3S7JA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 148
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7jA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7jA01
1NA0A 3RO3A 2UWJG 2XGSA 3ASFA 4N2QA 5EG2A 1N3JA 2WQHA 4GCNA 3CK7A 2VQ2A 4AM9A 3ASGA 3FFLA 3KMTA 4H7XA 2XEVA 3VUZA 2NC9A 4O30A 3AS8A 1ELRA 2FO7A 2FI7A 3AS4A 2IFUA 3S7FA 5KJNA 4KYOB 5T0KA 3RKVA 3IHXA 5CHEE 3S8PA 5TH7A 2L6JA 4WNFA 3Q47B 4GYWA 5JHNA 5G05C 4APOA 2VSNA 3RO2A 3DB5A 3ESKA 5JIYA 4EQFA 3OXGA 2HYZA 1PEGA 1TJCA 1FCHA 4U07A 5JJTA 2KC7A 1KT0A 5KJMA 2KCKA 3RQ4A 3BEEA 2VGXA 3QWPA 3CBPA 1Y8MA 5A6CA 4B94A 4UI9J 4JDSA 4LEUA 2XGMA 4JA7A 4I51A 4YVOA 5CCLA 2YQ8A 3O48A 4H7YA 2FBNA 4GZ6A 4N3CA 4O6FA 2GW1A 4UQYA 3CV0A 4NQ0A 4CGWA 5A7DB 3SWCA 4UI9C 3HNAA 3E4BA 5CCMA 4GZ5A 4HOTA 3MA5A 2O8JA 5LCWC 3CVNA 4Y6CA 4Z4PA 3GW4A 5EKQD 3KS2A 3AS5A 5ARFA 5G04J 3SZ7A 4GA2A 4GCOA 4GZ3A 3CEQA 4WNDA 3TAXA 2PQNA 3ZHEB 5AYFA 3VTXA 5TEGA 3GZ2A 3Q4AB 1ZBPA 2BUGA 3ASDA 2LSVA 3LYAA 3VV0A 3OS5A 4WNEA 4MI0A 4F3VA 4J8OA 2XCBA 3TG4A 5JJ0A 2KCLA 5F6KC 5FZSA 3LY7A 4IN3B 2MHKA 4GA1A 5FT9A 5TTFA 4NRHB 4LDGA 3R9AB 4G25A 4W9RA 3KAEA 3CK8A 1HH8A 4I9EA 3CBOA 4YPAA 4G24A 1IYGA 2P58C 3M57A 3M55A 2AVPA 4U04A 5KJLA 3ULQA 2UY1A 4AY6A 3UUXA 5FZQA 4HOSA 5BNWA 2Y4TA 4I9CA 5EX3A 4UI9K 4U0UA 4AU7A 2XGOA 1N6CA 3KMAA 3CKBA 3PDNA 4BTBA 1ELWA 1HZ4A 4MI5A 3M56A 1MVXA 2IF4A 4XI0A 1NA3A 2HR2A 1IHGA 4N39A 2QFCA 3MO0A 4WNGA 2XCCA 4YNMA 1W3BA 3OPEA 4GPKA 3FPDA 4UQZA 4QENA 5T5GA 4HOUA 4J7IA 5C1DA 4JLGA 4RZ0A 3M5AA 2LSUA 4G26A 4KXKB 3U4TA 3LCAA 3ZN3A 3ZPJA 3Q5MA 4I17A 3UPVA 2I6HA 2F69A 2QPWA 2R3AA 1NZNA 2G46A 1WAO1 3SF4A 4FMUA 4I2WA 4N3AA 1ZU2A 4NVQA 4J8DA 4N2SA 2PQRA 4BT8A 3FWVA 4HOQA 2R5SA 4YPUA 2XPIA 5DIZA 1O9SA 2W5YA 3OXLA 3CKCA 3ZHEA 3MEKA 3MV2B 4RG9A 1A17A 2PL2A 3F9YA 1KT1A 1ML9A 3HYMB 4IJ8A 4AIFA 3GZ1A 3MO2A 4G2VA 3ASHA 1KLXA 2FEZA 4GA0A 3LKUA 4U0SA 3MKRA 4BUPA 4CDRA 4I2ZA 4C1QA 2KCVA 4CGVA 4KBQA 3RIBA 3FP3A 2RFIA 2V5FA 1OUVA 3QDNA 3DALA 3RU0A 5LSXA 3S7DA 3OXFA 4E47A 2VYIA 5FJYA 4N3BA 3IEGA 3F9WA 5F5EA 1XNFA 1WM5A 5BT1A 3Q15A 5LCWJ 3LPZA 3GYZA 4H12A 2VGXB 3M53A 4J8EA 2UY1B 3BO5A 4IJDA 3UQ3A 3CVQA 3S7BA 3ZFWA 5JINA 3CBMA 3RJWA 3CK9A 4XI9A 4BTAA 4J83A 3RAYA 3CVLA 3K9IA 3KMJA 5F6LA 4XIFA 5JJ6A 4YVQC 2C2LA 1ZKKA 2Q7FA 4ME2A 2KATA 1H3IA 5D0QD 5FTPA 3NF1A 2J9QA 3RJVA 3M58A 4N5CA 4YPEA 5LSZA 1E96B 3PE3A 3M54A 4GYOA 4WUYA 4HORA 3TG5A 4A1SA 2ONDA 4YNPA 3M59A 3F9XA 4J7FA 2LNIA 3MO5A 3SW9A 2Y4UA 1N6AA 4ABNA 2VSYA 2JV0A 3PE4A 2JLBA 2W5ZA 4NJ5A 5HQ8A 5D0OD 5CPRB 4YNDA 4J0UA 1B89A 4I1AA 5EX0A 5AYWD 2YHCA 3QWVA 4QEOA 2C0MA 3LY8A 4JL0A 3U3WA 3TGOA 4UQXA 2C0LA 3CVPA 1PC2A 3N71A 4AY5A 1QQEA 3URZA 4JHRA 3VTYA 5M72A 3MV3B 1MT6A 4U0ZA 5ARGA 2HO1A 2E2EA 3JYSA 3LY9A 5F59A 5HI7A 5T0MA 3F9ZA 3QKYA 5FZRA 1QZ2A 4G1TA 5G05J 2BQZA 3WXXA 2DBAA 3ZGQA 3K5KA 3Q49B 2OOEA 4G23A 3S7JA 3EP0A 4J8FA 4Y6WA 2PZIA 4GYYA 4RG6A 5DBKA 5KJKA 4QEPA 1HXIA 2WPVA 1YA0A 3QWWA 3OOIA 2VGYA 1P5QA 1MUFA 5JJ7A 5G04C 2FF4A 3QOUA 1XQHA 2IGQA 3EDTB 3KD7A 4BWRA 5BW8C 1MVHA 4JA9A 4BT9A
chains in the Genus database with same CATH superfamily
1NA0A 1NFIE 2J4DA 2IQCA 4BESA 2XZTG 4N2QA 4ILHB 3LJ3A 4K0RA 3DSVA 3L9TA 2WB2A 4FHKA 2VQ2A 4AM9A 3HG0D 4H7XA 2DVWA 2XEVA 1LD8A 2AJAA 3PNTB 4K5BA 4DK5A 4KYOB 4U8VD 2J08A 5E75A 3Q47B 3RO2A 3DB5A 4D10C 4EQFA 3ZUVB 3CHQA 1PEGA 4PS3A 2V4LA 4HNAD 3SBSA 5E76A 3T5VA 3ASOE 1H6KA 3RQ4A 4F6RD 2VGXA 4BY6A 3G2TA 3CBPA 5EN5D 5BXUA 3EU9A 5B1AE 2ZIRA 2ZGGA 3LVQE 4JDSA 4A3VA 2IO2C 2RKKA 1AWCB 2F37A 3LVRE 3LS8A 1JPLA 3UMVA 3O48A 4UUCA 2V0PA 1IHBA 3VLDA 4CGWA 3UT7A 4UI9C 2P9SG 3ZVVA 1IQUA 3E4BA 5AQBA 5AQ9A 5BV1A 4GZ5A 4BX9A 3MCXA 2O8JA 3CVNA 2VSOE 1OWLA 2XEEA 3CHOA 2H6HA 4GAAA 4BSXA 2PQNA 3ZHEB 5TEGA 1SA5A 1HFAA 4LERA 4DRXE 2EIJE 2P9PG 2QC9A 2LUHA 2H6GA 2XCBA 4XZ4A 4JC8A 3L22A 3T8MA 3LY7A 2X6FA 2KZTB 4LDGA 5AARA 4ZHBA 2KXPC 4PUCA 4JW1A 5BXOA 1IYGA 2P58C 3FTZA 2AVPA 5J08A 5FZQA 3TL5A 4I9CA 3KMAA 3FTWA 4BSZB 4EZLA 3M56A 4A63B 4XI0A 1FT2A 1NA3A 3PZ3A 5KCMA 4DPRA 4I1MA 3QC1A 1IHGA 4N39A 4A1GA 4GPKA 2P9NG 4HOUA 3FU3A 1INZA 3TWVA 5B3SE 3M5AA 2IU1A 4GTPA 3T5XA 1U3CA 4K5AB 5AJLA 3ZPJA 3ZNGA 3DXMG 1EPUA 4P29A 2JEKA 3UPVA 2I6HA 4HRLA 4FLHA 4DI4A 2YHEA 3D9JA 1TR4A 4N2SA 4OVVA 3FHEA 2B0OE 2XS8A 3FWVA 4DX5D 4YPUA 2XPIA 5ITZF 5DIZA 3C98A 3HXDA 3PS6A 3UINC 4CDNA 3ZHEA 3AG3E 1A17A 2PL2A 4IRUA 1ML9A 1BLXB 2F8XK 3CVUA 4MKTA 3GZ1A 4J6IA 4AIFA 4GTMA 3LKUA 4U0SA 1WDYA 4CZ2D 4CDRA 4EBAA 3U66A 4CGVA 1PAQA 3EUVA 2V5FA 3RU0A 5LSXA 2ZISA 3Q9UC 3OXFA 1D9SA 1KPSB 3D9OA 4N3BA 3IEGA 3FEYA 1N0RA 5BT1A 4TXRA 4CEMA 4A55A 4J8EA 1HX8A 2H6FA 3FDHA 3B7SA 3FUJA 3RJWA 3J5PA 4BTAA 4J83A 2DYRE 3LDZA 3Q75A 2EINE 3FU0A 4JEHA 5HS0A 3MX3A 3E34A 1HS6A 1ZKKA 4HRMB 3CGHA 2KATA 1H3IA 1N4QA 2CHWA 2GGFA 3FUEA 1Z3XA 3ONKA 4YPEA 3M54A 5ENSD 4WUYA 2OCCE 2NSZA 3TG5A 3IHVA 1UW4B 3BU8A 3TWWA 3HXCA 1N6AA 4ABNA 3PZ4A 3AU4A 3PE4A 2JLBA 5CPRB 4E85A 5AYWD 2YHCA 3Q7AA 3QWVA 4QEOA 4FP7A 4L9PA 3UT8A 5AENA 4DJAA 2C0LA 2CFZA 4HFGA 1ELKA 4AY5A 2HM8A 1QQEA 2X6KA 3LEWA 5ARGA 1OXJA 2R2LA 3X2QE 5F59A 2A5UA 2VSXE 3L13A 2GRRB 5T0MA 3F9ZA 3QKYA 3RSEG 4GTOA 4DX7D 5KWDA 4APFA 1QZ2A 4I6EA 2R02A 4FLBA 5ENTD 3ZGQA 2BKKB 3S7JA 3ZXPA 3EU5A 1Z6TA 5G55A 4Y6WA 3DXKG 5CEAA 3HIZA 2WPVA 1HU3A 2V4HC 1P5QA 3U64A 2MYOA 1TNYA 1N94A 2Y3AA 5G04C 4FA6A 2X3MA 4QFVA 2LAHA 1MVHA 3NOGD 2JABA 1MX4A 3TWSA 2CHZA 3E37A 2RFAA 2LXLA 2XGSA 1X5BA 3FTXA 1X81A 3ASFA 3O4ZA 3FUFA 5FQ4A 3TWQA 1H2TC 2XEHA 3CK7A 4DI3A 3FUMA 3ASGA 1OCCE 2NC9A 4O30A 2FO7A 3AS4A 1N9AA 2IFUA 2EILE 3TJPA 3RKVA 5CHEE 1JCQA 3NBNB 4GTRA 1IXVA 2L6JA 1D8DA 2DIWA 3NZSA 5JIYA 2HYZA 2QYJA 4HXIA 1TJCA 4U07A 4JVSA 5KJMA 1OWOA 4ATGA 1OCZE 4LNUD 3QK0A 4B89A 3APCA 3BEEA 3DPDA 3APFA 3L08A 3ZYMA 3SGHA 5A6CA 5ENOD 3NOCD 3T8KA 4LEUA 2XGMA 2QZAA 3B7UX 3ABKE 4I51A 4YVOA 1Q2ZA 2BEDA 4WAFA 2YQ8A 2R17C 1E8YA 1E7VA 4TUMA 4GZ6A 2FBNA 4N3CA 3C3RA 4O6FA 1QNFA 4NQ0A 5A7DB 3D9PA 4CDMA 3TWXA 4HRNA 3HNAA 4U8HA 4DUIA 3MA5A 4Y6CA 4Z4PA 3GW4A 4QQIA 3PZ1A 3KS2A 3AS5A 5G04J 3SZ7A 3UM3A 