3S7JA

Structural basis of substrate methylation and inhibition of smyd2
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structural Basis of Substrate Methylation and Inhibition of SMYD2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 148
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3s7jA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3s7jA01
2LNIA 3OXFA 4N2QA 2V5FA 2O8JA 4CGWA 2DBAA 3QOUA 4UQYA 5JJ7A 5TEGA 1PC2A 4RZ0A 4EQFA 3FPDA 3CV0A 2FBNA 1TJCA 4U07A 4WNEA 3M56A 3CBMA 4JL0A 5JJ0A 4H12A 3DB5A 4N3AA 4GYYA 2KCLA 4RG6A 4JHRA 4HOTA 5JINA 4C1QA 2I6HA 4JA9A 3OS5A 5EX0A 2G46A 4B94A 3PDNA 3TG5A 4Z4PA 1E96B 1NA3A 2C2LA 3MV3B 5D0OD 4NJ5A 4NQ0A 4YNPA 3CK8A 1MT6A 4APOA 3ASGA 3F9ZA 2XGSA 2QFCA 4H7XA 4I9CA 5KJLA 5A7DB 4BWRA 4N3CA 4LDGA 1N6CA 2XPIA 3M53A 2LSVA 3ASFA 5T0MA 1Y8MA 4G25A 2YQ8A 3RKVA 2VGXA 3HNAA 4QEPA 1MVXA 4I51A 3SW9A 5F6KC 1ZU2A 2FEZA 2VSNA 4I17A 4U0ZA 1PEGA 4U0SA 4G2VA 1FCHA 2E2EA 2VQ2A 4WUYA 4U04A 3AS4A 4WNFA 4A1SA 4E47A 4I9EA 2HR2A 4G23A 2MHKA 2Q7FA 3WXXA 2J9QA 2KCVA 3UQ3A 4XI0A 3M55A 3KMJA 3VV0A 4GYWA 2Y4TA 3K9IA 4J8OA 4GYOA 4H7YA 2WQHA 1HXIA 2XGMA 3DALA 4ABNA 4O30A 4J83A 4G24A 3KD7A 3OPEA 3Q5MA 5HI7A 4MI0A 1KT1A 1IYGA 4YNMA 2VGXB 4AIFA 3RO2A 3Q49B 4J8DA 5D0QD 4BTBA 5CHEE 5KJKA 3LCAA 5BNWA 2KATA 5G04C 4I2WA 3OXLA 4GA2A 5ARFA 2FF4A 4O6FA 4Y6CA 3AS5A 4WNGA 2RFIA 5FTPA 1HZ4A 5JIYA 3FWVA 3VTXA 1N3JA 4ME2A 4J0UA 5T0KA 2FO7A 1MVHA 2W5ZA 3M59A 2L6JA 3MEKA 3MA5A 5FZQA 3U4TA 2XEVA 2C0LA 3CK7A 4BT8A 4GZ5A 2BQZA 5LCWJ 1ELWA 2UWJG 2IF4A 2PZIA 3ASHA 3MKRA 5T5GA 3OOIA 3Q4AB 2XGOA 3FP3A 4KBQA 4GCOA 1WM5A 2JLBA 3GW4A 3RIBA 4AU7A 4NVQA 3CKCA 4CGVA 3ASDA 5LSXA 2YHCA 3KAEA 2KC7A 3HYMB 2UY1B 1B89A 4J7IA 4JDSA 5TH7A 1A17A 5TTFA 4GA1A 3ULQA 3LYAA 3KS2A 2IGQA 3RJVA 2F69A 2Y4UA 4U0UA 4RG9A 4GZ6A 3KMTA 4HOUA 1QZ2A 3S7FA 5AYFA 3NF1A 2PQRA 3PE3A 3IEGA 3VUZA 4I1AA 4UQZA 3RU0A 