3S7JA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 148
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7jA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7jA01
2WPVA 1OUVA 3OPEA 4BWRA 3AS4A 4N3CA 4I9CA 1ZKKA 2KCKA 4WNDA 4YPEA 4I2WA 4GYOA 4G2VA 3M54A 2R5SA 5DIZA 3GZ2A 5FZSA 2IGQA 3DB5A 4I1AA 2FEZA 5CHEE 3LKUA 5DBKA 3KMJA 2KCLA 3MA5A 4N5CA 5F5EA 1MVHA 3OXFA 5G05C 2LNIA 2C0LA 1KT0A 1P5QA 3ASGA 3LCAA 4G25A 5LCWC 3UQ3A 1MVXA 3CBOA 4RG9A 4GYWA 2I6HA 1KLXA 1B89A 4U0ZA 5CCMA 4FMUA 5TTFA 3Q47B 2XCCA 1O9SA 4J8DA 4BTAA 1N3JA 4YPAA 3QWVA 4UI9C 4GZ5A 4G24A 1YA0A 2VSYA 4IN3B 5T0KA 3HNAA 1HXIA 5KJNA 4E47A 5BW8C 4GCOA 3AS5A 3RJWA 1QQEA 5JJ7A 2DBAA 1IYGA 1MUFA 4J8OA 4Z4PA 3Q15A 4G1TA 2HYZA 3RJVA 1XQHA 4G26A 2HR2A 2VQ2A 4QENA 5ARFA 3ASFA 3MO2A 4MI0A 4CDRA 4J83A 4GZ6A 5ARGA 4AY5A 3U4TA 3S7JA 4JA9A 4WNGA 4WNFA 3BO5A 2BUGA 5LSZA 4J8EA 2V5FA 4UI9K 3UPVA 1MT6A 3MEKA 4GA0A 5AYWD 3M57A 2QFCA 3UUXA 3GW4A 3CVNA 4HORA 3SZ7A 3CBPA 1WM5A 3NF1A 4W9RA 5JJTA 3RIBA 3S8PA 3RU0A 3KAEA 2ONDA 1NA3A 4BT9A 4GCNA 3GYZA 4QEPA 4GZ3A 4I51A 5KJLA 2L6JA 4IJDA 5JJ6A 4LDGA 4N39A 3SW9A 2G46A 3KMAA 2J9QA 2PQNA 3ULQA 3AS8A 2VYIA 3TAXA 5EG2A 4H7XA 4AY6A 3ASDA 2UY1B 4HOSA 1ELWA 2C2LA 5TH7A 1W3BA 2AVPA 3ZHEB 3QWWA 3F9YA 1IHGA 1ZU2A 4HOQA 5G04J 5EKQD 1KT1A 5D0OD 2PL2A 5F6LA 3LYAA 4UQXA 5FT9A 3CKBA 3MV3B 4GA1A 1N6AA 2YQ8A 3WXXA 2PZIA 2YHCA 5HI7A 4U0UA 4ABNA 2XGMA 1H3IA 1NZNA 4RZ0A 4NRHB 4NJ5A 3CBMA 5FZQA 3ZN3A 2UWJG 4UQYA 4H12A 3RO3A 3OOIA 5JHNA 3FP3A 4UQZA 3MO5A 4RG6A 5KJKA 1WAO1 2NC9A 4HOUA 4I2ZA 3S7FA 3ESKA 5F59A 4JLGA 3LY8A 2BQZA 2VSNA 5T0MA 4APOA 5JJ0A 3KD7A 4U07A 3CK9A 5D0QD 4AM9A 3LPZA 3MO0A 3CVPA 3PDNA 3VTXA 4C1QA 3S7DA 5F6KC 3KMTA 4F3VA 4J0UA 1FCHA 3GZ1A 4Y6WA 4BTBA 1NA0A 4JL0A 5A7DB 5G04C 3CVLA 3FFLA 2KCVA 3SF4A 2UY1A 2Y4UA 3VUZA 4B94A 2FBNA 3F9WA 2FO7A 5A6CA 4KXKB 4YVQC 3ZHEA 1N6CA 2IF4A 3FWVA 1Y8MA 1PEGA 4YNPA 4N2SA 3CKCA 3F9XA 2LSVA 1HZ4A 3QWPA 4EQFA 3HYMB 3BEEA 5JINA 3MKRA 5EX0A 2JV0A 3M53A 3PE4A 3ZFWA 3QKYA 4G23A 4IJ8A 4GPKA 5JIYA 5EX3A 3URZA 2WQHA 2HO1A 1ML9A 4QEOA 5M72A 4J7IA 3Q49B 1PC2A 3QOUA 4HOTA 5FTPA 3OS5A 3OXLA 4BUPA 3CK7A 2VGYA 4N3BA 2VGXA 2FF4A 3EP0A 5HQ8A 3O48A 3FPDA 4YNDA 4CGWA 2KATA 4ME2A 4AIFA 4NVQA 3RKVA 2C0MA 5KJMA 3M59A 3ZPJA 3U3WA 4YNMA 4GA2A 5T5GA 4N3AA 3K9IA 3M56A 3IHXA 4AU7A 3Q5MA 3QDNA 5CPRB 2E2EA 3DALA 2QPWA 3IEGA 1HH8A 4A1SA 3PE3A 2VGXB 2Q7FA 1ELRA 2Y4TA 3TG4A 4LEUA 3EDTB 4I17A 4JHRA 3RO2A 4J8FA 3CEQA 3OXGA 4YPUA 3Q4AB 2LSUA 2P58C 5BT1A 3E4BA 5CCLA 3R9AB 2XGOA 3ZGQA 4U04A 5C1DA 2F69A 3JYSA 3CVQA 3N71A 4CGVA 3M5AA 4JDSA 3CK8A 4N2QA 3ASHA 5TEGA 3RQ4A 5FJYA 3F9ZA 3M58A 1ZBPA 5G05J 1XNFA 2IFUA 4J7FA 4KYOB 5BNWA 4MI5A 3M55A 4YVOA 1QZ2A 2XGSA 4BT8A 2R3AA 2GW1A 3MV2B 3VV0A 2XEVA 5LCWJ 4GYYA 4XI0A 2PQRA 2JLBA 3TGOA 4WUYA 1A17A 1E96B 4O6FA 2MHKA 2FI7A 4KBQA 3SWCA 4H7YA 4JA7A 3KS2A 2XCBA 3RAYA 1TJCA 3LY9A 4Y6CA 5LSXA 2KC7A 3CV0A 4UI9J 2RFIA 2XPIA 3TG5A 3S7BA 4U0SA 4I9EA 2W5YA 5FZRA 2OOEA 4WNEA 3VTYA 5AYFA 4O30A 3K5KA 3LY7A 2W5ZA 2O8JA 4XI9A 4XIFA 4NQ0A
chains in the Genus database with same CATH superfamily
4GB9A 3UX4A 4HFGA 3AS4A 4N3CA 3HXCA 2BKGA 2KCKA 3NAWA 5DIZA 2IGQA 3G2VA 4GTRA 5EIDA 4LCTA 5CHEE 2ZIRA 1FT1A 2LXMA 3ZEFA 3U9WA 3JUEA 1D8EA 2XRZA 4XEIG 5JA4D 2C0LA 3F6QA 5KBAA 1KT0A 3FU5A 4ILHB 5AAOA 3FUHA 3CHPA 1BPOA 3G2TA 3UQ3A 1MVXA 3CBOA 5J90A 3P2BA 4U0ZA 4YDYA 3R7RA 3Q47B 3DSSA 2VGEA 1N3JA 1QYMA 2ZU6B 4EZJA 4IN3B 4C0EA 3HNAA 5ITZF 5FWQA 3G2WA 1NP7A 3KSQA 4ANWA 3AS5A 3I4GA 3RJWA 2WXFA 3EIQC 1MUFA 3Q15A 4CEMA 5ENPD 3NB2A 1TNYA 4CDRA 4BESA 1OWLA 4GZ6A 3AAAC 1JCRA 5ENQD 4AY5A 4ATZD 3S7JA 4WNGA 4OVUA 4P29A 3AG1E 2A5EA 4UI9K 4KZ0A 4LRZA 3E33A 1O5MA 3GW4A 3SZ7A 2R05A 4A63B 2WXQA 5JJTA 5AENA 3RIBA 3SBSA 3RU0A 3V2XA 3KAEA 1BI8B 1NA3A 4QEPA 4J7WA 5KJLA 1N95A 5A23A 1H6KA 2L6JA 3PRZA 1UJJA 4N39A 1EF1C 3E30A 2PQNA 5G2NA 4L1BA 3CSTA 2X3MA 4H7XA 3RRUA 4JB8P 2C2LA 5TH7A 2A5UA 3Q79A 5ANLA 4LSZE 1N0RA 1N52A 1KT1A 2VTBA 1E7VA 1HF8A 2IONA 3HXDA 4U0UA 2WXKA 4ABNA 2XEEA 2WQ7A 2XGMA 4AXHA 4DX5D 1U3DA 4UUCA 3CIAA 5CBNA 2OV8A 1OWOA 3L82A 5FZQA 4UQYA 3I3NA 3DEPA 2ZGDA 4JEHA 3UMVA 4UQZA 3MO5A 3PZ4A 4RG6A 5KJKA 3SQVA 4U8VD 4JLGA 3ML8A 2VSNA 5JJ0A 1IQRA 5D0QD 4DX6D 3CGHA 4AM9A 2ZISA 5T3RA 3LEWA 4HI8A 2OEWA 1X81A 3L08A 3VTXA 3DSWA 2KXPC 4C1QA 3X2QE 1KZPA 4LG6A 2YINA 3I4RB 3KSLA 4F3VA 3IBEA 4Y6WA 3CR3A 2QC9A 1OWNA 3JXIA 1WG0A 1E8YA 3ZNGA 5ANRA 3FFLA 2DYRE 4HB5A 3QB2A 2L0TB 4MRUA 3F9WA 3PREA 5ENRD 2YHEA 3FTUA 5A6CA 1TN6A 2LAIA 4KXKB 4YVQC 4GMJA 1OWMA 3UKRG 4ZHBA 4N2SA 3CKCA 1HZ4A 1SQMA 4EQFA 3HYMB 5JINA 3ASNE 3MKRA 2JV0A 1BLXB 2GRMA 2F8YA 2YNQA 3D9JA 3UINC 4DX2A 4GPKA 3D9LA 4C9BB 2XS1A 1D8DA 4DI4A 4DLQA 5EYPF 4EECA 3Q49B 2P9SG 4HOTA 5FTPA 3OS5A 2WXMA 3CK7A 4GTTA 5JHBA 4N3BA 3RK6A 3QARA 3O48A 1YMPA 3L6AA 4CGWA 1KPSB 2CHWA 2KATA 2DZNA 4EPZA 4ME2A 2LUHA 3RKVA 2C0MA 3EU5A 2RG8A 4YDWA 5KJMA 3FUIA 3Q9UC 4YNMA 3FUDA 4U8HA 4J6IA 2B6CA 3IHXA 3Q5MA 2FO1E 3QDNA 3CQCB 3DALA 2QYUA 4UWHA 2NSZA 3IHVA 2LO6A 4JHJA 1ELRA 4HRNA 2Y4TA 3TG4A 3EDTB 2Y69E 3CEQA 2WXPA 2LSUA 4MKTA 3UT8A 4J8YA 3E4BA 5B3SE 2XGOA 5C1DA 2P9LG 1N4PA 3B7RL 4PDXA 1OCOE 2KZTA 3CVQA 3M5AA 1IHBA 3APDA 1GW6A 2ETAA 5FJYA 3MCXA 5CBOA 5G05J 3ENEA 3PUKA 5BNWA 2ETBA 2KM4A 4BT8A 5AQ7A 3HDXA 3VV0A 4I6GA 2XEVA 4GYYA 2L6BA 2JLBA 3J5PA 4WUYA 1A17A 4FHJA 5T8IA 2IY0C 3L9TA 4I6JA 4FJYA 3SWCA 4FU3A 2I1JA 1TJCA 1Y6IA 4Y6CA 3CV0A 3HXBA 4JHKA 2XPIA 3UT4A 3SD5A 3LDZA 5FZRA 4ATGA 4QQIA 2DVWA 4F6RD 3NBNB 3K5KA 3CHRA 4A3TA 4XIFA 3EJNA 3UIPC 4TXRA 3SFYA 3LVQE 4UWFA 4E85A 4CYMD 4G2VA 2IOSA 2R5SA 5FZSA 4O1PA 4ANUA 5EYLA 3V2OA 4DX1A 2FEZA 3KMJA 2KCLA 3HHMA 3TWQA 1UN9A 3PZ2A 4N5CA 3FUNA 2I2OA 5T4YA 4RVBA 4DLOA 3AG2E 3ASGA 2ZXWE 2WXGA 4G25A 2HE0A 4RG9A 2GRNB 4GYWA 3HG0D 3O4ZA 1B89A 4FMUA 4DI3A 4RQIA 2P2CP 3FY4A 2WQ6A 5AIJA 3T5VA 1JUQA 3Q7AA 1HS6A 1HG2A 4J8DA 3W9GA 1YA0A 4CDNA 5KJNA 3QC1A 1MQSA 3TWTA 4O1OA 3FTVA 4J8OA 4Z4PA 3HIZA 2HYZA 3RAUA 4A55A 2VQ2A 4PS3A 3ZXPA 3FTWA 4KT6B 4JA9A 4WNFA 5EDSA 3AJIA 5LSZA 