3DSUA 4GCOA 4GZ3A 3CEQA 1OWPA 1TYQG 2RFMA 3ASDA 2LSVA 4CT0A 3ML8A 3OS5A 5BUZA 5CEDB 5LFAA 4HQDA 5JJ0A 2KCLA 3V30A 4G8KA 2GRQB 1DNPA 3R9AB 1SZAA 4G25A 2WXJA 3Q9NC 4W9RA 3CK8A 4G24A 4AP2A 1QBQA 3M57A 3M55A 4U04A 3HXEA 5KJLA 3ULQA 2UY1A 1H2VC 4O1OA 2WMOA 5IY5E 2Y4TA 4UI9K 1TEZA 2VTBA 4U0UA 1FVHA 4JEUA 3OTNA 1TNBA 5JHAA 1NI1A 4BTBA 3RAUA 5LP0A 3D9IA 4C48B 4I43A 2ZGDA 4UWGA 2WXKA 3CVWA 3MO0A 2XCCA 2XPZA 3FU5A 3UT4A 3OPEA 3FPDA 4UQZA 2QYUA 1ZB1A 4J7IA 3CIAA 4G26A 4OYSA 5KNGA 4HVBA 3DRAA 4K5CA 3U4TA 3LCAA 1RW2A 2CG3A 4M3OA 2I9CA 3SBTB 5ENNA 4I17A 2ZU6B 2F69A 2R3AA 3EHMA 4XE0A 2HE0A 4U96D 3SFZA 4AVXA 5FINA 4FMUA 4N3AA 3FTVA 4NVQA 4J8DA 5KNHD 3I3NA 3UKUG 3IKOB 5FQ7A 1MX2A 3P1UA 1A5EA 2AXZA 4Q69A 3BQOA 3MYVA 4I6JA 2YINA 1KT1A 3KSLA 4IJ8A 4HI9A 5T4YA 1KLXA 4I1OB 4BUPA 3UI2A 4C0MA 4KBQA 3FTYA 4URKA 3QDNA 3DALA 4Q96A 3AG2E 1SA4A 3ZEFA 2VYIA 2IEJA 2XRZA 2CG2A 2NXPA 1E90A 3F9WA 1XNFA 3FUNA 4MBGA 3FUIA 1N54A 3M53A 2UY1B 3FH5A 3BO5A 1N11A 2XENA 4ANWA 3CVQA 2XPYA 3ZFWA 2WXQA 3CBMA 4LSZE 3CK9A 3RAYA 3K9IA 5CMWA 4HLLA 5JJ6A 1TN6A 3ZYLA 1OCRE 2Q7FA 3DBSA 3TWUA 5D0QD 4PDXA 5FTPA 3CQGB 3QJZA 2J9QA 3ABME 4WWPA 1FVFA 5CMYA 5LSZA 1E96B 4LCTA 3UX4A 4AEZC 3Q7FA 4HORA 1YCSB 1O1RA 4LNGA 4JHKA 4XKCA 4XKBA 2I1JA 3PEUB 4J7FA 2LNIA 3MO5A 1G3NB 3SW9A 1OWNA 3CVVA 1IKND 4YNDA 2OVFA 4AOFA 4I1AA 4ACKA 2I1KA 4JPSA 4AV7A 1K1BA 1IQRA 4JL0A 3U3WA 1DVPA 5CRUA 4BEPA 3EHRA 1PC2A 4OVUA 2Y0BG 3URZA 3ZIMA 5M72A 3QB2A 1DC2A 1MT6A 4L1BA 1LF8A 2E2EA 1H2UA 4RVBA 1Y6IA 4HBDA 3VLFA 5HI7A 3HXFA 3JQ1A 3UIOC 3QNKA 2OV8A 4GMRA 3FUHA 3BG0B 4J8SA 3HRAA 1MX6A 4B8CB 2BQZA 3K5KA 2DBAA 4K03A 3E33A 2OOEA 3EP0A 1HXIA 1YA0A 3G2VA 3ABLE 2VGYA 2A4ZA 3PZ2A 3V31A 4ZFHA 1MUFA 4R7LA 4JB8P 1OCOE 2XS1A 4TUUA 1TN7A 4ILGA 1K1AA 1PY1A 2BF0X 3EDTB 5BW8C 3SI5A 3HHMA 2VJ8A 3D9MA 5J90A 3RO3A 2UWJG 3PREA 4UWLA 4GZDA 2WQHA 2V8SE 3L16A 2J09A 5CERB 3VUZA 4UWHA 3DWLG 1ELRA 5T0KA 2EIME 5TH7A 4WNFA 4HS2A 2PM6A 2NYJA 3FEXA 4GYWA 5JHNA 5G05C 5AIJA 4APOA 3ESKA 3OXGA 2L6BA 2EQXA 3EHNA 1KZPA 3ENEA 1FCHA 4F1SA 3PUJA 2YNQA 1KT0A 3C5RA 3B7BA 3CR3A 3SNXA 3FUKA 2ETCA 2P2CP 3C72A 4ANVA 3OAWA 4KVMA 1TN8A 1LTXA 3NQPA 1Y8MA 4B94A 4TXQA 1Z5SC 2XRYA 5ENQD 3D9HA 3CHPA 3CVYA 1K8KG 5CCLA 3QARA 1H0AA 5C2YA 3HVEA 5EIDA 4UQYA 3CV0A 3APDA 5G2NA 3SWCA 1UG3A 1Z3YA 3MGBA 1U2VG 3CHRA 5CCMA 4HOTA 2P9KG 3PNLB 2IY0C 5LCWC 5EKQD 1HG5A 5CBOA 5BPPA 4JD2G 3TAXA 3VTXA 4ANUA 2F0YA 2A5EA 3GZ2A 4CCAA 1H19A 3LYAA 1MZCA 4YDYA 3AAAC 3B7RL 2J8SD 4MI0A 4J8OA 4JHJA 3E32A 3TXNA 4CT4A 2WXNA 5FZSA 4IULA 3D3MA 2GRMA 4GA1A 5TTFA 2XQ0A 4F53A 1K3ZD 1N4SA 4RSYA 4L2YA 4TXPA 3KAEA 4HI8A 3D9KA 3I4RB 3CBOA 4WWOA 3L82A 1UJJA 3J5QB 3CSFA 3IV0A 1XGWA 4AY6A 4GB9A 3DPYA 4HOSA 4AU7A 2XGOA 1MJ0A 3CKBA 3PDNA 4GTQA 3R7RA 1EYHA 1ELWA 1HZ4A 4M7CA 1TNOA 1UJKA 2DCPA 3RRMB 1MVXA 2IF4A 3V2OA 4DX2A 3SO8A 4G8LA 4YNMA 3TXMA 3DSWA 2GROB 3CLJA 5H7PA 5T5GA 1BPOA 3ZU7B 5C1DA 1EDUA 4JLGA 2LSUA 5EYLA 1S70B 3ZN3A 1BI8B 3ASNE 4LUNU 3UM2A 2ETAA 2QPWA 3CQCB 3EHQA 1WAO1 2MRIA 1BD8A 5ANLA 3SF4A 4I2WA 3FH8A 4YDWA 1JWFA 2WQ6A 1N95A 2PQRA 4BT8A 3NB2A 2R5SA 3IHYA 4MLPA 4F7AA 4YDEA 2OEVA 5ENRD 1VDYA 3DEOA 2W5YA 5KBAA 4GMJA 3CKCA 3F9YA 1SQMA 2DWZA 3MO2A 2FEZA 3MKRA 3ULYA 1HO8A 4Q94A 4Z68A 2KCVA 4C1QA 3SFXA 3RIBA 3AJIA 2RFIA 1OUVA 4L23A 3S7DA 5FJYA 2ILRA 5F5EA 1WM5A 3S2AA 1MQSA 3R9MA 3D9LA 4OAVB 2BTDA 3LPZA 4H12A 2WXMA 3PUKA 5HKPA 4LG6A 3UQ3A 4EHMA 3S7BA 2KBXA 3UKRG 1TNZA 4UWFA 2P9LG 4F1PA 1UN9A 2OVBA 3CVLA 3KMJA 5F6LA 3JXJA 3LJNA 3R7QA 2J07A 1DCQA 3MKQA 2J4BA 1MYOA 3TWRA 3NF1A 3RJVA 3MZLB 2LXMA 4N5CA 5FIOA 1V55E 1JUQA 3GZSA 3ONLA 2H6IA 4GPMA 3PVLA 2ONDA 4YNPA 3M59A 4V3IA 2DYSE 3F9XA 2X6IA 2Y69E 2Y4UA 2R05A 5CRVA 3FTUA 4LNBA 2W5ZA 3P2BA 3B7TA 4NJ5A 5D0OD 5EYPF 1B89A 5EX0A 3DSSA 3SFYA 3SHFA 2C0MA 3LY8A 3D9NA 3L54A 4U7EB 2GRNB 4GTTA 1OWMA 3TGOA 4FJZA 1KZOA 3Q78A 2I2OA 3N71A 2CFUA 4JHRA 2IONA 1N4RA 4PS7A 3KSQA 3MV3B 4DX6D 4GMLA 3JYSA 3C3OA 5FQ6A 3T9KA 3LY9A 5EDSA 3JQ0A 5JMND 5JA4D 3KEZA 3JCKC 5FZRA 3ISMC 4MRUA 4O60A 2L9BA 3CSTA 1S0PA 3AG4E 2E0IA 3V2XA 4C0EA 4PH4B 3G2UA 4FADA 1HG2A 4EZKA 3FTSA 1O5MA 4GYYA 1JCRA 4RG6A 4U8YD 4O1PA 5KJKA 3RK6A 4JZYA 3QWWA 2QY7A 3OOIA 2WVIA 4U63A 4CRWA 5FQ8A 2XZDG 5JJ7A 4ATZD 4I6GA 2FF4A 4KT6B 2PNNA 2AXVA 1N0QA 3U9WA 2RG8A 5AJDA 4ACLA 1S64A 2WXLA 4AJWA 1JWGA 4A3TA 1OY3D 5EG2A 1N3JA 4L2LA 4GCNA 4C9BB 3FFLA 5D66A 3KMTA 4B93B 4PS8A 3MKQB 3AS8A 3ZW3A 4GTVA 2FI7A 1S63A 3S7FA 5KJNA 3IHXA 3Q73A 3S8PA 1RZ4A 3NAWA 2VSNA 1FPPA 4E6HA 1TNUA 5JJTA 5ANRA 2KC7A 5B1BE 2WMNA 1SVXA 2KCKA 2IOLA 4KVOA 5ENPD 4GZCA 4WWNA 5D2MC 5T3RA 4B8AA 3QWPA 3B13A 5LOZA 1GW6A 2ZXWE 4UI9J 4JA7A 3V79K 2EIKE 3PZDA 4EECA 3FULA 1UOHA 3QAQA 3AU5A 4H7YA 2GW1A 2M63A 2AW6A 1EF1C 3HVEB 4AXHA 4JXTA 4CYMD 5ARFA 4GA2A 4WNDA 4J8YA 4KMOA 5AYFA 1E8WA 4BETA 5AQAA 3Q4AB 1ZBPA 2BUGA 5EIBE 1H6OA 4EZJA 2IO3C 2KZTA 1JCSA 3VV0A 4WNEA 3DEPA 4F3VA 3TG4A 4L7TA 2AXUA 5F6KC 1SZ9A 5A23A 4IN3B 2VGEA 2MHKA 5FT9A 3SQVA 2J49A 4FC8A 4FULA 3UXGA 2Y1LE 1AP7A 4NRHB 2VTBB 3E30A 4N5QA 4NIKA 1HH8A 4I9EA 4YPAA 2OEWA 3W9FA 1FT1A 2P9IG 2WM9A 1SW6A 4EPZA 3CHMA 5CBNA 3UUXA 1D8EA 5BNWA 2WXOA 5EX3A 1N6CA 3PEVB 4B0ZA 1U3DA 2AWIA 1NP7A 1L5JA 5AN8A 2WXHA 3L6AA 4DLQA 4MI5A 4KZCA 1NL4A 4U95D 2KM4A 2HR2A 2PM7A 1WG0A 3ESLA 2QFCA 4FU3A 4WNGA 3VLEA 1W3BA 4FHJA 4BX8A 1MHQA 3FY4A 4QENA 4RZ0A 2BKGA 4KXKB 3EIJA 4GU5A 4EBAG 4TRQA 5HRYA 3NZUA 3Q5MA 3JXIA 3HXBA 1NZNA 3DSXA 4KZ0A 2G46A 3RRUA 3FH7A 3IBEA 4XEIG 3EJNA 5LX8A 2WXRA 1YYHA 1ZU2A 1DCEA 2F8YA 3Q79A 2LO6A 4HB5A 4HOQA 4RLYA 4UWKA 2X6JA 2WXPA 1O9SA 2CHXA 3OXLA 4MS6A 3MEKA 3MV2B 3W9GA 2P9UG 4RG9A 4XX5A 3KEAA 3HYMB 1YMPA 3I5PA 4G2VA 2R59A 3ASHA 4GA0A 5AAOA 4DX1A 2DZOA 4I2ZA 3FU6A 3G2WA 1LD7A 2DZNA 3FP3A 3ULEG 4NACA 4BFRA 3BUAA 3UM0A 4DLOA 1QYMA 5FWQA 4E47A 3SY2A 1BU9A 1N4PA 3WG7E 1O1TA 2V5QC 4RQIA 3Q15A 5LCWJ 2GRPB 1N52A 3DSTA 4NURA 3GYZA 2VGXB 3CHSA 2WXFA 1O1SA 4BERA 1E8ZA 4IJDA 2FULA 4LRZA 3LXUX 5JINA 4IYPA 2IOSA 3HDXA 3ZKJA 4XI9A 1H6PA 4XIFA 2ETBA 4FJYA 3L17A 4YVQC 2C2LA 5CECB 2WQ7A 4ME2A 3ZXSA 5JHBA 3RRNB 4ILIA 3G2SA 2LAIA 3ZYQA 1TJFA 2X6HA 3M58A 4HLEA 4OAUC 4J7WA 1HF8A 3PE3A 4GYOA 3I4GA 2WXGA 4A1SA 3IXEA 2VSYA 3EIQC 2JV0A 3MJWA 3F6QA 5HQ8A 2FO1E 2B6CA 3ZRHA 4J0UA 3UIPC 4ANXA 2XHEA 3C3QA 3AG1E 1OT8A 2IJGX 3SD5A 4UQXA 3CVPA 4TV3A 3BG1B 3VTYA 3CVXA 4U0ZA 2HO1A 4GTSA 1V54E 2L0TB 2GRLA 2WXIA 5AQ7A 3ZYKA 3ML9A 3UM1A 1E8XA 1E7UA 4G1TA 5G05J 3FUDA 4YDOA 3B95A 3WXXA 5BV0A 3Q49B 4G23A 4J8FA 1UN8A 2RD0A 1WY6A 2PZIA 1BI7B 4G11A 5DBKA 4QEPA 5EILA 3UTMA 2L0IA 3TWTA 2MOWA 3PH0C 3JUIA 1HE8A 3QOUA 4X8QA 2X38A 1XQHA 3PRZA 2R03A 5T8IA 2IGQA 3JUEA 3KD7A 4BWRA 4JA9A 4BT9A
