3S7JA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
428
structure length
428
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 148
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7jA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7jA01
5FJYA 3OS5A 5EKQD 4O6FA 2HYZA 4U0SA 3URZA 5FT9A 1XNFA 4MI5A 4JHRA 1ZKKA 4J8OA 5EX0A 5G05C 3RQ4A 3MO2A 3KD7A 5G04C 4A1SA 4LEUA 3RO2A 2G46A 4N39A 5JHNA 2VSNA 1FCHA 2GW1A 2XGOA 2UWJG 1ZU2A 1TJCA 3UUXA 5F5EA 4U04A 3HNAA 4I2ZA 3KS2A 4HOQA 1A17A 5CPRB 2UY1B 4CGVA 5D0OD 3K5KA 4GA0A 1B89A 3M5AA 4G1TA 3VTXA 4KBQA 4LDGA 4N5CA 4G24A 3CBMA 3CK7A 3F9XA 1HH8A 1OUVA 3RIBA 2FEZA 1W3BA 4YPAA 1KT0A 5JJ0A 4AY5A 4GZ5A 3QWPA 1ELRA 4H12A 3ZGQA 5HI7A 1QQEA 4AY6A 4Z4PA 3CEQA 2QFCA 3UPVA 3RAYA 2OOEA 4J8EA 2E2EA 2XGSA 3DB5A 3S8PA 4RG9A 4HOSA 3Q5MA 3M57A 4JL0A 5LSXA 5F6KC 3S7JA 5D0QD 4CDRA 5FTPA 4AIFA 4YPEA 2XPIA 4Y6WA 3CKCA 5A6CA 4W9RA 2FBNA 1N6AA 5BW8C 4EQFA 3VTYA 2XCBA 3KMAA 2YHCA 5A7DB 5LCWC 2PQNA 3M55A 4KYOB 2JV0A 2O8JA 2KATA 4QEOA 1PEGA 2VGXA 2IGQA 3ASDA 2KCKA 3OXFA 3R9AB 3WXXA 3GW4A 1E96B 2LSVA 4JLGA 2Y4UA 3QOUA 4JA7A 4RZ0A 3LCAA 3JYSA 5BT1A 3PE3A 5CHEE 3U4TA 4I17A 4H7XA 4YNPA 4WNEA 1PC2A 4YVOA 3MKRA 3ZPJA 2J9QA 5JJ7A 1O9SA 2VSYA 5EG2A 5KJLA 3LKUA 3AS4A 2Y4TA 2YQ8A 3M56A 2BQZA 5T0MA 2R5SA 3ASFA 2F69A 4QEPA 3N71A 5CCLA 3O48A 3RJWA 2KCVA 3OPEA 3U3WA 4I1AA 1MT6A 2XEVA 4YVQC 4GYWA 4HOUA 4N3BA 2RFIA 3ZN3A 4GCNA 4J0UA 1MUFA 2AVPA 4IN3B 3E4BA 5C1DA 1IYGA 4I9CA 3KMTA 3CKBA 4UI9C 3FWVA 3BEEA 5AYFA 1HZ4A 3QWWA 3NF1A 4UQXA 4E47A 4J83A 3MV2B 3EP0A 3OOIA 4GZ6A 1QZ2A 3CV0A 4UQYA 4N2QA 3OXGA 5HQ8A 3FFLA 5ARFA 4U0ZA 4XIFA 2VQ2A 3MO5A 5JINA 3VV0A 2FO7A 3S7DA 2DBAA 4GA2A 3RKVA 1H3IA 2JLBA 2FI7A 4BUPA 3Q47B 4NVQA 5T0KA 4G2VA 3M53A 4IJ8A 3F9YA 4GA1A 4NJ5A 3TGOA 3AS5A 3PE4A 3Q49B 2QPWA 5JJ6A 3Q4AB 3M59A 4AU7A 3LY7A 5FZRA 5G05J 4C1QA 5G04J 4ABNA 5TEGA 4I2WA 3KMJA 3FPDA 4BT8A 2I6HA 5CCMA 4HORA 2HO1A 5M72A 1WAO1 3CVNA 4NQ0A 5F6LA 4GYOA 5DIZA 1ML9A 4N3AA 3DALA 2KCLA 3LPZA 1N6CA 2VGXB 2VYIA 2R3AA 4J7FA 1NA3A 4RG6A 2V5FA 1YA0A 3QWVA 4WNGA 3CK9A 3BO5A 4I51A 2PZIA 3CBPA 4KXKB 2ONDA 4J7IA 3LY8A 3EDTB 3QKYA 4XI9A 4APOA 1MVXA 3M54A 4UI9J 4G23A 4I9EA 3ULQA 2NC9A 5KJMA 5ARGA 4U0UA 1P5QA 4IJDA 4GCOA 3RJVA 3CVLA 3MO0A 3SWCA 3MA5A 5KJNA 3ASHA 4BTBA 3CVQA 2PL2A 3SW9A 1ELWA 3OXLA 3SZ7A 2UY1A 2IF4A 3GZ2A 5FZSA 4ME2A 3ASGA 2BUGA 4O30A 3ZFWA 4WNFA 3HYMB 3FP3A 1WM5A 4H7YA 3MEKA 4J8FA 4BTAA 3CK8A 3TG4A 1MVHA 2W5YA 4UI9K 2Q7FA 2W5ZA 1KT1A 1NA0A 2C2LA 3GZ1A 5JJTA 2LNIA 2LSUA 1KLXA 2WPVA 2HR2A 4UQZA 1ZBPA 3TAXA 1N3JA 2XCCA 4BT9A 5FZQA 4MI0A 2PQRA 4JA9A 5F59A 4WNDA 5LCWJ 4WUYA 3Q15A 3SF4A 4YNDA 3QDNA 4U07A 2P58C 1IHGA 4Y6CA 3ZHEA 5BNWA 4HOTA 4BWRA 5LSZA 3CVPA 4N3CA 2FF4A 2MHKA 4F3VA 3ZHEB 3PDNA 5JIYA 4GYYA 4B94A 3CBOA 1HXIA 3F9WA 5TTFA 3RU0A 3AS8A 3TG5A 4G25A 3RO3A 4N2SA 3M58A 5TH7A 3S7FA 2KC7A 1NZNA 4FMUA 1Y8MA 5KJKA 5T5GA 3VUZA 3LYAA 4GPKA 4YPUA 3GYZA 2L6JA 2C0MA 4G26A 3MV3B 3LY9A 4J8DA 2WQHA 2IFUA 3UQ3A 4AM9A 3K9IA 3ESKA 4NRHB 5EX3A 5DBKA 5AYWD 4GZ3A 4YNMA 4QENA 3IEGA 2VGYA 4XI0A 4CGWA 4JDSA 3KAEA 3IHXA 2XGMA 1XQHA 2C0LA 3S7BA 3F9ZA
chains in the Genus database with same CATH superfamily
2EQXA 3DEOA 3E30A 3ABKE 1D9SA 4F7AA 3NBNB 3BU8A 3L08A 4CZ2D 4U0SA 3URZA 1X5BA 2WXRA 3LJNA 4R7LA 1XNFA 2KZTB 1FT2A 5G05C 5CRUA 1BPOA 2P9IG 5G04C 2CFZA 4LEUA 2G46A 4BSZB 4N39A 3FU0A 2GW1A 1MZCA 2HM8A 1ZU2A 3UUXA 3LXUX 5CPRB 3L9TA 4U8YD 1KPSB 2IONA 4CGVA 3HDXA 3ML8A 5ENRD 2Y3AA 5D0OD 1B89A 2AWIA 1Q2ZA 2JABA 3D9MA 2WXKA 4DX5D 4CEMA 3UI2A 3CBMA 2V0PA 2PM6A 3NAWA 4C48B 1W3BA 4FA6A 3Q9NC 2X6HA 4KMOA 1N0RA 3QWPA 2AW6A 4DLQA 2F0YA 1MYOA 3ZEFA 2GRPB 2F8YA 2XPZA 4CT4A 3BG0B 1QNFA 3TWSA 3BG1B 5EN5D 1Z5SC 2QFCA 2NYJA 4C0MA 5HKPA 1OWPA 1SA5A 4XEIG 1A5EA 4MRUA 5T4YA 3S8PA 4RG9A 1JCQA 3M57A 1EYHA 4JL0A 3CHOA 4Q69A 2R17C 1OY3D 4YPEA 4HQDA 2EIME 4Y6WA 1YYHA 4BETA 2GRRB 2ZU6B 4B0ZA 5BW8C 3U64A 4GZCA 3SY2A 4BEPA 5A7DB 2WXPA 2PQNA 3M55A 2JV0A 1N52A 2O8JA 2E0IA 3TJPA 1PEGA 4HRMB 1S64A 2FO1E 2P9SG 3KSQA 2GROB 2VGXA 5JMND 5LFAA 3R9AB 2OVFA 5JA4D 2ZXWE 4ILIA 2Y4UA 3ONKA 1DCEA 3PE3A 5CHEE 3JUIA 3O4ZA 4WNEA 1PC2A 2QYJA 1O9SA 5J08A 2VSYA 5EG2A 2NXPA 3AS4A 1QYMA 3SBTB 4BSXA 3HXBA 2BQZA 3PNLB 4QEPA 3UTMA 5AAOA 3OPEA 2QYUA 2A5EA 4UWKA 4I1AA 1MT6A 2XEVA 1K1BA 3ZN3A 4GCNA 4J0UA 5C1DA 2XEEA 3G2TA 3CKBA 4UI9C 4A3VA 4L1BA 2IO3C 3ZRHA 4EBAA 4FJZA 2XRZA 2PM7A 3TWWA 4BESA 4J83A 3APCA 3UINC 3EP0A 4I6EA 3V79K 1H19A 3MGBA 1KZOA 2DCPA 5HRYA 4UQYA 4U8HA 2WXQA 2I9CA 5HQ8A 3DPYA 5ARFA 3CVYA 1VDYA 3FH5A 5AQBA 1N95A 1DC2A 4F53A 3PZ2A 1JWFA 3L13A 1H3IA 1RZ4A 4DLOA 4IJ8A 4E85A 1UW4B 3TGOA 4D10C 4JD2G 1IHBA 3Q4AB 3M59A 3LY7A 5FZRA 3ULYA 5LOZA 3NQPA 4O1OA 2XENA 5HS0A 5TEGA 4BT8A 4CYMD 1L5JA 3G2SA 4HORA 1FVFA 2HO1A 1SZAA 3MX3A 5ENOD 3FTVA 2XEHA 5DIZA 1ML9A 5BXOA 4UUCA 1N6CA 1D8EA 3T9KA 2RFMA 4I51A 4RVBA 1HG2A 3IHVA 4HBDA 4XI9A 3L17A 1U3DA 2B6CA 4ANUA 4U0UA 4IJDA 4GCOA 2LXLA 1FPPA 3MA5A 2M63A 3EUVA 1WDYA 3CQCB 4JEUA 4HLLA 1ELWA 1G3NB 2BUGA 1D8DA 2IOLA 2DZNA 4DX7D 4N5QA 1O1SA 2WXLA 3FP3A 3CVVA 4H7YA 3QC1A 4AOFA 4J8FA 2CHZA 2P2CP 2W5ZA 4I6GA 5JJTA 3GZ1A 3L16A 1KLXA 2HR2A 4UQZA 4L7TA 1N3JA 2XCCA 4BT9A 3FH7A 5D2MC 1EF1C 4JA9A 3EHQA 1JUQA 2I1JA 3FHEA 3ZUVB 4U07A 5B3SE 5KNHD 3TWXA 1FT1A 4BWRA 4HOTA 4LRZA 4EHMA 2FF4A 4NACA 2LAHA 2MHKA 3PDNA 4EECA 4GYYA 2BF0X 3NZUA 4ILHB 1HXIA 3F9WA 3ZXPA 4G8KA 4FLHA 3RO3A 1TEZA 3M58A 1N94A 2KC7A 4FMUA 2ZGGA 2L0IA 1SQMA 3ZNGA 3DEPA 4UWFA 5E76A 4YPUA 3E34A 2F37A 4G26A 2XPYA 2IFUA 3UQ3A 4FC8A 1JWGA 1UG3A 2XQ0A 5CEAA 5EX3A 4DI3A 5A23A 2XS8A 2V5QC 4TXQA 4Q94A 4YNMA 4GTSA 4QENA 3TXNA 1UOHA 3LS8A 3IKOB 3KAEA 3IHXA 2XGMA 1XQHA 3Q75A 2X6FA 3QAQA 2YNQA 3OS5A 2WMOA 4L2YA 5FT9A 5EX0A 3DSTA 4WWPA 4FHJA 4A1SA 4FJYA 4ANWA 1SZ9A 5JHNA 2AXVA 2VSNA 3SI5A 1FCHA 2J07A 3I5PA 3TWTA 2AJAA 3UX4A 1TJCA 3BQOA 4ANXA 2UY1B 5EDSA 3W9GA 1TNBA 4DRXE 2RG8A 3VTXA 4LNUD 4LDGA 5ITZF 3DRAA 5FQ8A 5CMYA 2YINA 3TWRA 2X6IA 1HH8A 2WVIA 1Z6TA 3FU6A 2WXIA 3GZSA 3RRUA 4PH4B 3MCXA 4PS8A 2Y69E 5FINA 