3EP0A 5BW8C 4Y6WA 3F9XA 3TGOA 2WPVA 3R9AB 3ESKA 1ML9A 4J8EA 4UI9K 4G26A 1IHGA 4FMUA 4IJDA 3CKBA 3ZHEA 5F5EA 5KJMA 3KMAA 4N39A 3S8PA 3MO2A 2PQNA 5M72A 2VGYA 3SZ7A 2R5SA 5A6CA 3LY8A 4GPKA 2W5YA 3S7BA 3ZFWA 4F3VA 2P58C 4LEUA 4WNDA 4J8FA 3LY7A 4NRHB 3GYZA 3E4BA 2KCKA 3AS8A 3O48A 3GZ1A 3S7DA 1W3BA 1KLXA 5BT1A 4XI9A 2GW1A 4CDRA 2JV0A 3OXGA 3FFLA 1MUFA 3QKYA 3K5KA 1HH8A 5ARGA 2QPWA 2VSYA 5F6LA 2IFUA 3CVQA 4G1TA 5LSZA 1KT0A 3Q15A 3CVLA 3UUXA 3F9YA 4BUPA 3CVNA 1WAO1 3CK9A 5C1DA 3Q47B 3M54A 2C0MA 3U3WA 3ZGQA 3UPVA 3SWCA 3GZ2A 3N71A 5LCWC 2XCBA 5JJTA 4MI5A 3LPZA 4N2SA 3LY9A 5FJYA 4BTAA 3QWWA 4KXKB 3EDTB 1NZNA 4HOQA 1XQHA 3MO5A 2HYZA 4YVOA 5AYWD 4IJ8A 4QENA 3RAYA 3RQ4A 3TG4A 5FZRA 3QDNA 4GCNA 4JLGA 4AY6A 5EKQD 5DIZA 1N6AA 5F59A 3RO3A 4YNDA 3CBOA 2BUGA 2XCCA 4I2ZA 1O9SA 1ELRA 3PE4A 3ZPJA 4UI9J 4GA0A 2FI7A 3MV2B 1ZKKA 4JA7A 4UI9C 3SF4A 5JHNA 1XNFA 3BEEA 3CVPA 5EX3A 3M58A 5FZSA 3URZA 5HQ8A 4AY5A 5JJ6A 3M57A 4IN3B 2VYIA 3ZN3A 5EG2A 2PL2A 2AVPA 3BO5A 4YPAA 4GZ3A 4XIFA 3CBPA 1OUVA 4YPUA 4AM9A 2OOEA 4YPEA 2HO1A 3CEQA 5G05J 2LSUA 3M5AA 4UQXA 5G05C 3QWPA 2R3AA 3QWVA 4YVQC 1H3IA 4HOSA 3TAXA 1YA0A 1QQEA 4N5CA 4QEOA 3IHXA 4HORA 4KYOB 5CPRB 5DBKA 3RJWA 4BT9A 5CCMA 2NC9A 5G04J 3MO0A 3LKUA 3VTYA 4W9RA 3S7JA 3JYSA 1ZBPA 4N3BA 5CCLA 3ZHEB 1P5QA 2UY1A 4J7FA 1NA0A 5FT9A 2ONDA 3F9WA 5KJNA
chains in the Genus database with same CATH superfamily
2LNIA 3CHPA 3DPYA 2IO2C 3SFZA 4IRUA 1U3CA 5LOZA 4EQFA 4GTTA 3VLEA 2R17C 3ZVVA 5ANLA 3M56A 3CBMA 3CHOA 3R7QA 4EBAG 5JINA 4GYYA 2LUHA 3EHMA 4JW1A 5EX0A 2G46A 3ISMC 4B94A 4Z4PA 1YCSB 5CMYA 3UIOC 1SVXA 2X6IA 2XPZA 3DXKG 3MV3B 3PS6A 4NJ5A 3CK8A 5CRUA 2X6JA 1AP7A 2V4HC 3F9ZA 3FH8A 3CGHA 3CHMA 1UW4B 4H7XA 3UKRG 4I9CA 3RKVA 2VGXA 4U63A 2WXMA 1SW6A 2LXLA 5F6KC 2GRNB 4U8HA 4U0ZA 4G2VA 2LXMA 3ONLA 1MX2A 4AV7A 4WNFA 4A1SA 4AEZC 3ENEA 4I9EA 2HR2A 5AARA 3WXXA 2KCVA 3UQ3A 4XI0A 3KMJA 