chains in the Genus database with same CATH topology
4ACLA 3D9MA 1NA0A 4AJWA 2WXLA 5J90A 2J4DA 2IQCA 3RO3A 1JWGA 2UWJG 2XGSA 1X5BA 4A3TA 3FTXA 3ASFA 3PREA 4N2QA 4ILHB 3LJ3A 4UWLA 1N3JA 4K0RA 5EG2A 3O4ZA 3FUFA 2WQHA 4GZDA 4L2LA 5FQ4A 2V8SE 4GCNA 1H2TC 3L16A 3CK7A 4DI3A 4FHKA 2WB2A 2J09A 2VQ2A 3FUMA 4AM9A 3ASGA 4C9BB 3FFLA 3KMTA 4H7XA 4PS8A 2XEVA 3MKQB 3VUZA 2NC9A 4UWHA 3AS8A 4O30A 3PNTB 1ELRA 3ZW3A 2FO7A 2FI7A 3AS4A 4DK5A 2IFUA 3S7FA 5KJNA 3TJPA 4KYOB 5T0KA 3RKVA 2J08A 3IHXA 5CHEE 3S8PA 5TH7A 2L6JA 4WNFA 3Q47B 5E75A 4HS2A 2PM6A 3FEXA 4GYWA 5JHNA 5G05C 5AIJA 4APOA 2VSNA 3RO2A 3DB5A 2DIWA 3ESKA 3NZSA 4D10C 4EQFA 5JIYA 3OXGA 2HYZA 2EQXA 3CHQA 3EHNA 5C2YA 4E6HA 3ENEA 1TJCA 1FCHA 4HXIA 4PS3A 4U07A 2V4LA 5JJTA 4F1SA 5ANRA 2KC7A 3PUJA 2YNQA 1KT0A 4JVSA 5KJMA 3CR3A 3SNXA 1OWOA 2WMNA 3FUKA 4ATGA 3SBSA 5E76A 3QK0A 3T5VA 1H6KA 2KCKA 3APCA 4ANVA 4B89A 2IOLA 3OAWA 3RQ4A 4KVOA 3BEEA 3DPDA 4GZCA 4WWNA 4KVMA 3APFA 3L08A 2VGXA 4BY6A 3NQPA 3G2TA 5T3RA 3ZYMA 4B8AA 3QWPA 3SGHA 1Y8MA 3CBPA 5A6CA 3B13A 4B94A 5LOZA 1GW6A 2XRYA 3LVQE 4UI9J 4JDSA 4LEUA 2XGMA 4A3VA 3CHPA 4JA7A 3B7UX 3CVYA 4I51A 3LVRE 4YVOA 3LS8A 1JPLA 3PZDA 4EECA 4WAFA 3FULA 2YQ8A 2R17C 3QAQA 3QARA 3UMVA 5CCLA 1E8YA 1H0AA 3AU5A 1E7VA 3O48A 4H7YA 2FBNA 3HVEA 2V0PA 4GZ6A 2GW1A 4N3CA 2M63A 3CV0A 4O6FA 4UQYA 3APDA 1QNFA 3VLDA 4NQ0A 4CGWA 5G2NA 5A7DB 3UT7A 3D9PA 3SWCA 4CDMA 2AW6A 1UG3A 4UI9C 1Z3YA 3MGBA 3HNAA 3ZVVA 1IQUA 3CHRA 3E4BA 5BV1A 4U8HA 5CCMA 4GZ5A 1EF1C 4HOTA 4BX9A 3MCXA 3MA5A 3PNLB 2O8JA 5LCWC 3CVNA 2VSOE 4Y6CA 3HVEB 4Z4PA 1OWLA 3GW4A 5EKQD 4JXTA 4AXHA 3KS2A 3AS5A 5ARFA 5G04J 1HG5A 3SZ7A 4GA2A 4GCOA 4GZ3A 5BPPA 3CHOA 3CEQA 4WNDA 4GAAA 3TAXA 4BSXA 2PQNA 3ZHEB 1OWPA 4KMOA 5AYFA 1E8WA 3VTXA 4ANUA 5TEGA 1HFAA 3GZ2A 3Q4AB 1ZBPA 2BUGA 4CCAA 3ASDA 4LERA 4EZJA 2LSVA 1H19A 2KZTA 3LYAA 4CT0A 3ML8A 3VV0A 3B7RL 3OS5A 4WNEA 4MI0A 5BUZA 4F3VA 5LFAA 4J8OA 4JHJA 2XCBA 3TXNA 4XZ4A 4JC8A 3TG4A 5JJ0A 4L7TA 2AXUA 3L22A 4CT4A 2KCLA 5F6KC 1SZ9A 2WXNA 5FZSA 3T8MA 4IULA 3D3MA 3LY7A 5A23A 4IN3B 2MHKA 2GRMA 4GA1A 5FT9A 2J49A 2X6FA 4FC8A 4FULA 5TTFA 2XQ0A 4F53A 2KZTB 1DNPA 4NRHB 4LDGA 3R9AB 1SZAA 4G25A 2VTBB 4RSYA 2WXJA 4L2YA 4W9RA 3KAEA 3CK8A 4PUCA 1HH8A 4JW1A 3D9KA 3I4RB 4I9EA 3CBOA 4YPAA 4WWOA 4G24A 4AP2A 1IYGA 2P58C 2WM9A 3M57A 1UJJA 3FTZA 3M55A 2AVPA 3CSFA 4U04A 5J08A 3IV0A 5KJLA 3ULQA 1XGWA 2UY1A 4EPZA 1H2VC 3CHMA 4AY6A 4GB9A 3UUXA 5FZQA 3TL5A 2WMOA 4HOSA 5BNWA 2WXOA 2Y4TA 4I9CA 5EX3A 4UI9K 1TEZA 2VTBA 4U0UA 4AU7A 2XGOA 1FVHA 4JEUA 1N6CA 3PEVB 3KMAA 3OTNA 4B0ZA 1U3DA 3CKBA 3PDNA 5JHAA 2AWIA 1NP7A 4BTBA 3FTWA 1L5JA 1EYHA 3R7RA 1ELWA 2WXHA 4EZLA 3L6AA 4DLQA 1HZ4A 5LP0A 3D9IA 1UJKA 2DCPA 4KZCA 3RRMB 1MVXA 3M56A 4MI5A 2IF4A 4XI0A 4I43A 2KM4A 1NA3A 2HR2A 2PM7A 4UWGA 5KCMA 4DPRA 3ESLA 4I1MA 3QC1A 1IHGA 2WXKA 4N39A 3CVWA 2QFCA 3MO0A 4FU3A 4WNGA 2XCCA 2XPZA 4YNMA 3VLEA 3FU5A 4A1GA 1W3BA 4FHJA 3TXMA 4BX8A 3UT4A 3OPEA 4GPKA 1MHQA 3CLJA 4UQZA 3FPDA 3FY4A 4QENA 5T5GA 1BPOA 4HOUA 4J7IA 3CIAA 3FU3A 5C1DA 1INZA 1EDUA 4JLGA 4RZ0A 3M5AA 2LSUA 2IU1A 4G26A 4OYSA 4KXKB 3T5XA 4HVBA 3EIJA 1U3CA 3U4TA 3LCAA 3ZN3A 4GU5A 5AJLA 4EBAG 3ZPJA 4TRQA 2CG3A 4M3OA 4LUNU 2I9CA 1EPUA 3NZUA 3Q5MA 3SBTB 4P29A 5ENNA 2JEKA 2ZU6B 4I17A 3UPVA 2I6HA 2F69A 2QPWA 3CQCB 3EHMA 2R3AA 4XE0A 1NZNA 4KZ0A 2G46A 1WAO1 2MRIA 3RRUA 3SFZA 3FH7A 4FLHA 4AVXA 5ANLA 4DI4A 3IBEA 2YHEA 3EJNA 3SF4A 5LX8A 2WXRA 4I2WA 4FMUA 4N3AA 1ZU2A 3D9JA 3FH8A 3FTVA 1JWFA 2WQ6A 4NVQA 4J8DA 4N2SA 4OVVA 3FHEA 3I3NA 2PQRA 2LO6A 3IKOB 4BT8A 3FWVA 4HOQA 5FQ7A 2R5SA 4UWKA 3IHYA 2XPIA 4YPUA 2X6JA 4MLPA 5DIZA 3C98A 4F7AA 3PS6A 2WXPA 3P1UA 1O9SA 1VDYA 2W5YA 2CHXA 3OXLA 4GMJA 2AXZA 4CDNA 3CKCA 4MS6A 3ZHEA 3MEKA 3MV2B 4Q69A 3MYVA 4RG9A 4XX5A 1A17A 2PL2A 4I6JA 3F9YA 1SQMA 2YINA 1KT1A 4IRUA 1ML9A 3HYMB 4IJ8A 3CVUA 5T4YA 4MKTA 3GZ1A 4J6IA 3I5PA 4AIFA 3MO2A 4G2VA 2R59A 3ASHA 1KLXA 2FEZA 4GA0A 3LKUA 4I1OB 3MKRA 4U0SA 4CDRA 4EBAA 4BUPA 4I2ZA 3FU6A 3G2WA 1HO8A 4Q94A 4C1QA 2KCVA 4C0MA 3U66A 4CGVA 1PAQA 4KBQA 3RIBA 3FP3A 4NACA 2RFIA 3FTYA 4BFRA 2V5FA 4URKA 1OUVA 3QDNA 3DALA 4Q96A 4L23A 3RU0A 5LSXA 3S7DA 4DLOA 3OXFA 5FWQA 4E47A 3ZEFA 2VYIA 3D9OA 5FJYA 4N3BA 3IEGA 2XRZA 3FEYA 2CG2A 2NXPA 1E90A 3F9WA 2ILRA 5F5EA 1XNFA 1WM5A 3S2AA 4CEMA 5BT1A 1MQSA 3FUNA 3Q15A 5LCWJ 3D9LA 2BTDA 1N52A 3LPZA 4A55A 4NURA 3GYZA 4H12A 3FUIA 2WXMA 2VGXB 3CHSA 1N54A 2WXFA 3PUKA 3M53A 4J8EA 2UY1B 1HX8A 1E8ZA 3FH5A 3BO5A 4IJDA 3FDHA 3B7SA 2FULA 3UQ3A 4ANWA 3CVQA 4LRZA 3S7BA 2XPYA 3FUJA 3LXUX 3ZFWA 5JINA 4IYPA 2IOSA 2WXQA 3HDXA 3CBMA 3RJWA 4UWFA 3CK9A 4XI9A 4BTAA 4J83A 3RAYA 1UN9A 2OVBA 3CVLA 3K9IA 3LDZA 5CMWA 3KMJA 5F6LA 3SI5A 4XIFA 5JJ6A 3FU0A 4FJYA 3L17A 4JEHA 3MX3A 4YVQC 3ZYLA 1HS6A 2C2LA 3R7QA 1ZKKA 2WQ7A 2J07A 3CGHA 2Q7FA 4ME2A 3ZXSA 3MKQA 3DBSA 2J4BA 2KATA 5JHBA 1H3IA 5D0QD 4PDXA 3RRNB 5FTPA 3CQGB 3QJZA 3NF1A 2CHWA 2J9QA 4ILIA 3G2SA 2LAIA 3ZYQA 3MZLB 2GGFA 1TJFA 5AJDA 2X6HA 1Z3XA 3FUEA 1FVFA 4WWPA 3RJVA 4N5CA 3M58A 3ONKA 4YPEA 5CMYA 4HLEA 1JUQA 3GZSA 5LSZA 1E96B 3ONLA 1HF8A 3PE3A 4LCTA 3UX4A 3M54A 4GYOA 4AEZC 3PVLA 4WUYA 3I4GA 4HORA 2WXGA 4XKCA 2NSZA 4JHKA 4XKBA 3TG5A 4A1SA 2I1JA 3IHVA 2ONDA 4YNPA 3M59A 1UW4B 4V3IA 3PEUB 3F9XA 2X6IA 4J7FA 2LNIA 3MO5A 3SW9A 2Y4UA 1OWNA 1N6AA 3FTUA 4ABNA 2VSYA 3AU4A 3EIQC 3CVVA 2JV0A 3P2BA 2JLBA 3MJWA 3PE4A 3B7TA 2W5ZA 4NJ5A 5HQ8A 5D0OD 5CPRB 4YNDA 2OVFA 3ZRHA 4AOFA 4J0UA 4E85A 1B89A 