3JQ0A 3MZLB 5JMND 4GTSA 4GA0A 2Y0BG 3CHQA 3ASOE 3CBPA 2DZOA 3NF1A 2WM9A 2P9KG 5CEAA 3OAWA 2XHEA 4DX7D 2BF0X 3G2SA 3MX3A 4TXPA 4CT4A 4MS6A 2VSXE 1E8ZA 4IJDA 3KMAA 1S64A 3ULQA 3AS8A 2RFMA 2VYIA 2P9PG 3EHQA 4ILIA 4B93B 5AARA 4YDEA 4AY6A 5FQ8A 4DRXE 3L54A 1W3BA 2QY7A 4HXIA 5IY5E 4HS2A 4OVVA 3J5QB 4L9PA 4GTVA 5F6LA 4LUNU 4TUMA 2AXVA 5FQ6A 3I5PA 2CHZA 1N6AA 5HS0A 1S70B 2PZIA 2YHCA 3UKUG 4ANXA 4N5QA 3IV0A 4RZ0A 2R2LA 3TWRA 4NRHB 2RKKA 3NZUA 3NZSA 1Z3YA 3RO3A 3OOIA 5JHNA 1MHQA 5CEDB 1X5BA 2VTBB 1WAO1 4HOUA 5HKPA 3NQPA 1MYOA 2I1KA 3DPYA 3IXEA 5T0MA 2P9UG 2J4BA 4BX9A 1IXVA 3ABKE 1SZ9A 3MO0A 4JD2G 5J08A 1OWPA 3SFXA 3KMTA 1AP7A 2X6IA 4PH4B 5LFAA 1QBQA 5G04C 3RRMB 2KCVA 3SF4A 2Y4UA 3EHRA 1UOHA 2FBNA 4NIKA 3ZYMA 4M3OA 3ULYA 1TN7A 3JXJA 1N6CA 2IF4A 2WMNA 3FWVA 1Z5SC 4K5CA 4F1PA 1FVFA 1PEGA 4YNPA 4JPSA 2H6HA 1DNPA 2LSVA 1O1RA 3APCA 4AOFA 5EX0A 3MYVA 3M53A 4I6EA 3T8MA 4B8AA 5B1AE 3PE4A 1BI7B 3ABLE 1TEZA 5D66A 3LS8A 4HLEA 3KEZA 2DYSE 3BUAA 1ML9A 4BSXA 4J7IA 1SA5A 1OT8A 3B7UX 4CCAA 4BUPA 1DCEA 3Q7FA 4G11A 3ISMC 2VGXA 2FF4A 1N4RA 3OTNA 1TNUA 5EN5D 3UM0A 4K5AB 3FPDA 3FULA 2WB2A 4YNDA 3KEAA 1PY1A 3T5XA 4AIFA 3ZYQA 4AVXA 1PAQA 2RFAA 1TNOA 4APFA 5CERB 4GA2A 5T5GA 1E8WA 2R59A 2X6KA 5AQ9A 4AU7A 4DUIA 1DC2A 1HH8A 2J07A 3PE3A 4AJWA 3Q9NC 2WXHA 3UXGA 5BV1A 4LEUA 4JHRA 4IRUA 4J8FA 4L2LA 3OXGA 4WWOA 5BXOA 5BT1A 3MKQA 2DCPA 3FDHA 5ENTD 2PNNA 2NYJA 3FUJA 1UW4B 5CRVA 3N71A 4KVMA 4JC8A 2BTDA 4JDSA 3ASHA 4FLHA 5TEGA 3RQ4A 3M58A 4GAAA 4G8KA 4J7FA 3UM2A 4KYOB 3E32A 4MI5A 4YVOA 1QZ2A 2ZGGA 3RRNB 2CFZA 3SO8A 2GW1A 3AU4A 3TGOA 2JABA 4EBAA 3CHMA 4XE0A 3EU9A 2ILRA 3ZW3A 4H7YA 1E7UA 2KZTB 3KS2A 2XCBA 3B7SA 3LY9A 2KC7A 2PM7A 2RFIA 4FHKA 4E6HA 4PS7A 3TG5A 5G55A 3S7BA 2MYOA 4WNEA 5AYFA 1S0PA 3DPDA 4U8YD 1QNFA 2CHXA 3Q75A 1HG5A 3GZSA 1NFIE 1U2VG 4KVOA 2O8JA 3VLFA 4NQ0A 4B0ZA 4I9CA 1ZKKA 3ESLA 4WNDA 1O1TA 4GYOA 3FTZA 1JPLA 4GMLA 3M54A 3GZ2A 1DVPA 4I1AA 1N9AA 2EIJE 2EIME 3TJPA 2L0IA 3LKUA 2EINE 3ABME 4L7TA 1V54E 5JHAA 4ACLA 3BU8A 3PS6A 1MVHA 3OXFA 2LNIA 3BG1B 1MJ0A 3FEYA 3LCAA 2FULA 3DXMG 3D9HA 5LCWC 3EIJA 2QYJA 4PS8A 1FPPA 3ZVVA 4WWPA 3PNTB 3DSUA 1Q2ZA 5CCMA 1KLXA 5TTFA 4CDMA 1O9SA 1H2TC 1OCCE 4YPAA 4UI9C 3B7BA 2MOWA 4GZ5A 4G24A 3TWVA 4TUUA 3JQ1A 5T0KA 1HXIA 4L2YA 2M63A 5BW8C 4GCOA 3FUEA 2X6FA 2OVBA 3ZRHA 5JJ7A 2DBAA 3D9OA 1IYGA 2E0IA 1V55E 4QENA 3TXMA 3MO2A 4MI0A 3T9KA 3D9MA 1N54A 3EHMA 3SY2A 2V4HC 3FU6A 3UPVA 5AYWD 3M57A 3DSVA 3UUXA 2DWZA 1WM5A 2XPZA 3G2UA 2BEDA 2ONDA 3RSEG 3PEVB 4GCNA 2IJGX 3DBSA 2F8XK 3GYZA 2XRYA 4GZ3A 3UTMA 1NL4A 3CVVA 5AQAA 1K3ZD 4FULA 3SW9A 1YCSB 5BXUA 4MLPA 5LX8A 2J9QA 4GMRA 4HRLA 3TAXA 1G3NB 1TN8A 4Q94A 4AP2A 4ILGA 5CECB 3ASDA 1ELWA 3V79K 2AVPA 3QWWA 1K8KG 2MRIA 1IHGA 4HOQA 5EKQD 2CFUA 2PL2A 4IULA 3FU3A 3CKBA 3MV3B 4GA1A 4DJAA 2YQ8A 3DRAA 1H6OA 2H6FA 3D9KA 1H3IA 3APFA 4F53A 2VJ8A 5E76A 1OCZE 3FU0A 1KZOA 2EILE 3VLDA 3ZN3A 3ONLA 3U64A 4PUCA 2IO2C 1HFAA 4FA6A 3LJNA 4I2ZA 3ESKA 3PZDA 2B0OE 4FP7A 4Q69A 4G8LA 3PVLA 3FUFA 4R7LA 2LAHA 1XGWA 3KD7A 1EPUA 1TYQG 3C72A 3LVRE 3LPZA 4O60A 3CVPA 3D3MA 2Y3AA 4NURA 3S7DA 4C48B 5F6KC 3FEXA 3R9MA 2QZAA 5FQ7A 4J0UA 1FCHA 4BTBA 1NA0A 5A7DB 5FINA 1N0QA 4X8QA 5KNGA 2XPYA 3NOCD 2FO7A 5KNHD 3C98A 4OAUC 4BERA 1WY6A 2H6GA 1LD7A 1SA4A 1HX8A 3SFZA 3F9XA 4F7AA 2RD0A 3ZUVB 3BEEA 4RLYA 3SBTB 3FUKA 4K0RA 4EZLA 3ZFWA 4GTMA 4KZCA 5JIYA 3HXEA 3URZA 4FC8A 5C2YA 4GZCA 3E37A 5M72A 4FADA 2IEJA 4HVBA 4HQDA 1PC2A 3QOUA 3P1UA 2GRLA 3DXKG 3OXLA 4B89A 2VGYA 1SZAA 3V30A 3EP0A 2JEKA 3PZ3A 4BX8A 2J49A 1TNBA 1K1BA 1H2UA 5AJLA 1IQUA 1HU3A 2WMOA 2V0PA 5ENNA 4I43A 5AQBA 3U3WA 4DK5A 4FLBA 5AN8A 4N3AA 1HE8A 3K9IA 4JVSA 3M56A 1SW6A 3LJ3A 3QJZA 4L23A 4U96D 5CPRB 2E2EA 2QPWA 2J4DA 3IEGA 4A1SA 2VGXB 4MBGA 4LNGA 4I17A 3DSXA 3CQGB 2J08A 1MZCA 5CCLA 3FH8A 1FT2A 3ZGQA 3W9FA 3FTXA 2F69A 2V4LA 4AEZC 3CK8A 3FTYA 1ZBPA 3FH7A 1XNFA 5E75A 1ZB1A 4XX5A 3M55A 2XGSA 2R3AA 1RW2A 4XKBA 4DPRA 2GRRB 2WXIA 4XI0A 2PQRA 2Y1LE 3D9IA 1MX6A 4U7EB 2WXOA 3ZIMA 1JWFA 2MHKA 2A4ZA 2HM8A 2FI7A 4KBQA 3MKQB 3HVEB 2I9CA 4JA7A 2IO3C 4JEUA 2GRPB 5LSXA 4JZYA 1OY3D 4TRQA 5LOZA 1UN8A 2W5YA 2OOEA 1TR4A 3VTYA 3FH5A 4O30A 2J8SD 3IHYA 3ZXSA 2WXLA 2V5QC 2OEVA 2AWIA 2W5ZA 5CMWA 4XI9A 4GU5A 2WPVA 1OUVA 3OPEA 2R17C 4BWRA 5EILA 1N94A 4TV3A 2WXNA 4YPEA 4HRMB 4LNUD 2PM6A 4I2WA 2AW6A 3TWSA 3DB5A 3EUVA 4HNAD 5DBKA 3SGHA 4EBAG 2IU1A 3B7TA 3Q78A 3MA5A 5F5EA 3CLJA 5G05C 5CMYA 4D10C 5HRYA 1P5QA 4Q96A 1H0AA 5B1BE 4FJZA 2NXPA 5H7PA 3TL5A 2I6HA 3QK0A 1EDUA 4XZ4A 4V3IA 5AJDA 3AG3E 3CSFA 1RZ4A 2XCCA 4BY6A 4BTAA 3V31A 3QWVA 2EQXA 3L13A 2VSYA 4E47A 2H6IA 3HVEA 1H2VC 4QFVA 1QQEA 1DCQA 4B8CB 3CHSA 3TWWA 4U95D 4G1TA 3RJVA 4F1SA 5BV0A 1XQHA 4G26A 5FQ4A 3D9PA 2HR2A 2R03A 5ARFA 4A3VA 3ASFA 4J83A 5ARGA 3UM1A 3U4TA 2KBXA 2XENA 1NI1A 3BO5A 2BUGA 1MX4A 4A1GA 1O1SA 4J8EA 4EHMA 4JW1A 4XKCA 2V5FA 2ETCA 1MT6A 3MEKA 1BD8A 2QFCA 3CVNA 4HORA 3FUMA 4OAVB 4K5BA 3HXFA 2WXJA 4W9RA 4I1MA 1D9SA 3WG7E 3S8PA 2X6HA 1EYHA 1VDYA 4BT9A 3CVWA 4CRWA 4I51A 4LNBA 2XZTG 3UM3A 4LDGA 5JJ6A 3DEOA 1U3CA 3E34A 2G46A 2P9IG 2OCCE 3TWXA 4TXQA 2XEHA 3B95A 5EG2A 3PUJA 5D2MC 3QAQA 2UY1B 4HOSA 4HLLA 4BEPA 4U63A 1Z6TA 3CHOA 3ZHEB 2GROB 3F9YA 2X6JA 4GTPA 2OVFA 3BG0B 1ZU2A 5G04J 2X38A 3U66A 5D0OD 3LYAA 1N4SA 4K03A 4UQXA 4GTOA 5FT9A 3CVUA 1E8XA 3MGBA 4IYPA 3WXXA 5HI7A 5CRUA 3DWLG 1NZNA 5EIBE 4NJ5A 4HBDA 5KCMA 3CBMA 4UWGA 4CZ2D 1S63A 1IKND 1ELKA 3C3OA 2UWJG 1UG3A 1OXJA 4H12A 3EHNA 2V8SE 1Z3XA 3SHFA 3FP3A 2XZDG 1OCRE 3L22A 2CG3A 2NC9A 3S7FA 3PZ1A 1MX2A 4KMOA 5F59A 2F37A 3LY8A 2BQZA 3DSTA 4WWNA 3ZU7B 4APOA 4U07A 3CK9A 5ENOD 3ZKJA 3AU5A 3JUIA 3PDNA 3TWUA 1YYHA 2BKKB 4M7CA 3QNKA 1SVXA 1N11A 3Q73A 2P9NG 3BQOA 3ZYKA 2WXRA 3PH0C 3GZ1A 3PNLB 4URKA 3CVXA 4JL0A 4BSZB 3L16A 3CVLA 5LP0A 3LXUX 1LF8A 2UY1A 3VUZA 4B94A 3AG4E 3UIOC 3ZHEA 4Z68A 4UWKA 1Y8MA 1BU9A 3IKOB 1FVHA 3QWPA 2AJAA 3JCKC 4AV7A 1UJKA 3UT7A 4RSYA 4J8SA 1INZA 3C3QA 3QKYA 4G23A 4IJ8A 4UWLA 3SNXA 1JWGA 3ZYLA 5EX3A 2WQHA 2HO1A 5BPPA 4QEOA 2XQ0A 1TNZA 3S2AA 4LERA 1JCQA 2XS8A 4GTQA 2IOLA 1JCSA 5HQ8A 1H6PA 1A5EA 4NACA 3NOGD 3C3RA 4NVQA 4YDOA 2DIWA 2CG2A 3FTSA 3M59A 3ZPJA 4ACKA 4WAFA 2VSOE 4ANVA 2GRQB 1L5JA 1WDYA 2Q7FA 3C5RA 4OYSA 3RO2A 4GPMA 2F0YA 4YPUA 3CVYA 3Q4AB 1LD8A 3FHEA 2P58C 4CT0A 1LTXA 3D9NA 3ONKA 3R9AB 4U04A 4EZKA 3MJWA 4BETA 3JYSA 4CGVA 3HRAA 2AXUA 3T8KA 4N2QA 3F9ZA 4HI9A 1E90A 2IFUA 1H19A 4BFRA 4GZDA 1TJFA 3MV2B 5BUZA 5LCWJ 5FIOA 4JXTA 3UI2A 1E96B 4O6FA 2R02A 4ZFHA 4I1OB 3R7QA 3B13A 1K1AA 3VLEA 2AXZA 3SI5A 3RAYA 5ENSD 2J09A 1N4QA 1AWCB 3PEUB 4UI9J 2WVIA 4C0MA 5KWDA 3L17A 4U0SA 4I9EA 1HO8A 2IQCA 3ML9A 3ULEG 3LY7A 2LXLA 2L9BA 3TXNA 2GGFA 2EIKE