3SFXA 3HXEA 3K9IA 3ZYMA 3SQVA 4AVXA 1JUQA 4J83A 3B95A 3DSVA 3NZSA 5HKPA 3Q5MA 4MI0A 1TNUA 1IYGA 5A23A 1MJ0A 4HI8A 4XEIG 3RRNB 4AIFA 5BV0A 3D9IA 4BTBA 3F6QA 5CHEE 5G55A 5BNWA 3OXLA 1O1RA 4GA2A 2V4LA 5ARFA 3DEPA 5B1BE 2OV8A 4DRXE 3MGBA 5AENA 2H6IA 3VTXA 3DSWA 4A1GA 3QNKA 4J0UA 3C3RA 3CQGB 2IJGX 4EECA 2YINA 3U64A 3MA5A 2I1JA 3CK7A 2R05A 3LEWA 4DLQA 5EYLA 1ELWA 1OWNA 4DI4A 3MKRA 3FULA 4K03A 4YDOA 2AXZA 4KBQA 2PM7A 2RKKA 1INZA 2XPYA 2VTBA 2MOWA 1NP7A 4DX5D 3QJZA 3KAEA 4HI9A 2KC7A 4PS7A 1BLXB 4RQIA 3CIAA 1B89A 1DVPA 5TH7A 1A17A 3NOGD 1N9AA 4GA1A 4CT4A 3LYAA 3KS2A 2IGQA 3D9NA 4RVBA 3MKQA 4GZ6A 1QZ2A 3T9KA 4UUCA 4JC8A 1DCQA 1OWLA 2PQRA 1TJFA 3TWRA 3IEGA 2CHZA 4BSZB 2P2CP 3RU0A 4AXHA 3JCKC 5BW8C 1TN7A 2WPVA 1KZOA 3CVVA 1JCSA 2IEJA 3ZHEA 5KJMA 2LAIA 4LERA 4N39A 1SQMA 3MO2A 2PQNA 2WQ7A 4ATGA 4FHKA 1WG0A 4F3VA 2P58C 3TWQA 4LUNU 4LEUA 1TNBA 3ZKJA 3LY7A 2KCKA 3MZLB 3O48A 4GTRA 2J4BA 4OVUA 2JV0A 3TWVA 3QKYA 3K5KA 1UJKA 4GTVA 2P9IG 4CDMA 4CZ2D 1KT0A 4XKCA 4LCTA 2XQ0A 5FIOA 2XEHA 2VSOE 3CVLA 3Q15A 2ETCA 4EZLA 1WAO1 4C0MA 5C1DA 1H6KA 2C0MA 1OT8A 4BY6A 4B8CB 5KWDA 3UPVA 3SWCA 5T3RA 2P9PG 2V0PA 3GZ2A 4QFVA 3LPZA 3SY2A 2RD0A 3G2VA 2CFZA 5FJYA 4FLBA 4KXKB 3APCA 4HOQA 2ZISA 4XKBA 1BI8B 1XQHA 4RSYA 3FTVA 3MO5A 3QK0A 5AYWD 3RAYA 2KZTA 3UTMA 4GTOA 1K1AA 1HO8A 4ANXA 4OAVB 2EIKE 1PY1A 4HBDA 1HG2A 5EKQD 2JABA 2YNQA 4HXIA 4KZ0A 2DCPA 3AG3E 3BQOA 3BG1B 3U66A 2BUGA 2XCCA 2LAHA 4UI9J 2IQCA 1MX4A 2Y0BG 3B7UX 5EX3A 2IOLA 5HQ8A 3JQ0A 2GRQB 4EHMA 2AXVA 3CHSA 5KNHD 3TXNA 3FTYA 1N4RA 3BO5A 4B0ZA 4XIFA 2A5UA 2BKKB 3EU5A 1AWCB 4TXRA 5BPPA 5JHBA 4HQDA 2ZU6B 2R3AA 2P9KG 4GAAA 4YVQC 4BX8A 5B3SE 4IYPA 3RRMB 5CEAA 3TL5A 1YA0A 1JWGA 1QQEA 4HLLA 4BT9A 2RFAA 3G2UA 4DPRA 3MO0A 2AW6A 4GB9A 3WG7E 1RW2A 3V30A 5CCLA 3DSTA 4LNUD 1OWPA 2WM9A 4JHKA 4ILGA 2L9BA 5ENNA 4CGWA 2DBAA 2CHXA 3QOUA 3E34A 1TNZA 4FP7A 2B6CA 3UINC 2FBNA 4FHJA 