1N4QA 3Q7AA 4FLBA 4J8EA 4JHKA 3D9KA 4YDEA 4C9BB 3DB5A 4CT0A 3Q5MA 3ASNE 5LSXA 5F6KC 4OAUC 4CDRA 3PZDA 1S0PA 2XPIA 1TNUA 5A6CA 4AEZC 3D9IA 4EQFA 4FHKA 3UT8A 2LAIA 3FUNA 5LCWC 4JW1A 2B0OE 5LP0A 2IGQA 3ASDA 3FH8A 3FULA 2R03A 1HF8A 2A5UA 3QOUA 3AJIA 3JYSA 3ML9A 3G2VA 2BTDA 4EZKA 4H7XA 3EHMA 2Y1LE 3MKRA 3NOCD 3LVRE 3PUJA 3VLFA 2Y4TA 4JPSA 1LD8A 5CBNA 1EDUA 4HB5A 3B7UX 2R5SA 3UMVA 2GRNB 5ENSD 3N71A 4YDWA 5ENQD 3RJWA 1BD8A 2KCVA 4ZHBA 4U96D 3U3WA 1H0AA 1MX2A 1BI7B 4U95D 4BERA 3Q7FA 4DJAA 4EPZA 3MJWA 3PRZA 4N3BA 5ANRA 5JHAA 2WMNA 1MUFA 4IN3B 4Z68A 4JHJA 3RRNB 3KMTA 1OWMA 2L6BA 3RRMB 5FIOA 3U9WA 5H7PA 1HZ4A 3UIPC 4J6IA 3NF1A 2L0TB 4YDOA 5B1BE 2J49A 2KXPC 1S63A 2P9UG 3B7RL 3JUEA 1UJKA 4GZ6A 3ULEG 3B95A 4TV3A 2ZIRA 2WXFA 1MX6A 3FFLA 3CHRA 2QZAA 4XIFA 3J5QB 5JINA 3R9MA 2RFAA 3W9FA 1H6KA 1NFIE 2OCCE 2DBAA 4TXRA 3Q47B 3UM2A 4GMRA 3M53A 4NIKA 2J4BA 3F9YA 4GTVA 3D9HA 4GA1A 3AS5A 1DNPA 5JJ6A 2R02A 3B7TA 3DWLG 2XHEA 4ABNA 3Q9UC 3ASOE 3L22A 3FTYA 3ZVVA 4E6HA 2OEVA 3CVNA 3D9NA 4HFGA 4GYOA 2H6GA 4N3AA 3TXMA 3KSLA 4JZYA 3LPZA 3DSWA 5CBOA 1NA3A 1YA0A 3PH0C 3CK9A 4G11A 1TN7A 5ANLA 1OCZE 2ONDA 4GTRA 1LD7A 3FUHA 5KWDA 4HXIA 2J8SD 1MVXA 3M54A 4UI9J 3HVEA 2R59A 5EILA 4G23A 4CDMA 3QK0A 4I9EA 3ULQA 3CVUA 2NC9A 5KJMA 4WWNA 3DSVA 3I4RB 3AG2E 3CVLA 3E37A 4PDXA 3MO0A 3SWCA 1BI8B 4G8LA 2ETCA 1HFAA 5KJNA 4BTBA 2PL2A 4A1GA 4TUUA 2UY1A 2IF4A 2MYOA 4ME2A 4O30A 2GRQB 3HYMB 2WXOA 1WM5A 4ANVA 4KVOA 4DX2A 3MKQA 1MVHA 2W5YA 2Q7FA 2WXNA 4KZCA 2LNIA 2V4LA 4A55A 5AJDA 4HRNA 4DK5A 1DCQA 4MI0A 2GRMA 2A4ZA 4K5CA 3CHPA 2YHEA 3KEZA 2X6JA 5J90A 2ETBA 2RKKA 3F6QA 4YNDA 3SF4A 3QDNA 2P58C 3MYVA 3ZHEA 5BNWA 4DUIA 3ESLA 1GW6A 2WQ6A 4N3CA 1MX4A 3SHFA 3FTXA 1N11A 1OWNA 3I3NA 3CBOA 4XKBA 1IXVA 5TTFA 3RU0A 3AS8A 4G25A 3FUDA 4N2SA 5TH7A 4RQIA 3CHQA 1OT8A 1NZNA 5BV1A 3JXIA 3S2AA 3APFA 4L9PA 3ZYLA 4FP7A 2L6JA 2C0MA 3MV3B 4YDYA 2WQHA 5FWQA 3G2UA 3CHMA 4JEHA 3UKUG 3PEVB 1K8KG 4NRHB 3FY4A 1NP7A 5AYWD 2XS1A 2OEWA 4CDNA 3IEGA 4EBAG 4DI4A 5EYPF 5IY5E 5FQ6A 4CGWA 4ACLA 3D9OA 2KZTA 3KEAA 3S7BA 3F9ZA 3ZW3A 2GRLA 1O1TA 4ATGA 1ZKKA 4J8OA 1EPUA 4LG6A 5KCMA 2X3MA 3CSTA 3RQ4A 2WB2A 1E8ZA 3KD7A 3DXMG 4DX6D 2EINE 1H6PA 1OCCE 1JCRA 2OVBA 2UWJG 4LCTA 5F5EA 4PS7A 3FDHA 1U2VG 4I2ZA 3KS2A 4HOQA 3UKRG 3UT7A 1JPLA 2DVWA 4XE0A 4LNGA 5AARA 3M5AA 2CFUA 4G24A 3F9XA 1IKND 2FEZA 3QB2A 4YPAA 3FU5A 5JJ0A 2IQCA 2BKGA 3VLEA 2EIKE 4AY5A 4H12A 1LTXA 4I6JA 5HI7A 3ENEA 5AIJA 1E7UA 5AN8A 4AJWA 3CEQA 3UPVA 1TN6A 3CSFA 2QY7A 3RAYA 1IQUA 1ZB1A 2OOEA 3UM1A 3CHSA 3HXFA 1H2UA 2E2EA 2XGSA 3ABLE 3V2XA 4PS3A 5AQ9A 3E33A 3S7JA 4AIFA 4BY6A 3ZKJA 3HXEA 3TWQA 1MQSA 4TXPA 4K0RA 2LUHA 4OYSA 2FBNA 1N6AA 2VGEA 5ENTD 4HS2A 2XCBA 2HE0A 1N54A 1OWLA 3KMAA 3FUIA 4KYOB 4LUNU 2KATA 2ILRA 4HRLA 2J08A 1E8WA 2GGFA 3WXXA 3GW4A 4CCAA 2AXZA 2WXHA 3I4GA 3ZU7B 3IHYA 3L54A 3AAAC 3ZPJA 1H2TC 1MJ0A 4WAFA 2FULA 5KJLA 3LKUA 4GTPA 2YQ8A 3M56A 4M3OA 3ASFA 2F69A 3JCKC 3NZSA 1H2VC 3ZXSA 3OTNA 3FTZA 5T8IA 4BFRA 4QFVA 3PREA 4AP2A 3L82A 3U66A 4GYWA 4HOUA 2DYRE 1UN8A 3FTUA 3EHRA 1INZA 1IQRA 2AVPA 3AG4E 3BUAA 3RSEG 4B89A 1IYGA 4I9CA 3SFXA 3FWVA 3X2QE 4HVBA 5BPPA 5KNGA 2BKKB 4UQXA 3MV2B 4URKA 2RD0A 3FUJA 4GB9A 2X38A 3EIJA 3OOIA 1QZ2A 3CV0A 4N2QA 3OXGA 5EIBE 4HLEA 4J8YA 2VQ2A 3MO5A 3HXCA 3VV0A 3HRAA 3SFZA 4EZLA 4F6RD 1XGWA 3PNTB 3S7DA 3LDZA 4IYPA 3EU5A 2JLBA 4BUPA 4NVQA 3ZYMA 4G2VA 3AU4A 4Q96A 2QPWA 3PE4A 3Q49B 5CERB 2EILE 3PZ1A 4A3TA 3CLJA 3FU3A 5G05J 4U8VD 5G04J 1OWOA 3KMJA 4TUMA 1WG0A 2I6HA 4GMJA 4IULA 5M72A 1TJFA 1WAO1 2WXMA 5F6LA 3NB2A 3DALA 2KCLA 2VYIA 2R3AA 1HS6A 4FADA 2V5FA 3UIOC 4K03A 3QWVA 4L2LA 3EDTB 3SQVA 3QKYA 4J8SA 4APOA 3RAUA 1SVXA 2WQ7A 3Q73A 3DPDA 4GTOA 1K3ZD 5ARGA 1N4SA 2CG3A 4EZJA 3P1UA 2QC9A 2P9NG 3ASHA 3VLDA 4JXTA 3L6AA 3SZ7A 5FZSA 2ETAA 2IU1A 3ASGA 2AXUA 3ZFWA 4WNFA 3MEKA 2WM9A 4BTAA 2NSZA 1UJJA 2JEKA 4WWOA 3JQ1A 1KT1A 3IV0A 5CMWA 2WPVA 2V4HC 4HNAD 3V31A 5AQAA 1ELKA 1OCRE 2PQRA 1V55E 5D66A 1N0QA 3ZIMA 1O1RA 3R7QA 2EIJE 4WNDA 3C3OA 3PUKA 3Q15A 3PEUB 2IO2C 3D9JA 1NI1A 4Y6CA 4V3IA 2WXJA 5LSZA 3CVPA 3FTSA 2ZGDA 3RK6A 4F3VA 4JC8A 3DXKG 5JIYA 4B94A 4B93B 3ISMC 4QQIA 1WY6A 2IOSA 2LO6A 3Q78A 3TG5A 4RSYA 3S7FA 3FUKA 3FUMA 2DWZA 4I1MA 5KJKA 5T5GA 2J4DA 2P9KG 4BX8A 3FTWA 4GPMA 4GPKA 4GAAA 3LY9A 1K1AA 3EJNA 3T5VA 2OV8A 5B1AE 3ESKA 4U63A 5DBKA 3EIQC 4UWGA 3C72A 4I43A 3Q79A 1AWCB 3EHNA 5FJYA 2VTBB 5EKQD 4OVUA 4O6FA 2HYZA 2BEDA 5ENPD 3T5XA 4MI5A 4JHRA 4GMLA 4HI9A 3UT4A 3LJ3A 3MO2A 4DX1A 3DSSA 3RO2A 1HO8A 2DZOA 5BV0A 3HXDA 2XGOA 2CHWA 5AENA 4U04A 3SBSA 3V30A 3D9PA 3HNAA 2H6IA 3UM3A 1A17A 2I2OA 2MOWA 2V8SE 3CVXA 2KM4A 3K5KA 4GA0A 4XZ4A 3ABME 5ENNA 4G1TA 3HIZA 4KBQA 1TNYA 1UN9A 4N5CA 1S70B 3CK7A 1Y6IA 3G2WA 3HG0D 1OUVA 4P29A 3RIBA 3V2OA 1KT0A 1SA4A 4KVMA 1TNOA 4GZ5A 1ELRA 3ZGQA 4CRWA 1QQEA 3PZ3A 4GTTA 4JVSA 1PAQA 4DPRA 4AY6A 4Z4PA 1QBQA 4B8AA 1FVHA 5CRVA 3DSUA 3IXEA 1SW6A 3CGHA 4HOSA 3SO8A 2MRIA 1X81A 1YMPA 5D0QD 4AXHA 5FTPA 1NL4A 1HG5A 3JQ0A 1KZPA 2LXMA 4MS6A 3CKCA 4K5BA 4W9RA 5BXUA 1Z3XA 3VTYA 2YHCA 1OCOE 4GU5A 1OXJA 2X6KA 4A63B 4QEOA 2I1KA 3AG3E 3SNXA 3MZLB 3SD5A 4JB8P 2KCKA 5JHBA 3OXFA 2KBXA 3SFYA 3P2BA 3LEWA 3OAWA 1AP7A 1E96B 1U3CA 2LSVA 4GZDA 2F8XK 4JLGA 4JA7A 4RZ0A 3LCAA 4B8CB 5FQ7A 5BT1A 4XKCA 4F1PA 4OAVB 3U4TA 4I17A 4RLYA 4YNPA 4YVOA 3FUEA 4X8QA 3AG1E 2J9QA 5JJ7A 3NOGD 4ILGA 4BX9A 3FEXA 3QJZA 5G55A 5T0MA 2DIWA 4LSZE 5CEDB 1YCSB 5CCLA 4TRQA 2IEJA 3O48A 3T8MA 3QNKA 2R05A 3PZ4A 4APFA 2CG2A 4YVQC 4KT6B 1E7VA 4M7CA 4F1SA 2RFIA 5FQ4A 1E8YA 4O1PA 3E4BA 1O5MA 3CQGB 4C0EA 4L23A 3IBEA 3BEEA 5AYFA 2H6HA 4K5AB 3QWWA 4AV7A 4LNBA 2L9BA 4E47A 2WXGA 4GTMA 3D3MA 1BLXB 1Z3YA 4OVVA 3WG7E 2VSOE 4U0ZA 1HX8A 4MLPA 3FUFA 5CECB 2FO7A 3UM0A 1V54E 4GA2A 3DSXA 3TL5A 3RKVA 1N9AA 3ZYKA 2FI7A 1TNZA 3R7RA 5T0KA 4ACKA 3TWVA 4NJ5A 2H6FA 1BU9A 4U7EB 2P9PG 1N4PA 4AU7A 3DBSA 1RW2A 4C1QA 1HE8A 5EYLA 4I2WA 5G2NA 3C5RA 5CCMA 3CVWA 4NQ0A 4IRUA 1MHQA 4PUCA 2VGXB 3FEYA 4J7FA 3B7SA 4RG6A 3QARA 1TR4A 3APDA 3BO5A 4WNGA 4MKTA 2VTBA 3E32A 1PY1A 1HU3A 2PZIA 3CBPA 4KXKB 2PNNA 4J7IA 3LY8A 2IJGX 4FU3A 3ONLA 1P5QA 3RJVA 3HVEB 4NURA 4O60A 3CVQA 2IY0C 3D9LA 1N4RA 1E90A 5BUZA 3SW9A 1JCSA 2XZTG 3OXLA 3GZ2A 3B7BA 5AQ7A 5T3RA 3CK8A 3TG4A 4J7WA 4UI9K 1NA0A 2C2LA 2LSUA 4I1OB 1H6OA 3SGHA 3MKQB 3T8KA 1ZBPA 3TAXA 4XX5A 2Y0BG 5FZQA 5EIDA 3TWUA 2R2LA 4LERA 5E75A 3JXJA 3PS6A 5F59A 5LCWJ 4WUYA 2J09A 2VJ8A 1TN8A 3CR3A 1IHGA 4GTQA 4ZFHA 4FULA 3C3RA 3ZHEB 2ZISA 3ZYQA 3C3QA 2P9LG 4MBGA 5AJLA 1DVPA 3HHMA 5KBAA 3EU9A 3PVLA 1E8XA 4UWHA 5C2YA 3AU5A 4ATZD 4HI8A 2DYSE 5LX8A 1Y8MA 2XZDG 3B13A 3C98A 3VUZA 3LYAA 4AVXA 2XRYA 3GYZA 3LVQE 4KZ0A 4J8DA 3J5PA 2CHXA 1TYQG 4AM9A 2VSXE 4UWLA 3K9IA 3UXGA 3CIAA 4GZ3A 2VGYA 1LF8A 4XI0A 4JDSA 3FPDA 2C0LA