chains in the Genus database with same CATH topology
4GB9A 2WPVA 1OUVA 3LVQE 3OPEA 2R17C 3UX4A 4HFGA 4BWRA 3AS4A 4N3CA 3M57A 4I9CA 1ZKKA 2KCKA 3ESLA 4TV3A 2WXNA 4UWFA 4WNDA 4E85A 4YPEA 2PM6A 4I2WA 4GYOA 3FTZA 4G2VA 2AW6A 1JPLA 2IOSA 4GMLA 3M54A 2R5SA 5DIZA 3GZ2A 5FZSA 2IGQA 4ANUA 3DB5A 1DVPA 3G2VA 4LCTA 4I1AA 3TJPA 2FEZA 2L0IA 5CHEE 3LKUA 5DBKA 3SGHA 2KCLA 4EBAG 3KMJA 2IU1A 3HHMA 3B7TA 4L7TA 3MA5A 3ZEFA 3U9WA 1UN9A 4N5CA 5JHAA 3FUNA 2I2OA 4ACLA 5T4YA 3PS6A 1MVHA 5F5EA 3OXFA 3CLJA 5G05C 2XRZA 2LNIA 2C0LA 5CMYA 4RVBA 3BG1B 4D10C 1KT0A 3FU5A 4DLOA 1P5QA 3FEYA 3ASGA 4ILHB 3LCAA 4Q96A 1H0AA 2FULA 3FUHA 3CHPA 2WXGA 4G25A 1BPOA 3G2TA 5LCWC 3EIJA 3UQ3A 4PS8A 3ZVVA 1MVXA 4WWPA 3CBOA 4RG9A 3PNTB 4FJZA 2NXPA 3TL5A 5J90A 3P2BA 4GYWA 5FQ7A 2I6HA 1KLXA 1B89A 1EDUA 3O4ZA 3QK0A 4U0ZA 4XZ4A 4DI3A 5CCMA 4V3IA 3FY4A 4FMUA 5AJDA 5TTFA 3CSFA 2WQ6A 3R7RA 5AIJA 3T5VA 1JUQA 3Q47B 2XCCA 4CDMA 1HS6A 1O9SA 4BY6A 1HG2A 1H2TC 4J8DA 4BTAA 1N3JA 4YPAA 3QWVA 2EQXA 4UI9C 2MOWA 2ZU6B 4G24A 4GZ5A 3L13A 1YA0A 2VSYA 4EZJA 4IN3B 4TUUA 3JQ1A 4C0EA 3HNAA 5T0KA 1HXIA 5FWQA 4CDNA 5KJNA 4L2YA 4E47A 3HVEA 1H2VC 2M63A 3G2WA 5BW8C 4GCOA 1NP7A 4ANWA 3FUEA 2X6FA 3AS5A 2OVBA 3I4GA 3QC1A 1MQSA 4QFVA 3ZRHA 3RJWA 1QQEA 5JJ7A 2DBAA 2WXFA 3EIQC 3D9OA 4B8CB 1IYGA 1MUFA 3CHSA 3FTVA 2E0IA 4J8OA 4Z4PA 3Q15A 4CEMA 3HIZA 4G1TA 2HYZA 3RJVA 4F1SA 5BV0A 1XQHA 4G26A 5FQ4A 3D9PA 2HR2A 4A55A 2VQ2A 4QENA 3TXMA 5ARFA 4A3VA 3ASFA 3MO2A 4MI0A 4CDRA 4J83A 1OWLA 4GZ6A 4PS3A 5ARGA 3D9MA 3FTWA 4KT6B 4AY5A 3U4TA 1N54A 3S7JA 4JA9A 4WNGA 4WNFA 3EHMA 4OVUA 4P29A 5EDSA 3FU6A 3BO5A 2BUGA 5LSZA 4A1GA 3JQ0A 4J8EA 4JW1A 3MZLB 4XKCA 2V5FA 4UI9K 3UPVA 1MT6A 3MEKA 4GA0A 4KZ0A 4LRZA 2QFCA 5AYWD 3CHQA 3GW4A 3UUXA 3CVNA 4HORA 3SZ7A 3FUMA 3CBPA 1WM5A 3NF1A 2WXJA 2WM9A 4W9RA 2WXQA 5JJTA 5AENA 3RIBA 2XPZA 4I1MA 3SBSA 3G2UA 3S8PA 2X6HA 3RU0A 3KAEA 2ONDA 1EYHA 1VDYA 1NA3A 3PEVB 4BT9A 4GCNA 2IJGX 3OAWA 3DBSA 2XHEA 3CVWA 2BF0X 3GYZA 2XRYA 3G2SA 4QEPA 3MX3A 4GZ3A 4CRWA 4CT4A 4I51A 5KJLA 5A23A 1H6KA 4MS6A 2VSXE 2L6JA 1E8ZA 3PRZA 3CVVA 4IJDA 4FULA 5JJ6A 4LDGA 1UJJA 4N39A 3SW9A 1EF1C 1U3CA 2G46A 4MLPA 5LX8A 3KMAA 2J9QA 2PQNA 3ULQA 3AS8A 5G2NA 2VYIA 3TAXA 5EG2A 4ILIA 4L1BA 4Q94A 3PUJA 3CSTA 4AP2A 3QAQA 2X3MA 4H7XA 4ILGA 4AY6A 5FQ8A 3ASDA 2UY1B 4HOSA 1ELWA 3RRUA 2C2LA 3L54A 4U63A 5TH7A 1W3BA 2AVPA 2QY7A 4HXIA 1Z6TA 3CHOA 2A5UA 3ZHEB 3QWWA 5ANLA 4HS2A 4OVVA 2MRIA 2X6JA 3F9YA 2OVFA 3BG0B 1IHGA 1ZU2A 1N52A 2X38A 4HOQA 5EKQD 5G04J 1KT1A 3U66A 5D0OD 2CFUA 2PL2A 4LUNU 2VTBA 5F6LA 3LYAA 2AXVA 4IULA 5FQ6A 1E7VA 1HF8A 2IONA 3I5PA 4K03A 4UQXA 3FU3A 5FT9A 3CVUA 2CHZA 3CKBA 3MV3B 1E8XA 4GA1A 3MGBA 4DJAA 1N6AA 4IYPA 2YQ8A 3WXXA 2PZIA 2YHCA 5HI7A 4U0UA 2WXKA 4ANXA 4ABNA 2WQ7A 2XGMA 3D9KA 1H3IA 3APFA 3IV0A 4AXHA 1NZNA 4F53A 4RZ0A 2VJ8A 1U3DA 5E76A 3FU0A 4NRHB 3CIAA 4NJ5A 5KCMA 3VLDA 3CBMA 2OV8A 1OWOA 4UWGA 3NZUA 5FZQA 3ZN3A 1ELKA 2UWJG 4UQYA 1UG3A 3NZSA 1Z3YA 4H12A 3EHNA 3RO3A 3OOIA 5JHNA 1MHQA 3ONLA 2V8SE 3I3NA 4JEHA 3U64A 1X5BA 1Z3XA 3SHFA 3UMVA 3FP3A 2VTBB 4PUCA 4UQZA 3MO5A 4RG6A 5KJKA 3L22A 1WAO1 1HFAA 2CG3A 2NC9A 4HOUA 4FA6A 4I2ZA 3S7FA 3ESKA 3PZDA 4KMOA 5F59A 4FP7A 4Q69A 3NQPA 3PVLA 3FUFA 4JLGA 2I1KA 3LY8A 3ML8A 4R7LA 2BQZA 4WWNA 2VSNA 5T0MA 2LAHA 4APOA 1XGWA 5JJ0A 3KD7A 1IQRA 3CK9A 4U07A 5D0QD 2J4BA 1EPUA 4BX9A 3CGHA 4AM9A 5T3RA 3AU5A 3JUIA 3LEWA 3LPZA 3LVRE 1SZ9A 3MO0A 3CVPA 3L08A 3D3MA 3PDNA 3VTXA 4C1QA 2Y3AA 5J08A 3QNKA 4NURA 3S7DA 1OWPA 5F6KC 3ZYKA 3FEXA 2WXRA 2YINA 3I4RB 3KMTA 4F3VA 3IBEA 3PH0C 4J0UA 1FCHA 2X6IA 3GZ1A 4Y6WA 4PH4B 1NA0A 3CR3A 1OWNA 3PNLB 4BTBA 4URKA 5LFAA 4JL0A 5A7DB 1E8YA 3CVXA 3L16A 5G04C 3CVLA 3RRMB 5LP0A 3LXUX 5ANRA 1LF8A 2KCVA 3FFLA 3SF4A 2UY1A 2Y4UA 3VUZA 2XPYA 4B94A 3QB2A 2FBNA 2L0TB 4MRUA 3F9WA 3PREA 2YHEA 2FO7A 4M3OA 3FTUA 3ZYMA 5A6CA 3C98A 2LAIA 4KXKB 4YVQC 3ZHEA 4GMJA 1N6CA 1OWMA 4UWKA 2IF4A 2WMNA 3FWVA 1FVFA 1Y8MA 1WY6A 1PEGA 4YNPA 4JPSA 1HX8A 3IKOB 4N2SA 3CKCA 3SFZA 3F9XA 1FVHA 1HZ4A 1DNPA 2LSVA 3QWPA 1SQMA 4F7AA 4EQFA 2RD0A 3HYMB 3BEEA 3APCA 5JINA 3JCKC 3MKRA 4AOFA 5EX0A 4AV7A 2JV0A 3SBTB 3MYVA 3M53A 1UJKA 4I6EA 3T8MA 4B8AA 2GRMA 3UT7A 2YNQA 3D9JA 3PE4A 4J8SA 4RSYA 3FUKA 1INZA 4K0RA 1TEZA 4EZLA 3ZFWA 3LS8A 3QKYA 4HLEA 4G23A 4IJ8A 4GPKA 4KZCA 3D9LA 4UWLA 3SNXA 4C9BB 5JIYA 1JWGA 3KEZA 3ZYLA 5EX3A 3URZA 4DI4A 4DLQA 2WQHA 4FC8A 2HO1A 5BPPA 4BSXA 1ML9A 4QEOA 2XQ0A 4GZCA 5C2YA 5M72A 4EECA 4J7IA 4FADA 3S2AA 4LERA 3Q49B 4HVBA 1PC2A 3QOUA 3B7UX 4HOTA 3P1UA 2GRLA 5FTPA 4CCAA 3OS5A 2WXMA 3OXLA 3CK7A 4BUPA 2IOLA 2VGYA 1SZAA 4G11A 4B89A 4N3BA 2VGXA 3RK6A 5JHBA 2FF4A 3QARA 3EP0A 3OTNA 2JEKA 5HQ8A 4BX8A 3O48A 3FPDA 3FULA 2WB2A 3L6AA 2J49A 4YNDA 4CGWA 1H2UA 1PY1A 2CHWA 1IQUA 1HU3A 2KATA 5AJLA 4NACA 4EPZA 2WMOA 4ME2A 2V0PA 3T5XA 4AIFA 4NVQA 5ENNA 3ZYQA 3RKVA 2C0MA 4AVXA 2DIWA 1PAQA 2RG8A 2CG2A 5KJMA 3FUIA 4I43A 3FTSA 3M59A 3ZPJA 3U3WA 4APFA 4DK5A 4YNMA 4FLBA 4GA2A 4ACKA 3FUDA 5T5GA 4WAFA 1E8WA 2R59A 4J6IA 4N3AA 4U8HA 1HE8A 3K9IA 4JVSA 2VSOE 2X6KA 4ANVA 3IHXA 3M56A 3LJ3A 3QJZA 3Q5MA 4AU7A 4L23A 3QDNA 5CPRB 2E2EA 3CQCB 3DALA 2QPWA 2J4DA 3IEGA 1L5JA 1HH8A 2J07A 4A1SA 3PE3A 4UWHA 2NSZA 3IHVA 2VGXB 2Q7FA 2LO6A 4AJWA 4JHJA 1ELRA 2WXHA 2Y4TA 5BV1A 4OYSA 3TG4A 4LEUA 3EDTB 4I17A 4JHRA 3RO2A 4IRUA 4J8FA 4L2LA 3CQGB 3CEQA 3OXGA 4YPUA 3CVYA 2WXPA 2LSUA 3Q4AB 2J08A 4WWOA 3FHEA 2P58C 4MKTA 4CT0A 3UT8A 5BT1A 3E4BA 3MKQA 3D9NA 