UAVA 1JDTA 2D54A 2SHKA 4JBWA 2BCEA 4OU4A 3ZCRA 4EJMA 5AHWA 2UVPA 3T6KA 2WB2A 4PZ9A 3VR4D 4BRSA 3QXSA 5BRNA 5C31A 3UJNA 2SCUB 5DHUA 3H1GA 3HA2A 3NPAA 5JSFA 1NXVA 3DKKA 4QELA 2NXNA 4PNEA 3LUFA 1CUIA 1Z8DA 2GPSA 2K2WA 5FKJA 3BIWA 2I6GA 3OEWA 4HN2A 5DBFA 5HEKA 2FSVC 3CLHA 5A5EA 1Z4OA 4I55B 4Q21A 2QJOA 1EVQA 1U9CA 1Y42X 2FLVA 2PJUA 2VBIA 3MJVA 3DMTA 3T7JA 4UHEA 1PG0A 4HQFA 2AYYA 4CV3A 1LBIA 4RWZA 1WMAA 4E08A 3RSGA 1DOAA 1E92A 2R8XA 1JR3A 4RL6A 1MV8A 1NIJA 4WOCA 3LV8A 3IV7A 2RHCA 5HPYB 1IZ9A 1EAYA 1T1RA 4L07A 3ER9A 1P5JA 1YS1X 3E3NA 3QVJA 4GYJA 2BEVA 2JGNA 4K6CA 4PYOA 1HE8B 4EMBA 2C7PA 2H7XA 5K8JB 1FQOA 1ZD8A 3KX2A 4HSGA 4UHDA 3VO9A 1EFRD 2H2AA 4P4SB 4A2QA 3KQKA 3TOCA 2D1RA 2GPNA 1TUEA 3WKCA 2QMYA 1Z0KA 4CHGA 2GPTA 4JLNA 2I2FA 3F47A 1A4UA 1XJQA 4R1MA 3EJWA 3MWFA 1Y8RA 3JZMA 3NJ4A 2NU9A 3QHPA 2YFYA 4GZ6A 4OCZA 4ALIA 4JT4A 1I2CA 2IIPA 1NY6A 1RJDA 4U1RA 1QIDA 3A0UA 3I34X 4IM7A 4QOIA 3K0KA 4RH3A 2FQ1A 3KR0A 2Y4NA 5J1TB 3EPKA 4D82A 3TX2A 5IT4A 1I01A 3IOYA 2HM7A 2SKCA 1PD1A 1TM7E 4UMFA 4AKEA 2XGJA 2G9RA 2X13A 3PXAA 4V02A 3HSSA 4QPDA 2ZS7A 5HBRA 1KDTA 2PFKA 2Q3MA 3R8XA 3QVTA 1SC1A 3VYSB 5IU6A 4NAVA 2W48A 4XGQA 3BC1A 4OY3A 3H11B 5KDLA 3TGWA 3GLIB 4I99A 4ZKEA 2WB4A 5AK0A 4ZN6A 1UAYA 5I9TA 1ZJ6A 4Y1EA 2LKCA 2J3LA 1W5TA 2KBEA 4ZQIA 4IV8A 5DWVA 1KJ9A 1ZX1A 3RJZA 1ES9A 1B7GO 1XZKA 2QPOA 2ZE7A 1G8GA 3BWVA 3H9GA 1WUIS 4M38A 4YLGA 5I5EA 5CFLA 5AOAA 5BQOA 2AF4C 2WAOA 3KTOA 1X1TA 5EHNA 1FP4A 3DLAA 5ALNA 1LF5A 4YRJA 1DWOA 3ZWQA 1CTQA 1MO2A 2FJUA 4R8VA 3X1WA 5JAHA 4N12A 4V0QA 4BBPA 1BHJA 4IWNA 3IOCA 3ZE6A 4JSTA 1NLYA 1XGKA 1THMA 2HHCA 2I62A 2WIDA 3BZUA 1AN9A 1Z74A 3MMNA 5G53C 4MR7A 3OPVA 1YU6A 4MYDA 3LXUX 1IZZA 2EWMA 4QGHA 1RRPA 2VYVD 5IBCA 4RZ2A 2FUCA 2IPNA 3IRVA 4MJ3A 4RD0A 1G2OA 3F3SA 4JN6B 2OD2A 3A3KA 4PGGA 3LGXA 3O4RA 3BFPA 3TE6A 1D2AA 1M0SA 5DLYA 1VGVA 1ABBA 4F1WA 1K6XA 1PU2A 5DI3B 5AW0A 4FDAA 1RCTE 3P0JA 1PSWA 1NJSA 1JKJA 3IKTA 3CUEF 1T35A 3ZK8A 3I2JA 3GO4A 4TXJA 1POXA 1NBAA 3QFCA 4WAUA 2RAVA 1SK9A 1SQSA 1AURA 3L7IA 1KMQA 5JYCA 3AQIA 4FEYA 3AY3A 1J33A 4IHJB 4EGSA 4PZYA 4EWLA 3HCCA 1SBNE 2GN1A 3AOGA 3KYJB 1EINA 2NV6A 1K6IA 1Q0QA 3LP8A 1PTKA 4Q9LA 1ZUIA 5FYDA 3WLIA 3PFGA 4J0HA 1VIMA 2QU7A 2ETXA 5EJAA 4D41A 2PE5A 2RGYA 4BO6A 1GPBA 1IJKA 