chains in the Genus database with same CATH topology
3QAQA 2EQXA 2YNQA 5FJYA 3ZW3A 3OS5A 2VTBB 4F7AA 2GRLA 5EKQD 4OVUA 3L08A 2WMOA 4O6FA 2HYZA 4L2YA 4U0SA 3URZA 1X5BA 2WXRA 3T5XA 4ATGA 5FT9A 4R7LA 1XNFA 4MI5A 2KZTB 4JHRA 1ZKKA 4J8OA 1EPUA 5EX0A 4GMLA 3UT4A 5KCMA 2X3MA 5G05C 3CSTA 1BPOA 3RQ4A 3LJ3A 2WB2A 3MO2A 1E8ZA 4WWPA 3KD7A 4FHJA 5G04C 2CFZA 4A1SA 4LEUA 3RO2A 2G46A 4FJYA 1HO8A 1SZ9A 4ANWA 4N39A 2AXVA 3FU0A 2VSNA 3SI5A 1FCHA 2GW1A 2J07A 3I5PA 5BV0A 2OVBA 2XGOA 2HM8A 2CHWA 2UWJG 1ZU2A 4LCTA 1TJCA 3UX4A 3UUXA 4U04A 4PS7A 5AENA 3SBSA 3FDHA 3D9PA 3HNAA 4I2ZA 3KS2A 4HOQA 1A17A 2I2OA 3UT7A 3LXUX 4ANXA 5CPRB 2MOWA 2UY1B 2IONA 2V8SE 4CGVA 1JPLA 3CVXA 3HDXA 3ML8A 2KM4A 4XE0A 2Y3AA 5D0OD 3K5KA 4GA0A 4XZ4A 5EDSA 1B89A 2AWIA 5ENNA 3M5AA 4G1TA 2RG8A 3VTXA 3HIZA 4KBQA 3D9MA 2CFUA 2WXKA 4LDGA 1UN9A 4N5CA 4CEMA 5FQ8A 5CMYA 4G24A 2YINA 3CBMA 2X6IA 3CK7A 3F9XA 1Y6IA 2V0PA 1HH8A 3G2WA 1OUVA 2PM6A 4P29A 3RIBA 2FEZA 3QB2A 1W3BA 2WVIA 1KT0A 4FA6A 4YPAA 3FU5A 5JJ0A 2X6HA 2IQCA 1Z6TA 4KMOA 4KVMA 4AY5A 3VLEA 4GZ5A 3QWPA 2AW6A 4DLQA 3FU6A 2WXIA 3GZSA 1ELRA 4H12A 3ZGQA 3ZEFA 4CRWA 4I6JA 2XPZA 4CT4A 3BG0B 5HI7A 1QNFA 1QQEA 3ENEA 3RRUA 5AIJA 1E7UA 4PH4B 3MCXA 4JVSA 1PAQA 4DPRA 4AY6A 3BG1B 4Z4PA 4AJWA 3CEQA 4PS8A 2QFCA 4C0MA 3UPVA 3CSFA 2QY7A 3RAYA 1IQUA 2OOEA 4B8AA 1OWPA 1FVHA 4FLBA 3CHSA 4J8EA 4JHKA 3D9KA 4MRUA 1H2UA 2E2EA 2XGSA 5T4YA 4C9BB 3CGHA 3DB5A 3S8PA 4PS3A 4RG9A 4CT0A 4HOSA 3Q5MA 3M57A 1EYHA 4JL0A 3CHOA 5LSXA 4Q69A 3S7JA 5F6KC 2MRIA 2R17C 5D0QD 4CDRA 4AXHA 5FTPA 4AIFA 1HG5A 3PZDA 4BY6A 1S0PA 4YPEA 3JQ0A 2XPIA 1MQSA 4Y6WA 4MS6A 3CKCA 4K0RA 5A6CA 4AEZC 4OYSA 2ZU6B 4W9RA 2FBNA 4B0ZA 3D9IA 1N6AA 5BW8C 3U64A 4GZCA 5F5EA 4EQFA 1Z3XA 4HS2A 3VTYA 4FHKA 2XCBA 3KMAA 1N54A 1OWLA 2LAIA 2YHCA 3FUNA 2WXPA 5A7DB 3UT8A 3FUIA 5LCWC 2PQNA 3M55A 4GU5A 4KYOB 2JV0A 4JW1A 1N52A 2X6KA 2O8JA 2E0IA 4LUNU 2KATA 4QEOA 2I1KA 2ILRA 3SNXA 3TJPA 3MZLB 1PEGA 5LP0A 3SD5A 2VGXA 2IGQA 3ASDA 2KCKA 2J08A 5LFAA 3FH8A 1E8WA 3FULA 5JHBA 3OXFA 2GGFA 3R9AB 3WXXA 1HF8A 3P2BA 3LEWA 3GW4A 2OVFA 4CCAA 3OAWA 1E96B 1U3CA 2LSVA 4GZDA 2A5UA 4ILIA 4JLGA 2Y4UA 2AXZA 3QOUA 3ONKA 4JA7A 4RZ0A 2WXHA 3LCAA 3I4GA 3JYSA 4B8CB 5FQ7A 3ML9A 3G2VA 3PE3A 4XKCA 5BT1A 2BTDA 3IHYA 5CHEE 3JUIA 3O4ZA 3L54A 4EZKA 3U4TA 4I17A 4H7XA 3EHMA 3T5VA 4WNEA 4YNPA 1PC2A 4YVOA 3FUEA 3MKRA 3ZPJA 3LVRE 1H2TC 2J9QA 4WAFA 5JJ7A 1O9SA 2FULA 3PUJA 2VSYA 5J08A 5EG2A 5KJLA 4ILGA 3LKUA 2NXPA 3AS4A 3VLFA 4BX9A 3FEXA 3SBTB 3QJZA 2Y4TA 2YQ8A 4JPSA 3M56A 4BSXA 5G55A 1EDUA 2BQZA 3B7UX 2R5SA 4M3OA 2DIWA 3ASFA 3UMVA 5T0MA 3PNLB 2F69A 4QEPA 3JCKC 3NZSA 3N71A 1H2VC 3ZXSA 5CCLA 4TRQA 3O48A 3OTNA 3RJWA 3T8MA 3FTZA 5T8IA 2KCVA 3QNKA 3OPEA 3U3WA 4BFRA 4QFVA 1H0AA 2CG2A 4I1AA 4UWKA 4APFA 1MT6A 2XEVA 4YVQC 3PREA 4AP2A 3U66A 4KT6B 4DJAA 4GYWA 4HOUA 4EPZA 3MJWA 1E7VA 3PRZA 4N3BA 5ANRA 4F1SA 5JHAA 1UN8A 3FTUA 3ZN3A 2RFIA 5FQ4A 4GCNA 1INZA 1E8YA 2WMNA 4J0UA 1MUFA 1IQRA 2AVPA 4IN3B 3E4BA 4B89A 5C1DA 4C0EA 3CQGB 4I9CA 4JHJA 4L23A 3RRNB 1IYGA 3KMTA 3G2TA 3IBEA 3CKBA 1OWMA 4UI9C 3FWVA 3RRMB 4A3VA 3BEEA 5AYFA 4L1BA 4HVBA 3U9WA 1HZ4A 3ZRHA 4EBAA 5BPPA 4J6IA 3QWWA 4AV7A 3NF1A 4FJZA 2XRZA 2L0TB 4UQXA 2J49A 2PM7A 2L9BA 4E47A 4J83A 3MV2B 3APCA 2WXGA 3EP0A 4I6EA 1H19A 3MGBA 3B7RL 3D3MA 4URKA 2RD0A 3FUJA 4GB9A 1Z3YA 1UJKA 2X38A 3EIJA 4GZ6A 3OOIA 4OVVA 1QZ2A 2DCPA 4TV3A 3CV0A 4UQYA 4N2QA 4U8HA 2WXQA 3OXGA 2WXFA 2I9CA 2VSOE 4HLEA 5HQ8A 3FFLA 5ARFA 3CHRA 4U0ZA 1HX8A 3CVYA 1VDYA 4XIFA 3FH5A 2VQ2A 4MLPA 3MO5A 5JINA 3FUFA 3VV0A 2FO7A 5JHNA 3SFZA 1H6KA 4EZLA 4F53A 1XGWA 3PNTB 3S7DA 2DBAA 3LDZA 4GA2A 1JWFA 4IYPA 3TL5A 3RKVA 3L13A 3ZYKA 1H3IA 2JLBA 2FI7A 4DLOA 3Q47B 4NVQA 4BUPA 3R7RA 3ZYMA 5T0KA 4G2VA 3M53A 3AU4A 4IJ8A 2J4BA 4Q96A 4ACKA 4E85A 3F9YA 1UW4B 4GA1A 4NJ5A 3TGOA 4D10C 3AS5A 3PE4A 3Q49B 2QPWA 1DNPA 4A3TA 3CLJA 5JJ6A 3Q4AB 3M59A 3FU3A 4AU7A 3DBSA 3LY7A 5FZRA 5G05J 3B7TA 5LOZA 2XHEA 4C1QA 3NQPA 5G04J 4ABNA 1HE8A 1OWOA 5TEGA 4I2WA 3KMJA 5G2NA 3FPDA 3L22A 4BT8A 2I6HA 1L5JA 3G2SA 3FTYA 4GMJA 4IULA 3ZVVA 1FVFA 4E6HA 2HO1A 1SZAA 3MX3A 3CVWA 4HORA 5M72A 1TJFA 1WAO1 3CVNA 4NQ0A 4IRUA 3D9NA 2WXMA 5F6LA 4HFGA 4GYOA 1MHQA 3FTVA 5DIZA 1ML9A 4N3AA 4PUCA 3TXMA 3DALA 4JZYA 2KCLA 3LPZA 1N6CA 2VGXB 2VYIA 3FEYA 2R3AA 4J7FA 1HS6A 3B7SA 1NA3A 4RG6A 3QARA 2V5FA 4FADA 4K03A 1YA0A 3PH0C 3APDA 3QWVA 4WNGA 3CK9A 3BO5A 4I51A 4L2LA 4G11A 4MKTA 2VTBA 4RVBA 5ANLA 1PY1A 1HG2A 1HU3A 2PZIA 3IHVA 3CBPA 4KXKB 2ONDA 4J7IA 3LY8A 3EDTB 3FUHA 3QKYA 4J8SA 4XI9A 4HXIA 4APOA 1MVXA 3M54A 2IJGX 4UI9J 3HVEA 2R59A 4FU3A 4G23A 4CDMA 2WQ7A 3QK0A 3DPDA 4I9EA 3ULQA 3CVUA 2NC9A 3L17A 5KJMA 1U3DA 3ONLA 5ARGA 4ANUA 4U0UA 2CG3A 1P5QA 4WWNA 3I4RB 4IJDA 4GCOA 3RJVA 3CVLA 4EZJA 3HVEB 3P1UA 4PDXA 3MO0A 4NURA 3SWCA 3MA5A 1HFAA 2M63A 5KJNA 3ASHA 4BTBA 3CVQA 2PL2A 3CQCB 3D9LA 4JEUA 4A1GA 1E90A 4TUUA 3VLDA 5BUZA 3SW9A 4JXTA 3L6AA 1ELWA 3OXLA 3SZ7A 2UY1A 2IF4A 3GZ2A 5FZSA 2IU1A 4ME2A 3ASGA 2BUGA 2AXUA 4O30A 2IOLA 3ZFWA 4WNFA 3HYMB 2WXLA 3FP3A 2WXOA 3CVVA 1WM5A 4H7YA 3QC1A 4KVOA 4AOFA 3MEKA 2WM9A 2CHZA 4J8FA 5T3RA 3CK8A 2NSZA 4BTAA 3MKQA 3TG4A 1MVHA 1UJJA 2W5YA 2JEKA 4WWOA 4UI9K 2Q7FA 3JQ1A 5CCMA 2W5ZA 2WXNA 1KT1A 1NA0A 4I6GA 2C2LA 3GZ1A 3L16A 4KZCA 5JJTA 2LNIA 2V4LA 2LSUA 3IV0A 1KLXA 4I1OB 4A55A 5CMWA 5AJDA 2WPVA 2HR2A 3SGHA 4DK5A 3MKQB 4UQZA 1ZBPA 3TAXA 4L7TA 4XX5A 1N3JA 