2DCPA 5CCLA 3FDHA 3FH8A 3ONKA 3R9AB 2XGOA 3ZGQA 3FTXA 4U04A 5C1DA 3B7RL 4EZKA 3FUJA 3MJWA 4PDXA 1UW4B 2KZTA 2F69A 3JYSA 2V4LA 3CVQA 3N71A 4KVMA 4AEZC 4CGVA 3M5AA 4JC8A 2AXUA 2BTDA 3APDA 1GW6A 3CK8A 4N2QA 3ASHA 4FLHA 4JDSA 5TEGA 3RQ4A 3FTYA 5FJYA 3F9ZA 3M58A 3MCXA 1ZBPA 5G05J 4GAAA 1E90A 1XNFA 2IFUA 3FH7A 5E75A 1H19A 4BFRA 4J7FA 4GZDA 3ENEA 3PUKA 4KYOB 5BNWA 4MI5A 4XX5A 3M55A 1TJFA 4YVOA 1QZ2A 2XGSA 2KM4A 4BT8A 2R3AA 3RRNB 2CFZA 3HDXA 4XKBA 4DPRA 2GW1A 3MV2B 5BUZA 3AU4A 4I6GA 3VV0A 2WXIA 2XEVA 4GYYA 5LCWJ 4XI0A 2PQRA 2JLBA 3D9IA 3TGOA 4WUYA 4JXTA 4EBAA 2WXOA 1A17A 4FHJA 1E96B 4O6FA 1JWFA 3CHMA 3ZIMA 5T8IA 2MHKA 2A4ZA 2HM8A 2FI7A 4KBQA 3MKQB 4I6JA 4FJYA 4XE0A 3HVEB 4I1OB 2ILRA 3SWCA 2I9CA 3ZW3A 3R7QA 4H7YA 1E7UA 2KZTB 3B13A 4JA7A 4FU3A 3KS2A 3VLEA 2XCBA 2AXZA 3SI5A 3RAYA 4JEUA 3B7SA 2J09A 2I1JA 1TJCA 3LY9A 1Y6IA 4Y6CA 5LSXA 3PEUB 2KC7A 2PM7A 3CV0A 4UI9J 4JZYA 2RFIA 4JHKA 2XPIA 4TRQA 4FHKA 3UT4A 4E6HA 4PS7A 3SD5A 2WVIA 3TG5A 5G55A 4C0MA 3L17A 3S7BA 4U0SA 4I9EA 3LDZA 5LOZA 1UN8A 2W5YA 1HO8A 5FZRA 2OOEA 4WNEA 3VTYA 5AYFA 4ATGA 1S0PA 2IQCA 3DPDA 1QNFA 3FH5A 3ML9A 4O30A 3IHYA 3ZXSA 2CHXA 3K5KA 3LY7A 3CHRA 2L9BA 2WXLA 3TXNA 1HG5A 2AWIA 3GZSA 2W5ZA 2GGFA 4A3TA 5CMWA 4KVOA 2O8JA 4XI9A 4XIFA 3VLFA 3EJNA 4NQ0A 4B0ZA 4GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV A;  1OUV A;  3OPE A;  4BWR A;  3AS4 A;  4N3C A;  4I9C A;  1ZKK A;  2KCK A;  4WND A;  4YPE A;  4I2W A;  4GYO A;  4G2V A;  3M54 A;  2R5S A;  5DIZ A;  3GZ2 A;  5FZS A;  2IGQ A;  3DB5 A;  4I1A A;  2FEZ A;  5CHE E;  3LKU A;  5DBK A;  3KMJ A;  2KCL A;  3MA5 A;  4N5C A;  5F5E A;  1MVH A;  3OXF A;  5G05 C;  2LNI A;  2C0L A;  1KT0 A;  1P5Q A;  3ASG A;  3LCA A;  4G25 A;  5LCW C;  3UQ3 A;  1MVX A;  3CBO A;  4RG9 A;  4GYW A;  2I6H A;  1KLX A;  1B89 A;  4U0Z A;  5CCM A;  4FMU A;  5TTF A;  3Q47 B;  2XCC A;  1O9S A;  4J8D A;  4BTA A;  1N3J A;  4YPA A;  3QWV A;  4UI9 C;  4GZ5 A;  4G24 A;  1YA0 A;  2VSY A;  4IN3 B;  5T0K A;  3HNA A;  1HXI A;  5KJN A;  4E47 A;  5BW8 C;  4GCO A;  3AS5 A;  3RJW A;  1QQE A;  5JJ7 A;  2DBA A;  1IYG A;  1MUF A;  4J8O A;  4Z4P A;  3Q15 A;  4G1T A;  2HYZ A;  3RJV A;  1XQH A;  4G26 A;  2HR2 A;  2VQ2 A;  4QEN A;  5ARF A;  3ASF A;  3MO2 A;  4MI0 A;  4CDR A;  4J83 A;  4GZ6 A;  5ARG A;  4AY5 A;  3U4T A;  3S7J A;  4JA9 A;  4WNG A;  4WNF A;  3BO5 A;  2BUG A;  5LSZ A;  4J8E A;  2V5F A;  4UI9 K;  3UPV A;  1MT6 A;  3MEK A;  4GA0 A;  5AYW D;  3M57 A;  2QFC A;  3UUX A;  3GW4 A;  3CVN A;  4HOR A;  3SZ7 A;  3CBP A;  1WM5 A;  3NF1 A;  4W9R A;  5JJT A;  3RIB A;  3S8P A;  3RU0 A;  3KAE A;  2OND A;  1NA3 A;  4BT9 A;  4GCN A;  3GYZ A;  4QEP A;  4GZ3 A;  4I51 A;  5KJL A;  2L6J A;  4IJD A;  5JJ6 A;  4LDG A;  4N39 A;  3SW9 A;  2G46 A;  3KMA A;  2J9Q A;  2PQN A;  3ULQ A;  3AS8 A;  2VYI A;  3TAX A;  5EG2 A;  4H7X A;  4AY6 A;  3ASD A;  2UY1 B;  4HOS A;  1ELW A;  2C2L A;  5TH7 A;  1W3B A;  2AVP A;  3ZHE B;  3QWW A;  3F9Y A;  1IHG A;  1ZU2 A;  4HOQ A;  5G04 J;  5EKQ D;  1KT1 A;  5D0O D;  2PL2 A;  5F6L A;  3LYA A;  4UQX A;  5FT9 A;  3CKB A;  3MV3 B;  4GA1 A;  1N6A A;  2YQ8 A;  3WXX A;  2PZI A;  2YHC A;  5HI7 A;  4U0U A;  4ABN A;  2XGM A;  1H3I A;  1NZN A;  4RZ0 A;  4NRH B;  4NJ5 A;  3CBM A;  5FZQ A;  3ZN3 A;  2UWJ G;  4UQY A;  4H12 A;  3RO3 A;  3OOI A;  5JHN A;  3FP3 A;  4UQZ A;  3MO5 A;  4RG6 A;  5KJK A;  1WAO 1;  2NC9 A;  4HOU A;  4I2Z A;  3S7F A;  3ESK A;  5F59 A;  4JLG A;  3LY8 A;  2BQZ A;  2VSN A;  5T0M A;  4APO A;  5JJ0 A;  3KD7 A;  4U07 A;  3CK9 A;  5D0Q D;  4AM9 A;  3LPZ A;  3MO0 A;  3CVP A;  3PDN A;  3VTX A;  4C1Q A;  3S7D A;  5F6K C;  3KMT A;  4F3V A;  4J0U A;  1FCH A;  3GZ1 A;  4Y6W A;  4BTB A;  1NA0 A;  4JL0 A;  5A7D B;  5G04 C;  3CVL A;  3FFL A;  2KCV A;  3SF4 A;  2UY1 A;  2Y4U A;  3VUZ A;  4B94 A;  2FBN A;  3F9W A;  2FO7 A;  5A6C A;  4KXK B;  4YVQ C;  3ZHE A;  1N6C A;  2IF4 A;  3FWV A;  1Y8M A;  1PEG A;  4YNP A;  4N2S A;  3CKC A;  3F9X A;  2LSV A;  1HZ4 A;  3QWP A;  4EQF A;  3HYM B;  3BEE A;  5JIN A;  3MKR A;  5EX0 A;  2JV0 A;  3M53 A;  3PE4 A;  3ZFW A;  3QKY A;  4G23 A;  4IJ8 A;  4GPK A;  5JIY A;  5EX3 A;  3URZ A;  2WQH A;  2HO1 A;  1ML9 A;  4QEO A;  5M72 A;  4J7I A;  3Q49 B;  1PC2 A;  3QOU A;  4HOT A;  5FTP A;  3OS5 A;  3OXL A;  4BUP A;  3CK7 A;  2VGY A;  4N3B A;  2VGX A;  2FF4 A;  3EP0 A;  5HQ8 A;  3O48 A;  3FPD A;  4YND A;  4CGW A;  2KAT A;  4ME2 A;  4AIF A;  4NVQ A;  3RKV A;  2C0M A;  5KJM A;  3M59 A;  3ZPJ A;  3U3W A;  4YNM A;  4GA2 A;  5T5G A;  4N3A A;  3K9I A;  3M56 A;  3IHX A;  4AU7 A;  3Q5M A;  3QDN A;  5CPR B;  2E2E A;  3DAL A;  2QPW A;  3IEG A;  1HH8 A;  4A1S A;  3PE3 A;  2VGX B;  2Q7F A;  1ELR A;  2Y4T A;  3TG4 A;  4LEU A;  3EDT B;  4I17 A;  4JHR A;  3RO2 A;  4J8F A;  3CEQ A;  3OXG A;  4YPU A;  3Q4A B;  2LSU A;  2P58 C;  5BT1 A;  3E4B A;  5CCL A;  3R9A B;  2XGO A;  3ZGQ A;  4U04 A;  5C1D A;  2F69 A;  3JYS A;  3CVQ A;  3N71 A;  4CGV A;  3M5A A;  4JDS A;  3CK8 A;  4N2Q A;  3ASH A;  5TEG A;  3RQ4 A;  5FJY A;  3F9Z A;  3M58 A;  1ZBP A;  5G05 J;  1XNF A;  2IFU A;  4J7F A;  4KYO B;  5BNW A;  4MI5 A;  3M55 A;  4YVO A;  1QZ2 A;  2XGS A;  4BT8 A;  2R3A A;  2GW1 A;  3MV2 B;  3VV0 A;  2XEV A;  5LCW J;  4GYY A;  4XI0 A;  2PQR A;  2JLB A;  3TGO A;  4WUY A;  1A17 A;  1E96 B;  4O6F A;  2MHK A;  2FI7 A;  4KBQ A;  3SWC A;  4H7Y A;  4JA7 A;  3KS2 A;  2XCB A;  3RAY A;  1TJC A;  3LY9 A;  4Y6C A;  5LSX A;  2KC7 A;  3CV0 A;  4UI9 J;  2RFI A;  2XPI A;  3TG5 A;  3S7B A;  4U0S A;  4I9E A;  2W5Y A;  5FZR A;  2OOE A;  4WNE A;  3VTY A;  5AYF A;  4O30 A;  3K5K A;  3LY7 A;  2W5Z A;  2O8J A;  4XI9 A;  4XIF A;  4NQ0 A; 
#chains in the Genus database with same CATH topology