4I1AA 5EX0A 5AYWD 4ACKA 2I1KA 2YHCA 3QWVA 4QEOA 4JPSA 4AV7A 4ANXA 3SHFA 2C0MA 3LY8A 4FP7A 2XHEA 3D9NA 3L54A 1IQRA 3UT8A 4JL0A 3U3WA 5AENA 2IJGX 1OWMA 3TGOA 3SD5A 4UQXA 4DJAA 1DVPA 2C0LA 2CFZA 4FJZA 4HFGA 3CVPA 1PC2A 2I2OA 4OVUA 1ELKA 3N71A 4AY5A 2HM8A 4TV3A 1QQEA 3URZA 2CFUA 2X6KA 4JHRA 2IONA 3BG1B 3VTYA 3ZIMA 3CVXA 3LEWA 5M72A 4PS7A 3QB2A 3MV3B 1MT6A 4U0ZA 5ARGA 2HO1A 1LF8A 4GMLA 4L1BA 2E2EA 3JYSA 5FQ6A 1H2UA 2L0TB 4RVBA 1Y6IA 3LY9A 1PEGA 5F59A 2GRLA 3VLFA 2WXIA 2A5UA 2VSXE 3L13A 5HI7A 3JQ1A 3ZYKA 5EDSA 3JQ0A 5T0MA 3F9ZA 3QKYA 3QNKA 2OV8A 3ML9A 3KEZA 1E8XA 3FUHA 3JCKC 5FZRA 1E7UA 3BG0B 4J8SA 1QZ2A 4MRUA 4I6EA 4APFA 4G1TA 5G05J 4FLBA 2L9BA 3FUDA 4B8CB 2BQZA 3CSTA 1S0PA 2E0IA 3WXXA 2DBAA 3ZGQA 3K5KA 4K03A 5BV0A 3Q49B 2OOEA 4G23A 4PH4B 3S7JA 4C0EA 3EP0A 3G2UA 4FADA 4J8FA 1HG2A 1UN8A 4EZKA 1Z6TA 2RD0A 3FTSA 5G55A 4Y6WA 1WY6A 2PZIA 4GYYA 4RG6A 4G11A 5DBKA 5KJKA 4QEPA 3RK6A 1HXIA 2WPVA 2L0IA 1YA0A 3G2VA 3HIZA 4JZYA 1HU3A 2QY7A 3QWWA 2VGYA 3OOIA 1P5QA 2A4ZA 2MOWA 3PH0C 3U64A 2WVIA 3JUIA 1MUFA 4U63A 4CRWA 4R7LA 5FQ8A 1HE8A 2Y3AA 4TUUA 5JJ7A 5G04C 4I6GA 2FF4A 4FA6A 4ILGA 4KT6B 2X3MA 4QFVA 2AXVA 3QOUA 2X38A 1XQHA 3PRZA 2LAHA 5T8IA 1PY1A 3U9WA 2BF0X 2IGQA 3EDTB 3KD7A 4BWRA 5BW8C 1MVHA 4JA9A 2RG8A 4BT9A 2CHZA 3HHMA 2VJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA0 A;  3RO3 A;  2UWJ G;  2XGS A;  3ASF A;  4N2Q A;  5EG2 A;  1N3J A;  2WQH A;  4GCN A;  3CK7 A;  2VQ2 A;  4AM9 A;  3ASG A;  3FFL A;  3KMT A;  4H7X A;  2XEV A;  3VUZ A;  2NC9 A;  4O30 A;  3AS8 A;  1ELR A;  2FO7 A;  2FI7 A;  3AS4 A;  2IFU A;  3S7F A;  5KJN A;  4KYO B;  5T0K A;  3RKV A;  3IHX A;  5CHE E;  3S8P A;  5TH7 A;  2L6J A;  4WNF A;  3Q47 B;  4GYW A;  5JHN A;  5G05 C;  4APO A;  2VSN A;  3RO2 A;  3DB5 A;  3ESK A;  5JIY A;  4EQF A;  3OXG A;  2HYZ A;  1PEG A;  1TJC A;  1FCH A;  4U07 A;  5JJT A;  2KC7 A;  1KT0 A;  5KJM A;  2KCK A;  3RQ4 A;  3BEE A;  2VGX A;  3QWP A;  3CBP A;  1Y8M A;  5A6C A;  4B94 A;  4UI9 J;  4JDS A;  4LEU A;  2XGM A;  4JA7 A;  4I51 A;  4YVO A;  5CCL A;  2YQ8 A;  3O48 A;  4H7Y A;  2FBN A;  4GZ6 A;  4N3C A;  4O6F A;  2GW1 A;  4UQY A;  3CV0 A;  4NQ0 A;  4CGW A;  5A7D B;  3SWC A;  4UI9 C;  3HNA A;  3E4B A;  5CCM A;  4GZ5 A;  4HOT A;  3MA5 A;  2O8J A;  5LCW C;  3CVN A;  4Y6C A;  4Z4P A;  3GW4 A;  5EKQ D;  3KS2 A;  3AS5 A;  5ARF A;  5G04 J;  3SZ7 A;  4GA2 A;  4GCO A;  4GZ3 A;  3CEQ A;  4WND A;  3TAX A;  2PQN A;  3ZHE B;  5AYF A;  3VTX A;  5TEG A;  3GZ2 A;  3Q4A B;  1ZBP A;  2BUG A;  3ASD A;  2LSV A;  3LYA A;  3VV0 A;  3OS5 A;  4WNE A;  4MI0 A;  4F3V A;  4J8O A;  2XCB A;  3TG4 A;  5JJ0 A;  2KCL A;  5F6K C;  5FZS A;  3LY7 A;  4IN3 B;  2MHK A;  4GA1 A;  5FT9 A;  5TTF A;  4NRH B;  4LDG A;  3R9A B;  4G25 A;  4W9R A;  3KAE A;  3CK8 A;  1HH8 A;  4I9E A;  3CBO A;  4YPA A;  4G24 A;  1IYG A;  2P58 C;  3M57 A;  3M55 A;  2AVP A;  4U04 A;  5KJL A;  3ULQ A;  2UY1 A;  4AY6 A;  3UUX A;  5FZQ A;  4HOS A;  5BNW A;  2Y4T A;  4I9C A;  5EX3 A;  4UI9 K;  4U0U A;  4AU7 A;  2XGO A;  1N6C A;  3KMA A;  3CKB A;  3PDN A;  4BTB A;  1ELW A;  1HZ4 A;  4MI5 A;  3M56 A;  1MVX A;  2IF4 A;  4XI0 A;  1NA3 A;  2HR2 A;  1IHG A;  4N39 A;  2QFC A;  3MO0 A;  4WNG A;  2XCC A;  4YNM A;  1W3B A;  3OPE A;  4GPK A;  3FPD A;  4UQZ A;  4QEN A;  5T5G A;  4HOU A;  4J7I A;  5C1D A;  4JLG A;  4RZ0 A;  3M5A A;  2LSU A;  4G26 A;  4KXK B;  3U4T A;  3LCA A;  3ZN3 A;  3ZPJ A;  3Q5M A;  4I17 A;  3UPV A;  2I6H A;  2F69 A;  2QPW A;  2R3A A;  1NZN A;  2G46 A;  1WAO 1;  3SF4 A;  4FMU A;  4I2W A;  4N3A A;  1ZU2 A;  4NVQ A;  4J8D A;  4N2S A;  2PQR A;  4BT8 A;  3FWV A;  4HOQ A;  2R5S A;  4YPU A;  2XPI A;  5DIZ A;  1O9S A;  2W5Y A;  3OXL A;  3CKC A;  3ZHE A;  3MEK A;  3MV2 B;  4RG9 A;  1A17 A;  2PL2 A;  3F9Y A;  1KT1 A;  1ML9 A;  3HYM B;  4IJ8 A;  4AIF A;  3GZ1 A;  3MO2 A;  4G2V A;  3ASH A;  1KLX A;  2FEZ A;  4GA0 A;  3LKU A;  4U0S A;  3MKR A;  4BUP A;  4CDR A;  4I2Z A;  4C1Q A;  2KCV A;  4CGV A;  4KBQ A;  3RIB A;  3FP3 A;  2RFI A;  2V5F A;  1OUV A;  3QDN A;  3DAL A;  3RU0 A;  5LSX A;  3S7D A;  3OXF A;  4E47 A;  2VYI A;  5FJY A;  4N3B A;  3IEG A;  3F9W A;  5F5E A;  1XNF A;  1WM5 A;  5BT1 A;  3Q15 A;  5LCW J;  3LPZ A;  3GYZ A;  4H12 A;  2VGX B;  3M53 A;  4J8E A;  2UY1 B;  3BO5 A;  4IJD A;  3UQ3 A;  3CVQ A;  3S7B A;  3ZFW A;  5JIN A;  3CBM A;  3RJW A;  3CK9 A;  4XI9 A;  4BTA A;  4J83 A;  3RAY A;  3CVL A;  3K9I A;  3KMJ A;  5F6L A;  4XIF A;  5JJ6 A;  4YVQ C;  2C2L A;  1ZKK A;  2Q7F A;  4ME2 A;  2KAT A;  1H3I A;  5D0Q D;  5FTP A;  3NF1 A;  2J9Q A;  3RJV A;  3M58 A;  4N5C A;  4YPE A;  5LSZ A;  1E96 B;  3PE3 A;  3M54 A;  4GYO A;  4WUY A;  4HOR A;  3TG5 A;  4A1S A;  2OND A;  4YNP A;  3M59 A;  3F9X A;  4J7F A;  2LNI A;  3MO5 A;  3SW9 A;  2Y4U A;  1N6A A;  4ABN A;  2VSY A;  2JV0 A;  3PE4 A;  2JLB A;  2W5Z A;  4NJ5 A;  5HQ8 A;  5D0O D;  5CPR B;  4YND A;  4J0U A;  1B89 A;  4I1A A;  5EX0 A;  5AYW D;  2YHC A;  3QWV A;  4QEO A;  2C0M A;  3LY8 A;  4JL0 A;  3U3W A;  3TGO A;  4UQX A;  2C0L A;  3CVP A;  1PC2 A;  3N71 A;  4AY5 A;  1QQE A;  3URZ A;  4JHR A;  3VTY A;  5M72 A;  3MV3 B;  1MT6 A;  4U0Z A;  5ARG A;  2HO1 A;  2E2E A;  3JYS A;  3LY9 A;  5F59 A;  5HI7 A;  5T0M A;  3F9Z A;  3QKY A;  5FZR A;  1QZ2 A;  4G1T A;  5G05 J;  2BQZ A;  3WXX A;  2DBA A;  3ZGQ A;  3K5K A;  3Q49 B;  2OOE A;  4G23 A;  3S7J A;  3EP0 A;  4J8F A;  4Y6W A;  2PZI A;  4GYY A;  4RG6 A;  5DBK A;  5KJK A;  4QEP A;  1HXI A;  2WPV A;  1YA0 A;  3QWW A;  3OOI A;  2VGY A;  1P5Q A;  1MUF A;  5JJ7 A;  5G04 C;  2FF4 A;  3QOU A;  1XQH A;  2IGQ A;  3EDT B;  3KD7 A;  4BWR A;  5BW8 C;  1MVH A;  4JA9 A;  4BT9 A; 
#chains in the Genus database with same CATH topology