2XCCA 4BT9A 5FZQA 3FH7A 1ELKA 4MI0A 2PQRA 2GRMA 2A4ZA 4LERA 5E75A 3PS6A 3ZIMA 3CHPA 1EF1C 2YHEA 3KEZA 3R7QA 4JA9A 5F59A 2X6JA 4WNDA 5LCWJ 1JUQA 4WUYA 5J90A 2I1JA 3PUKA 3FHEA 3Q15A 2J09A 3PEUB 4YNDA 2VJ8A 3SF4A 3QDNA 4U07A 2P58C 3MYVA 3CR3A 3D9JA 1IHGA 4Y6CA 3ZHEA 5BNWA 4V3IA 2WXJA 4HOTA 3ESLA 4BWRA 1GW6A 5LSZA 3CVPA 4LRZA 2WQ6A 4N3CA 3FTSA 3SHFA 2FF4A 4FULA 4NACA 3FTXA 4ANVA 3RK6A 2LAHA 2MHKA 4F3VA 4JC8A 3ZHEB 3PDNA 3ZYQA 4EECA 4GYYA 5JIYA 1OWNA 3I3NA 2BF0X 3NZUA 4B94A 3CBOA 4XKBA 5AJLA 1DVPA 1WY6A 2IOSA 4ILHB 1HXIA 3HHMA 2LO6A 3F9WA 5TTFA 3RU0A 3AS8A 3TG5A 3PVLA 1E8XA 4G25A 3FUDA 4UWHA 4FLHA 5C2YA 3RO3A 1TEZA 4N2SA 4RSYA 3M58A 5TH7A 3AU5A 3CHQA 3S7FA 3FUKA 5LX8A 2KC7A 1NZNA 4FMUA 3FUMA 1Y8MA 5BV1A 2L0IA 3S2AA 3B13A 4I1MA 1SQMA 5KJKA 5T5GA 3APFA 3C98A 3VUZA 2J4DA 3LYAA 4AVXA 4BX8A 4UWFA 5E76A 3FTWA 3ZYLA 4GPKA 4FP7A 4GAAA 2XRYA 3GYZA 4YPUA 2L6JA 2C0MA 4G26A 3LVQE 3MV3B 3LY9A 4J8DA 4KZ0A 2CHXA 2XPYA 2WQHA 3EJNA 2IFUA 5FWQA 4FC8A 3UQ3A 4AM9A 2VSXE 3G2UA 1JWGA 3CHMA 1UG3A 4UWLA 2OV8A 2XQ0A 3K9IA 4JEHA 3ESKA 3PEVB 4NRHB 4U63A 5DBKA 5EX3A 3EIQC 4DI3A 3FY4A 4UWGA 3CIAA 1NP7A 5AYWD 5A23A 4GZ3A 4I43A 4YNMA 4Q94A 4QENA 4CDNA 3TXNA 3IEGA 4EBAG 2VGYA 1LF8A 4DI4A 3LS8A 4XI0A 5FQ6A 4ACLA 3D9OA 3IKOB 4CGWA 4JDSA 3KAEA 3IHXA 2KZTA 3EHNA 2XGMA 1XQHA 2X6FA 2C0LA 3S7BA 3F9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJY A;  3OS5 A;  5EKQ D;  4O6F A;  2HYZ A;  4U0S A;  3URZ A;  5FT9 A;  1XNF A;  4MI5 A;  4JHR A;  1ZKK A;  4J8O A;  5EX0 A;  5G05 C;  3RQ4 A;  3MO2 A;  3KD7 A;  5G04 C;  4A1S A;  4LEU A;  3RO2 A;  2G46 A;  4N39 A;  5JHN A;  2VSN A;  1FCH A;  2GW1 A;  2XGO A;  2UWJ G;  1ZU2 A;  1TJC A;  3UUX A;  5F5E A;  4U04 A;  3HNA A;  4I2Z A;  3KS2 A;  4HOQ A;  1A17 A;  5CPR B;  2UY1 B;  4CGV A;  5D0O D;  3K5K A;  4GA0 A;  1B89 A;  3M5A A;  4G1T A;  3VTX A;  4KBQ A;  4LDG A;  4N5C A;  4G24 A;  3CBM A;  3CK7 A;  3F9X A;  1HH8 A;  1OUV A;  3RIB A;  2FEZ A;  1W3B A;  4YPA A;  1KT0 A;  5JJ0 A;  4AY5 A;  4GZ5 A;  3QWP A;  1ELR A;  4H12 A;  3ZGQ A;  5HI7 A;  1QQE A;  4AY6 A;  4Z4P A;  3CEQ A;  2QFC A;  3UPV A;  3RAY A;  2OOE A;  4J8E A;  2E2E A;  2XGS A;  3DB5 A;  3S8P A;  4RG9 A;  4HOS A;  3Q5M A;  3M57 A;  4JL0 A;  5LSX A;  5F6K C;  3S7J A;  5D0Q D;  4CDR A;  5FTP A;  4AIF A;  4YPE A;  2XPI A;  4Y6W A;  3CKC A;  5A6C A;  4W9R A;  2FBN A;  1N6A A;  5BW8 C;  4EQF A;  3VTY A;  2XCB A;  3KMA A;  2YHC A;  5A7D B;  5LCW C;  2PQN A;  3M55 A;  4KYO B;  2JV0 A;  2O8J A;  2KAT A;  4QEO A;  1PEG A;  2VGX A;  2IGQ A;  3ASD A;  2KCK A;  3OXF A;  3R9A B;  3WXX A;  3GW4 A;  1E96 B;  2LSV A;  4JLG A;  2Y4U A;  3QOU A;  4JA7 A;  4RZ0 A;  3LCA A;  3JYS A;  5BT1 A;  3PE3 A;  5CHE E;  3U4T A;  4I17 A;  4H7X A;  4YNP A;  4WNE A;  1PC2 A;  4YVO A;  3MKR A;  3ZPJ A;  2J9Q A;  5JJ7 A;  1O9S A;  2VSY A;  5EG2 A;  5KJL A;  3LKU A;  3AS4 A;  2Y4T A;  2YQ8 A;  3M56 A;  2BQZ A;  5T0M A;  2R5S A;  3ASF A;  2F69 A;  4QEP A;  3N71 A;  5CCL A;  3O48 A;  3RJW A;  2KCV A;  3OPE A;  3U3W A;  4I1A A;  1MT6 A;  2XEV A;  4YVQ C;  4GYW A;  4HOU A;  4N3B A;  2RFI A;  3ZN3 A;  4GCN A;  4J0U A;  1MUF A;  2AVP A;  4IN3 B;  3E4B A;  5C1D A;  1IYG A;  4I9C A;  3KMT A;  3CKB A;  4UI9 C;  3FWV A;  3BEE A;  5AYF A;  1HZ4 A;  3QWW A;  3NF1 A;  4UQX A;  4E47 A;  4J83 A;  3MV2 B;  3EP0 A;  3OOI A;  4GZ6 A;  1QZ2 A;  3CV0 A;  4UQY A;  4N2Q A;  3OXG A;  5HQ8 A;  3FFL A;  5ARF A;  4U0Z A;  4XIF A;  2VQ2 A;  3MO5 A;  5JIN A;  3VV0 A;  2FO7 A;  3S7D A;  2DBA A;  4GA2 A;  3RKV A;  1H3I A;  2JLB A;  2FI7 A;  4BUP A;  3Q47 B;  4NVQ A;  5T0K A;  4G2V A;  3M53 A;  4IJ8 A;  3F9Y A;  4GA1 A;  4NJ5 A;  3TGO A;  3AS5 A;  3PE4 A;  3Q49 B;  2QPW A;  5JJ6 A;  3Q4A B;  3M59 A;  4AU7 A;  3LY7 A;  5FZR A;  5G05 J;  4C1Q A;  5G04 J;  4ABN A;  5TEG A;  4I2W A;  3KMJ A;  3FPD A;  4BT8 A;  2I6H A;  5CCM A;  4HOR A;  2HO1 A;  5M72 A;  1WAO 1;  3CVN A;  4NQ0 A;  5F6L A;  4GYO A;  5DIZ A;  1ML9 A;  4N3A A;  3DAL A;  2KCL A;  3LPZ A;  1N6C A;  2VGX B;  2VYI A;  2R3A A;  4J7F A;  1NA3 A;  4RG6 A;  2V5F A;  1YA0 A;  3QWV A;  4WNG A;  3CK9 A;  3BO5 A;  4I51 A;  2PZI A;  3CBP A;  4KXK B;  2OND A;  4J7I A;  3LY8 A;  3EDT B;  3QKY A;  4XI9 A;  4APO A;  1MVX A;  3M54 A;  4UI9 J;  4G23 A;  4I9E A;  3ULQ A;  2NC9 A;  5KJM A;  5ARG A;  4U0U A;  1P5Q A;  4IJD A;  4GCO A;  3RJV A;  3CVL A;  3MO0 A;  3SWC A;  3MA5 A;  5KJN A;  3ASH A;  4BTB A;  3CVQ A;  2PL2 A;  3SW9 A;  1ELW A;  3OXL A;  3SZ7 A;  2UY1 A;  2IF4 A;  3GZ2 A;  5FZS A;  4ME2 A;  3ASG A;  2BUG A;  4O30 A;  3ZFW A;  4WNF A;  3HYM B;  3FP3 A;  1WM5 A;  4H7Y A;  3MEK A;  4J8F A;  4BTA A;  3CK8 A;  3TG4 A;  1MVH A;  2W5Y A;  4UI9 K;  2Q7F A;  2W5Z A;  1KT1 A;  1NA0 A;  2C2L A;  3GZ1 A;  5JJT A;  2LNI A;  2LSU A;  1KLX A;  2WPV A;  2HR2 A;  4UQZ A;  1ZBP A;  3TAX A;  1N3J A;  2XCC A;  4BT9 A;  5FZQ A;  4MI0 A;  2PQR A;  4JA9 A;  5F59 A;  4WND A;  5LCW J;  4WUY A;  3Q15 A;  3SF4 A;  4YND A;  3QDN A;  4U07 A;  2P58 C;  1IHG A;  4Y6C A;  3ZHE A;  5BNW A;  4HOT A;  4BWR A;  5LSZ A;  3CVP A;  4N3C A;  2FF4 A;  2MHK A;  4F3V A;  3ZHE B;  3PDN A;  5JIY A;  4GYY A;  4B94 A;  3CBO A;  1HXI A;  3F9W A;  5TTF A;  3RU0 A;  3AS8 A;  3TG5 A;  4G25 A;  3RO3 A;  4N2S A;  3M58 A;  5TH7 A;  3S7F A;  2KC7 A;  1NZN A;  4FMU A;  1Y8M A;  5KJK A;  5T5G A;  3VUZ A;  3LYA A;  4GPK A;  4YPU A;  3GYZ A;  2L6J A;  2C0M A;  4G26 A;  3MV3 B;  3LY9 A;  4J8D A;  2WQH A;  2IFU A;  3UQ3 A;  4AM9 A;  3K9I A;  3ESK A;  4NRH B;  5EX3 A;  5DBK A;  5AYW D;  4GZ3 A;  4YNM A;  4QEN A;  3IEG A;  2VGY A;  4XI0 A;  4CGW A;  4JDS A;  3KAE A;  3IHX A;  2XGM A;  1XQH A;  2C0L A;  3S7B A;  3F9Z A; 
#chains in the Genus database with same CATH topology