2ZT6A 4HLUC 3N0RA 1QH0A 3PS9A 2VTDA 5CA1B 2OUIA 3G0CA 2IL1A 3E5HA 1KOJA 4GDFA 2XYVA 2W4QA 4OKIA 3EULA 1YB7A 4QDZA 1ZAKA 4BTLA 1MG5A 3Q0EA 4NJEB 4A27A 4X65B 3WNCA 3OE4A 2RMKA 1W48A 2IF0A 3GMSA 1Z0SA 5CK4A 3V00A 4Z6KA 4NEGA 3TRDA 1SHLA 1JEQA 1RRVA 2DH5A 4FFMA 4D74A 2BDEA 1H5UA 1T5HX 1ZIDA 3QXGA 5IN5A 5TQ0A 1IEWA 4L73A 4HGOA 4CM8B 3DS8A 4CVNA 1YNSA 5I9NA 3G1WA 3K09A 4OHWA 1RJ9B 4U2CA 4YAKA 2NP7A 2FZGA 2A3NA 4RO0A 3HB1A 1MJHA 2F9LA 4DUGD 3DXYA 4JSYA 5KWJA 1FSZA 5G2OA 2PUWA 3ABQB 1UZLA 4L7VA 5CT5A 4EUSA 3D5TA 5FXMA 1A9ZA 5H83A 4ZOCA 3RAEC 3KL2A 2P69A 1M10A 2V1UA 3QZUA 3S5UA 3GZ4A 4TYPA 3SP1A 1U7UA 3P2KA 1YSCA 1YGPA 5AVKA 2X2PA 2XODA 2X0KA 4I5EA 3ZXIA 4EG1A 2JDID 1QONA 1JV2B 4OXQA 1XAHA 4EGAA 4V0LA 1G5IA 2Z83A 5FT9A 3QPUA 1E1KA 1TAGA 3RT9A 2NU8A 2VRWA 3AUKA 4PHGA 3SBDA 2CEKA 2FW9A 2Q6OA 3QV2A 4DC0A 3OEED 4Y1GA 4OTZA 5GGXA 2IV2X 1GPJA 4MTLA 2NGRA 1S7CA 5JI2E 3L0CA 2PQ2A 1WMEA 1QGZA 4L8FA 4XVHA 4J16C 4X1IA 1II8B 4YAWA 3SNKA 5TX7A 4BFLA 2PRKA 1YCGA 2B4TO 3C1OA 4NOLA 1MG0A 3ROXA 3MJHA 1D09A 4HNQA 1NW3A 3OESA 3MLEA 3JQ8B 4Q93A 2DKOA 1WSDA 2W9XA 3BYZA 3FYSA 4FE4A 4OATA 5F4BA 3LTNC 2NO7A 1ODTC 3FWHA 3U17A 4CKXA 4AQDA 1SELA 2O8EB 3ZZMA 3VYTB 4DB4A 2WJAA 3CIOA 3Q7TA 4RTQA 3L6CA 4JP3A 2FMKA 3QBEA 5A0FA 2A92A 1FUIA 2OZLA 4FJ0A 4KG7A 4OH1A 3CKYA 2BFFA 5LOVF 4JLJA 3EZFA 1XQVA 2A57A 3DZKA 2QRQA 1YQQA 3G2MA 3I9JA 5AK3A 4ZVQA 3UAYA 3UVEA 2CXQA 4LCJA 1ZQ9A 4FTWA 3FGPA 5JAZA 2WYWA 4CLEA 1Q1QA 1Z0ZA 1P74A 4P1ZA 1EDDA 2IP2A 3M70A 4MAMA 4ZVUA 5AW7A 2ZIAA 1R3UA 3NBYC 4AMVA 1LFAA 3UH0A 4DS3A 1OASA 1X8JA 2VP9A 1E5VA 1AB6A 2VUUA 2HT6A 3FPSA 2OM6A 4J94A 2BJVA 5F9HA 3OFND 5BPHA 1IMJA 1SVUA 5DK6A 3IDZA 4M0LA 5I9IA 4MHTA 3N5KA 1DAHA 2R6FA 4X1IB 4BX3A 2NAFA 2A14A 3W8FA 4UPVA 3WISA 1P4JA 2CMDA 1P7ZA 3I9V6 2A6PA 4GEGA 4KQFA 2ACWA 4P54A 1JFRA 2DY1A 4TWJA 1OGJA 4EKEA 4R2MA 4NH0A 1ZVQA 2QLNA 5JPCA 1ZUNB 1EIZA 1R4AA 2PZMA 3TUIC 3C7DB 5BQ3A 2WHPB 4XFKA 3H2KA 2VLBA 1JHMA 4N3CA 1Q1EA 2IZ6A 4NTZA 4A2WA 2ZVDA 5LD2C 1BG6A 3K16A 4RK0A 3F9RA 4ZCIA 4CNQA 3A2LA 2VLIA 1OTXA 2V03A 3D3QA 3CF6R 1NPYA 2Z0MA 1GA4A 1N9KA 1E6LA 3BFVA 4CM6A 3ZVKA 2H2WA 2ZJFA 3P2MA 4M1YA 1YR6A 1KEEB 5B7GA 5SY9A 2GEKA 1XWFA 3WRWA 4RFSA 3K8ZA 3LRTA 4PZEA 1DC7A 3BJRA 2XE6A 1YQEA 3OKAA 5IAGA 3HYRA 