 1NA0 A;  1NFI E;  2J4D A;  2IQC A;  4BES A;  2XZT G;  4N2Q A;  4ILH B;  3LJ3 A;  4K0R A;  3DSV A;  3L9T A;  2WB2 A;  4FHK A;  2VQ2 A;  4AM9 A;  3HG0 D;  4H7X A;  2DVW A;  2XEV A;  1LD8 A;  2AJA A;  3PNT B;  4K5B A;  4DK5 A;  4KYO B;  4U8V D;  2J08 A;  5E75 A;  3Q47 B;  3RO2 A;  3DB5 A;  4D10 C;  4EQF A;  3ZUV B;  3CHQ A;  1PEG A;  4PS3 A;  2V4L A;  4HNA D;  3SBS A;  5E76 A;  3T5V A;  3ASO E;  1H6K A;  3RQ4 A;  4F6R D;  2VGX A;  4BY6 A;  3G2T A;  3CBP A;  5EN5 D;  5BXU A;  3EU9 A;  5B1A E;  2ZIR A;  2ZGG A;  3LVQ E;  4JDS A;  4A3V A;  2IO2 C;  2RKK A;  1AWC B;  2F37 A;  3LVR E;  3LS8 A;  1JPL A;  3UMV A;  3O48 A;  4UUC A;  2V0P A;  1IHB A;  3VLD A;  4CGW A;  3UT7 A;  4UI9 C;  2P9S G;  3ZVV A;  1IQU A;  3E4B A;  5AQB A;  5AQ9 A;  5BV1 A;  4GZ5 A;  4BX9 A;  3MCX A;  2O8J A;  3CVN A;  2VSO E;  1OWL A;  2XEE A;  3CHO A;  2H6H A;  4GAA A;  4BSX A;  2PQN A;  3ZHE B;  5TEG A;  1SA5 A;  1HFA A;  4LER A;  4DRX E;  2EIJ E;  2P9P G;  2QC9 A;  2LUH A;  2H6G A;  2XCB A;  4XZ4 A;  4JC8 A;  3L22 A;  3T8M A;  3LY7 A;  2X6F A;  2KZT B;  4LDG A;  5AAR A;  4ZHB A;  2KXP C;  4PUC A;  4JW1 A;  5BXO A;  1IYG A;  2P58 C;  3FTZ A;  2AVP A;  5J08 A;  5FZQ A;  3TL5 A;  4I9C A;  3KMA A;  3FTW A;  4BSZ B;  4EZL A;  3M56 A;  4A63 B;  4XI0 A;  1FT2 A;  1NA3 A;  3PZ3 A;  5KCM A;  4DPR A;  4I1M A;  3QC1 A;  1IHG A;  4N39 A;  4A1G A;  4GPK A;  2P9N G;  4HOU A;  3FU3 A;  1INZ A;  3TWV A;  5B3S E;  3M5A A;  2IU1 A;  4GTP A;  3T5X A;  1U3C A;  4K5A B;  5AJL A;  3ZPJ A;  3ZNG A;  3DXM G;  1EPU A;  4P29 A;  2JEK A;  3UPV A;  2I6H A;  4HRL A;  4FLH A;  4DI4 A;  2YHE A;  3D9J A;  1TR4 A;  4N2S A;  4OVV A;  3FHE A;  2B0O E;  2XS8 A;  3FWV A;  4DX5 D;  4YPU A;  2XPI A;  5ITZ F;  5DIZ A;  3C98 A;  3HXD A;  3PS6 A;  3UIN C;  4CDN A;  3ZHE A;  3AG3 E;  1A17 A;  2PL2 A;  4IRU A;  1ML9 A;  1BLX B;  2F8X K;  3CVU A;  4MKT A;  3GZ1 A;  4J6I A;  4AIF A;  4GTM A;  3LKU A;  4U0S A;  1WDY A;  4CZ2 D;  4CDR A;  4EBA A;  3U66 A;  4CGV A;  1PAQ A;  3EUV A;  2V5F A;  3RU0 A;  5LSX A;  2ZIS A;  3Q9U C;  3OXF A;  1D9S A;  1KPS B;  3D9O A;  4N3B A;  3IEG A;  3FEY A;  1N0R A;  5BT1 A;  4TXR A;  4CEM A;  4A55 A;  4J8E A;  1HX8 A;  2H6F A;  3FDH A;  3B7S A;  3FUJ A;  3RJW A;  3J5P A;  4BTA A;  4J83 A;  2DYR E;  3LDZ A;  3Q75 A;  2EIN E;  3FU0 A;  4JEH A;  5HS0 A;  3MX3 A;  3E34 A;  1HS6 A;  1ZKK A;  4HRM B;  3CGH A;  2KAT A;  1H3I A;  1N4Q A;  2CHW A;  2GGF A;  3FUE A;  1Z3X A;  3ONK A;  4YPE A;  3M54 A;  5ENS D;  4WUY A;  2OCC E;  2NSZ A;  3TG5 A;  3IHV A;  1UW4 B;  3BU8 A;  3TWW A;  3HXC A;  1N6A A;  4ABN A;  3PZ4 A;  3AU4 A;  3PE4 A;  2JLB A;  5CPR B;  4E85 A;  5AYW D;  2YHC A;  3Q7A A;  3QWV A;  4QEO A;  4FP7 A;  4L9P A;  3UT8 A;  5AEN A;  4DJA A;  2C0L A;  2CFZ A;  4HFG A;  1ELK A;  4AY5 A;  2HM8 A;  1QQE A;  2X6K A;  3LEW A;  5ARG A;  1OXJ A;  2R2L A;  3X2Q E;  5F59 A;  2A5U A;  2VSX E;  3L13 A;  2GRR B;  5T0M A;  3F9Z A;  3QKY A;  3RSE G;  4GTO A;  4DX7 D;  5KWD A;  4APF A;  1QZ2 A;  4I6E A;  2R02 A;  4FLB A;  5ENT D;  3ZGQ A;  2BKK B;  3S7J A;  3ZXP A;  3EU5 A;  1Z6T A;  5G55 A;  4Y6W A;  3DXK G;  5CEA A;  3HIZ A;  2WPV A;  1HU3 A;  2V4H C;  1P5Q A;  3U64 A;  2MYO A;  1TNY A;  1N94 A;  2Y3A A;  5G04 C;  4FA6 A;  2X3M A;  4QFV A;  2LAH A;  1MVH A;  3NOG D;  2JAB A;  1MX4 A;  3TWS A;  2CHZ A;  3E37 A;  2RFA A;  2LXL A;  2XGS A;  1X5B A;  3FTX A;  1X81 A;  3ASF A;  3O4Z A;  3FUF A;  5FQ4 A;  3TWQ A;  1H2T C;  2XEH A;  3CK7 A;  4DI3 A;  3FUM A;  3ASG A;  1OCC E;  2NC9 A;  4O30 A;  2FO7 A;  3AS4 A;  1N9A A;  2IFU A;  2EIL E;  3TJP A;  3RKV A;  5CHE E;  1JCQ A;  3NBN B;  4GTR A;  1IXV A;  2L6J A;  1D8D A;  2DIW A;  3NZS A;  5JIY A;  2HYZ A;  2QYJ A;  4HXI A;  1TJC A;  4U07 A;  4JVS A;  5KJM A;  1OWO A;  4ATG A;  1OCZ E;  4LNU D;  3QK0 A;  4B89 A;  3APC A;  3BEE A;  3DPD A;  3APF A;  3L08 A;  3ZYM A;  3SGH A;  5A6C A;  5ENO D;  3NOC D;  3T8K A;  4LEU A;  2XGM A;  2QZA A;  3B7U X;  3ABK E;  4I51 A;  4YVO A;  1Q2Z A;  2BED A;  4WAF A;  2YQ8 A;  2R17 C;  1E8Y A;  1E7V A;  4TUM A;  4GZ6 A;  2FBN A;  4N3C A;  3C3R A;  4O6F A;  1QNF A;  4NQ0 A;  5A7D B;  3D9P A;  4CDM A;  3TWX A;  4HRN A;  3HNA A;  4U8H A;  4DUI A;  3MA5 A;  4Y6C A;  4Z4P A;  3GW4 A;  4QQI A;  3PZ1 A;  3KS2 A;  3AS5 A;  5G04 J;  3SZ7 A;  3UM3 A;  3DSU A;  4GCO A;  4GZ3 A;  3CEQ A;  1OWP A;  1TYQ G;  2RFM A;  3ASD A;  2LSV A;  4CT0 A;  3ML8 A;  3OS5 A;  5BUZ A;  5CED B;  5LFA A;  4HQD A;  5JJ0 A;  2KCL A;  3V30 A;  4G8K A;  2GRQ B;  1DNP A;  3R9A B;  1SZA A;  4G25 A;  2WXJ A;  3Q9N C;  4W9R A;  3CK8 A;  4G24 A;  4AP2 A;  1QBQ A;  3M57 A;  3M55 A;  4U04 A;  3HXE A;  5KJL A;  3ULQ A;  2UY1 A;  1H2V C;  4O1O A;  2WMO A;  5IY5 E;  2Y4T A;  4UI9 K;  1TEZ A;  2VTB A;  4U0U A;  1FVH A;  4JEU A;  3OTN A;  1TNB A;  5JHA A;  1NI1 A;  4BTB A;  3RAU A;  5LP0 A;  3D9I A;  4C48 B;  4I43 A;  2ZGD A;  4UWG A;  2WXK A;  3CVW A;  3MO0 A;  2XCC A;  2XPZ A;  3FU5 A;  3UT4 A;  3OPE A;  3FPD A;  4UQZ A;  2QYU A;  1ZB1 A;  4J7I A;  3CIA A;  4G26 A;  4OYS A;  5KNG A;  4HVB A;  3DRA A;  4K5C A;  3U4T A;  3LCA A;  1RW2 A;  2CG3 A;  4M3O A;  2I9C A;  3SBT B;  5ENN A;  4I17 A;  2ZU6 B;  2F69 A;  2R3A A;  3EHM A;  4XE0 A;  2HE0 A;  4U96 D;  3SFZ A;  4AVX A;  5FIN A;  4FMU A;  4N3A A;  3FTV A;  4NVQ A;  4J8D A;  5KNH D;  3I3N A;  3UKU G;  3IKO B;  5FQ7 A;  1MX2 A;  3P1U A;  1A5E A;  2AXZ A;  4Q69 A;  3BQO A;  3MYV A;  4I6J A;  2YIN A;  1KT1 A;  3KSL A;  4IJ8 A;  4HI9 A;  5T4Y A;  1KLX A;  4I1O B;  4BUP A;  3UI2 A;  4C0M A;  4KBQ A;  3FTY A;  4URK A;  3QDN A;  3DAL A;  4Q96 A;  3AG2 E;  1SA4 A;  3ZEF A;  2VYI A;  2IEJ A;  2XRZ A;  2CG2 A;  2NXP A;  1E90 A;  3F9W A;  1XNF A;  3FUN A;  4MBG A;  3FUI A;  1N54 A;  3M53 A;  2UY1 B;  3FH5 A;  3BO5 A;  1N11 A;  2XEN A;  4ANW A;  3CVQ A;  2XPY A;  3ZFW A;  2WXQ A;  3CBM A;  4LSZ E;  3CK9 A;  3RAY A;  3K9I A;  5CMW A;  4HLL A;  5JJ6 A;  1TN6 A;  3ZYL A;  1OCR E;  2Q7F A;  3DBS A;  3TWU A;  5D0Q D;  4PDX A;  5FTP A;  3CQG B;  3QJZ A;  2J9Q A;  3ABM E;  4WWP A;  1FVF A;  5CMY A;  5LSZ A;  1E96 B;  4LCT A;  3UX4 A;  4AEZ C;  3Q7F A;  4HOR A;  1YCS B;  1O1R A;  4LNG A;  4JHK A;  4XKC A;  4XKB A;  2I1J A;  3PEU B;  4J7F A;  2LNI A;  3MO5 A;  1G3N B;  3SW9 A;  1OWN A;  3CVV