 4GB9 A;  3UX4 A;  4HFG A;  3AS4 A;  4N3C A;  3HXC A;  2BKG A;  2KCK A;  3NAW A;  5DIZ A;  2IGQ A;  3G2V A;  4GTR A;  5EID A;  4LCT A;  5CHE E;  2ZIR A;  1FT1 A;  2LXM A;  3ZEF A;  3U9W A;  3JUE A;  1D8E A;  2XRZ A;  4XEI G;  5JA4 D;  2C0L A;  3F6Q A;  5KBA A;  1KT0 A;  3FU5 A;  4ILH B;  5AAO A;  3FUH A;  3CHP A;  1BPO A;  3G2T A;  3UQ3 A;  1MVX A;  3CBO A;  5J90 A;  3P2B A;  4U0Z A;  4YDY A;  3R7R A;  3Q47 B;  3DSS A;  2VGE A;  1N3J A;  1QYM A;  2ZU6 B;  4EZJ A;  4IN3 B;  4C0E A;  3HNA A;  5ITZ F;  5FWQ A;  3G2W A;  1NP7 A;  3KSQ A;  4ANW A;  3AS5 A;  3I4G A;  3RJW A;  2WXF A;  3EIQ C;  1MUF A;  3Q15 A;  4CEM A;  5ENP D;  3NB2 A;  1TNY A;  4CDR A;  4BES A;  1OWL A;  4GZ6 A;  3AAA C;  1JCR A;  5ENQ D;  4AY5 A;  4ATZ D;  3S7J A;  4WNG A;  4OVU A;  4P29 A;  3AG1 E;  2A5E A;  4UI9 K;  4KZ0 A;  4LRZ A;  3E33 A;  1O5M A;  3GW4 A;  3SZ7 A;  2R05 A;  4A63 B;  2WXQ A;  5JJT A;  5AEN A;  3RIB A;  3SBS A;  3RU0 A;  3V2X A;  3KAE A;  1BI8 B;  1NA3 A;  4QEP A;  4J7W A;  5KJL A;  1N95 A;  5A23 A;  1H6K A;  2L6J A;  3PRZ A;  1UJJ A;  4N39 A;  1EF1 C;  3E30 A;  2PQN A;  5G2N A;  4L1B A;  3CST A;  2X3M A;  4H7X A;  3RRU A;  4JB8 P;  2C2L A;  5TH7 A;  2A5U A;  3Q79 A;  5ANL A;  4LSZ E;  1N0R A;  1N52 A;  1KT1 A;  2VTB A;  1E7V A;  1HF8 A;  2ION A;  3HXD A;  4U0U A;  2WXK A;  4ABN A;  2XEE A;  2WQ7 A;  2XGM A;  4AXH A;  4DX5 D;  1U3D A;  4UUC A;  3CIA A;  5CBN A;  2OV8 A;  1OWO A;  3L82 A;  5FZQ A;  4UQY A;  3I3N A;  3DEP A;  2ZGD A;  4JEH A;  3UMV A;  4UQZ A;  3MO5 A;  3PZ4 A;  4RG6 A;  5KJK A;  3SQV A;  4U8V D;  4JLG A;  3ML8 A;  2VSN A;  5JJ0 A;  1IQR A;  5D0Q D;  4DX6 D;  3CGH A;  4AM9 A;  2ZIS A;  5T3R A;  3LEW A;  4HI8 A;  2OEW A;  1X81 A;  3L08 A;  3VTX A;  3DSW A;  2KXP C;  4C1Q A;  3X2Q E;  1KZP A;  4LG6 A;  2YIN A;  3I4R B;  3KSL A;  4F3V A;  3IBE A;  4Y6W A;  3CR3 A;  2QC9 A;  1OWN A;  3JXI A;  1WG0 A;  1E8Y A;  3ZNG A;  5ANR A;  3FFL A;  2DYR E;  4HB5 A;  3QB2 A;  2L0T B;  4MRU A;  3F9W A;  3PRE A;  5ENR D;  2YHE A;  3FTU A;  5A6C A;  1TN6 A;  2LAI A;  4KXK B;  4YVQ C;  4GMJ A;  1OWM A;  3UKR G;  4ZHB A;  4N2S A;  3CKC A;  1HZ4 A;  1SQM A;  4EQF A;  3HYM B;  5JIN A;  3ASN E;  3MKR A;  2JV0 A;  1BLX B;  2GRM A;  2F8Y A;  2YNQ A;  3D9J A;  3UIN C;  4DX2 A;  4GPK A;  3D9L A;  4C9B B;  2XS1 A;  1D8D A;  4DI4 A;  4DLQ A;  5EYP F;  4EEC A;  3Q49 B;  2P9S G;  4HOT A;  5FTP A;  3OS5 A;  2WXM A;  3CK7 A;  4GTT A;  5JHB A;  4N3B A;  3RK6 A;  3QAR A;  3O48 A;  1YMP A;  3L6A A;  4CGW A;  1KPS B;  2CHW A;  2KAT A;  2DZN A;  4EPZ A;  4ME2 A;  2LUH A;  3RKV A;  2C0M A;  3EU5 A;  2RG8 A;  4YDW A;  5KJM A;  3FUI A;  3Q9U C;  4YNM A;  3FUD A;  4U8H A;  4J6I A;  2B6C A;  3IHX A;  3Q5M A;  2FO1 E;  3QDN A;  3CQC B;  3DAL A;  2QYU A;  4UWH A;  2NSZ A;  3IHV A;  2LO6 A;  4JHJ A;  1ELR A;  4HRN A;  2Y4T A;  3TG4 A;  3EDT B;  2Y69 E;  3CEQ A;  2WXP A;  2LSU A;  4MKT A;  3UT8 A;  4J8Y A;  3E4B A;  5B3S E;  2XGO A;  5C1D A;  2P9L G;  1N4P A;  3B7R L;  4PDX A;  1OCO E;  2KZT A;  3CVQ A;  3M5A A;  1IHB A;  3APD A;  1GW6 A;  2ETA A;  5FJY A;  3MCX A;  5CBO A;  5G05 J;  3ENE A;  3PUK A;  5BNW A;  2ETB A;  2KM4 A;  4BT8 A;  5AQ7 A;  3HDX A;  3VV0 A;  4I6G A;  2XEV A;  4GYY A;  2L6B A;  2JLB A;  3J5P A;  4WUY A;  1A17 A;  4FHJ A;  5T8I A;  2IY0 C;  3L9T A;  4I6J A;  4FJY A;  3SWC A;  4FU3 A;  2I1J A;  1TJC A;  1Y6I A;  4Y6C A;  3CV0 A;  3HXB A;  4JHK A;  2XPI A;  3UT4 A;  3SD5 A;  3LDZ A;  5FZR A;  4ATG A;  4QQI A;  2DVW A;  4F6R D;  3NBN B;  3K5K A;  3CHR A;  4A3T A;  4XIF A;  3EJN A;  3UIP C;  4TXR A;  3SFY A;  3LVQ E;  4UWF A;  4E85 A;  4CYM D;  4G2V A;  2IOS A;  2R5S A;  5FZS A;  4O1P A;  4ANU A;  5EYL A;  3V2O A;  4DX1 A;  2FEZ A;  3KMJ A;  2KCL A;  3HHM A;  3TWQ A;  1UN9 A;  3PZ2 A;  4N5C A;  3FUN A;  2I2O A;  5T4Y A;  4RVB A;  4DLO A;  3AG2 E;  3ASG A;  2ZXW E;  2WXG A;  4G25 A;  2HE0 A;  4RG9 A;  2GRN B;  4GYW A;  3HG0 D;  3O4Z A;  1B89 A;  4FMU A;  4DI3 A;  4RQI A;  2P2C P;  3FY4 A;  2WQ6 A;  5AIJ A;  3T5V A;  1JUQ A;  3Q7A A;  1HS6 A;  1HG2 A;  4J8D A;  3W9G A;  1YA0 A;  4CDN A;  5KJN A;  3QC1 A;  1MQS A;  3TWT A;  4O1O A;  3FTV A;  4J8O A;  4Z4P A;  3HIZ A;  2HYZ A;  3RAU A;  4A55 A;  2VQ2 A;  4PS3 A;  3ZXP A;  3FTW A;  4KT6 B;  4JA9 A;  4WNF A;  5EDS A;  3AJI A;  5LSZ A;  3JQ0 A;  3MZL B;  5JMN D;  4GTS A;  4GA0 A;  2Y0B G;  3CHQ A;  3ASO E;  3CBP A;  2DZO A;  3NF1 A;  2WM9 A;  2P9K G;  5CEA A;  3OAW A;  2XHE A;  4DX7 D;  2BF0 X;  3G2S A;  3MX3 A;  4TXP A;  4CT4 A;  4MS6 A;  2VSX E;  1E8Z A;  4IJD A;  3KMA A;  1S64 A;  3ULQ A;  3AS8 A;  2RFM A;  2VYI A;  2P9P G;  3EHQ A;  4ILI A;  4B93 B;  5AAR A;  4YDE A;  4AY6 A;  5FQ8 A;  4DRX E;  3L54 A;  1W3B A;  2QY7 A;  4HXI A;  5IY5 E;  4HS2 A;  4OVV A;  3J5Q B;  4L9P A;  4GTV A;  5F6L A;  4LUN U;  4TUM A;  2AXV A;  5FQ6 A;  3I5P A;  2CHZ A;  1N6A A;  5HS0 A;  1S70 B;  2PZI A;  2YHC A;  3UKU G;  4ANX A;  4N5Q A;  3IV0 A;  4RZ0 A;  2R2L A;  3TWR A;  4NRH B;  2RKK A;  3NZU A;  3NZS A;  1Z3Y A;  3RO3 A;  3OOI A;  5JHN A;  1MHQ A;  5CED B;  1X5B A;  2VTB B;  1WAO 1;  4HOU A;  5HKP A;  3NQP A;  1MYO A;  2I1K A;  3DPY A;  3IXE A;  5T0M A;  2P9U G;  2J4B A;  4BX9 A;  1IXV A;  3ABK E;  1SZ9 A;  3MO0 A;  4JD2 G;  5J08 A;  1OWP A;  3SFX A;  3KMT A;  1AP7 A;  2X6I A;  4PH4 B;  5LFA A;  1QBQ A;  5G04 C;  3RRM B;  2KCV A;  3SF4 A;  2Y4U A;  3EHR A;  1UOH A;  2FBN A;  4NIK A;  3ZYM A;  4M3O A;  3ULY A;  1TN7 A;  3JXJ A;  1N6C A;  2IF4 A;  2WMN A;  3FWV A;  1Z5S C;  4K5C A;  4F1P A;  1FVF A;  1PEG A;  4YNP A;  4JPS A;  2H6H A;  1DNP A;  2LSV A;  1O1R A;  3APC A;  4AOF A;  5EX0 A;  3MYV A;  3M53 A;  4I6E A;  3T8M A;  4B8A A;  5B1A E;  3PE4 A;  1BI7 B;  3ABL E;  1TEZ A;  5D66 A;  3LS8 A;  4HLE A;  3KEZ A;  2DYS E;  3BUA A;  1ML9 A;  4BSX A;  4J7I A;  1SA5 A;  1OT8 A;  3B7U X;  4CCA A;  4BUP A;  1DCE A;  3Q7F A;  4G11 A;  3ISM C;  2VGX A;  2FF4 A;  1N4R A;  3OTN A;  1TNU A;  5EN5 D;  3UM0 A;  4K5A B;  3FPD A;  3FUL A;  2WB2 A;  4YND A;  3KEA A;  1PY1 A;  3T5X A;  4AIF A;  3ZYQ A;  4AVX A;  1PAQ A;  2RFA A;  1TNO A;  4APF A;  5CER B;  4GA2 A;  5T5G A;  1E8W A;  2R59 A;  2X6K A;  5AQ9 A;  4AU7 A;  4DUI A;  1DC2 A;  1HH8 A;  2J07 A;  3PE3 A;  4AJW A;  3Q9N C;  2WXH A;  3UXG A;  5BV1 