3ZV5A 5JDIC 1YZKA 2IXTA 3QU2A 1B6TA 1RFGE 1KP9A 4EQ6B 3EIEA 4YRKA 3A4YA 1C1YA 2Y0CA 4XTRA 3ONNA 4U0JA 4IJ5A 4IG9A 1WWKA 3P8ZA 4WCVA 3COZA 3V55A 2WINI 3DPSA 2ZUEA 2VH1A 3QUQA 3QY9A 4CMEC 3PFFA 1SKYE 4TLCA 3CG0A 5G0TA 4M49A 5J59A 4E5NA 2H2IA 4RZQA 5JC1A 3ADKA 4EZBA 4F6LA 3LCMA 3PQDA 2QJTA 2M6KA 4ZAYA 3VDQA 1E3MA 4POOA 3DZ8A 3ET4A 2AW5A 2ZIVB 3A9SA 2D1YA 3JZFA 1CQXA 3I73A 4H7JA 1W30A 4HRVA 4J7UA 1PJ8A 4AT1A 3OJOA 4D0NA 4YAIA 1IK4A 3ACBA 4IZOA 1WETA 2BTQA 4FE3A 1P2SA 3UC9A 1MJGM 1U4OA 1R9GA 3C3YA 4Q05A 4GSLA 3TSOA 3QLUC 3OIYA 5NLLA 3DT6A 2CHQA 2GS9A 2X3UA 5K8LA 5E4JA 1RNLA 5AW3A 3MIIA 1JS1X 1L4EA 3OHMA 4EB6A 1BFDA 2A5DA 2O7NA 4XUGB 4BY9E 1K66A 4G1EB 2QG4A 3WADA 1MJGA 3ANYB 4URZR 2XKAA 4TV8B 1V45E 2H4FA 2PZ8A 3QSGA 3AY0A 3VAYA 4QIHA 3TDKA 1N5IA 5C8ZA 3ZQKA 2VP4A 2OBNA 2ZREA 2IIBA 5T4HA 1M6EX 4RVGA 1SBIA 1JFTA 2QNBA 4FWIB 2VNJA 4HEA1 3SX2A 4YMWA 2X8JA 3U37A 3ZDCA 2CHUA 2YRWA 3G0OA 2H2DA 4MB0A 1QV9A 3R44A 3D43A 4RD1A 4RF2A 4HVTA 4ND2A 4KR6A 3BHJA 1ZUNA 2DFVA 4KRYA 3PQ6A 1F48A 3QG1A 2R6GA 2P79A 4OXXA 3B1XA 1EX9A 4WXEA 4YDQA 3QVVA 4LTNA 1QHSA 3E05A 1VSVA 2NUTA 2O2JA 3C70A 1E9FA 4KO2S 2JI7A 5CNJA 2FPOA 2NT3A 1NVGA 3R3ZA 2Q1YA 1QHGA 1D2NA 1DAEA 1G3QA 3EARA 2XWSA 3LL7A 4TTQA 4CZ2A 1XX6A 3V8BA 3R23A 3FPKA 2ZVPX 3GT7A 3FTQA 3HBAA 4AJEA 4P83A 5BWBA 1E61A 2D0IA 2X4IA 3O7WA 1RRFA 2POQX 2B8NA 2Q3FA 3E18A 4J6EA 5B3JC 4MI6A 3VKHA 3QU5A 2Q3JA 2B3DA 1C30B 3MMXA 1RABA 1BW9A 1XO1A 1Z0UA 2YFQA 3F78A 3QKIA 4FE7A 4EYEA 3IH5A 3VR4A 3KR2A 5JNSA 2J5XA 1SCUB 3I2GA 3KT3A 2UUAB 4JLWA 1QE5A 2VBFA 4IYRA 4YY3B 3ID6C 1KEUA 1AUOA 1YO6A 2D5AA 3RJMA 2KPOA 4PSCA 1AMUA 4MWDA 3FOEC 2IZZA 2XMRA 3QHAA 4Q7MB 4TTRA 4AECA 4DCOA 3BKWA 3O93A 1WOYA 5AHKA 2HPVA 2YJ6A 2YICA 4DSUA 4KRFA 3EW9A 1XZGA 5KYTA 4QU8A 1LK7A 2PEZA 1CUFA 1ZR2A 5E1MA 3GG9A 4HB4A 5K6TA 2QK4A 1NVXQ 1RXSA 2WF6A 3UHFA 4YMLA 2EX4A 2QEQA 2QZJA 4CWAA 2FSIA 2WJYA 3HM2A 2GJ9A 3ENKA 3RS5A 1E2QA 4DCSA 5JY6A 2YQ4A 3GJ6A 1EESA 3LP5A 1PJBA 4EZIA 4E2YA 5E9QA 1FLDA 1M2WA 4AMBA 3HNRA 4KACA 4PFSA 2GN4A 4B9AA 3ZU6A 4CMGA 4UXJA 1GQRA 1BFUA 3HDJA 3KU1A 4X3PA 4DEVA 4FYHA 1E9SA 1QLHA 4GKKB 1I1HA 1R37A 4EA9A 3QJGA 2VG8A 3IP9A 4Q3OA 2BMJA 2ZWIA 2P77A 1ZL0A 2Q9UA 2GERA 1IPHA 2ICAA 1J21A 2EGHA 1TW2A 3PR3A 4GDMA 3UMRA 2XBUA 