 2EQX A;  3DEO A;  3E30 A;  3ABK E;  1D9S A;  4F7A A;  3NBN B;  3BU8 A;  3L08 A;  4CZ2 D;  4U0S A;  3URZ A;  1X5B A;  2WXR A;  3LJN A;  4R7L A;  1XNF A;  2KZT B;  1FT2 A;  5G05 C;  5CRU A;  1BPO A;  2P9I G;  5G04 C;  2CFZ A;  4LEU A;  2G46 A;  4BSZ B;  4N39 A;  3FU0 A;  2GW1 A;  1MZC A;  2HM8 A;  1ZU2 A;  3UUX A;  3LXU X;  5CPR B;  3L9T A;  4U8Y D;  1KPS B;  2ION A;  4CGV A;  3HDX A;  3ML8 A;  5ENR D;  2Y3A A;  5D0O D;  1B89 A;  2AWI A;  1Q2Z A;  2JAB A;  3D9M A;  2WXK A;  4DX5 D;  4CEM A;  3UI2 A;  3CBM A;  2V0P A;  2PM6 A;  3NAW A;  4C48 B;  1W3B A;  4FA6 A;  3Q9N C;  2X6H A;  4KMO A;  1N0R A;  3QWP A;  2AW6 A;  4DLQ A;  2F0Y A;  1MYO A;  3ZEF A;  2GRP B;  2F8Y A;  2XPZ A;  4CT4 A;  3BG0 B;  1QNF A;  3TWS A;  3BG1 B;  5EN5 D;  1Z5S C;  2QFC A;  2NYJ A;  4C0M A;  5HKP A;  1OWP A;  1SA5 A;  4XEI G;  1A5E A;  4MRU A;  5T4Y A;  3S8P A;  4RG9 A;  1JCQ A;  3M57 A;  1EYH A;  4JL0 A;  3CHO A;  4Q69 A;  2R17 C;  1OY3 D;  4YPE A;  4HQD A;  2EIM E;  4Y6W A;  1YYH A;  4BET A;  2GRR B;  2ZU6 B;  4B0Z A;  5BW8 C;  3U64 A;  4GZC A;  3SY2 A;  4BEP A;  5A7D B;  2WXP A;  2PQN A;  3M55 A;  2JV0 A;  1N52 A;  2O8J A;  2E0I A;  3TJP A;  1PEG A;  4HRM B;  1S64 A;  2FO1 E;  2P9S G;  3KSQ A;  2GRO B;  2VGX A;  5JMN D;  5LFA A;  3R9A B;  2OVF A;  5JA4 D;  2ZXW E;  4ILI A;  2Y4U A;  3ONK A;  1DCE A;  3PE3 A;  5CHE E;  3JUI A;  3O4Z A;  4WNE A;  1PC2 A;  2QYJ A;  1O9S A;  5J08 A;  2VSY A;  5EG2 A;  2NXP A;  3AS4 A;  1QYM A;  3SBT B;  4BSX A;  3HXB A;  2BQZ A;  3PNL B;  4QEP A;  3UTM A;  5AAO A;  3OPE A;  2QYU A;  2A5E A;  4UWK A;  4I1A A;  1MT6 A;  2XEV A;  1K1B A;  3ZN3 A;  4GCN A;  4J0U A;  5C1D A;  2XEE A;  3G2T A;  3CKB A;  4UI9 C;  4A3V A;  4L1B A;  2IO3 C;  3ZRH A;  4EBA A;  4FJZ A;  2XRZ A;  2PM7 A;  3TWW A;  4BES A;  4J83 A;  3APC A;  3UIN C;  3EP0 A;  4I6E A;  3V79 K;  1H19 A;  3MGB A;  1KZO A;  2DCP A;  5HRY A;  4UQY A;  4U8H A;  2WXQ A;  2I9C A;  5HQ8 A;  3DPY A;  5ARF A;  3CVY A;  1VDY A;  3FH5 A;  5AQB A;  1N95 A;  1DC2 A;  4F53 A;  3PZ2 A;  1JWF A;  3L13 A;  1H3I A;  1RZ4 A;  4DLO A;  4IJ8 A;  4E85 A;  1UW4 B;  3TGO A;  4D10 C;  4JD2 G;  1IHB A;  3Q4A B;  3M59 A;  3LY7 A;  5FZR A;  3ULY A;  5LOZ A;  3NQP A;  4O1O A;  2XEN A;  5HS0 A;  5TEG A;  4BT8 A;  4CYM D;  1L5J A;  3G2S A;  4HOR A;  1FVF A;  2HO1 A;  1SZA A;  3MX3 A;  5ENO D;  3FTV A;  2XEH A;  5DIZ A;  1ML9 A;  5BXO A;  4UUC A;  1N6C A;  1D8E A;  3T9K A;  2RFM A;  4I51 A;  4RVB A;  1HG2 A;  3IHV A;  4HBD A;  4XI9 A;  3L17 A;  1U3D A;  2B6C A;  4ANU A;  4U0U A;  4IJD A;  4GCO A;  2LXL A;  1FPP A;  3MA5 A;  2M63 A;  3EUV A;  1WDY A;  3CQC B;  4JEU A;  4HLL A;  1ELW A;  1G3N B;  2BUG A;  1D8D A;  2IOL A;  2DZN A;  4DX7 D;  4N5Q A;  1O1S A;  2WXL A;  3FP3 A;  3CVV A;  4H7Y A;  3QC1 A;  4AOF A;  4J8F A;  2CHZ A;  2P2C P;  2W5Z A;  4I6G A;  5JJT A;  3GZ1 A;  3L16 A;  1KLX A;  2HR2 A;  4UQZ A;  4L7T A;  1N3J A;  2XCC A;  4BT9 A;  3FH7 A;  5D2M C;  1EF1 C;  4JA9 A;  3EHQ A;  1JUQ A;  2I1J A;  3FHE A;  3ZUV B;  4U07 A;  5B3S E;  5KNH D;  3TWX A;  1FT1 A;  4BWR A;  4HOT A;  4LRZ A;  4EHM A;  2FF4 A;  4NAC A;  2LAH A;  2MHK A;  3PDN A;  4EEC A;  4GYY A;  2BF0 X;  3NZU A;  4ILH B;  1HXI A;  3F9W A;  3ZXP A;  4G8K A;  4FLH A;  3RO3 A;  1TEZ A;  3M58 A;  1N94 A;  2KC7 A;  4FMU A;  2ZGG A;  2L0I A;  1SQM A;  3ZNG A;  3DEP A;  4UWF A;  5E76 A;  4YPU A;  3E34 A;  2F37 A;  4G26 A;  2XPY A;  2IFU A;  3UQ3 A;  4FC8 A;  1JWG A;  1UG3 A;  2XQ0 A;  5CEA A;  5EX3 A;  4DI3 A;  5A23 A;  2XS8 A;  2V5Q C;  4TXQ A;  4Q94 A;  4YNM A;  4GTS A;  4QEN A;  3TXN A;  1UOH A;  3LS8 A;  3IKO B;  3KAE A;  3IHX A;  2XGM A;  1XQH A;  3Q75 A;  2X6F A;  3QAQ A;  2YNQ A;  3OS5 A;  2WMO A;  4L2Y A;  5FT9 A;  5EX0 A;  3DST A;  4WWP A;  4FHJ A;  4A1S A;  4FJY A;  4ANW A;  1SZ9 A;  5JHN A;  2AXV A;  2VSN A;  3SI5 A;  1FCH A;  2J07 A;  3I5P A;  3TWT A;  2AJA A;  3UX4 A;  1TJC A;  3BQO A;  4ANX A;  2UY1 B;  5EDS A;  3W9G A;  1TNB A;  4DRX E;  2RG8 A;  3VTX A;  4LNU D;  4LDG A;  5ITZ F;  3DRA A;  5FQ8 A;  5CMY A;  2YIN A;  3TWR A;  2X6I A;  1HH8 A;  2WVI A;  1Z6T A;  3FU6 A;  2WXI A;  3GZS A;  3RRU A;  4PH4 B;  3MCX A;  4PS8 A;  2Y69 E;  5FIN A;  1N4Q A;  3Q7A A;  4FLB A;  4J8E A;  4JHK A;  3D9K A;  4YDE A;  4C9B B;  3DB5 A;  4CT0 A;  3Q5M A;  3ASN E;  5LSX A;  5F6K C;  4OAU C;  4CDR A;  3PZD A;  1S0P A;  2XPI A;  1TNU A;  5A6C A;  4AEZ C;  3D9I A;  4EQF A;  4FHK A;  3UT8 A;  2LAI A;  3FUN A;  5LCW C;  4JW1 A;  2B0O E;  5LP0 A;  2IGQ A;  3ASD A;  3FH8 A;  3FUL A;  2R03 A;  1HF8 A;  2A5U A;  3QOU A;  3AJI A;  3JYS A;  3ML9 A;  3G2V A;  2BTD A;  4EZK A;  4H7X A;  3EHM A;  2Y1L E;  3MKR A;  3NOC D;  3LVR E;  3PUJ A;  3VLF A;  2Y4T A;  4JPS A;  1LD8 A;  5CBN A;  1EDU A;  4HB5 A;  3B7U X;  2R5S A;  3UMV A;  2GRN B;  5ENS D;  3N71 A;  4YDW A;  5ENQ D;  3RJW A;  1BD8 A;  2KCV A;  4ZHB A;  4U96 D;  3U3W A;  1H0A A;  1MX2 A;  1BI7 B;  4U95 D;  4BER A;  3Q7F A;  4DJA A;  4EPZ A;  3MJW A;  3PRZ A;  4N3B A;  5ANR A;  5JHA A;  2WMN A;  1MUF A;  4IN3 B;  4Z68 A;  4JHJ A;  3RRN B;  3KMT A;  1OWM A;  2L6B A;  3RRM B;  5FIO A;  3U9W A;  5H7P A;  1HZ4 A;  3UIP C;  4J6I A;  3NF1 A;  2L0T B;  4YDO A;  5B1B E;  2J49 A;  2KXP C;  1S63 A;  2P9U G;  3B7R L;  3JUE A;  1UJK A;  4GZ6 A;  3ULE G;  3B95 A;  4TV3 A;  2ZIR A;  2WXF A;  1MX6 A;  3FFL A;  3CHR A;  2QZA A;  4XIF A;  3J5Q B;  5JIN A;  3R9M A;  2RFA A;  3W9F A;  1H6K A;  1NFI E;  2OCC E;  2DBA A;  4TXR A;  3Q47 B;  3UM2 A;  4GMR A;  3M53 A;  4NIK A;  2J4B A;  3F9Y A;  4GTV A;  3D9H A;  4GA1 A;  3AS5 A;  1DNP A;  5JJ6 A;  2R02 A;  3B7T A;  3DWL G;  2XHE A;  4ABN A;  3Q9U C;  3ASO E;  3L22 A;  3FTY A;  3ZVV A;  4E6H A;  2OEV A;  3CVN A;  3D9N A;  4HFG A;  4GYO A;  2H6G A;  4N3A A;  3TXM A;  3KSL A;  4JZY A;  3LPZ A;  3DSW A;  5CBO A;  1NA3 A;  1YA0 A;  3PH0 C;  3CK9 A;  4G11 A;  1TN7 A;  5ANL A;  1OCZ E;  2OND A;  4GTR A;  1LD7 A;  3FUH A;  5KWD A;  4HXI A;  2J8S D;  1MVX A;  3M54 A;  4UI9 J;  3HVE A;  2R59 A;  5EIL A;  4G23 A;  4CDM A;  3QK0 A;  4I9E A;  3ULQ A;  3CVU A;  2NC9 A;  5KJM A;  4WWN A;  3DSV A;  3I4R B;  3AG2 E;  3CVL A;  3E37 A;  4PDX A;  3MO0 A;  3SWC A;  1BI8 B;  4G8L A;  2ETC A;  1HFA A;  5KJN A;  4BTB A;  