A;  1IKN D;  4YND A;  2OVF A;  4AOF A;  4I1A A;  4ACK A;  2I1K A;  4JPS A;  4AV7 A;  1K1B A;  1IQR A;  4JL0 A;  3U3W A;  1DVP A;  5CRU A;  4BEP A;  3EHR A;  1PC2 A;  4OVU A;  2Y0B G;  3URZ A;  3ZIM A;  5M72 A;  3QB2 A;  1DC2 A;  1MT6 A;  4L1B A;  1LF8 A;  2E2E A;  1H2U A;  4RVB A;  1Y6I A;  4HBD A;  3VLF A;  5HI7 A;  3HXF A;  3JQ1 A;  3UIO C;  3QNK A;  2OV8 A;  4GMR A;  3FUH A;  3BG0 B;  4J8S A;  3HRA A;  1MX6 A;  4B8C B;  2BQZ A;  3K5K A;  2DBA A;  4K03 A;  3E33 A;  2OOE A;  3EP0 A;  1HXI A;  1YA0 A;  3G2V A;  3ABL E;  2VGY A;  2A4Z A;  3PZ2 A;  3V31 A;  4ZFH A;  1MUF A;  4R7L A;  4JB8 P;  1OCO E;  2XS1 A;  4TUU A;  1TN7 A;  4ILG A;  1K1A A;  1PY1 A;  2BF0 X;  3EDT B;  5BW8 C;  3SI5 A;  3HHM A;  2VJ8 A;  3D9M A;  5J90 A;  3RO3 A;  2UWJ G;  3PRE A;  4UWL A;  4GZD A;  2WQH A;  2V8S E;  3L16 A;  2J09 A;  5CER B;  3VUZ A;  4UWH A;  3DWL G;  1ELR A;  5T0K A;  2EIM E;  5TH7 A;  4WNF A;  4HS2 A;  2PM6 A;  2NYJ A;  3FEX A;  4GYW A;  5JHN A;  5G05 C;  5AIJ A;  4APO A;  3ESK A;  3OXG A;  2L6B A;  2EQX A;  3EHN A;  1KZP A;  3ENE A;  1FCH A;  4F1S A;  3PUJ A;  2YNQ A;  1KT0 A;  3C5R A;  3B7B A;  3CR3 A;  3SNX A;  3FUK A;  2ETC A;  2P2C P;  3C72 A;  4ANV A;  3OAW A;  4KVM A;  1TN8 A;  1LTX A;  3NQP A;  1Y8M A;  4B94 A;  4TXQ A;  1Z5S C;  2XRY A;  5ENQ D;  3D9H A;  3CHP A;  3CVY A;  1K8K G;  5CCL A;  3QAR A;  1H0A A;  5C2Y A;  3HVE A;  5EID A;  4UQY A;  3CV0 A;  3APD A;  5G2N A;  3SWC A;  1UG3 A;  1Z3Y A;  3MGB A;  1U2V G;  3CHR A;  5CCM A;  4HOT A;  2P9K G;  3PNL B;  2IY0 C;  5LCW C;  5EKQ D;  1HG5 A;  5CBO A;  5BPP A;  4JD2 G;  3TAX A;  3VTX A;  4ANU A;  2F0Y A;  2A5E A;  3GZ2 A;  4CCA A;  1H19 A;  3LYA A;  1MZC A;  4YDY A;  3AAA C;  3B7R L;  2J8S D;  4MI0 A;  4J8O A;  4JHJ A;  3E32 A;  3TXN A;  4CT4 A;  2WXN A;  5FZS A;  4IUL A;  3D3M A;  2GRM A;  4GA1 A;  5TTF A;  2XQ0 A;  4F53 A;  1K3Z D;  1N4S A;  4RSY A;  4L2Y A;  4TXP A;  3KAE A;  4HI8 A;  3D9K A;  3I4R B;  3CBO A;  4WWO A;  3L82 A;  1UJJ A;  3J5Q B;  3CSF A;  3IV0 A;  1XGW A;  4AY6 A;  4GB9 A;  3DPY A;  4HOS A;  4AU7 A;  2XGO A;  1MJ0 A;  3CKB A;  3PDN A;  4GTQ A;  3R7R A;  1EYH A;  1ELW A;  1HZ4 A;  4M7C A;  1TNO A;  1UJK A;  2DCP A;  3RRM B;  1MVX A;  2IF4 A;  3V2O A;  4DX2 A;  3SO8 A;  4G8L A;  4YNM A;  3TXM A;  3DSW A;  2GRO B;  3CLJ A;  5H7P A;  5T5G A;  1BPO A;  3ZU7 B;  5C1D A;  1EDU A;  4JLG A;  2LSU A;  5EYL A;  1S70 B;  3ZN3 A;  1BI8 B;  3ASN E;  4LUN U;  3UM2 A;  2ETA A;  2QPW A;  3CQC B;  3EHQ A;  1WAO 1;  2MRI A;  1BD8 A;  5ANL A;  3SF4 A;  4I2W A;  3FH8 A;  4YDW A;  1JWF A;  2WQ6 A;  1N95 A;  2PQR A;  4BT8 A;  3NB2 A;  2R5S A;  3IHY A;  4MLP A;  4F7A A;  4YDE A;  2OEV A;  5ENR D;  1VDY A;  3DEO A;  2W5Y A;  5KBA A;  4GMJ A;  3CKC A;  3F9Y A;  1SQM A;  2DWZ A;  3MO2 A;  2FEZ A;  3MKR A;  3ULY A;  1HO8 A;  4Q94 A;  4Z68 A;  2KCV A;  4C1Q A;  3SFX A;  3RIB A;  3AJI A;  2RFI A;  1OUV A;  4L23 A;  3S7D A;  5FJY A;  2ILR A;  5F5E A;  1WM5 A;  3S2A A;  1MQS A;  3R9M A;  3D9L A;  4OAV B;  2BTD A;  3LPZ A;  4H12 A;  2WXM A;  3PUK A;  5HKP A;  4LG6 A;  3UQ3 A;  4EHM A;  3S7B A;  2KBX A;  3UKR G;  1TNZ A;  4UWF A;  2P9L G;  4F1P A;  1UN9 A;  2OVB A;  3CVL A;  3KMJ A;  5F6L A;  3JXJ A;  3LJN A;  3R7Q A;  2J07 A;  1DCQ A;  3MKQ A;  2J4B A;  1MYO A;  3TWR A;  3NF1 A;  3RJV A;  3MZL B;  2LXM A;  4N5C A;  5FIO A;  1V55 E;  1JUQ A;  3GZS A;  3ONL A;  2H6I A;  4GPM A;  3PVL A;  2OND A;  4YNP A;  3M59 A;  4V3I A;  2DYS E;  3F9X A;  2X6I A;  2Y69 E;  2Y4U A;  2R05 A;  5CRV A;  3FTU A;  4LNB A;  2W5Z A;  3P2B A;  3B7T A;  4NJ5 A;  5D0O D;  5EYP F;  1B89 A;  5EX0 A;  3DSS A;  3SFY A;  3SHF A;  2C0M A;  3LY8 A;  3D9N A;  3L54 A;  4U7E B;  2GRN B;  4GTT A;  1OWM A;  3TGO A;  4FJZ A;  1KZO A;  3Q78 A;  2I2O A;  3N71 A;  2CFU A;  4JHR A;  2ION A;  1N4R A;  4PS7 A;  3KSQ A;  3MV3 B;  4DX6 D;  4GML A;  3JYS A;  3C3O A;  5FQ6 A;  3T9K A;  3LY9 A;  5EDS A;  3JQ0 A;  5JMN D;  5JA4 D;  3KEZ A;  3JCK C;  5FZR A;  3ISM C;  4MRU A;  4O60 A;  2L9B A;  3CST A;  1S0P A;  3AG4 E;  2E0I A;  3V2X A;  4C0E A;  4PH4 B;  3G2U A;  4FAD A;  1HG2 A;  4EZK A;  3FTS A;  1O5M A;  4GYY A;  1JCR A;  4RG6 A;  4U8Y D;  4O1P A;  5KJK A;  3RK6 A;  4JZY A;  3QWW A;  2QY7 A;  3OOI A;  2WVI A;  4U63 A;  4CRW A;  5FQ8 A;  2XZD G;  5JJ7 A;  4ATZ D;  4I6G A;  2FF4 A;  4KT6 B;  2PNN A;  2AXV A;  1N0Q A;  3U9W A;  2RG8 A;  5AJD A;  4ACL A;  1S64 A;  2WXL A;  4AJW A;  1JWG A;  4A3T A;  1OY3 D;  5EG2 A;  1N3J A;  4L2L A;  4GCN A;  4C9B B;  3FFL A;  5D66 A;  3KMT A;  4B93 B;  4PS8 A;  3MKQ B;  3AS8 A;  3ZW3 A;  4GTV A;  2FI7 A;  1S63 A;  3S7F A;  5KJN A;  3IHX A;  3Q73 A;  3S8P A;  1RZ4 A;  3NAW A;  2VSN A;  1FPP A;  4E6H A;  1TNU A;  5JJT A;  5ANR A;  2KC7 A;  5B1B E;  2WMN A;  1SVX A;  2KCK A;  2IOL A;  4KVO A;  5ENP D;  4GZC A;  4WWN A;  5D2M C;  5T3R A;  4B8A A;  3QWP A;  3B13 A;  5LOZ A;  1GW6 A;  2ZXW E;  4UI9 J;  4JA7 A;  3V79 K;  2EIK E;  3PZD A;  4EEC A;  3FUL A;  1UOH A;  3QAQ A;  3AU5 A;  4H7Y A;  2GW1 A;  2M63 A;  2AW6 A;  1EF1 C;  3HVE B;  4AXH A;  4JXT A;  4CYM D;  5ARF A;  4GA2 A;  4WND A;  4J8Y A;  4KMO A;  5AYF A;  1E8W A;  4BET A;  5AQA A;  3Q4A B;  1ZBP A;  2BUG A;  5EIB E;  1H6O A;  4EZJ A;  2IO3 C;  2KZT A;  1JCS A;  3VV0 A;  4WNE A;  3DEP A;  4F3V A;  3TG4 A;  4L7T A;  2AXU A;  5F6K C;  1SZ9 A;  5A23 A;  4IN3 B;  2VGE A;  2MHK A;  5FT9 A;  3SQV A;  2J49 A;  4FC8 A;  4FUL A;  3UXG A;  2Y1L E;  1AP7 A;  4NRH B;  2VTB B;  3E30 A;  4N5Q A;  4NIK A;  1HH8 A;  4I9E A;  4YPA A;  2OEW A;  3W9F A;  1FT1 A;  2P9I G;  2WM9 A;  1SW6 A;  4EPZ A;  3CHM A;  5CBN A;  3UUX A;  1D8E A;  5BNW A;  2WXO A;  5EX3 A;  1N6C A;  3PEV B;  4B0Z A;  1U3D A;  2AWI A;  1NP7 A;  1L5J A;  5AN8 A;  2WXH A;  3L6A A;  4DLQ A;  4MI5 A;  4KZC A;  1NL4 A;  4U95 D;  2KM4 A;  2HR2 A;  2PM7 A;  1WG0 A;  3ESL A;  2QFC A;  4FU3 A;  4WNG A;  3VLE A;  1W3B A;  4FHJ A;  4BX8 A;  1MHQ A;  3FY4 A;  4QEN A;  4RZ0 A;  2BKG