2VDWB 4TL9A 1T2EA 1CZHA 3L1UA 4K5QA 1HKUA 4XX0A 4XOUA 4CL2A 2C3YA 1DKOA 1LBQA 4WZAA 2V45A 4LE0A 3B53X 2PJZA 4B71A 1EVEA 3HSYA 4OMFG 3RT7A 1YDGA 4RQAA 1EE9A 2BISA 1E9AA 2HO4A 3SI7A 4B6EA 4YDRA 2FK7A 3M5PA 2VTEA 4DVJA 1PR3A 2BMEA 1NN1A 2QL9A 3G89A 4IJ6A 2UZ4A 2YJ5A 1MGPA 1IN5A 1G8YA 2QSYA 1Z26A 3CE9A 1W88B 5KAPA 3ZV3A 1AO3A 2C4VA 2YHIA 1MAUA 2AZDA 2AOUA 2VDRB 3PGLA 3TG8A 1MHPA 1UEXC 1RP7A 2NO1A 3PX2A 3Q15C 1C9YA 5K2MA 3REOA 1TYAE 3T15A 2DVMA 2ZTHA 3UHJA 3NVKI 1Z7BA 2PVPA 4Y9UA 10MHA 1CVRA 1P2VA 4IF6A 5CA1F 1PAUA 3HVHA 2L0XA 1TC1A 2Q4DA 2ZT8A 4J0QA 4ML3A 4C3ZA 2VQEB 4LJ8A 4OB7A 5A5VA 4RGYA 1IUNA 1PYDA 3Q3JB 1JQEA 3OFJA 1YXMA 2QTBA 1O0BA 5HKKA 2C88A 4BFZA 4PHHA 3TIXB 3FCSB 1FEZA 1NJFA 1UJMA 1ZCZA 2AOVA 3IOBA 4OL0A 2JKZA 3JQAA 5AKEA 3JQBA 4PZZA 2WTAA 5EIHA 1OAAA 2YYZA 1T36A 3SE7A 1AUVA 5FTLA 1KJNA 1G8MA 4FKMA 3F6SA 3IVAA 2WZQA 4FOLA 1R4NB 3PXCX 1Y1SA 5A04A 4GG1A 2YXBA 2RGGA 2GAIA 2XVAA 3LA8A 1SK8A 2BUAA 2OOKA 1D2CA 1JDVA 1NP7A 1J22A 2PS9A 3OUUA 4GWGA 1IHYA 4C9BA 5BN1A 4CTJA 3R9WA 2LDBA 3M5CA 1H3EA 2F43B 4TTSA 4X7BA 2WWTA 1P0PA 1TVEA 4HSEA 1W4BA 4TKVB 2B2XA 3CZMA 3H5RA 2C9BA 3GUVA 1FYWA 5DWQA 3Q11A 4KNWA 4DZTA 2GA9A 1WPGA 1W44A 3JZAA 2I8LA 3I9NA 4J7CA 3U7EB 1Y3DE 1SBZA 1O03A 5EHXA 3H3FA 3A4NA 3KQUA 2GN9A 4PCUA 4DCCA 1Y7IA 3AFHA 5HG0A 3TQTA 2DTXA 3F2VA 4YI3A 4WX2B 3FZEA 3KXPA 1KE2A 3T7EA 3TCNA 1D3AA 2F59A 4RJJA 3JQDA 1Q91A 1XEWX 2O2YA 2Y76A 4QARA 5G40A 2QMQA 3B78A 3JQ6A 4FOSA 1H1LA 4QSMA 2QROA 1Z5GA 2ATCA 3BH6A 1T91A 3H2ZA 4QUKA 4BO9A 1YS9A 4YCJA 1B2RA 3RYHA 2R62A 2WUEA 1EGQA 3SE0A 4G84A 1B8NA 4P4GA 4AO7A 2VHQA 4BJ6A 5AVXA 1TEXA 1CQJB 1Q1GA 4DBLE 4PONA 2PUAA 2Q9BA 2H1RA 1OXKB 3X1JA 4M88A 3EXG1 3ES9A 2W6IA 4NZPA 2YNMC 3K71B 5KX5F 3N59A 2V0GA 2P9FA 2O0LA 3KB2A 5ESDA 4Y6OA 2P4UA 2FEMA 4LK3A 1OLUB 2BFWA 1XI2A 1QVWA 5FBLB 4FMBB 4DLYA 2BHTA 4N5HX 3MTQA 3DC7A 3EF0A 1YL7A 3DDHA 3HQ4O 2AMVA 4ID9A 3G0BA 1KKLA 3JTEA 1V3VA 2GAJA 2WFZA 1XOIA 3K1JA 1TM3E 4HPXB 1KPIA 1N6NA 3HB0A 4IH1A 5AESA 1FNBA 4FI3C 2B7LA 4FSHA 3WQRA 5BXYA 2FXIA 3RYFB 4DG9A 2WAMA 5I7OA 3WDLA 1OLXB 3E84A 3QE2A 1FTGA 1VA4A 4QASA 4DIKA 1IWBB 5M7EA 4ABYA 4AKIA 2R96A 3D59A 1T8UA 2GWHA 3EEIA 3TVYA 2ZKIA 2F00A 4YMIA 4TLBA 2KI5A 1K3TA 2RI1A 4HDSA 4LWPA 5KYUB 1Y8ZA 3SIWA 