3S6LA

Crystal structure of a yada-like head domain of the trimeric autotransporter adhesin boaa from burkholderia pseudomallei solved by iodide ion sad phasing
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
155
structure length
155
Chain Sequence
VRTSSLGDTSAGNGANASGGNGTAVGGAASASGTDATALGQASNASGNHSTALGQASSASGSGSTAVGQGAGAPGDGASAFGQGALASGTDSTALGAHSTAAAPNSAAIGANSVASAPNSVSFGSRGHERRLTNVAPGIDGTDAANMNQLWGVQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hep_Hag family
publication title Crystal structure of a YadA-like head domain of the trimeric autotransporter adhesin BoaA from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Cell adhesion
total genus 48
structure length 155
sequence length 155
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3s6lA00
1K7IA 1O0TA 2QUAA 1O0QA 3LAAA 3S6LA 1OM6A 5CXLA 2ZJ6A 2AGMA 1AF0A 2ML2A 2YO0A 1OMJA 3HDAP 3LA9A 4I35A 3A6ZA 3HBUP 5D7WA 3U1RA 1K7GA 1SMPA 1GO8P 2ZJ7A 1P9HA 3HB2P 3HBVP 1H71P 2ZVDA 1OM7A 5CVWA 3A70A 1K7QA 1JIWP 1G9KA 1OM8A 1SRPA 2XQHA 2YO1A 1KAPP 2Z8XA 3ULTA 3WP8A 2QUBA 3NTNA 1AKLA 3VI1A 2Z8ZA 1SATA 1GO7P
chains in the Genus database with same CATH superfamily
4DT5A 1K7IA 1O0TA 2QUAA 1O0QA 3LAAA 3S6LA 1OM6A 5CXLA 2ZJ6A 2AGMA 1AF0A 2ML2A 2YO0A 1OMJA 3HDAP 3LA9A 4I35A 3A6ZA 3HBUP 5D7WA 3U1RA 1K7GA 1SMPA 1GO8P 2ZJ7A 1P9HA 3HB2P 3HBVP 1H71P 2ZVDA 1OM7A 5CVWA 3A70A 1K7QA 1JIWP 1G9KA 1OM8A 1SRPA 2XQHA 2YO1A 1KAPP 2Z8XA 3ULTA 3WP8A 2QUBA 3NTNA 1AKLA 3VI1A 2Z8ZA 1SATA 1GO7P
chains in the Genus database with same CATH topology
1K7IA 1O0TA 2QUAA 1O0QA 3LAAA 3S6LA 1OM6A 5CXLA 2ZJ6A 2AGMA 1AF0A 2ML2A 2YO0A 1OMJA 3HDAP 3LA9A 4I35A 3A6ZA 3HBUP 5D7WA 3U1RA 1K7GA 1SMPA 1GO8P 2ZJ7A 1P9HA 3HB2P 3HBVP 1H71P 2ZVDA 1OM7A 5CVWA 3A70A 1K7QA 1JIWP 1G9KA 1OM8A 1SRPA 2XQHA 2YO1A 1KAPP 2Z8XA 3ULTA 3WP8A 2QUBA 3NTNA 1AKLA 3VI1A 2Z8ZA 1SATA 1GO7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7I A;  1O0T A;  2QUA A;  1O0Q A;  3LAA A;  3S6L A;  1OM6 A;  5CXL A;  2ZJ6 A;  2AGM A;  1AF0 A;  2ML2 A;  2YO0 A;  1OMJ A;  3HDA P;  3LA9 A;  4I35 A;  3A6Z A;  3HBU P;  5D7W A;  3U1R A;  1K7G A;  1SMP A;  1GO8 P;  2ZJ7 A;  1P9H A;  3HB2 P;  3HBV P;  1H71 P;  2ZVD A;  1OM7 A;  5CVW A;  3A70 A;  1K7Q A;  1JIW P;  1G9K A;  1OM8 A;  1SRP A;  2XQH A;  2YO1 A;  1KAP P;  2Z8X A;  3ULT A;  3WP8 A;  2QUB A;  3NTN A;  1AKL A;  3VI1 A;  2Z8Z A;  1SAT A;  1GO7 P; 
#chains in the Genus database with same CATH topology
 4DT5 A;  1K7I A;  1O0T A;  2QUA A;  1O0Q A;  3LAA A;  3S6L A;  1OM6 A;  5CXL A;  2ZJ6 A;  2AGM A;  1AF0 A;  2ML2 A;  2YO0 A;  1OMJ A;  3HDA P;  3LA9 A;  4I35 A;  3A6Z A;  3HBU P;  5D7W A;  3U1R A;  1K7G A;  1SMP A;  1GO8 P;  2ZJ7 A;  1P9H A;  3HB2 P;  3HBV P;  1H71 P;  2ZVD A;  1OM7 A;  5CVW A;  3A70 A;  1K7Q A;  1JIW P;  1G9K A;  1OM8 A;  1SRP A;  2XQH A;  2YO1 A;  1KAP P;  2Z8X A;  3ULT A;  3WP8 A;  2QUB A;  3NTN A;  1AKL A;  3VI1 A;  2Z8Z A;  1SAT A;  1GO7 P; 
#chains in the Genus database with same CATH homology
 1K7I A;  1O0T A;  2QUA A;  1O0Q A;  3LAA A;  3S6L A;  1OM6 A;  5CXL A;  2ZJ6 A;  2AGM A;  1AF0 A;  2ML2 A;  2YO0 A;  1OMJ A;  3HDA P;  3LA9 A;  4I35 A;  3A6Z A;  3HBU P;  5D7W A;  3U1R A;  1K7G A;  1SMP A;  1GO8 P;  2ZJ7 A;  1P9H A;  3HB2 P;  3HBV P;  1H71 P;  2ZVD A;  1OM7 A;  5CVW A;  3A70 A;  1K7Q A;  1JIW P;  1G9K A;  1OM8 A;  1SRP A;  2XQH A;  2YO1 A;  1KAP P;  2Z8X A;  3ULT A;  3WP8 A;  2QUB A;  3NTN A;  1AKL A;  3VI1 A;  2Z8Z A;  1SAT A;  1GO7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...