A;  4LEU A;  4JHR A;  4IRU A;  4J8F A;  4L2L A;  3OXG A;  4WWO A;  5BXO A;  5BT1 A;  3MKQ A;  2DCP A;  3FDH A;  5ENT D;  2PNN A;  2NYJ A;  3FUJ A;  1UW4 B;  5CRV A;  3N71 A;  4KVM A;  4JC8 A;  2BTD A;  4JDS A;  3ASH A;  4FLH A;  5TEG A;  3RQ4 A;  3M58 A;  4GAA A;  4G8K A;  4J7F A;  3UM2 A;  4KYO B;  3E32 A;  4MI5 A;  4YVO A;  1QZ2 A;  2ZGG A;  3RRN B;  2CFZ A;  3SO8 A;  2GW1 A;  3AU4 A;  3TGO A;  2JAB A;  4EBA A;  3CHM A;  4XE0 A;  3EU9 A;  2ILR A;  3ZW3 A;  4H7Y A;  1E7U A;  2KZT B;  3KS2 A;  2XCB A;  3B7S A;  3LY9 A;  2KC7 A;  2PM7 A;  2RFI A;  4FHK A;  4E6H A;  4PS7 A;  3TG5 A;  5G55 A;  3S7B A;  2MYO A;  4WNE A;  5AYF A;  1S0P A;  3DPD A;  4U8Y D;  1QNF A;  2CHX A;  3Q75 A;  1HG5 A;  3GZS A;  1NFI E;  1U2V G;  4KVO A;  2O8J A;  3VLF A;  4NQ0 A;  4B0Z A;  4I9C A;  1ZKK A;  3ESL A;  4WND A;  1O1T A;  4GYO A;  3FTZ A;  1JPL A;  4GML A;  3M54 A;  3GZ2 A;  1DVP A;  4I1A A;  1N9A A;  2EIJ E;  2EIM E;  3TJP A;  2L0I A;  3LKU A;  2EIN E;  3ABM E;  4L7T A;  1V54 E;  5JHA A;  4ACL A;  3BU8 A;  3PS6 A;  1MVH A;  3OXF A;  2LNI A;  3BG1 B;  1MJ0 A;  3FEY A;  3LCA A;  2FUL A;  3DXM G;  3D9H A;  5LCW C;  3EIJ A;  2QYJ A;  4PS8 A;  1FPP A;  3ZVV A;  4WWP A;  3PNT B;  3DSU A;  1Q2Z A;  5CCM A;  1KLX A;  5TTF A;  4CDM A;  1O9S A;  1H2T C;  1OCC E;  4YPA A;  4UI9 C;  3B7B A;  2MOW A;  4GZ5 A;  4G24 A;  3TWV A;  4TUU A;  3JQ1 A;  5T0K A;  1HXI A;  4L2Y A;  2M63 A;  5BW8 C;  4GCO A;  3FUE A;  2X6F A;  2OVB A;  3ZRH A;  5JJ7 A;  2DBA A;  3D9O A;  1IYG A;  2E0I A;  1V55 E;  4QEN A;  3TXM A;  3MO2 A;  4MI0 A;  3T9K A;  3D9M A;  1N54 A;  3EHM A;  3SY2 A;  2V4H C;  3FU6 A;  3UPV A;  5AYW D;  3M57 A;  3DSV A;  3UUX A;  2DWZ A;  1WM5 A;  2XPZ A;  3G2U A;  2BED A;  2OND A;  3RSE G;  3PEV B;  4GCN A;  2IJG X;  3DBS A;  2F8X K;  3GYZ A;  2XRY A;  4GZ3 A;  3UTM A;  1NL4 A;  3CVV A;  5AQA A;  1K3Z D;  4FUL A;  3SW9 A;  1YCS B;  5BXU A;  4MLP A;  5LX8 A;  2J9Q A;  4GMR A;  4HRL A;  3TAX A;  1G3N B;  1TN8 A;  4Q94 A;  4AP2 A;  4ILG A;  5CEC B;  3ASD A;  1ELW A;  3V79 K;  2AVP A;  3QWW A;  1K8K G;  2MRI A;  1IHG A;  4HOQ A;  5EKQ D;  2CFU A;  2PL2 A;  4IUL A;  3FU3 A;  3CKB A;  3MV3 B;  4GA1 A;  4DJA A;  2YQ8 A;  3DRA A;  1H6O A;  2H6F A;  3D9K A;  1H3I A;  3APF A;  4F53 A;  2VJ8 A;  5E76 A;  1OCZ E;  3FU0 A;  1KZO A;  2EIL E;  3VLD A;  3ZN3 A;  3ONL A;  3U64 A;  4PUC A;  2IO2 C;  1HFA A;  4FA6 A;  3LJN A;  4I2Z A;  3ESK A;  3PZD A;  2B0O E;  4FP7 A;  4Q69 A;  4G8L A;  3PVL A;  3FUF A;  4R7L A;  2LAH A;  1XGW A;  3KD7 A;  1EPU A;  1TYQ G;  3C72 A;  3LVR E;  3LPZ A;  4O60 A;  3CVP A;  3D3M A;  2Y3A A;  4NUR A;  3S7D A;  4C48 B;  5F6K C;  3FEX A;  3R9M A;  2QZA A;  5FQ7 A;  4J0U A;  1FCH A;  4BTB A;  1NA0 A;  5A7D B;  5FIN A;  1N0Q A;  4X8Q A;  5KNG A;  2XPY A;  3NOC D;  2FO7 A;  5KNH D;  3C98 A;  4OAU C;  4BER A;  1WY6 A;  2H6G A;  1LD7 A;  1SA4 A;  1HX8 A;  3SFZ A;  3F9X A;  4F7A A;  2RD0 A;  3ZUV B;  3BEE A;  4RLY A;  3SBT B;  3FUK A;  4K0R A;  4EZL A;  3ZFW A;  4GTM A;  4KZC A;  5JIY A;  3HXE A;  3URZ A;  4FC8 A;  5C2Y A;  4GZC A;  3E37 A;  5M72 A;  4FAD A;  2IEJ A;  4HVB A;  4HQD A;  1PC2 A;  3QOU A;  3P1U A;  2GRL A;  3DXK G;  3OXL A;  4B89 A;  2VGY A;  1SZA A;  3V30 A;  3EP0 A;  2JEK A;  3PZ3 A;  4BX8 A;  2J49 A;  1TNB A;  1K1B A;  1H2U A;  5AJL A;  1IQU A;  1HU3 A;  2WMO A;  2V0P A;  5ENN A;  4I43 A;  5AQB A;  3U3W A;  4DK5 A;  4FLB A;  5AN8 A;  4N3A A;  1HE8 A;  3K9I A;  4JVS A;  3M56 A;  1SW6 A;  3LJ3 A;  3QJZ A;  4L23 A;  4U96 D;  5CPR B;  2E2E A;  2QPW A;  2J4D A;  3IEG A;  4A1S A;  2VGX B;  4MBG A;  4LNG A;  4I17 A;  3DSX A;  3CQG B;  2J08 A;  1MZC A;  5CCL A;  3FH8 A;  1FT2 A;  3ZGQ A;  3W9F A;  3FTX A;  2F69 A;  2V4L A;  4AEZ C;  3CK8 A;  3FTY A;  1ZBP A;  3FH7 A;  1XNF A;  5E75 A;  1ZB1 A;  4XX5 A;  3M55 A;  2XGS A;  2R3A A;  1RW2 A;  4XKB A;  4DPR A;  2GRR B;  2WXI A;  4XI0 A;  2PQR A;  2Y1L E;  3D9I A;  1MX6 A;  4U7E B;  2WXO A;  3ZIM A;  1JWF A;  2MHK A;  2A4Z A;  2HM8 A;  2FI7 A;  4KBQ A;  3MKQ B;  3HVE B;  2I9C A;  4JA7 A;  2IO3 C;  4JEU A;  2GRP B;  5LSX A;  4JZY A;  1OY3 D;  4TRQ A;  5LOZ A;  1UN8 A;  2W5Y A;  2OOE A;  1TR4 A;  3VTY A;  3FH5 A;  4O30 A;  2J8S D;  3IHY A;  3ZXS A;  2WXL A;  2V5Q C;  2OEV A;  2AWI A;  2W5Z A;  5CMW A;  4XI9 A;  4GU5 A;  2WPV A;  1OUV A;  3OPE A;  2R17 C;  4BWR A;  5EIL A;  1N94 A;  4TV3 A;  2WXN A;  4YPE A;  4HRM B;  4LNU D;  2PM6 A;  4I2W A;  2AW6 A;  3TWS A;  3DB5 A;  3EUV A;  4HNA D;  5DBK A;  3SGH A;  4EBA G;  2IU1 A;  3B7T A;  3Q78 A;  3MA5 A;  5F5E A;  3CLJ A;  5G05 C;  5CMY A;  4D10 C;  5HRY A;  1P5Q A;  4Q96 A;  1H0A A;  5B1B E;  4FJZ A;  2NXP A;  5H7P A;  3TL5 A;  2I6H A;  3QK0 A;  1EDU A;  4XZ4 A;  4V3I A;  5AJD A;  3AG3 E;  3CSF A;  1RZ4 A;  2XCC A;  4BY6 A;  4BTA A;  3V31 A;  3QWV A;  2EQX A;  3L13 A;  2VSY A;  4E47 A;  2H6I A;  3HVE A;  1H2V C;  4QFV A;  1QQE A;  1DCQ A;  4B8C B;  3CHS A;  3TWW A;  4U95 D;  4G1T A;  3RJV A;  4F1S A;  5BV0 A;  1XQH A;  4G26 A;  5FQ4 A;  3D9P A;  2HR2 A;  2R03 A;  5ARF A;  4A3V A;  3ASF A;  4J83 A;  5ARG A;  3UM1 A;  3U4T A;  2KBX A;  2XEN A;  1NI1 A;  3BO5 A;  2BUG A;  1MX4 A;  4A1G A;  1O1S A;  4J8E A;  4EHM A;  4JW1 A;  4XKC A;  2V5F A;  2ETC A;  1MT6 A;  3MEK A;  1BD8 A;  2QFC A;  3CVN A;  4HOR A;  3FUM A;  4OAV B;  4K5B A;  3HXF A;  2WXJ A;  4W9R A;  4I1M A;  1D9S A;  3WG7 E;  3S8P A;  2X6H A;  1EYH A;  1VDY A;  4BT9 A;  3CVW A;  4CRW A;  4I51 A;  4LNB A;  2XZT G;  3UM3 A;  4LDG A;  5JJ6 A;  3DEO A;  1U3C A;  3E34 A;  2G46 A;  2P9I G;  2OCC E;  3TWX A;  4TXQ A;  2XEH A;  3B95 A;  5EG2 A;  3PUJ A;  5D2M C;  3QAQ A;  2UY1 B;  4HOS A;  4HLL A;  4BEP A;  4U63 A;  1Z6T A;  3CHO A;  3ZHE B;  2GRO B;  3F9Y A;  2X6J A;  4GTP A;  2OVF A;  3BG0 B;  1ZU2 A;  5G04 J;  2X38 A;  3U66 A;  5D0O D;  3LYA A;  1N4S A;  4K03 A;  4UQX A;  4GTO A;  5FT9 A;  3CVU A;  1E8X A;  3MGB A;  4IYP A;  3WXX A;  5HI7 A;  5CRU A;  3DWL G;  1NZN A;  5EIB