1U1DA 1N5OX 2ZS9A 3FDZB 1FPMA 3OX4A 4MVCA 1LZLA 2VNSA 1V1JA 4Q00A 4HDNB 1MFZA 1Z5NA 2CCGA 2R00C 5GGYA 3AKCA 2RGUA 2HOQA 3IHWA 3U61B 2EXXA 2ENWA 4JGBA 2F8MA 1ZD1A 3IAFA 3OIWA 4HYTA 4B2PA 3RF6A 3WL7A 4U7HA 4KVZA 4ETMA 1C9DB 4DRYA 2M2IA 3FOZA 4MLZA 3EIFA 5EE5B 1MQAA 2ZYHA 1ID1A 1TM4E 1WCXA 2XCIA 1QP7A 1JH8A 3BFKA 4QTZA 1FCJA 4HWGA 3AVOA 4LS3A 2UVPB 4WOBA 4L6IA 3CEJA 1GXSA 3H1AA 5SY6A 4D79A 5ECYA 3VDRA 4HFJA 3D0KA 5KNCD 1TGVA 2PZFA 1QQTA 4JOQA 3PKIA 1NWHA 2V55B 3U1TA 1PZNA 1T4CB 2XECA 4EATA 2LZ0A 4O2AA 3AY7A 1ZN7A 3EUAA 4TV9A 3ILYA 2Z1DA 4MQLA 2ID7A 2VTBB 2ZYVX 1I3OA 2DUWA 2J1LA 3GRKA 3MELA 5F33A 2OB2A 4YXWD 5BW5A 3RRMA 5LOVB 5LWQA 4A82A 2I2AA 4J0DA 2HADA 2QHXA 1O9HA 1SHJA 4UQLA 1L5WA 4LJLA 1L5HB 3UJ9A 4M1SA 4C0QC 3T38A 5IS2A 2I2DA 4U7GA 1GA1A 3K9LA 4RABA 2OBFA 3SC3A 5AVYA 1QH8B 3WBJA 3DC2A 5H3HA 1Z7WA 4I4TF 3KP1A 3L8ZA 3LLSA 4A3SA 2VWHA 3ELBA 1XLVA 2Q1XA 3PQCA 1P31A 2JGAA 5K9ZA 4MJLA 3OUZA 2IDMA 4B3RB 1N2JA 1SCBA 4BQEA 1M7HA 5I8ZA 2GEBA 4L76A 4X54A 4PZPA 1A8SA 3GBVA 5K3OA 2Y1EA 3VPDA 3FX2A 3C6MA 5C2JB 1UM9B 3BH0A 1E3WB 3STXA 1DIRA 3WYDA 3EH1A 4QREA 1UBRS 4MJ7A 1MOZA 4MUAA 4NRDA 5EJMA 3DE4X 1HEIA 1IU9A 3TTWA 1HDEA 4CU5A 4ME6A 1A27A 2VNAA 4LC1A 1D5WA 3T3EA 2EFGA 2RDMA 1UBEA 4FK8A 2HA4A 1P77A 1VL1A 2A9PA 3WXMA 1L2TA 3ZJYA 2NXEA 1P62B 4NL4H 1SKYB 4Y1RB 3U4GA 4ZKDA 1L4YA 3EVAA 2A1UB 4D57A 2XVMA 1Z6PA 3HMQA 4N41A 2WF9A 2CUTA 1YRBA 3RJTA 3VNVA 1EKXA 2ZU0C 3C45A 5LIRA 4LC0A 2GZ1A 2QR5A 3OT1A 4U02A 4MQFB 3H86A 1HI9A 2PZAA 4HG2A 3TRIA 2H92A 3A9UA 2CJYA 5DASA 4S05A 2VHEA 3WIUA 4AX4A 4F60A 5HM8A 3G7NA 5FJIA 3H4TA 2NADA 1ZC3A 4EG6A 2Y27A 421PA 3ND9A 4PRYA 5B30A 1DG1G 4DCVA 4O4HF 3EFBA 1XNHA 1KI4A 4JLBA 3MXTA 2X58A 4HAIA 5AKKA 5ETJA 2O54A 1B6SA 1N4DA 4HQKA 4NMXB 4KC0A 2NTNA 2YQ5A 1YZHA 1LNSA 2ZFUA 2VDMB 3OOJA 5AW1A 5KPJA 3IQEA 3AGQA 4XYGA 2ZU6A 3L04A 4QC2A 2RHOA 3OURA 1F12A 3KXDA 4WLEA 4A5SA 1P9LA 1NUHA 3R3JA 3ZD7A 2Q0SA 3UJHA 4UXIA 4ENUA 4IIDA 5LP6B 1S3IA 3ZBTA 5FOSA 2NACA 2O8FA 2OCGA 3PUYA 5TF0A 3UUEA 4ZYXA 2VAVA 1Z4KA 2XMZA 4ND8A 2HB6A 4ZI5A 3A1SA 1BJRE 4H1WA 3ZBPA 1E5XA 4HNSA 1VIDA 4J7XA 3WLMA 2V3CC 2Q1SA 4PLCA 5A6VA 2HL6A 1FY2A 4FFBA 2QPLA 3ZE8A 1L1RA 3RFCA 2QU8A 5K4AA 2JCYA 4WN3A 2PUBA 1D1QA 1QH9A 2V5UA 1BDIA 1QC5A 1A8UA 1W36B 