2PL2 A;  4A1G A;  4TUU A;  2UY1 A;  2IF4 A;  2MYO A;  4ME2 A;  4O30 A;  2GRQ B;  3HYM B;  2WXO A;  1WM5 A;  4ANV A;  4KVO A;  4DX2 A;  3MKQ A;  1MVH A;  2W5Y A;  2Q7F A;  2WXN A;  4KZC A;  2LNI A;  2V4L A;  4A55 A;  5AJD A;  4HRN A;  4DK5 A;  1DCQ A;  4MI0 A;  2GRM A;  2A4Z A;  4K5C A;  3CHP A;  2YHE A;  3KEZ A;  2X6J A;  5J90 A;  2ETB A;  2RKK A;  3F6Q A;  4YND A;  3SF4 A;  3QDN A;  2P58 C;  3MYV A;  3ZHE A;  5BNW A;  4DUI A;  3ESL A;  1GW6 A;  2WQ6 A;  4N3C A;  1MX4 A;  3SHF A;  3FTX A;  1N11 A;  1OWN A;  3I3N A;  3CBO A;  4XKB A;  1IXV A;  5TTF A;  3RU0 A;  3AS8 A;  4G25 A;  3FUD A;  4N2S A;  5TH7 A;  4RQI A;  3CHQ A;  1OT8 A;  1NZN A;  5BV1 A;  3JXI A;  3S2A A;  3APF A;  4L9P A;  3ZYL A;  4FP7 A;  2L6J A;  2C0M A;  3MV3 B;  4YDY A;  2WQH A;  5FWQ A;  3G2U A;  3CHM A;  4JEH A;  3UKU G;  3PEV B;  1K8K G;  4NRH B;  3FY4 A;  1NP7 A;  5AYW D;  2XS1 A;  2OEW A;  4CDN A;  3IEG A;  4EBA G;  4DI4 A;  5EYP F;  5IY5 E;  5FQ6 A;  4CGW A;  4ACL A;  3D9O A;  2KZT A;  3KEA A;  3S7B A;  3F9Z A;  3ZW3 A;  2GRL A;  1O1T A;  4ATG A;  1ZKK A;  4J8O A;  1EPU A;  4LG6 A;  5KCM A;  2X3M A;  3CST A;  3RQ4 A;  2WB2 A;  1E8Z A;  3KD7 A;  3DXM G;  4DX6 D;  2EIN E;  1H6P A;  1OCC E;  1JCR A;  2OVB A;  2UWJ G;  4LCT A;  5F5E A;  4PS7 A;  3FDH A;  1U2V G;  4I2Z A;  3KS2 A;  4HOQ A;  3UKR G;  3UT7 A;  1JPL A;  2DVW A;  4XE0 A;  4LNG A;  5AAR A;  3M5A A;  2CFU A;  4G24 A;  3F9X A;  1IKN D;  2FEZ A;  3QB2 A;  4YPA A;  3FU5 A;  5JJ0 A;  2IQC A;  2BKG A;  3VLE A;  2EIK E;  4AY5 A;  4H12 A;  1LTX A;  4I6J A;  5HI7 A;  3ENE A;  5AIJ A;  1E7U A;  5AN8 A;  4AJW A;  3CEQ A;  3UPV A;  1TN6 A;  3CSF A;  2QY7 A;  3RAY A;  1IQU A;  1ZB1 A;  2OOE A;  3UM1 A;  3CHS A;  3HXF A;  1H2U A;  2E2E A;  2XGS A;  3ABL E;  3V2X A;  4PS3 A;  5AQ9 A;  3E33 A;  3S7J A;  4AIF A;  4BY6 A;  3ZKJ A;  3HXE A;  3TWQ A;  1MQS A;  4TXP A;  4K0R A;  2LUH A;  4OYS A;  2FBN A;  1N6A A;  2VGE A;  5ENT D;  4HS2 A;  2XCB A;  2HE0 A;  1N54 A;  1OWL A;  3KMA A;  3FUI A;  4KYO B;  4LUN U;  2KAT A;  2ILR A;  4HRL A;  2J08 A;  1E8W A;  2GGF A;  3WXX A;  3GW4 A;  4CCA A;  2AXZ A;  2WXH A;  3I4G A;  3ZU7 B;  3IHY A;  3L54 A;  3AAA C;  3ZPJ A;  1H2T C;  1MJ0 A;  4WAF A;  2FUL A;  5KJL A;  3LKU A;  4GTP A;  2YQ8 A;  3M56 A;  4M3O A;  3ASF A;  2F69 A;  3JCK C;  3NZS A;  1H2V C;  3ZXS A;  3OTN A;  3FTZ A;  5T8I A;  4BFR A;  4QFV A;  3PRE A;  4AP2 A;  3L82 A;  3U66 A;  4GYW A;  4HOU A;  2DYR E;  1UN8 A;  3FTU A;  3EHR A;  1INZ A;  1IQR A;  2AVP A;  3AG4 E;  3BUA A;  3RSE G;  4B89 A;  1IYG A;  4I9C A;  3SFX A;  3FWV A;  3X2Q E;  4HVB A;  5BPP A;  5KNG A;  2BKK B;  4UQX A;  3MV2 B;  4URK A;  2RD0 A;  3FUJ A;  4GB9 A;  2X38 A;  3EIJ A;  3OOI A;  1QZ2 A;  3CV0 A;  4N2Q A;  3OXG A;  5EIB E;  4HLE A;  4J8Y A;  2VQ2 A;  3MO5 A;  3HXC A;  3VV0 A;  3HRA A;  3SFZ A;  4EZL A;  4F6R D;  1XGW A;  3PNT B;  3S7D A;  3LDZ A;  4IYP A;  3EU5 A;  2JLB A;  4BUP A;  4NVQ A;  3ZYM A;  4G2V A;  3AU4 A;  4Q96 A;  2QPW A;  3PE4 A;  3Q49 B;  5CER B;  2EIL E;  3PZ1 A;  4A3T A;  3CLJ A;  3FU3 A;  5G05 J;  4U8V D;  5G04 J;  1OWO A;  3KMJ A;  4TUM A;  1WG0 A;  2I6H A;  4GMJ A;  4IUL A;  5M72 A;  1TJF A;  1WAO 1;  2WXM A;  5F6L A;  3NB2 A;  3DAL A;  2KCL A;  2VYI A;  2R3A A;  1HS6 A;  4FAD A;  2V5F A;  3UIO C;  4K03 A;  3QWV A;  4L2L A;  3EDT B;  3SQV A;  3QKY A;  4J8S A;  4APO A;  3RAU A;  1SVX A;  2WQ7 A;  3Q73 A;  3DPD A;  4GTO A;  1K3Z D;  5ARG A;  1N4S A;  2CG3 A;  4EZJ A;  3P1U A;  2QC9 A;  2P9N G;  3ASH A;  3VLD A;  4JXT A;  3L6A A;  3SZ7 A;  5FZS A;  2ETA A;  2IU1 A;  3ASG A;  2AXU A;  3ZFW A;  4WNF A;  3MEK A;  2WM9 A;  4BTA A;  2NSZ A;  1UJJ A;  2JEK A;  4WWO A;  3JQ1 A;  1KT1 A;  3IV0 A;  5CMW A;  2WPV A;  2V4H C;  4HNA D;  3V31 A;  5AQA A;  1ELK A;  1OCR E;  2PQR A;  1V55 E;  5D66 A;  1N0Q A;  3ZIM A;  1O1R A;  3R7Q A;  2EIJ E;  4WND A;  3C3O A;  3PUK A;  3Q15 A;  3PEU B;  2IO2 C;  3D9J A;  1NI1 A;  4Y6C A;  4V3I A;  2WXJ A;  5LSZ A;  3CVP A;  3FTS A;  2ZGD A;  3RK6 A;  4F3V A;  4JC8 A;  3DXK G;  5JIY A;  4B94 A;  4B93 B;  3ISM C;  4QQI A;  1WY6 A;  2IOS A;  2LO6 A;  3Q78 A;  3TG5 A;  4RSY A;  3S7F A;  3FUK A;  3FUM A;  2DWZ A;  4I1M A;  5KJK A;  5T5G A;  2J4D A;  2P9K G;  4BX8 A;  3FTW A;  4GPM A;  4GPK A;  4GAA A;  3LY9 A;  1K1A A;  3EJN A;  3T5V A;  2OV8 A;  5B1A E;  3ESK A;  4U63 A;  5DBK A;  3EIQ C;  4UWG A;  3C72 A;  4I43 A;  3Q79 A;  1AWC B;  3EHN A;  5FJY A;  2VTB B;  5EKQ D;  4OVU A;  4O6F A;  2HYZ A;  2BED A;  5ENP D;  3T5X A;  4MI5 A;  4JHR A;  4GML A;  4HI9 A;  3UT4 A;  3LJ3 A;  3MO2 A;  4DX1 A;  3DSS A;  3RO2 A;  1HO8 A;  2DZO A;  5BV0 A;  3HXD A;  2XGO A;  2CHW A;  5AEN A;  4U04 A;  3SBS A;  3V30 A;  3D9P A;  3HNA A;  2H6I A;  3UM3 A;  1A17 A;  2I2O A;  2MOW A;  2V8S E;  3CVX A;  2KM4 A;  3K5K A;  4GA0 A;  4XZ4 A;  3ABM E;  5ENN A;  4G1T A;  3HIZ A;  4KBQ A;  1TNY A;  1UN9 A;  4N5C A;  1S70 B;  3CK7 A;  1Y6I A;  3G2W A;  3HG0 D;  1OUV A;  4P29 A;  3RIB A;  3V2O A;  1KT0 A;  1SA4 A;  4KVM A;  1TNO A;  4GZ5 A;  1ELR A;  3ZGQ A;  4CRW A;  1QQE A;  3PZ3 A;  4GTT A;  4JVS A;  1PAQ A;  4DPR A;  4AY6 A;  4Z4P A;  1QBQ A;  4B8A A;  1FVH A;  5CRV A;  3DSU A;  3IXE A;  1SW6 A;  3CGH A;  4HOS A;  3SO8 A;  2MRI A;  1X81 A;  1YMP A;  5D0Q D;  4AXH A;  5FTP A;  1NL4 A;  1HG5 A;  3JQ0 A;  1KZP A;  2LXM A;  4MS6 A;  3CKC A;  4K5B A;  4W9R A;  5BXU A;  1Z3X A;  3VTY A;  2YHC A;  1OCO E;  4GU5 A;  1OXJ A;  2X6K A;  4A63 B;  4QEO A;  2I1K A;  3AG3 E;  3SNX A;  3MZL B;  3SD5 A;  4JB8 P;  2KCK A;  5JHB A;  3OXF A;  2KBX A;  3SFY A;  3P2B A;  3LEW A;  3OAW A;  1AP7 A;  1E96 B;  1U3C A;  2LSV A;  4GZD A;  2F8X K;  4JLG A;  4JA7 A;  4RZ0 A;  3LCA A;  4B8C B;  5FQ7 A;  5BT1 A;  4XKC A;  4F1P A;  4OAV B;  3U4T A;  4I17 A;  4RLY A;  4YNP A;  4YVO A;  3FUE A;  4X8Q A;  3AG1 E;  2J9Q A;  5JJ7 A;  3NOG D;  4ILG A;  4BX9 A;  3FEX A;  3QJZ A;  5G55 A;  5T0M A;  2DIW A;  4LSZ E;  5CED B;  1YCS B;  5CCL A;  4TRQ A;  