A;  4KXK B;  3EIJ A;  4GU5 A;  4EBA G;  4TRQ A;  5HRY A;  3NZU A;  3Q5M A;  3JXI A;  3HXB A;  1NZN A;  3DSX A;  4KZ0 A;  2G46 A;  3RRU A;  3FH7 A;  3IBE A;  4XEI G;  3EJN A;  5LX8 A;  2WXR A;  1YYH A;  1ZU2 A;  1DCE A;  2F8Y A;  3Q79 A;  2LO6 A;  4HB5 A;  4HOQ A;  4RLY A;  4UWK A;  2X6J A;  2WXP A;  1O9S A;  2CHX A;  3OXL A;  4MS6 A;  3MEK A;  3MV2 B;  3W9G A;  2P9U G;  4RG9 A;  4XX5 A;  3KEA A;  3HYM B;  1YMP A;  3I5P A;  4G2V A;  2R59 A;  3ASH A;  4GA0 A;  5AAO A;  4DX1 A;  2DZO A;  4I2Z A;  3FU6 A;  3G2W A;  1LD7 A;  2DZN A;  3FP3 A;  3ULE G;  4NAC A;  4BFR A;  3BUA A;  3UM0 A;  4DLO A;  1QYM A;  5FWQ A;  4E47 A;  3SY2 A;  1BU9 A;  1N4P A;  3WG7 E;  1O1T A;  2V5Q C;  4RQI A;  3Q15 A;  5LCW J;  2GRP B;  1N52 A;  3DST A;  4NUR A;  3GYZ A;  2VGX B;  3CHS A;  2WXF A;  1O1S A;  4BER A;  1E8Z A;  4IJD A;  2FUL A;  4LRZ A;  3LXU X;  5JIN A;  4IYP A;  2IOS A;  3HDX A;  3ZKJ A;  4XI9 A;  1H6P A;  4XIF A;  2ETB A;  4FJY A;  3L17 A;  4YVQ C;  2C2L A;  5CEC B;  2WQ7 A;  4ME2 A;  3ZXS A;  5JHB A;  3RRN B;  4ILI A;  3G2S A;  2LAI A;  3ZYQ A;  1TJF A;  2X6H A;  3M58 A;  4HLE A;  4OAU C;  4J7W A;  1HF8 A;  3PE3 A;  4GYO A;  3I4G A;  2WXG A;  4A1S A;  3IXE A;  2VSY A;  3EIQ C;  2JV0 A;  3MJW A;  3F6Q A;  5HQ8 A;  2FO1 E;  2B6C A;  3ZRH A;  4J0U A;  3UIP C;  4ANX A;  2XHE A;  3C3Q A;  3AG1 E;  1OT8 A;  2IJG X;  3SD5 A;  4UQX A;  3CVP A;  4TV3 A;  3BG1 B;  3VTY A;  3CVX A;  4U0Z A;  2HO1 A;  4GTS A;  1V54 E;  2L0T B;  2GRL A;  2WXI A;  5AQ7 A;  3ZYK A;  3ML9 A;  3UM1 A;  1E8X A;  1E7U A;  4G1T A;  5G05 J;  3FUD A;  4YDO A;  3B95 A;  3WXX A;  5BV0 A;  3Q49 B;  4G23 A;  4J8F A;  1UN8 A;  2RD0 A;  1WY6 A;  2PZI A;  1BI7 B;  4G11 A;  5DBK A;  4QEP A;  5EIL A;  3UTM A;  2L0I A;  3TWT A;  2MOW A;  3PH0 C;  3JUI A;  1HE8 A;  3QOU A;  4X8Q A;  2X38 A;  1XQH A;  3PRZ A;  2R03 A;  5T8I A;  2IGQ A;  3JUE A;  3KD7 A;  4BWR A;  4JA9 A;  4BT9 A; 
#chains in the Genus database with same CATH homology
 4ACL A;  3D9M A;  1NA0 A;  4AJW A;  2WXL A;  5J90 A;  2J4D A;  2IQC A;  3RO3 A;  1JWG A;  2UWJ G;  2XGS A;  1X5B A;  4A3T A;  3FTX A;  3ASF A;  3PRE A;  4N2Q A;  4ILH B;  3LJ3 A;  4UWL A;  1N3J A;  4K0R A;  5EG2 A;  3O4Z A;  3FUF A;  2WQH A;  4GZD A;  4L2L A;  5FQ4 A;  2V8S E;  4GCN A;  1H2T C;  3L16 A;  3CK7 A;  4DI3 A;  4FHK A;  2WB2 A;  2J09 A;  2VQ2 A;  3FUM A;  4AM9 A;  3ASG A;  4C9B B;  3FFL A;  3KMT A;  4H7X A;  4PS8 A;  2XEV A;  3MKQ B;  3VUZ A;  2NC9 A;  4UWH A;  3AS8 A;  4O30 A;  3PNT B;  1ELR A;  3ZW3 A;  2FO7 A;  2FI7 A;  3AS4 A;  4DK5 A;  2IFU A;  3S7F A;  5KJN A;  3TJP A;  4KYO B;  5T0K A;  3RKV A;  2J08 A;  3IHX A;  5CHE E;  3S8P A;  5TH7 A;  2L6J A;  4WNF A;  3Q47 B;  5E75 A;  4HS2 A;  2PM6 A;  3FEX A;  4GYW A;  5JHN A;  5G05 C;  5AIJ A;  4APO A;  2VSN A;  3RO2 A;  3DB5 A;  2DIW A;  3ESK A;  3NZS A;  4D10 C;  4EQF A;  5JIY A;  3OXG A;  2HYZ A;  2EQX A;  3CHQ A;  3EHN A;  5C2Y A;  4E6H A;  3ENE A;  1TJC A;  1FCH A;  4HXI A;  4PS3 A;  4U07 A;  2V4L A;  5JJT A;  4F1S A;  5ANR A;  2KC7 A;  3PUJ A;  2YNQ A;  1KT0 A;  4JVS A;  5KJM A;  3CR3 A;  3SNX A;  1OWO A;  2WMN A;  3FUK A;  4ATG A;  3SBS A;  5E76 A;  3QK0 A;  3T5V A;  1H6K A;  2KCK A;  3APC A;  4ANV A;  4B89 A;  2IOL A;  3OAW A;  3RQ4 A;  4KVO A;  3BEE A;  3DPD A;  4GZC A;  4WWN A;  4KVM A;  3APF A;  3L08 A;  2VGX A;  4BY6 A;  3NQP A;  3G2T A;  5T3R A;  3ZYM A;  4B8A A;  3QWP A;  3SGH A;  1Y8M A;  3CBP A;  5A6C A;  3B13 A;  4B94 A;  5LOZ A;  1GW6 A;  2XRY A;  3LVQ E;  4UI9 J;  4JDS A;  4LEU A;  2XGM A;  4A3V A;  3CHP A;  4JA7 A;  3B7U X;  3CVY A;  4I51 A;  3LVR E;  4YVO A;  3LS8 A;  1JPL A;  3PZD A;  4EEC A;  4WAF A;  3FUL A;  2YQ8 A;  2R17 C;  3QAQ A;  3QAR A;  3UMV A;  5CCL A;  1E8Y A;  1H0A A;  3AU5 A;  1E7V A;  3O48 A;  4H7Y A;  2FBN A;  3HVE A;  2V0P A;  4GZ6 A;  2GW1 A;  4N3C A;  2M63 A;  3CV0 A;  4O6F A;  4UQY A;  3APD A;  1QNF A;  3VLD A;  4NQ0 A;  4CGW A;  5G2N A;  5A7D B;  3UT7 A;  3D9P A;  3SWC A;  4CDM A;  2AW6 A;  1UG3 A;  4UI9 C;  1Z3Y A;  3MGB A;  3HNA A;  3ZVV A;  1IQU A;  3CHR A;  3E4B A;  5BV1 A;  4U8H A;  5CCM A;  4GZ5 A;  1EF1 C;  4HOT A;  4BX9 A;  3MCX A;  3MA5 A;  3PNL B;  2O8J A;  5LCW C;  3CVN A;  2VSO E;  4Y6C A;  3HVE B;  4Z4P A;  1OWL A;  3GW4 A;  5EKQ D;  4JXT A;  4AXH A;  3KS2 A;  3AS5 A;  5ARF A;  5G04 J;  1HG5 A;  3SZ7 A;  4GA2 A;  4GCO A;  4GZ3 A;  5BPP A;  3CHO A;  3CEQ A;  4WND A;  4GAA A;  3TAX A;  4BSX A;  2PQN A;  3ZHE B;  1OWP A;  4KMO A;  5AYF A;  1E8W A;  3VTX A;  4ANU A;  5TEG A;  1HFA A;  3GZ2 A;  3Q4A B;  1ZBP A;  2BUG A;  4CCA A;  3ASD A;  4LER A;  4EZJ A;  2LSV A;  1H19 A;  2KZT A;  3LYA A;  4CT0 A;  3ML8 A;  3VV0 A;  3B7R L;  3OS5 A;  4WNE A;  4MI0 A;  5BUZ A;  4F3V A;  5LFA A;  4J8O A;  4JHJ A;  2XCB A;  3TXN A;  4XZ4 A;  4JC8 A;  3TG4 A;  5JJ0 A;  4L7T A;  2AXU A;  3L22 A;  4CT4 A;  2KCL A;  5F6K C;  1SZ9 A;  2WXN A;  5FZS A;  3T8M A;  4IUL A;  3D3M A;  3LY7 A;  5A23 A;  4IN3 B;  2MHK A;  2GRM A;  4GA1 A;  5FT9 A;  2J49 A;  2X6F A;  4FC8 A;  4FUL A;  5TTF A;  2XQ0 A;  4F53 A;  2KZT B;  1DNP A;  4NRH B;  4LDG A;  3R9A B;  1SZA A;  4G25 A;  2VTB B;  4RSY A;  2WXJ A;  4L2Y A;  4W9R A;  3KAE A;  3CK8 A;  4PUC A;  1HH8 A;  4JW1 A;  3D9K A;  3I4R B;  4I9E A;  3CBO A;  4YPA A;  4WWO A;  4G24 A;  4AP2 A;  1IYG A;  2P58 C;  2WM9 A;  3M57 A;  1UJJ A;  3FTZ A;  3M55 A;  2AVP A;  3CSF A;  4U04 A;  5J08 A;  3IV0 A;  5KJL A;  3ULQ A;  1XGW A;  2UY1 A;  4EPZ A;  1H2V C;  3CHM A;  4AY6 A;  4GB9 A;  3UUX A;  5FZQ A;  3TL5 A;  2WMO A;  4HOS A;  5BNW A;  2WXO A;  2Y4T A;  4I9C A;  5EX3 A;  4UI9 K;  1TEZ A;  2VTB A;  4U0U A;  4AU7 A;  2XGO A;  1FVH A;  4JEU A;  1N6C A;  3PEV B;  3KMA A;  3OTN A;  4B0Z A;  1U3D A;  3CKB A;  3PDN A;  5JHA A;  2AWI A;  1NP7 A;  4BTB A;  3FTW A;  1L5J A;  1EYH A;  3R7R A;  1ELW A;  2WXH A;  4EZL A;  3L6A A;  4DLQ A;  1HZ4 A;  5LP0 A;  3D9I A;  1UJK A;  2DCP A;  4KZC A;  3RRM B;  1MVX A;  3M56 A;  4MI5 