2AJDA 5KYNA 4E6PA 1XRPA 4YXWA 1T1SA 3MINA 3DDSA 1DDOA 1Z35A 4NFSA 1Y1PA 4B8WA 4QT4A 2G04A 4Q9DA 4L9AA 1HLFA 3VU3A 3PPWA 4OSOA 4ARBA 2Y9PB 4Y30A 3RSLA 5A1JA 3FSEA 1ZLXA 2CFOA 4MW0A 5AK6A 3IIIA 1ZVVA 4OAOA 3ZD9A 1H2EA 4HY3A 1NUTA 3KOUA 4G85A 4HTAA 4OMUA 5D3MA 4AJKA 1ST3A 3F67A 1DTSA 2I7XA 1IN4A 3NCHA 1J90A 3OOSA 2GM5A 3DEFA 5ENDA 4RQBA 2AQKA 2VSQA 2HMUA 2OMKA 1Z0FA 1SQGA 2XCQA 3A7EA 4RQTA 1THTA 3R5JA 4RXMA 4QUJA 2Z8ZA 1XCMA 5CDGA 4UE3S 1L8XA 2DBVO 1CJCA 2HX1A 4W8OA 5ALKA 3KE8A 5JH7F 4KQKA 4UBJA 2NU9B 3SZLA 5KTYA 4DNQA 4NONA 1FC0A 1DL5A 5FHRA 5B53A 1N57A 2D2IA 1TYZA 4XYLA 2WAAA 4X66B 4B4KA 3WYBA 1CUCA 3A10A 4KDEA 2GAOA 5AHRA 3A1VA 3IBYA 3KALA 3KEMA 4KVFA 3KJIA 1G42A 2EJCA 5EMNA 3IMFA 1YZUA 4EUEA 2CV0A 3ZJTA 4ZTBA 3OPYI 4FWBA 3WNDA 3T1TA 2F2TA 3A6JA 1DIAA 1A9SA 2JHFA 3EN0A 3NYIA 1A5TA 4UBLA 4GI2A 1E20A 3PT5A 5JXWA 3ER6A 4MA5A 1PNRA 1Z4MA 3TNYA 4D4HA 3VSCA 2XZLA 2P9BA 3ZWBA 4F71A 1CKEA 1OZ0A 1UAGA 1ND5A 3EY4A 4JWKA 3M4ZA 4L08A 4L4YA 2YJTD 1JAHA 4DHEA 3VKVA 3IVMA 1GUZA 4G9BA 5EJ2A 5IJAA 1A2QA 2FG6C 4PG5A 5E9JA 2XNDA 2EEPA 4LBWA 1HF3A 1HE5A 2M9MA 5LBUA 4DGQA 4YMVA 1OCEA 3IO3A 1JLLB 2Y66A 3DQZA 1A9XA 1Y5IA 4L3VA 3RTEA 5IFKA 1BVYF 1NLFA 1QV7A 4YIHA 3UWKA 5DN6D 2YWJA 1EVKA 4QU0A 3UN1A 4BFSA 3V8MA 5FAKA 3V1NA 1IG3A 5EYPA 1SHTX 5C7YA 5DP1A 3OWHA 4HLDA 4LF5B 4QPZA 3W2GA 4MZDA 4BGDA 2ZANA 2OHVA 1ZM7A 2PMBA 4DM3A 3GXBA 4HAZA 4NHOA 4OQYA 4YYEA 1T9HA 3RC9A 4RANA 3WA7A 1JAZA 4DW8A 4Q9IA 3QTTA 2ZRPA 3BDVA 4H6PA 4PEVA 3ZWYA 5A06A 5L4NA 1E2BA 4P7JA 4HDAA 4ZC8A 1ZMRA 1T26A 3SY8A 2YJNA 4QKQA 3HLYA 3EA0A 3UGQA 3H1FA 5CT4A 4EPVA 1M66A 2P9YA 3PD1A 5M04A 2ZAIA 4XQEA 4HS4A 4LNAA 1DGQA 1I0ZA 5AK5A 4EKGA 2WIFA 3GA0A 4XYBA 4FMPA 1UDCA 3MHTA 2BZGA 1UKYA 1JJIA 3FTDA 1X1DA 1JE1A 1FFDA 3G6KA 2IDKA 1X6VA 3BFJA 2I1VB 2NU7A 4YJ2F 3AI7A 2XMSA 5LBIA 4KE7A 2HV9A 1RRCA 2EOAA 3I5MA 1LXCA 1NF3A 3PVCA 2Q21A 2XCSB 2IZ1A 2ZIXB 4JHXA 3X1MA 3K9QO 2D0PB 2QMZA 2QYHA 2XMQA 1BRTA 3HXOA 1JZTA 2XA9A 4DTCA 3C3CA 2IXDA 1T2VA 1U28A 3EODA 3I53A 3QVGB 4IUBS 4OFWA 1W4RA 1ZOOA 2IE0A 4QGFA 3WLNA 5TQ2A 2PL1A 4TS9A 3WWYA 2E3JA 3E9DA 3H3JA 5GP1A 3G2LA 4M60A 4ZZ2A 1IEQA 5IVIA 1ISFA 1JWAB 2AOTA 2ZRKA 4N4AA 3RSFA 3CUTA 3UM9A 1L8AA 5FNVB 4F8JA 1BS9A 4U2KA 5TLSA 5AM3A 1P5RA 1CCWA 5D7NA 