2IEJ A;  3O48 A;  3T8M A;  3QNK A;  2R05 A;  3PZ4 A;  4APF A;  2CG2 A;  4YVQ C;  4KT6 B;  1E7V A;  4M7C A;  4F1S A;  2RFI A;  5FQ4 A;  1E8Y A;  4O1P A;  3E4B A;  1O5M A;  3CQG B;  4C0E A;  4L23 A;  3IBE A;  3BEE A;  5AYF A;  2H6H A;  4K5A B;  3QWW A;  4AV7 A;  4LNB A;  2L9B A;  4E47 A;  2WXG A;  4GTM A;  3D3M A;  1BLX B;  1Z3Y A;  4OVV A;  3WG7 E;  2VSO E;  4U0Z A;  1HX8 A;  4MLP A;  3FUF A;  5CEC B;  2FO7 A;  3UM0 A;  1V54 E;  4GA2 A;  3DSX A;  3TL5 A;  3RKV A;  1N9A A;  3ZYK A;  2FI7 A;  1TNZ A;  3R7R A;  5T0K A;  4ACK A;  3TWV A;  4NJ5 A;  2H6F A;  1BU9 A;  4U7E B;  2P9P G;  1N4P A;  4AU7 A;  3DBS A;  1RW2 A;  4C1Q A;  1HE8 A;  5EYL A;  4I2W A;  5G2N A;  3C5R A;  5CCM A;  3CVW A;  4NQ0 A;  4IRU A;  1MHQ A;  4PUC A;  2VGX B;  3FEY A;  4J7F A;  3B7S A;  4RG6 A;  3QAR A;  1TR4 A;  3APD A;  3BO5 A;  4WNG A;  4MKT A;  2VTB A;  3E32 A;  1PY1 A;  1HU3 A;  2PZI A;  3CBP A;  4KXK B;  2PNN A;  4J7I A;  3LY8 A;  2IJG X;  4FU3 A;  3ONL A;  1P5Q A;  3RJV A;  3HVE B;  4NUR A;  4O60 A;  3CVQ A;  2IY0 C;  3D9L A;  1N4R A;  1E90 A;  5BUZ A;  3SW9 A;  1JCS A;  2XZT G;  3OXL A;  3GZ2 A;  3B7B A;  5AQ7 A;  5T3R A;  3CK8 A;  3TG4 A;  4J7W A;  4UI9 K;  1NA0 A;  2C2L A;  2LSU A;  4I1O B;  1H6O A;  3SGH A;  3MKQ B;  3T8K A;  1ZBP A;  3TAX A;  4XX5 A;  2Y0B G;  5FZQ A;  5EID A;  3TWU A;  2R2L A;  4LER A;  5E75 A;  3JXJ A;  3PS6 A;  5F59 A;  5LCW J;  4WUY A;  2J09 A;  2VJ8 A;  1TN8 A;  3CR3 A;  1IHG A;  4GTQ A;  4ZFH A;  4FUL A;  3C3R A;  3ZHE B;  2ZIS A;  3ZYQ A;  3C3Q A;  2P9L G;  4MBG A;  5AJL A;  1DVP A;  3HHM A;  5KBA A;  3EU9 A;  3PVL A;  1E8X A;  4UWH A;  5C2Y A;  3AU5 A;  4ATZ D;  4HI8 A;  2DYS E;  5LX8 A;  1Y8M A;  2XZD G;  3B13 A;  3C98 A;  3VUZ A;  3LYA A;  4AVX A;  2XRY A;  3GYZ A;  3LVQ E;  4KZ0 A;  4J8D A;  3J5P A;  2CHX A;  1TYQ G;  4AM9 A;  2VSX E;  4UWL A;  3K9I A;  3UXG A;  3CIA A;  4GZ3 A;  2VGY A;  1LF8 A;  4XI0 A;  4JDS A;  3FPD A;  2C0L A; 
#chains in the Genus database with same CATH homology
 3QAQ A;  2EQX A;  2YNQ A;  5FJY A;  3ZW3 A;  3OS5 A;  2VTB B;  4F7A A;  2GRL A;  5EKQ D;  4OVU A;  3L08 A;  2WMO A;  4O6F A;  2HYZ A;  4L2Y A;  4U0S A;  3URZ A;  1X5B A;  2WXR A;  3T5X A;  4ATG A;  5FT9 A;  4R7L A;  1XNF A;  4MI5 A;  2KZT B;  4JHR A;  1ZKK A;  4J8O A;  1EPU A;  5EX0 A;  4GML A;  3UT4 A;  5KCM A;  2X3M A;  5G05 C;  3CST A;  1BPO A;  3RQ4 A;  3LJ3 A;  2WB2 A;  3MO2 A;  1E8Z A;  4WWP A;  3KD7 A;  4FHJ A;  5G04 C;  2CFZ A;  4A1S A;  4LEU A;  3RO2 A;  2G46 A;  4FJY A;  1HO8 A;  1SZ9 A;  4ANW A;  4N39 A;  2AXV A;  3FU0 A;  2VSN A;  3SI5 A;  1FCH A;  2GW1 A;  2J07 A;  3I5P A;  5BV0 A;  2OVB A;  2XGO A;  2HM8 A;  2CHW A;  2UWJ G;  1ZU2 A;  4LCT A;  1TJC A;  3UX4 A;  3UUX A;  4U04 A;  4PS7 A;  5AEN A;  3SBS A;  3FDH A;  3D9P A;  3HNA A;  4I2Z A;  3KS2 A;  4HOQ A;  1A17 A;  2I2O A;  3UT7 A;  3LXU X;  4ANX A;  5CPR B;  2MOW A;  2UY1 B;  2ION A;  2V8S E;  4CGV A;  1JPL A;  3CVX A;  3HDX A;  3ML8 A;  2KM4 A;  4XE0 A;  2Y3A A;  5D0O D;  3K5K A;  4GA0 A;  4XZ4 A;  5EDS A;  1B89 A;  2AWI A;  5ENN A;  3M5A A;  4G1T A;  2RG8 A;  3VTX A;  3HIZ A;  4KBQ A;  3D9M A;  2CFU A;  2WXK A;  4LDG A;  1UN9 A;  4N5C A;  4CEM A;  5FQ8 A;  5CMY A;  4G24 A;  2YIN A;  3CBM A;  2X6I A;  3CK7 A;  3F9X A;  1Y6I A;  2V0P A;  1HH8 A;  3G2W A;  1OUV A;  2PM6 A;  4P29 A;  3RIB A;  2FEZ A;  3QB2 A;  1W3B A;  2WVI A;  1KT0 A;  4FA6 A;  4YPA A;  3FU5 A;  5JJ0 A;  2X6H A;  2IQC A;  1Z6T A;  4KMO A;  4KVM A;  4AY5 A;  3VLE A;  4GZ5 A;  3QWP A;  2AW6 A;  4DLQ A;  3FU6 A;  2WXI A;  3GZS A;  1ELR A;  4H12 A;  3ZGQ A;  3ZEF A;  4CRW A;  4I6J A;  2XPZ A;  4CT4 A;  3BG0 B;  5HI7 A;  1QNF A;  1QQE A;  3ENE A;  3RRU A;  5AIJ A;  1E7U A;  4PH4 B;  3MCX A;  4JVS A;  1PAQ A;  4DPR A;  4AY6 A;  3BG1 B;  4Z4P A;  4AJW A;  3CEQ A;  4PS8 A;  2QFC A;  4C0M A;  3UPV A;  3CSF A;  2QY7 A;  3RAY A;  1IQU A;  2OOE A;  4B8A A;  1OWP A;  1FVH A;  4FLB A;  3CHS A;  4J8E A;  4JHK A;  3D9K A;  4MRU A;  1H2U A;  2E2E A;  2XGS A;  5T4Y A;  4C9B B;  3CGH A;  3DB5 A;  3S8P A;  4PS3 A;  4RG9 A;  4CT0 A;  4HOS A;  3Q5M A;  3M57 A;  1EYH A;  4JL0 A;  3CHO A;  5LSX A;  4Q69 A;  3S7J A;  5F6K C;  2MRI A;  2R17 C;  5D0Q D;  4CDR A;  4AXH A;  5FTP A;  4AIF A;  1HG5 A;  3PZD A;  4BY6 A;  1S0P A;  4YPE A;  3JQ0 A;  2XPI A;  1MQS A;  4Y6W A;  4MS6 A;  3CKC A;  4K0R A;  5A6C A;  4AEZ C;  4OYS A;  2ZU6 B;  4W9R A;  2FBN A;  4B0Z A;  3D9I A;  1N6A A;  5BW8 C;  3U64 A;  4GZC A;  5F5E A;  4EQF A;  1Z3X A;  4HS2 A;  3VTY A;  4FHK A;  2XCB A;  3KMA A;  1N54 A;  1OWL A;  2LAI A;  2YHC A;  3FUN A;  2WXP A;  5A7D B;  3UT8 A;  3FUI A;  5LCW C;  2PQN A;  3M55 A;  4GU5 A;  4KYO B;  2JV0 A;  4JW1 A;  1N52 A;  2X6K A;  2O8J A;  2E0I A;  4LUN U;  2KAT A;  4QEO A;  2I1K A;  2ILR A;  3SNX A;  3TJP A;  3MZL B;  1PEG A;  5LP0 A;  3SD5 A;  2VGX A;  2IGQ A;  3ASD A;  2KCK A;  2J08 A;  5LFA A;  3FH8 A;  1E8W A;  3FUL A;  5JHB A;  3OXF A;  2GGF A;  3R9A B;  3WXX A;  1HF8 A;  3P2B A;  3LEW A;  3GW4 A;  2OVF A;  4CCA A;  3OAW A;  1E96 B;  1U3C A;  2LSV A;  4GZD A;  2A5U A;  4ILI A;  4JLG A;  2Y4U A;  2AXZ A;  3QOU A;  3ONK A;  4JA7 A;  4RZ0 A;  2WXH A;  3LCA A;  3I4G A;  3JYS A;  4B8C B;  5FQ7 A;  3ML9 A;  3G2V A;  3PE3 A;  4XKC A;  5BT1 A;  2BTD A;  3IHY A;  5CHE E;  3JUI A;  3O4Z A;  3L54 A;  4EZK A;  3U4T A;  4I17 A;  4H7X A;  3EHM A;  3T5V A;  4WNE A;  4YNP A;  1PC2 A;  4YVO A;  3FUE A;  3MKR A;  3ZPJ A;  3LVR E;  1H2T C;  2J9Q A;  4WAF A;  5JJ7 A;  1O9S A;  2FUL A;  3PUJ A;  2VSY A;  5J08 A;  5EG2 A;  5KJL A;  4ILG A;  3LKU A;  2NXP A;  3AS4 A;  3VLF A;  4BX9 A;  3FEX A;  3SBT B;  3QJZ A;  2Y4T A;  2YQ8 A;  4JPS A;  3M56 A;  4BSX A;  5G55 A;  1EDU A;  2BQZ A;  3B7U X;  2R5S A;  4M3O A;  2DIW A;  3ASF A;  3UMV A;  5T0M A;  3PNL B;  2F69 A;  4QEP A;  3JCK C;  3NZS A;  3N71 A;  1H2V C;  3ZXS A;  5CCL A;  4TRQ A;  3O48 A;  3OTN A;  3RJW A;  3T8M A;  3FTZ A;  5T8I A;  2KCV A;  3QNK A;  3OPE A;  3U3W A;  4BFR