E;  4NJ5 A;  4HBD A;  5KCM A;  3CBM A;  4UWG A;  4CZ2 D;  1S63 A;  1IKN D;  1ELK A;  3C3O A;  2UWJ G;  1UG3 A;  1OXJ A;  4H12 A;  3EHN A;  2V8S E;  1Z3X A;  3SHF A;  3FP3 A;  2XZD G;  1OCR E;  3L22 A;  2CG3 A;  2NC9 A;  3S7F A;  3PZ1 A;  1MX2 A;  4KMO A;  5F59 A;  2F37 A;  3LY8 A;  2BQZ A;  3DST A;  4WWN A;  3ZU7 B;  4APO A;  4U07 A;  3CK9 A;  5ENO D;  3ZKJ A;  3AU5 A;  3JUI A;  3PDN A;  3TWU A;  1YYH A;  2BKK B;  4M7C A;  3QNK A;  1SVX A;  1N11 A;  3Q73 A;  2P9N G;  3BQO A;  3ZYK A;  2WXR A;  3PH0 C;  3GZ1 A;  3PNL B;  4URK A;  3CVX A;  4JL0 A;  4BSZ B;  3L16 A;  3CVL A;  5LP0 A;  3LXU X;  1LF8 A;  2UY1 A;  3VUZ A;  4B94 A;  3AG4 E;  3UIO C;  3ZHE A;  4Z68 A;  4UWK A;  1Y8M A;  1BU9 A;  3IKO B;  1FVH A;  3QWP A;  2AJA A;  3JCK C;  4AV7 A;  1UJK A;  3UT7 A;  4RSY A;  4J8S A;  1INZ A;  3C3Q A;  3QKY A;  4G23 A;  4IJ8 A;  4UWL A;  3SNX A;  1JWG A;  3ZYL A;  5EX3 A;  2WQH A;  2HO1 A;  5BPP A;  4QEO A;  2XQ0 A;  1TNZ A;  3S2A A;  4LER A;  1JCQ A;  2XS8 A;  4GTQ A;  2IOL A;  1JCS A;  5HQ8 A;  1H6P A;  1A5E A;  4NAC A;  3NOG D;  3C3R A;  4NVQ A;  4YDO A;  2DIW A;  2CG2 A;  3FTS A;  3M59 A;  3ZPJ A;  4ACK A;  4WAF A;  2VSO E;  4ANV A;  2GRQ B;  1L5J A;  1WDY A;  2Q7F A;  3C5R A;  4OYS A;  3RO2 A;  4GPM A;  2F0Y A;  4YPU A;  3CVY A;  3Q4A B;  1LD8 A;  3FHE A;  2P58 C;  4CT0 A;  1LTX A;  3D9N A;  3ONK A;  3R9A B;  4U04 A;  4EZK A;  3MJW A;  4BET A;  3JYS A;  4CGV A;  3HRA A;  2AXU A;  3T8K A;  4N2Q A;  3F9Z A;  4HI9 A;  1E90 A;  2IFU A;  1H19 A;  4BFR A;  4GZD A;  1TJF A;  3MV2 B;  5BUZ A;  5LCW J;  5FIO A;  4JXT A;  3UI2 A;  1E96 B;  4O6F A;  2R02 A;  4ZFH A;  4I1O B;  3R7Q A;  3B13 A;  1K1A A;  3VLE A;  2AXZ A;  3SI5 A;  3RAY A;  5ENS D;  2J09 A;  1N4Q A;  1AWC B;  3PEU B;  4UI9 J;  2WVI A;  4C0M A;  5KWD A;  3L17 A;  4U0S A;  4I9E A;  1HO8 A;  2IQC A;  3ML9 A;  3ULE G;  3LY7 A;  2LXL A;  2L9B A;  3TXN A;  2GGF A;  2EIK E; 
#chains in the Genus database with same CATH homology
 4GB9 A;  2WPV A;  1OUV A;  3LVQ E;  3OPE A;  2R17 C;  3UX4 A;  4HFG A;  4BWR A;  3AS4 A;  4N3C A;  3M57 A;  4I9C A;  1ZKK A;  2KCK A;  3ESL A;  4TV3 A;  2WXN A;  4UWF A;  4WND A;  4E85 A;  4YPE A;  2PM6 A;  4I2W A;  4GYO A;  3FTZ A;  4G2V A;  2AW6 A;  1JPL A;  2IOS A;  4GML A;  3M54 A;  2R5S A;  5DIZ A;  3GZ2 A;  5FZS A;  2IGQ A;  4ANU A;  3DB5 A;  1DVP A;  3G2V A;  4LCT A;  4I1A A;  3TJP A;  2FEZ A;  2L0I A;  5CHE E;  3LKU A;  5DBK A;  3SGH A;  2KCL A;  4EBA G;  3KMJ A;  2IU1 A;  3HHM A;  3B7T A;  4L7T A;  3MA5 A;  3ZEF A;  3U9W A;  1UN9 A;  4N5C A;  5JHA A;  3FUN A;  2I2O A;  4ACL A;  5T4Y A;  3PS6 A;  1MVH A;  5F5E A;  3OXF A;  3CLJ A;  5G05 C;  2XRZ A;  2LNI A;  2C0L A;  5CMY A;  4RVB A;  3BG1 B;  4D10 C;  1KT0 A;  3FU5 A;  4DLO A;  1P5Q A;  3FEY A;  3ASG A;  4ILH B;  3LCA A;  4Q96 A;  1H0A A;  2FUL A;  3FUH A;  3CHP A;  2WXG A;  4G25 A;  1BPO A;  3G2T A;  5LCW C;  3EIJ A;  3UQ3 A;  4PS8 A;  3ZVV A;  1MVX A;  4WWP A;  3CBO A;  4RG9 A;  3PNT B;  4FJZ A;  2NXP A;  3TL5 A;  5J90 A;  3P2B A;  4GYW A;  5FQ7 A;  2I6H A;  1KLX A;  1B89 A;  1EDU A;  3O4Z A;  3QK0 A;  4U0Z A;  4XZ4 A;  4DI3 A;  5CCM A;  4V3I A;  3FY4 A;  4FMU A;  5AJD A;  5TTF A;  3CSF A;  2WQ6 A;  3R7R A;  5AIJ A;  3T5V A;  1JUQ A;  3Q47 B;  2XCC A;  4CDM A;  1HS6 A;  1O9S A;  4BY6 A;  1HG2 A;  1H2T C;  4J8D A;  4BTA A;  1N3J A;  4YPA A;  3QWV A;  2EQX A;  4UI9 C;  2MOW A;  2ZU6 B;  4G24 A;  4GZ5 A;  3L13 A;  1YA0 A;  2VSY A;  4EZJ A;  4IN3 B;  4TUU A;  3JQ1 A;  4C0E A;  3HNA A;  5T0K A;  1HXI A;  5FWQ A;  4CDN A;  5KJN A;  4L2Y A;  4E47 A;  3HVE A;  1H2V C;  2M63 A;  3G2W A;  5BW8 C;  4GCO A;  1NP7 A;  4ANW A;  3FUE A;  2X6F A;  3AS5 A;  2OVB A;  3I4G A;  3QC1 A;  1MQS A;  4QFV A;  3ZRH A;  3RJW A;  1QQE A;  5JJ7 A;  2DBA A;  2WXF A;  3EIQ C;  3D9O A;  4B8C B;  1IYG A;  1MUF A;  3CHS A;  3FTV A;  2E0I A;  4J8O A;  4Z4P A;  3Q15 A;  4CEM A;  3HIZ A;  4G1T A;  2HYZ A;  3RJV A;  4F1S A;  5BV0 A;  1XQH A;  4G26 A;  5FQ4 A;  3D9P A;  2HR2 A;  4A55 A;  2VQ2 A;  4QEN A;  3TXM A;  5ARF A;  4A3V A;  3ASF A;  3MO2 A;  4MI0 A;  4CDR A;  4J83 A;  1OWL A;  4GZ6 A;  4PS3 A;  5ARG A;  3D9M A;  3FTW A;  4KT6 B;  4AY5 A;  3U4T A;  1N54 A;  3S7J A;  4JA9 A;  4WNG A;  4WNF A;  3EHM A;  4OVU A;  4P29 A;  5EDS A;  3FU6 A;  3BO5 A;  2BUG A;  5LSZ A;  4A1G A;  3JQ0 A;  4J8E A;  4JW1 A;  3MZL B;  4XKC A;  2V5F A;  4UI9 K;  3UPV A;  1MT6 A;  3MEK A;  4GA0 A;  4KZ0 A;  4LRZ A;  2QFC A;  5AYW D;  3CHQ A;  3GW4 A;  3UUX A;  3CVN A;  4HOR A;  3SZ7 A;  3FUM A;  3CBP A;  1WM5 A;  3NF1 A;  2WXJ A;  2WM9 A;  4W9R A;  2WXQ A;  5JJT A;  5AEN A;  3RIB A;  2XPZ A;  4I1M A;  3SBS A;  3G2U A;  3S8P A;  2X6H A;  3RU0 A;  3KAE A;  2OND A;  1EYH A;  1VDY A;  1NA3 A;  3PEV B;  4BT9 A;  4GCN A;  2IJG X;  3OAW A;  3DBS A;  2XHE A;  3CVW A;  2BF0 X;  3GYZ A;  2XRY A;  3G2S A;  4QEP A;  3MX3 A;  4GZ3 A;  4CRW A;  4CT4 A;  4I51 A;  5KJL A;  5A23 A;  1H6K A;  4MS6 A;  2VSX E;  2L6J A;  1E8Z A;  3PRZ A;  3CVV A;  4IJD A;  4FUL A;  5JJ6 A;  4LDG A;  1UJJ A;  4N39 A;  3SW9 A;  1EF1 C;  1U3C A;  2G46 A;  4MLP A;  5LX8 A;  3KMA A;  2J9Q A;  2PQN A;  3ULQ A;  3AS8 A;  5G2N A;  2VYI A;  3TAX A;  5EG2 A;  4ILI A;  4L1B A;  4Q94 A;  3PUJ A;  3CST A;  4AP2 A;  3QAQ A;  2X3M A;  4H7X A;  4ILG A;  4AY6 A;  5FQ8 A;  3ASD A;  2UY1 B;  4HOS A;  1ELW A;  3RRU A;  2C2L A;  3L54 A;  4U63 A;  5TH7 A;  1W3B A;  2AVP A;  2QY7 A;  4HXI A;  1Z6T A;  3CHO A;  2A5U A;  3ZHE B;  3QWW A;  5ANL A;  4HS2 A;  4OVV A;  2MRI A;  2X6J A;  3F9Y A;  2OVF A;  3BG0 B;  1IHG A;  1ZU2 A;  1N52 A;  2X38 A;  4HOQ A;  5EKQ D;  5G04 J;  1KT1 A;  3U66 A;  5D0O D;  2CFU A;  2PL2 A;  4LUN U;  2VTB A;  5F6L A;  3LYA A;  2AXV A;  4IUL A;  5FQ6 A;  1E7V A;  1HF8 A;  2ION A;  3I5P A;  4K03 A;  4UQX A;  3FU3 A;  5FT9 A;  3CVU A;  2CHZ A;  3CKB A;  3MV3 B;  1E8X A;  4GA1 A;  3MGB A;  4DJA A;  1N6A A;  4IYP A;  2YQ8 A;  3WXX A;  2PZI A;  2YHC A;  5HI7 A;  4U0U