A;  2IF4 A;  4XI0 A;  4I43 A;  2KM4 A;  1NA3 A;  2HR2 A;  2PM7 A;  4UWG A;  5KCM A;  4DPR A;  3ESL A;  4I1M A;  3QC1 A;  1IHG A;  2WXK A;  4N39 A;  3CVW A;  2QFC A;  3MO0 A;  4FU3 A;  4WNG A;  2XCC A;  2XPZ A;  4YNM A;  3VLE A;  3FU5 A;  4A1G A;  1W3B A;  4FHJ A;  3TXM A;  4BX8 A;  3UT4 A;  3OPE A;  4GPK A;  1MHQ A;  3CLJ A;  4UQZ A;  3FPD A;  3FY4 A;  4QEN A;  5T5G A;  1BPO A;  4HOU A;  4J7I A;  3CIA A;  3FU3 A;  5C1D A;  1INZ A;  1EDU A;  4JLG A;  4RZ0 A;  3M5A A;  2LSU A;  2IU1 A;  4G26 A;  4OYS A;  4KXK B;  3T5X A;  4HVB A;  3EIJ A;  1U3C A;  3U4T A;  3LCA A;  3ZN3 A;  4GU5 A;  5AJL A;  4EBA G;  3ZPJ A;  4TRQ A;  2CG3 A;  4M3O A;  4LUN U;  2I9C A;  1EPU A;  3NZU A;  3Q5M A;  3SBT B;  4P29 A;  5ENN A;  2JEK A;  2ZU6 B;  4I17 A;  3UPV A;  2I6H A;  2F69 A;  2QPW A;  3CQC B;  3EHM A;  2R3A A;  4XE0 A;  1NZN A;  4KZ0 A;  2G46 A;  1WAO 1;  2MRI A;  3RRU A;  3SFZ A;  3FH7 A;  4FLH A;  4AVX A;  5ANL A;  4DI4 A;  3IBE A;  2YHE A;  3EJN A;  3SF4 A;  5LX8 A;  2WXR A;  4I2W A;  4FMU A;  4N3A A;  1ZU2 A;  3D9J A;  3FH8 A;  3FTV A;  1JWF A;  2WQ6 A;  4NVQ A;  4J8D A;  4N2S A;  4OVV A;  3FHE A;  3I3N A;  2PQR A;  2LO6 A;  3IKO B;  4BT8 A;  3FWV A;  4HOQ A;  5FQ7 A;  2R5S A;  4UWK A;  3IHY A;  2XPI A;  4YPU A;  2X6J A;  4MLP A;  5DIZ A;  3C98 A;  4F7A A;  3PS6 A;  2WXP A;  3P1U A;  1O9S A;  1VDY A;  2W5Y A;  2CHX A;  3OXL A;  4GMJ A;  2AXZ A;  4CDN A;  3CKC A;  4MS6 A;  3ZHE A;  3MEK A;  3MV2 B;  4Q69 A;  3MYV A;  4RG9 A;  4XX5 A;  1A17 A;  2PL2 A;  4I6J A;  3F9Y A;  1SQM A;  2YIN A;  1KT1 A;  4IRU A;  1ML9 A;  3HYM B;  4IJ8 A;  3CVU A;  5T4Y A;  4MKT A;  3GZ1 A;  4J6I A;  3I5P A;  4AIF A;  3MO2 A;  4G2V A;  2R59 A;  3ASH A;  1KLX A;  2FEZ A;  4GA0 A;  3LKU A;  4I1O B;  3MKR A;  4U0S A;  4CDR A;  4EBA A;  4BUP A;  4I2Z A;  3FU6 A;  3G2W A;  1HO8 A;  4Q94 A;  4C1Q A;  2KCV A;  4C0M A;  3U66 A;  4CGV A;  1PAQ A;  4KBQ A;  3RIB A;  3FP3 A;  4NAC A;  2RFI A;  3FTY A;  4BFR A;  2V5F A;  4URK A;  1OUV A;  3QDN A;  3DAL A;  4Q96 A;  4L23 A;  3RU0 A;  5LSX A;  3S7D A;  4DLO A;  3OXF A;  5FWQ A;  4E47 A;  3ZEF A;  2VYI A;  3D9O A;  5FJY A;  4N3B A;  3IEG A;  2XRZ A;  3FEY A;  2CG2 A;  2NXP A;  1E90 A;  3F9W A;  2ILR A;  5F5E A;  1XNF A;  1WM5 A;  3S2A A;  4CEM A;  5BT1 A;  1MQS A;  3FUN A;  3Q15 A;  5LCW J;  3D9L A;  2BTD A;  1N52 A;  3LPZ A;  4A55 A;  4NUR A;  3GYZ A;  4H12 A;  3FUI A;  2WXM A;  2VGX B;  3CHS A;  1N54 A;  2WXF A;  3PUK A;  3M53 A;  4J8E A;  2UY1 B;  1HX8 A;  1E8Z A;  3FH5 A;  3BO5 A;  4IJD A;  3FDH A;  3B7S A;  2FUL A;  3UQ3 A;  4ANW A;  3CVQ A;  4LRZ A;  3S7B A;  2XPY A;  3FUJ A;  3LXU X;  3ZFW A;  5JIN A;  4IYP A;  2IOS A;  2WXQ A;  3HDX A;  3CBM A;  3RJW A;  4UWF A;  3CK9 A;  4XI9 A;  4BTA A;  4J83 A;  3RAY A;  1UN9 A;  2OVB A;  3CVL A;  3K9I A;  3LDZ A;  5CMW A;  3KMJ A;  5F6L A;  3SI5 A;  4XIF A;  5JJ6 A;  3FU0 A;  4FJY A;  3L17 A;  4JEH A;  3MX3 A;  4YVQ C;  3ZYL A;  1HS6 A;  2C2L A;  3R7Q A;  1ZKK A;  2WQ7 A;  2J07 A;  3CGH A;  2Q7F A;  4ME2 A;  3ZXS A;  3MKQ A;  3DBS A;  2J4B A;  2KAT A;  5JHB A;  1H3I A;  5D0Q D;  4PDX A;  3RRN B;  5FTP A;  3CQG B;  3QJZ A;  3NF1 A;  2CHW A;  2J9Q A;  4ILI A;  3G2S A;  2LAI A;  3ZYQ A;  3MZL B;  2GGF A;  1TJF A;  5AJD A;  2X6H A;  1Z3X A;  3FUE A;  1FVF A;  4WWP A;  3RJV A;  4N5C A;  3M58 A;  3ONK A;  4YPE A;  5CMY A;  4HLE A;  1JUQ A;  3GZS A;  5LSZ A;  1E96 B;  3ONL A;  1HF8 A;  3PE3 A;  4LCT A;  3UX4 A;  3M54 A;  4GYO A;  4AEZ C;  3PVL A;  4WUY A;  3I4G A;  4HOR A;  2WXG A;  4XKC A;  2NSZ A;  4JHK A;  4XKB A;  3TG5 A;  4A1S A;  2I1J A;  3IHV A;  2OND A;  4YNP A;  3M59 A;  1UW4 B;  4V3I A;  3PEU B;  3F9X A;  2X6I A;  4J7F A;  2LNI A;  3MO5 A;  3SW9 A;  2Y4U A;  1OWN A;  1N6A A;  3FTU A;  4ABN A;  2VSY A;  3AU4 A;  3EIQ C;  3CVV A;  2JV0 A;  3P2B A;  2JLB A;  3MJW A;  3PE4 A;  3B7T A;  2W5Z A;  4NJ5 A;  5HQ8 A;  5D0O D;  5CPR B;  4YND A;  2OVF A;  3ZRH A;  4AOF A;  4J0U A;  4E85 A;  1B89 A;  4I1A A;  5EX0 A;  5AYW D;  4ACK A;  2I1K A;  2YHC A;  3QWV A;  4QEO A;  4JPS A;  4AV7 A;  4ANX A;  3SHF A;  2C0M A;  3LY8 A;  4FP7 A;  2XHE A;  3D9N A;  3L54 A;  1IQR A;  3UT8 A;  4JL0 A;  3U3W A;  5AEN A;  2IJG X;  1OWM A;  3TGO A;  3SD5 A;  4UQX A;  4DJA A;  1DVP A;  2C0L A;  2CFZ A;  4FJZ A;  4HFG A;  3CVP A;  1PC2 A;  2I2O A;  4OVU A;  1ELK A;  3N71 A;  4AY5 A;  2HM8 A;  4TV3 A;  1QQE A;  3URZ A;  2CFU A;  2X6K A;  4JHR A;  2ION A;  3BG1 B;  3VTY A;  3ZIM A;  3CVX A;  3LEW A;  5M72 A;  4PS7 A;  3QB2 A;  3MV3 B;  1MT6 A;  4U0Z A;  5ARG A;  2HO1 A;  1LF8 A;  4GML A;  4L1B A;  2E2E A;  3JYS A;  5FQ6 A;  1H2U A;  2L0T B;  4RVB A;  1Y6I A;  3LY9 A;  1PEG A;  5F59 A;  2GRL A;  3VLF A;  2WXI A;  2A5U A;  2VSX E;  3L13 A;  5HI7 A;  3JQ1 A;  3ZYK A;  5EDS A;  3JQ0 A;  5T0M A;  3F9Z A;  3QKY A;  3QNK A;  2OV8 A;  3ML9 A;  3KEZ A;  1E8X A;  3FUH A;  3JCK C;  5FZR A;  1E7U A;  3BG0 B;  4J8S A;  1QZ2 A;  4MRU A;  4I6E A;  4APF A;  4G1T A;  5G05 J;  4FLB A;  2L9B A;  3FUD A;  4B8C B;  2BQZ A;  3CST A;  1S0P A;  2E0I A;  3WXX A;  2DBA A;  3ZGQ A;  3K5K A;  4K03 A;  5BV0 A;  3Q49 B;  2OOE A;  4G23 A;  4PH4 B;  3S7J A;  4C0E A;  3EP0 A;  3G2U A;  4FAD A;  4J8F A;  1HG2 A;  1UN8 A;  4EZK A;  1Z6T A;  2RD0 A;  3FTS A;  5G55 A;  4Y6W A;  1WY6 A;  2PZI A;  4GYY A;  4RG6 A;  4G11 A;  5DBK A;  5KJK A;  4QEP A;  3RK6 A;  1HXI A;  2WPV A;  2L0I A;  1YA0 A;  3G2V A;  3HIZ A;  4JZY A;  1HU3 A;  2QY7 A;  3QWW A;  2VGY A;  3OOI A;  1P5Q A;  2A4Z A;  2MOW A;  3PH0 C;  3U64 A;  2WVI A;  3JUI A;  1MUF A;  4U63 A;  4CRW A;  4R7L A;  5FQ8 A;  1HE8 A;  2Y3A A;  4TUU A;  5JJ7 A;  5G04 C;  4I6G A;  2FF4 A;  4FA6 A;  4ILG A;  4KT6 B;  2X3M A;  4QFV A;  2AXV A;  3QOU A;  2X38 A;  1XQH A;  3PRZ A;  2LAH A;  5T8I A;  1PY1 A;  3U9W A;  2BF0 X;  2IGQ A;  3EDT B;  3KD7 A;  4BWR A;  5BW8 C;  1MVH A;  4JA9 A;  2RG8 A;  4BT9 A;  2CHZ A;  3HHM A;  2VJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...