3PC8C 4FNMA 3P9NA 5EE1A 2R1TB 2FWIA 5LBTA 3QX9A 4JJ6A 1ORTA 5EIOA 3KPWA 1E9RA 3OZSA 3PL5A 2PMEA 3VNSA 4D1YA 4D25A 5DJ5A 1IAVA 1WXGA 2VK2A 2AIRA 1KK3A 2LR0A 1XNGA 2FOLA 3DFMA 4FI3F 4H0FA 3GEBA 5B2FA 2J0VA 3BILA 1X9HA 1TCUA 1ZK0A 1WXDA 1XMJA 3DE7X 3LT0A 3FYTA 4US1R 4DEXA 1JTFA 1RRMA 2Z2YA 4I1YA 4F0JA 1BHO1 4DCUA 2XOKA 3DFUA 3VNUA 5K0NA 2FZCA 3ADCA 2G08A 3HNPA 3ETJA 4AKTA 3JCZA 2YV3A 3ROMA 3LHFA 1TKAA 2MSEB 1RHRA 1Y7PA 2FN4A 1MOSA 2FWRA 3HEMA 3OC6A 2PCJA 2PGIA 2JVJA 4JVSB 2OFXA 4WY5A 4O4LA 4OU5A 4X8HA 3H75A 2PUDA 4IH4A 2JFXA 4U7TB 4ZYZA 2FGJA 3C3XA 4C7JA 3U7FB 2AD1A 4H6WA 1WB5A 1MIOA 1L6RA 3DT9A 3TOVA 1IDOA 1KRHA 4LVNA 2FSPA 3KQMA 2GAFA 4TQUS 3QG5A 3H83A 5DN6A 4FBMA 1P5ZB 6LDHA 3N0TA 3IVGA 2QORA 5AJWA 1MIOB 2YWGA 1PN3A 2YYAA 1A97A 4L4XA 3FBTA 1NRJB 4LISA 2Y1DA 4BPRA 5LYYA 3SM3A 2FTKE 2OK7A 2VO1A 2H1VA 2W93A 4DF3A 1IC6A 4C7BA 5EFOA 3OP4A 2HC9A 1EEXB 1JR3E 4RYDA 4EH1A 1ZH4A 2P6OA 1TUBA 4NI5A 5C80A 4G0QA 4NY1A 1UZNA 2WG2A 3V34A 4XIFA 4ZVVA 5F98A 4UM8B 4D3SA 1A7AA 3WLPA 4F11A 3Q8MA 1ACLA 1DV1A 2C00A 1VL5A 3HKEB 3IUQA 3RVDA 4QZVA 2MOKA 2G80A 1L5NA 3DAFA 3HJFA 4AY2A 2E5WA 3MWEA 1EX6A 1E59A 2OXTA 1OLSB 1PZMA 4FNAA 4NU6A 5E1OA 4ENWA 5T5QA 4KAAA 3K2EA 4K9DA 2XUKA 1PT6A 2YY7A 4KGZA 1A5BB 3HL4A 4LFCB 5KC8A 3KZCA 4OBBA 3G17A 4AC9A 3QWHA 2Z2JA 4Y9TA 3CJQA 1CJSA 3SEFA 3U7JA 3W06A 1I4LD 3MMZA 4I4TB 3IE0A 4LZOA 3VJLA 3B6MA 4OX9Y 1BMFA 3BCHA 4MW2A 2REBA 3IQWA 1ADJA 3U4QA 4BVAA 4MMXB 3OVMA 2P6NA 2WWIA 1NMXA 4KQWA 1VIAA 1ORRA 4HQOA 1DBSA 1WZNA 2NYUA 2C1ZA 4GSYA 1V0JA 2WSYB 3X1DA 1F5NA 3AUJB 2OO5C 2PT5A 2QRNA 2UYHA 3ANTA 2IVZA 2Q4OA 4ZO7A 1MX9A 1RHMA 3A1FA 3D4IA 2A88A 2QVLA 3NDIA 4FR0A 1KC1A 5BPFA 5D84A 2EG5A 3OSUA 2IY9A 2P9TA 5AM1A 3OLCX 1UOQA 3CLUD 4HBGA 3RKSA 4HZGA 3ZHRA 4O2RA 3L1JA 3SZUA 1BA3A 2B99A 2FVYA 5M29A 2HYIC 2GI4A 4V0ME 5A3QA 1WV1A 3KYBA 5C9ZA 1N8NA 4MRPA 4Z4GA 2TECE 2Q4TA 3AVYA 2ZJ1A 1OU4A 1XZJA 4X3OA 2D2VA 3QEBZ 5HIKA 1E6CA 1NBEA 5A4AA 3IERA 3TMYA 3X1ZA 4C4RA 4ZO8A 1Y1QA 3E5MA 1HYHA 2VIIA 5DHQA 3AUFA 1DC3A 2ACKA 3MQ4A 1EB8A 1G1MA 1Y4AE 4MGEA 4LJRA 1JHAA 3ML1A 4F3KA 4TKMA 1KRWA 1V8DA 4LWZA 4L22A 3WYFA 2GFHA 5BMVA 4QATA 3NKFA 4E2XA 2BKAA 4K9RA 4CIYA 1DMSA 1XD8A 1RWWA 2I1WA 2QTMA 1SBQA 2QUAA 1SCAA 3I2IA 4Z3DA 1GNTA 3L8GA 3QXHA 