4U07A 4WNEA 3CHQA 5JJ0A 4N3AA 2KCLA 4JHRA 4E85A 3PEUB 3ZUVB 3KSLA 3DWLG 1EYHA 3TG5A 3T5VA 2GRPB 3BU8A 5BXOA 1BI7B 4M3OA 4NQ0A 4X8QA 5D2MC 4APOA 4JHJA 3APFA 3I5PA 3FH7A 2BF0X 4BWRA 4LDGA 2XPIA 3M53A 2LSVA 4HLEA 4G25A 2QY7A 3DSSA 5T8IA 3HNAA 4QEPA 3VLFA 4D10C 5FINA 3D9PA 4KVOA 3SW9A 5JHAA 2J08A 3CVXA 4I6EA 4U0SA 1FCHA 2VQ2A 3ONKA 2ZGDA 4E47A 2P9UG 2Q7FA 4L7TA 2CG3A 5CMWA 3M55A 4I43A 3VV0A 3C3OA 4GYOA 4GTSA 2ZGGA 2WQHA 1HXIA 4TXPA 4G24A 3PZ4A 3ML8A 4HS2A 3ZRHA 2VGXB 3PREA 4F53A 5ENQD 2DZNA 3RO2A 3Q49B 4J8DA 5D0QD 3UM1A 5HRYA 3NB2A 2IO3C 5LP0A 3LCAA 4MLPA 3UM0A 4N5QA 2FF4A 3QAQA 5ITZF 1X81A 4Y6CA 2NYJA 1N11A 4FC8A 2BEDA 4CT0A 3E30A 2DZOA 3EHRA 4HRLA 4ME2A 4O60A 1H2TC 2EIJE 3TWUA 5EN5D 3S2AA 3CVWA 4BERA 3U4TA 2BQZA 5FQ4A 1QBQA 3Q4AB 4GCOA 1UN9A 4YDYA 3GW4A 3TJPA 4AU7A 4GZDA 3CKCA 5LSXA 2ZIRA 3QARA 3SGHA 1JPLA 1OY3D 1JCQA 1QYMA 5D66A 3FUEA 1UOHA 1OWOA 3CQCB 2UY1B 5AIJA 4J7IA 4JDSA 1E8YA 2WXRA 5T4YA 3NBNB 2X38A 3ULQA 4LNBA 3SHFA 1N0QA 1VDYA 1RZ4A 3B7SA 1H0AA 4YDWA 4RG9A 4BSXA 1WY6A 3TWTA 1IHBA 3D9HA 3C72A 3AAAC 3L54A 3PE3A 4GPMA 4I1AA 4FU3A 4UQZA 2WXKA 3G2WA 3EP0A 5C2YA 1TNYA 5EIDA 3F9XA 3TGOA 3R9AB 3I3NA 2WXGA 3IHVA 4ZFHA 1N0RA 4IJDA 3KMAA 2R02A 5KBAA 3S8PA 2VGYA 3D9OA 4O1PA 4WWOA 4GPKA 2W5YA 3S7BA 3PZDA 4L23A 1SZAA 4Q69A 4K0RA 3HRAA 2DVWA 1LD8A 3PRZA 2IOSA 4AP2A 5E76A 1YYHA 5ENOD 4DLOA 4ATZD 5BT1A 4FLHA 4LRZA 1FT1A 4XI9A 2EINE 4CDRA 4F1PA 3R9MA 3OXGA 3FFLA 1MUFA 2WXIA 4XZ4A 3ZXSA 2MRIA 1XGWA 3ZYKA 2WB2A 2IFUA 3V2OA 4YDEA 5LSZA 1WDYA 3F9YA 3CVNA 4DI3A 1N95A 3Q47B 3M54A 1OCZE 2M63A 4G8LA 4BX9A 2F8YA 5LCWC 2XCBA 5AQ9A 3LY9A 5EILA 1NI1A 2J8SD 3KEAA 3T8MA 4BTAA 3O4ZA 3L08A 4BESA 1HX8A 4BEPA 2L0TB 1HU3A 3FU3A 3E33A 3FH5A 3EIQC 1FVHA 3FUFA 4FJZA 4YVOA 2I2OA 4IJ8A 4QENA 1E90A 3AG4E 3RQ4A 2XZDG 3EHQA 2R2LA 3PH0C 4BETA 5AQBA 4Q96A 4KMOA 4I1OB 4GCNA 1U3DA 2BTDA 5DIZA 3B7BA 2V8SE 3RO3A 4GTPA 