A;  4QFV A;  1H0A A;  2CG2 A;  4I1A A;  4UWK A;  4APF A;  1MT6 A;  2XEV A;  4YVQ C;  3PRE A;  4AP2 A;  3U66 A;  4KT6 B;  4DJA A;  4GYW A;  4HOU A;  4EPZ A;  3MJW A;  1E7V A;  3PRZ A;  4N3B A;  5ANR A;  4F1S A;  5JHA A;  1UN8 A;  3FTU A;  3ZN3 A;  2RFI A;  5FQ4 A;  4GCN A;  1INZ A;  1E8Y A;  2WMN A;  4J0U A;  1MUF A;  1IQR A;  2AVP A;  4IN3 B;  3E4B A;  4B89 A;  5C1D A;  4C0E A;  3CQG B;  4I9C A;  4JHJ A;  4L23 A;  3RRN B;  1IYG A;  3KMT A;  3G2T A;  3IBE A;  3CKB A;  1OWM A;  4UI9 C;  3FWV A;  3RRM B;  4A3V A;  3BEE A;  5AYF A;  4L1B A;  4HVB A;  3U9W A;  1HZ4 A;  3ZRH A;  4EBA A;  5BPP A;  4J6I A;  3QWW A;  4AV7 A;  3NF1 A;  4FJZ A;  2XRZ A;  2L0T B;  4UQX A;  2J49 A;  2PM7 A;  2L9B A;  4E47 A;  4J83 A;  3MV2 B;  3APC A;  2WXG A;  3EP0 A;  4I6E A;  1H19 A;  3MGB A;  3B7R L;  3D3M A;  4URK A;  2RD0 A;  3FUJ A;  4GB9 A;  1Z3Y A;  1UJK A;  2X38 A;  3EIJ A;  4GZ6 A;  3OOI A;  4OVV A;  1QZ2 A;  2DCP A;  4TV3 A;  3CV0 A;  4UQY A;  4N2Q A;  4U8H A;  2WXQ A;  3OXG A;  2WXF A;  2I9C A;  2VSO E;  4HLE A;  5HQ8 A;  3FFL A;  5ARF A;  3CHR A;  4U0Z A;  1HX8 A;  3CVY A;  1VDY A;  4XIF A;  3FH5 A;  2VQ2 A;  4MLP A;  3MO5 A;  5JIN A;  3FUF A;  3VV0 A;  2FO7 A;  5JHN A;  3SFZ A;  1H6K A;  4EZL A;  4F53 A;  1XGW A;  3PNT B;  3S7D A;  2DBA A;  3LDZ A;  4GA2 A;  1JWF A;  4IYP A;  3TL5 A;  3RKV A;  3L13 A;  3ZYK A;  1H3I A;  2JLB A;  2FI7 A;  4DLO A;  3Q47 B;  4NVQ A;  4BUP A;  3R7R A;  3ZYM A;  5T0K A;  4G2V A;  3M53 A;  3AU4 A;  4IJ8 A;  2J4B A;  4Q96 A;  4ACK A;  4E85 A;  3F9Y A;  1UW4 B;  4GA1 A;  4NJ5 A;  3TGO A;  4D10 C;  3AS5 A;  3PE4 A;  3Q49 B;  2QPW A;  1DNP A;  4A3T A;  3CLJ A;  5JJ6 A;  3Q4A B;  3M59 A;  3FU3 A;  4AU7 A;  3DBS A;  3LY7 A;  5FZR A;  5G05 J;  3B7T A;  5LOZ A;  2XHE A;  4C1Q A;  3NQP A;  5G04 J;  4ABN A;  1HE8 A;  1OWO A;  5TEG A;  4I2W A;  3KMJ A;  5G2N A;  3FPD A;  3L22 A;  4BT8 A;  2I6H A;  1L5J A;  3G2S A;  3FTY A;  4GMJ A;  4IUL A;  3ZVV A;  1FVF A;  4E6H A;  2HO1 A;  1SZA A;  3MX3 A;  3CVW A;  4HOR A;  5M72 A;  1TJF A;  1WAO 1;  3CVN A;  4NQ0 A;  4IRU A;  3D9N A;  2WXM A;  5F6L A;  4HFG A;  4GYO A;  1MHQ A;  3FTV A;  5DIZ A;  1ML9 A;  4N3A A;  4PUC A;  3TXM A;  3DAL A;  4JZY A;  2KCL A;  3LPZ A;  1N6C A;  2VGX B;  2VYI A;  3FEY A;  2R3A A;  4J7F A;  1HS6 A;  3B7S A;  1NA3 A;  4RG6 A;  3QAR A;  2V5F A;  4FAD A;  4K03 A;  1YA0 A;  3PH0 C;  3APD A;  3QWV A;  4WNG A;  3CK9 A;  3BO5 A;  4I51 A;  4L2L A;  4G11 A;  4MKT A;  2VTB A;  4RVB A;  5ANL A;  1PY1 A;  1HG2 A;  1HU3 A;  2PZI A;  3IHV A;  3CBP A;  4KXK B;  2OND A;  4J7I A;  3LY8 A;  3EDT B;  3FUH A;  3QKY A;  4J8S A;  4XI9 A;  4HXI A;  4APO A;  1MVX A;  3M54 A;  2IJG X;  4UI9 J;  3HVE A;  2R59 A;  4FU3 A;  4G23 A;  4CDM A;  2WQ7 A;  3QK0 A;  3DPD A;  4I9E A;  3ULQ A;  3CVU A;  2NC9 A;  3L17 A;  5KJM A;  1U3D A;  3ONL A;  5ARG A;  4ANU A;  4U0U A;  2CG3 A;  1P5Q A;  4WWN A;  3I4R B;  4IJD A;  4GCO A;  3RJV A;  3CVL A;  4EZJ A;  3HVE B;  3P1U A;  4PDX A;  3MO0 A;  4NUR A;  3SWC A;  3MA5 A;  1HFA A;  2M63 A;  5KJN A;  3ASH A;  4BTB A;  3CVQ A;  2PL2 A;  3CQC B;  3D9L A;  4JEU A;  4A1G A;  1E90 A;  4TUU A;  3VLD A;  5BUZ A;  3SW9 A;  4JXT A;  3L6A A;  1ELW A;  3OXL A;  3SZ7 A;  2UY1 A;  2IF4 A;  3GZ2 A;  5FZS A;  2IU1 A;  4ME2 A;  3ASG A;  2BUG A;  2AXU A;  4O30 A;  2IOL A;  3ZFW A;  4WNF A;  3HYM B;  2WXL A;  3FP3 A;  2WXO A;  3CVV A;  1WM5 A;  4H7Y A;  3QC1 A;  4KVO A;  4AOF A;  3MEK A;  2WM9 A;  2CHZ A;  4J8F A;  5T3R A;  3CK8 A;  2NSZ A;  4BTA A;  3MKQ A;  3TG4 A;  1MVH A;  1UJJ A;  2W5Y A;  2JEK A;  4WWO A;  4UI9 K;  2Q7F A;  3JQ1 A;  5CCM A;  2W5Z A;  2WXN A;  1KT1 A;  1NA0 A;  4I6G A;  2C2L A;  3GZ1 A;  3L16 A;  4KZC A;  5JJT A;  2LNI A;  2V4L A;  2LSU A;  3IV0 A;  1KLX A;  4I1O B;  4A55 A;  5CMW A;  5AJD A;  2WPV A;  2HR2 A;  3SGH A;  4DK5 A;  3MKQ B;  4UQZ A;  1ZBP A;  3TAX A;  4L7T A;  4XX5 A;  1N3J A;  2XCC A;  4BT9 A;  5FZQ A;  3FH7 A;  1ELK A;  4MI0 A;  2PQR A;  2GRM A;  2A4Z A;  4LER A;  5E75 A;  3PS6 A;  3ZIM A;  3CHP A;  1EF1 C;  2YHE A;  3KEZ A;  3R7Q A;  4JA9 A;  5F59 A;  2X6J A;  4WND A;  5LCW J;  1JUQ A;  4WUY A;  5J90 A;  2I1J A;  3PUK A;  3FHE A;  3Q15 A;  2J09 A;  3PEU B;  4YND A;  2VJ8 A;  3SF4 A;  3QDN A;  4U07 A;  2P58 C;  3MYV A;  3CR3 A;  3D9J A;  1IHG A;  4Y6C A;  3ZHE A;  5BNW A;  4V3I A;  2WXJ A;  4HOT A;  3ESL A;  4BWR A;  1GW6 A;  5LSZ A;  3CVP A;  4LRZ A;  2WQ6 A;  4N3C A;  3FTS A;  3SHF A;  2FF4 A;  4FUL A;  4NAC A;  3FTX A;  4ANV A;  3RK6 A;  2LAH A;  2MHK A;  4F3V A;  4JC8 A;  3ZHE B;  3PDN A;  3ZYQ A;  4EEC A;  4GYY A;  5JIY A;  1OWN A;  3I3N A;  2BF0 X;  3NZU A;  4B94 A;  3CBO A;  4XKB A;  5AJL A;  1DVP A;  1WY6 A;  2IOS A;  4ILH B;  1HXI A;  3HHM A;  2LO6 A;  3F9W A;  5TTF A;  3RU0 A;  3AS8 A;  3TG5 A;  3PVL A;  1E8X A;  4G25 A;  3FUD A;  4UWH A;  4FLH A;  5C2Y A;  3RO3 A;  1TEZ A;  4N2S A;  4RSY A;  3M58 A;  5TH7 A;  3AU5 A;  3CHQ A;  3S7F A;  3FUK A;  5LX8 A;  2KC7 A;  1NZN A;  4FMU A;  3FUM A;  1Y8M A;  5BV1 A;  2L0I A;  3S2A A;  3B13 A;  4I1M A;  1SQM A;  5KJK A;  5T5G A;  3APF A;  3C98 A;  3VUZ A;  2J4D A;  3LYA A;  4AVX A;  4BX8 A;  4UWF A;  5E76 A;  3FTW A;  3ZYL A;  4GPK A;  4FP7 A;  4GAA A;  2XRY A;  3GYZ A;  4YPU A;  2L6J A;  2C0M A;  4G26 A;  3LVQ E;  3MV3 B;  3LY9 A;  4J8D A;  4KZ0 A;  2CHX A;  2XPY A;  2WQH A;  3EJN A;  2IFU A;  5FWQ A;  4FC8 A;  3UQ3 A;  4AM9 A;  2VSX E;  3G2U A;  1JWG A;  3CHM A;  1UG3 A;  4UWL A;  2OV8 A;  2XQ0 A;  3K9I A;  4JEH A;  3ESK A;  3PEV B;  4NRH B;  4U63 A;  5DBK A;  5EX3 A;  3EIQ C;  4DI3 A;  3FY4 A;  4UWG A;  3CIA A;  1NP7 A;  5AYW D;  5A23 A;  4GZ3 A;  4I43 A;  4YNM A;  4Q94 A;  4QEN A;  4CDN A;  3TXN A;  3IEG A;  4EBA G;  2VGY A;  1LF8 A;  4DI4 A;  3LS8 A;  4XI0 A;  5FQ6 A;  4ACL A;  3D9O A;  3IKO B;  4CGW A;  4JDS A;  3KAE A;  3IHX A;  2KZT A;  3EHN A;  2XGM A;  1XQH A;  2X6F A;  2C0L A;  3S7B A;  3F9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...