A;  2WXK A;  4ANX A;  4ABN A;  2WQ7 A;  2XGM A;  3D9K A;  1H3I A;  3APF A;  3IV0 A;  4AXH A;  1NZN A;  4F53 A;  4RZ0 A;  2VJ8 A;  1U3D A;  5E76 A;  3FU0 A;  4NRH B;  3CIA A;  4NJ5 A;  5KCM A;  3VLD A;  3CBM A;  2OV8 A;  1OWO A;  4UWG A;  3NZU A;  5FZQ A;  3ZN3 A;  1ELK A;  2UWJ G;  4UQY A;  1UG3 A;  3NZS A;  1Z3Y A;  4H12 A;  3EHN A;  3RO3 A;  3OOI A;  5JHN A;  1MHQ A;  3ONL A;  2V8S E;  3I3N A;  4JEH A;  3U64 A;  1X5B A;  1Z3X A;  3SHF A;  3UMV A;  3FP3 A;  2VTB B;  4PUC A;  4UQZ A;  3MO5 A;  4RG6 A;  5KJK A;  3L22 A;  1WAO 1;  1HFA A;  2CG3 A;  2NC9 A;  4HOU A;  4FA6 A;  4I2Z A;  3S7F A;  3ESK A;  3PZD A;  4KMO A;  5F59 A;  4FP7 A;  4Q69 A;  3NQP A;  3PVL A;  3FUF A;  4JLG A;  2I1K A;  3LY8 A;  3ML8 A;  4R7L A;  2BQZ A;  4WWN A;  2VSN A;  5T0M A;  2LAH A;  4APO A;  1XGW A;  5JJ0 A;  3KD7 A;  1IQR A;  3CK9 A;  4U07 A;  5D0Q D;  2J4B A;  1EPU A;  4BX9 A;  3CGH A;  4AM9 A;  5T3R A;  3AU5 A;  3JUI A;  3LEW A;  3LPZ A;  3LVR E;  1SZ9 A;  3MO0 A;  3CVP A;  3L08 A;  3D3M A;  3PDN A;  3VTX A;  4C1Q A;  2Y3A A;  5J08 A;  3QNK A;  4NUR A;  3S7D A;  1OWP A;  5F6K C;  3ZYK A;  3FEX A;  2WXR A;  2YIN A;  3I4R B;  3KMT A;  4F3V A;  3IBE A;  3PH0 C;  4J0U A;  1FCH A;  2X6I A;  3GZ1 A;  4Y6W A;  4PH4 B;  1NA0 A;  3CR3 A;  1OWN A;  3PNL B;  4BTB A;  4URK A;  5LFA A;  4JL0 A;  5A7D B;  1E8Y A;  3CVX A;  3L16 A;  5G04 C;  3CVL A;  3RRM B;  5LP0 A;  3LXU X;  5ANR A;  1LF8 A;  2KCV A;  3FFL A;  3SF4 A;  2UY1 A;  2Y4U A;  3VUZ A;  2XPY A;  4B94 A;  3QB2 A;  2FBN A;  2L0T B;  4MRU A;  3F9W A;  3PRE A;  2YHE A;  2FO7 A;  4M3O A;  3FTU A;  3ZYM A;  5A6C A;  3C98 A;  2LAI A;  4KXK B;  4YVQ C;  3ZHE A;  4GMJ A;  1N6C A;  1OWM A;  4UWK A;  2IF4 A;  2WMN A;  3FWV A;  1FVF A;  1Y8M A;  1WY6 A;  1PEG A;  4YNP A;  4JPS A;  1HX8 A;  3IKO B;  4N2S A;  3CKC A;  3SFZ A;  3F9X A;  1FVH A;  1HZ4 A;  1DNP A;  2LSV A;  3QWP A;  1SQM A;  4F7A A;  4EQF A;  2RD0 A;  3HYM B;  3BEE A;  3APC A;  5JIN A;  3JCK C;  3MKR A;  4AOF A;  5EX0 A;  4AV7 A;  2JV0 A;  3SBT B;  3MYV A;  3M53 A;  1UJK A;  4I6E A;  3T8M A;  4B8A A;  2GRM A;  3UT7 A;  2YNQ A;  3D9J A;  3PE4 A;  4J8S A;  4RSY A;  3FUK A;  1INZ A;  4K0R A;  1TEZ A;  4EZL A;  3ZFW A;  3LS8 A;  3QKY A;  4HLE A;  4G23 A;  4IJ8 A;  4GPK A;  4KZC A;  3D9L A;  4UWL A;  3SNX A;  4C9B B;  5JIY A;  1JWG A;  3KEZ A;  3ZYL A;  5EX3 A;  3URZ A;  4DI4 A;  4DLQ A;  2WQH A;  4FC8 A;  2HO1 A;  5BPP A;  4BSX A;  1ML9 A;  4QEO A;  2XQ0 A;  4GZC A;  5C2Y A;  5M72 A;  4EEC A;  4J7I A;  4FAD A;  3S2A A;  4LER A;  3Q49 B;  4HVB A;  1PC2 A;  3QOU A;  3B7U X;  4HOT A;  3P1U A;  2GRL A;  5FTP A;  4CCA A;  3OS5 A;  2WXM A;  3OXL A;  3CK7 A;  4BUP A;  2IOL A;  2VGY A;  1SZA A;  4G11 A;  4B89 A;  4N3B A;  2VGX A;  3RK6 A;  5JHB A;  2FF4 A;  3QAR A;  3EP0 A;  3OTN A;  2JEK A;  5HQ8 A;  4BX8 A;  3O48 A;  3FPD A;  3FUL A;  2WB2 A;  3L6A A;  2J49 A;  4YND A;  4CGW A;  1H2U A;  1PY1 A;  2CHW A;  1IQU A;  1HU3 A;  2KAT A;  5AJL A;  4NAC A;  4EPZ A;  2WMO A;  4ME2 A;  2V0P A;  3T5X A;  4AIF A;  4NVQ A;  5ENN A;  3ZYQ A;  3RKV A;  2C0M A;  4AVX A;  2DIW A;  1PAQ A;  2RG8 A;  2CG2 A;  5KJM A;  3FUI A;  4I43 A;  3FTS A;  3M59 A;  3ZPJ A;  3U3W A;  4APF A;  4DK5 A;  4YNM A;  4FLB A;  4GA2 A;  4ACK A;  3FUD A;  5T5G A;  4WAF A;  1E8W A;  2R59 A;  4J6I A;  4N3A A;  4U8H A;  1HE8 A;  3K9I A;  4JVS A;  2VSO E;  2X6K A;  4ANV A;  3IHX A;  3M56 A;  3LJ3 A;  3QJZ A;  3Q5M A;  4AU7 A;  4L23 A;  3QDN A;  5CPR B;  2E2E A;  3CQC B;  3DAL A;  2QPW A;  2J4D A;  3IEG A;  1L5J A;  1HH8 A;  2J07 A;  4A1S A;  3PE3 A;  4UWH A;  2NSZ A;  3IHV A;  2VGX B;  2Q7F A;  2LO6 A;  4AJW A;  4JHJ A;  1ELR A;  2WXH A;  2Y4T A;  5BV1 A;  4OYS A;  3TG4 A;  4LEU A;  3EDT B;  4I17 A;  4JHR A;  3RO2 A;  4IRU A;  4J8F A;  4L2L A;  3CQG B;  3CEQ A;  3OXG A;  4YPU A;  3CVY A;  2WXP A;  2LSU A;  3Q4A B;  2J08 A;  4WWO A;  3FHE A;  2P58 C;  4MKT A;  4CT0 A;  3UT8 A;  5BT1 A;  3E4B A;  3MKQ A;  3D9N A;  2DCP A;  5CCL A;  3FDH A;  3FH8 A;  3ONK A;  3R9A B;  2XGO A;  3ZGQ A;  3FTX A;  4U04 A;  5C1D A;  3B7R L;  4EZK A;  3FUJ A;  3MJW A;  4PDX A;  1UW4 B;  2KZT A;  2F69 A;  3JYS A;  2V4L A;  3CVQ A;  3N71 A;  4KVM A;  4AEZ C;  4CGV A;  3M5A A;  4JC8 A;  2AXU A;  2BTD A;  3APD A;  1GW6 A;  3CK8 A;  4N2Q A;  3ASH A;  4FLH A;  4JDS A;  5TEG A;  3RQ4 A;  3FTY A;  5FJY A;  3F9Z A;  3M58 A;  3MCX A;  1ZBP A;  5G05 J;  4GAA A;  1E90 A;  1XNF A;  2IFU A;  3FH7 A;  5E75 A;  1H19 A;  4BFR A;  4J7F A;  4GZD A;  3ENE A;  3PUK A;  4KYO B;  5BNW A;  4MI5 A;  4XX5 A;  3M55 A;  1TJF A;  4YVO A;  1QZ2 A;  2XGS A;  2KM4 A;  4BT8 A;  2R3A A;  3RRN B;  2CFZ A;  3HDX A;  4XKB A;  4DPR A;  2GW1 A;  3MV2 B;  5BUZ A;  3AU4 A;  4I6G A;  3VV0 A;  2WXI A;  2XEV A;  4GYY A;  5LCW J;  4XI0 A;  2PQR A;  2JLB A;  3D9I A;  3TGO A;  4WUY A;  4JXT A;  4EBA A;  2WXO A;  1A17 A;  4FHJ A;  1E96 B;  4O6F A;  1JWF A;  3CHM A;  3ZIM A;  5T8I A;  2MHK A;  2A4Z A;  2HM8 A;  2FI7 A;  4KBQ A;  3MKQ B;  4I6J A;  4FJY A;  4XE0 A;  3HVE B;  4I1O B;  2ILR A;  3SWC A;  2I9C A;  3ZW3 A;  3R7Q A;  4H7Y A;  1E7U A;  2KZT B;  3B13 A;  4JA7 A;  4FU3 A;  3KS2 A;  3VLE A;  2XCB A;  2AXZ A;  3SI5 A;  3RAY A;  4JEU A;  3B7S A;  2J09 A;  2I1J A;  1TJC A;  3LY9 A;  1Y6I A;  4Y6C A;  5LSX A;  3PEU B;  2KC7 A;  2PM7 A;  3CV0 A;  4UI9 J;  4JZY A;  2RFI A;  4JHK A;  2XPI A;  4TRQ A;  4FHK A;  3UT4 A;  4E6H A;  4PS7 A;  3SD5 A;  2WVI A;  3TG5 A;  5G55 A;  4C0M A;  3L17 A;  3S7B A;  4U0S A;  4I9E A;  3LDZ A;  5LOZ A;  1UN8 A;  2W5Y A;  1HO8 A;  5FZR A;  2OOE A;  4WNE A;  3VTY A;  5AYF A;  4ATG A;  1S0P A;  2IQC A;  3DPD A;  1QNF A;  3FH5 A;  3ML9 A;  4O30 A;  3IHY A;  3ZXS A;  2CHX A;  3K5K A;  3LY7 A;  3CHR A;  2L9B A;  2WXL A;  3TXN A;  1HG5 A;  2AWI A;  3GZS A;  2W5Z A;  2GGF A;  4A3T A;  5CMW A;  4KVO A;  2O8J A;  4XI9 A;  4XIF A;  3VLF A;  3EJN A;  4NQ0 A;  4B0Z A;  4GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...