2P9NG 2P9LG 2ZXWE 4YNDA 2IONA 3TWWA 1IKND 1O9SA 3PE4A 3ZPJA 2FI7A 4ZHBA 1D8DA 3PZ3A 4UI9C 1Z3YA 3ZU7B 1XNFA 2X6HA 4NACA 3BEEA 3M58A 3V2XA 5FZSA 3URZA 4WWPA 4AY5A 2ETAA 4PS8A 5JJ6A 3M57A 2VYIA 3ZN3A 2PL2A 4XX5A 3ZYQA 4CEMA 4BFRA 4GZ3A 3PNTB 3CBPA 1OUVA 3FUJA 4YPUA 4JVSA 2OOEA 1MHQA 5G05J 3M5AA 2GRLA 4G11A 3Q75A 1A5EA 3QWPA 1S63A 1H3IA 2WXPA 4MBGA 1GW6A 3DSXA 4N5CA 1E7UA 1IXVA 4KYOB 4HORA 2XRYA 3RJWA 4JEHA 4FADA 5CCMA 2A4ZA 2NC9A 4KVMA 3LKUA 1O5MA 4W9RA 3PVLA 2WXQA 3BG0B 3HG0D 2IU1A 4TXQA 4F6RD 5ENPD 1IQRA 3LJNA 3PUJA 1NA0A 1H2VC 5FT9A 3OXFA 2L0IA 2V5FA 3ESLA 1DC2A 3HXDA 4UQYA 5TEGA 4PS3A 1PC2A 2DIWA 3CV0A 1TJCA 3EU9A 5G2NA 3Q73A 4JL0A 5KCMA 1V54E 4HOTA 2WVIA 2F8XK 1E7VA 4PH4B 4HRMB 4JA9A 3D9MA 3PDNA 1E96B 3UIPC 3CSTA 3Q7AA 5CBOA 2C2LA 2PNNA 2WXNA 4YNPA 1Z5SC 3HVEB 3U9WA 3ASGA 1NFIE 4CDNA 3T8KA 3CSFA 3OAWA 5A7DB 4N3CA 1N6CA 4UWLA 1MX6A 1Y8MA 4UWKA 1Q2ZA 2RFMA 3FUMA 1MVXA 3IXEA 5JMND 4JEUA 4I51A 5ENTD 4PUCA 3Q78A 2OEVA 4MKTA 5EIBE 2XHEA 2HE0A 3TWSA 4O1OA 2E2EA 3ASNE 1N52A 5LFAA 3SI5A 3AS4A 1LD7A 4G23A 4GTMA 2J9QA 4GYWA 2Y1LE 2Y4TA 3D9KA 4IULA 4H7YA 2XGMA 3DALA 3JUIA 3ZW3A 1N54A 2AXUA 4O30A 2YHEA 5J08A 1Y6IA 3KD7A 3Q9UC 3OPEA 3W9GA 3UXGA 3C98A 1DNPA 4YNMA 1Z6TA 5BXUA 1V55E 1FT2A 3Q79A 2X6KA 5IY5E 2CHWA 1E8ZA 5FQ8A 3FU5A 4I2WA 5G04C 3UX4A 3JXJA 3L82A 2P9SG 1KPSB 4O6FA 4J8YA 3FEXA 3AS5A 4KT6B 4EZJA 4WNGA 4GMJA 2RFIA 2VJ8A 5FTPA 5JIYA 3V31A 1ZB1A 1NL4A 3FWVA 4XE0A 1N3JA 1E8XA 2FO7A 3DSUA 1MVHA 1OWMA 3MEKA 4FJYA 2XEVA 2C0LA 2ILRA 4BT8A 2EIME 3E37A 4K5BA 2UWJG 2CFUA 2IF4A 4C48B 5AJDA 4L1BA 5T5GA 2GRMA 3OOIA 4B93B 3D9LA 4ANUA 2JLBA 1UJJA 3ZEFA 4NVQA 1YMPA 3QB2A 4CGVA 3ASDA 2DYSE 3SD5A 4U96D 3ZIMA 4TUUA 3HYMB 2AJAA 2H6FA 5CERB 1ELKA 5HS0A 3PZ1A 2QC9A 5FWQA 5AQAA 3APDA 2Y4UA 3L13A 4U0UA 5H7PA 3HHMA 1HFAA 1HS6A 2XS1A 3KSQA 1TN6A 3HXBA 3FTSA 4F1SA 3S7FA 5AYFA 4HNAD 2QZAA 3FHEA 2AWIA 4L2YA 1N4SA 