4AJHA 2FX5A 4U2GA 1MW8X 4RTKA 5KYVA 1AIPA 2QLTA 1C9EA 1Q92A 1U1FA 1VHDA 3GPCA 1IMOA 3Q88A 3RVKA 3S7TA 2VYND 2O23A 3CH4B 3PEEA 4QRDA 3VC2A 4AM8A 5LKAA 2VJAA 2OO3A 1SB8A 1SVNA 2EBHX 1NMQA 3ZE2B 1LWNA 1OFIA 1VPEA 3SFVA 4UZEA 1T3LA 4RTPA 1MVOA 3Q9UA 3R7AA 2R4UA 1KOLA 2SKEA 1JKMA 5DW0A 4C3OB 2XYQA 3VHLB 1UK6A 4DARA 4QFMA 3X44A 4YFVA 5JZVA 2PIDA 3S40A 5KQMA 1EP9A 1NAHA 3UV6A 1B3RA 3KUUA 2ZAGA 4MR8B 4DVGA 1Z2DA 1L5MA 4HXYA 1U3VA 4HWOA 1WEKA 5GONA 3ZGOA 4EITA 3NRJA 3W3AH 1RQNA 3FPBA 1PS8A 4U7WA 1O95C 2QRGA 4N8EA 5HKLA 5K3FA 5JXJA 1QP4A 2BONA 3WHIA 3AIOA 5FF9A 3QUBA 5J2TB 3JQ8A 5DLQC 1XEXB 4X84A 4D9NA 2F8LA 5F3WB 1X15A 1R7RA 1L3IA 1QGOA 1UPCA 2AC2A 2AN1A 1HFEL 3OOHA 3QK7A 2IKQA 1YOVB 4PV7A 3I8SA 2PKQP 4BFUA 1GHTA 2AG6A 3A4MA 2HA2A 2QVXX 3NGLA 4L5BA 5JE8A 1H9BA 4ITVA 1IHUA 4DC9A 1DJPA 3PEVA 4MYSA 1B6RA 1FFEA 3NCTA 4KW7A 1WCIA 5LSAA 3RVOA 3ESZA 2W43A 4D56A 4TLDA 3KEFA 1FXWF 1XKXA 4JYZA 1GFIA 4DCPA 3BB3A 1R9MA 3M0EA 4N5DA 3UANA 4C7VA 1IHOA 4O4HB 4YRFA 5BNTA 1X3LA 2ZYUX 3O8RA 4BUJA 3TUZC 2AQIA 3PQFA 3UJ6A 1T1JA 1XEWY 3Q8LA 4XJXA 4DBVO 1QQ5A 1SOUA 1VYVA 3AGPA 1NQWA 3K72B 3E9CA 3T0IA 4D8UA 1F0NA 2JFUA 4B3XA 5AKGA 1AZLA 5B1SA 1V5WA 2PA0A 4LHEA 5E1DA 1XBTA 2NZWA 4L4UA 2P3QA 5KJFA 4RBNA 1W4LA 5TQ0B 3ZTTA 5LP6F 3HABA 4CE6A 3OICA 1G6HA 1U7TA 1ONOA 3BORA 4DBZA 1EDZA 2OSBA 5LDGA 2XT0A 4C6TA 4R1SA 2FPIA 1UMCB 2E87A 4KQJA 3VMMA 4MDHA 1J8YF 1U99A 1PEKE 3GYBA 3PICA 4GPZA 3AR3A 2FEXA 2Q5FA 2GOYA 1Y8RB 1HG0A 4J0GA 1Z83A 3RFXA 4DOMA 3HKDB 1OI2A 1QRRA 1MMFB 4WI1A 3UWPA 3E4DA 2NSJA 2ZJ6A 4ZAXA 2RK3A 2YMLA 3OZWA 3WYCA 1FBNA 1PFVA 5K0EA 2C9CA 4IRXA 4Q9AA 4RC9A 4ZQCB 4BEBA 5LQCA 1HYGA 4XWYA 3R9KA 1Z08A 5JQGF 3EAFA 5AP9A 3VVBA 3PHCA 2B98A 1KERA 1VKJA 3KKMA 4EW3A 3DMRA 3EDQA 1EWVA 4J91A 4MGKR 4WXPA 1UK9A 1DHTA 4MRMA 4UM9D 2PCLA 2OD9A 1M7GA 1RZ3A 3JYNA 3WKBA 5CVEA 5AJUA 3SWWA 2VP2A 3FFWA 4C1NA 2R2GA 2Q6VA 3ZIAD 1VHJA 4FNOA 4MR8A 2HQSA 5EQJB 3DMDA 3DVRX 5LQAA 1VE3A 3Q1LA 1WM1A 3L9WA 5K3DA 3ZUGA 1BD4A 4HV4A 4RAQA 3C0KA 3DCIA 4D80A 4TMKA 2WWHA 1VL2A 1Q0HA 1SKQA 1AX9A 3OTOB 2G5GX 3F74A 1KK0A 2QI9C 3SKYA 4D9IA 3PXBA 4MKXA 1R64A 2HPZA 4GOKA 3NB0A 1A4IA 2AC4A 5B55A 2DH6A 3AL0C 1SUEA 4JI3B 1ILEA 1V16A 4YRPA 4PYMA 2PGDA 3H5IA 5FDFA 3G0IA 3AUUA 1KZ7B 3UV7A 3TN7A