4ACLA 5E75A 4FA6A 1ML9A 3J5PA 3SFYA 4J8EA 4G26A 1IHGA 4R7LA 1UG3A 2EQXA 1OXJA 1O1SA 2R03A 2BKGA 5JA4D 4EPZA 1Z3XA 5CRVA 1OCRE 3SZ7A 4EZKA 5A6CA 3LY8A 4OAUC 2DYRE 1SZ9A 4WNDA 4NRHB 5CEDB 3GZ1A 4P29A 1W3BA 1KLXA 2GW1A 2E0IA 3L6AA 2QPWA 5ARGA 3VLDA 1PAQA 3DRAA 1S70B 1BD8A 3ABLE 4BUPA 3C3QA 1JCRA 3CK9A 4J6IA 5ENRD 3N71A 1MZCA 5JJTA 4MI5A 3AJIA 1N94A 3OTNA 1LTXA 3QWWA 3EDTB 1TEZA 1JWFA 4FULA 4TUMA 2HYZA 3L22A 2XRZA 3NOCD 3ABME 2CG2A 3NAWA 4TV3A 3TG4A 1QNFA 4DX7D 4F7AA 3NZUA 3ASOE 5AN8A 3UKUG 3FU0A 3RRUA 4B8AA 2IY0C 4JD2G 1HE8A 4AY6A 1KZPA 4A3TA 3EHNA 1EDUA 3CBOA 4ANVA 3Q7FA 3C5RA 3ULEG 3IV0A 1X5BA 2VTBB 3SF4A 3UM2A 3SBTB 4K5AB 3HDXA 2XENA 3BUAA 4NURA 5EG2A 3MYVA 2AVPA 3DEOA 1D8EA 2J49A 3FTZA 3FEYA 4YPEA 2WXHA 2HO1A 5BV1A 2WXLA 3CEQA 4UQXA 3MKQB 4K5CA 4CYMD 2LO6A 5G05C 3FU6A 4QQIA 4HOSA 4KZCA 3X2QE 5CPRB 3FUDA 1UN8A 3R7RA 3VTYA 2OEWA 4JB8P 4WAFA 2XS8A 3JYSA 1ZBPA 3ZHEB 3SBSA 1P5QA 2UY1A 3RAUA 2WMNA 2ONDA 4CRWA 5KJNA 4U8YD 4N2QA 2H6HA 1K1BA 1S64A 2O8JA 3ML9A 5JJ7A 4RZ0A 3P2BA 3FPDA 2X3MA 2VGEA 4RLYA 4H12A 2XZTG 4G8KA 3DB5A 4RG6A 2WQ6A 4C1QA 2I6HA 2X6FA 3IHYA 2MYOA 3OS5A 3ABKE 1NA3A 2RG8A 3I4RB 5D0OD 1MT6A 3D3MA 3PUKA 2XGSA 2QFCA 4I1MA 4GZCA 5KJLA 1U2VG 4EBAA 3ASFA 3MCXA 5T0MA 2YQ8A 2J09A 3LVQE 2KBXA 2Y3AA 3FUIA 3GZSA 2JEKA 1ZU2A 2FEZA 3MX3A 1H2UA 2VSNA 3ZYLA 3B13A 1O1TA 4I17A 5B1AE 4U95D 2VSXE 1PEGA 5AJLA 2I9CA 3ZNGA 4JXTA 4Q94A 3KEZA 3L16A 3B7TA 3FUNA 4J7WA 4WUYA 1FVFA 3IKOB 4E6HA 4U04A 2KZTB 3W9FA 2Y69E 2MHKA 3AG1E 4DX1A 3P1UA 4L9PA 3FUKA 3TXMA 1TN8A 4J8OA 4HVBA 1N4QA 4ABNA 1TNOA 4I6GA 5ENSD 4HRNA 3CLJA 3MJWA 4ACKA 4LSZE 1L5JA 2GROB 2FO1E 5FQ6A 5HI7A 3LJ3A 1KT1A 2F37A 2PM6A 3FTUA 3FY4A 5AQ7A 3L17A 3CVYA 2NXPA 3LVRE 5KJKA 1TR4A 1E8WA 2KATA 2WMOA 3CR3A 4LNGA 4DUIA 1FPPA 4CCAA 1IQUA 4URKA 1HZ4A 4UWGA 4C9BB 5T0KA 3FTWA 4A55A 2WXOA 3PNLB 2W5ZA 3M59A 2L6JA 3CVUA 5EYPF 4A3VA 5FZQA 3AU5A 4OVVA 1LF8A 4GZ5A 4LG6A 5LCWJ 1OCOE 3NQPA 2NSZA 3UT8A 3SO8A 2J07A 2PZIA 3ASHA 3DXMG 2XGOA 3J5QB 3FP3A 2GRRB 1BU9A 1WM5A 4DK5A 3HIZA 3RIBA 1N4PA 5AAOA 1MYOA 5BUZA 2YHCA 4DJAA 4AOFA 4GU5A 3EJNA 5TTFA 2XEEA 3DPDA 3RJVA 2F69A 1DCEA 4AJWA 2QYUA 2F0YA 3PEVB 4HFGA 5CECB 3KMTA 4HOUA 3G2SA 3NF1A 3VUZA 4HB5A 3QC1A 2J4DA 4Y6WA 3L9TA 4OYSA 1D9SA 3ESKA 3HXFA 4UI9K 1K3ZD 5LX8A 3TWXA 4FMUA 3CKBA 5F5EA 3UT7A 5M72A 3RSEG 4GMLA 2R5SA 4UWFA 4M7CA 2I1KA 3ZFWA 3AG2E 4U7EB 4A63B 3IBEA 4JZYA 4J8FA 2FULA 3JXIA 3GYZA 3E4BA 3Q9NC 3AS8A 3S7DA 3UMVA 2V5QC 3UI2A 2ETBA 3JUEA 1HF8A 1HH8A 2VSYA 2WXFA 3UM3A 5F6LA 2OVFA 3CVQA 5ANRA 3I4GA 4G1TA 1H19A 3FTXA 3UUXA 3HVEA 2R59A 3FDHA 3JQ1A 3U3WA 3ZGQA 1HG5A 1SA4A 3E32A 2B0OE 4Z68A 4N2SA 1MQSA 5CBNA 1NZNA 3SNXA 2H6GA 4U8VD 4APFA 1EF1C 4C0EA 2EILE 3D9JA 4V3IA 3CHRA 4JPSA 4GTQA 3T5XA 5FZRA 3V79K 3DBSA 3UT4A 2L6BA 4UWHA 3QDNA 4JLGA 3LS8A 3HXCA 1N6AA 5F59A 4TRQA 2OCCE 1BPOA 1K8KG 4PDXA 4J8SA 4GMRA 2DWZA 1EPUA 5EDSA 4I2ZA 1ELRA 3EIJA 4GA0A 3MV2B 1ZKKA 2OVBA 4JA7A 3RK6A 3EUVA 1SA5A 4ILHB 3ZXPA 3B7RL 5JHNA 3CVPA 5J90A 5FQ7A 4IN3B 3AU4A 2KXPC 2WXJA 4ILIA 2HM8A 4YPAA 4B89A 3LXUX 4AM9A 4I6JA 1H6PA 2LSUA 2KM4A 4DX2A 4NIKA 3LDZA 4MS6A 3ULYA 3QWVA 1TYQG 3TAXA 4QEOA 3IHXA 1H6OA 4L2LA 5DBKA 5KNGA 5G04J 4MRUA 3PZ2A 1G3NB 4DX6D 3FUHA 4ANWA 3S7JA 2GGFA 4N3BA 1S0PA 1OCCE 4J7FA 2A5EA 3G2TA 3F9WA 4WWNA 2QYJA
chains in the Genus database with same CATH topology
2LNIA 3OXFA 4N2QA 3CHPA 2L9BA 2L0IA 2V5FA 3ESLA 5ENNA 2O8JA 3ML9A 2DBAA 2CHXA 3QOUA 3SFZA 4UQYA 4CGWA 5JJ7A 5TEGA 4PS3A 4IRUA 1PC2A 1U3CA 4RZ0A 4FP7A 5LOZA 2DIWA 3P2BA 4EQFA 3FPDA 3CV0A 2FBNA 1TJCA 3VLEA 2R17C 3ZVVA 4FHJA 4U07A 4WNEA 2X3MA 5ANLA 5G2NA 3CBMA 3M56A 3CHOA 3R7QA 4EBAG 4JL0A 3CHQA 5JJ0A 4H12A 5KCMA 4N3AA 4GYYA 2KCLA 4RG6A 4JHRA 2WQ6A 4HOTA 3DB5A 5JINA 2WVIA 4C1QA 4E85A 3EHMA 2I6HA 3PEUB 2X6FA 3IHYA 1E7VA 4PH4B 4JA9A 3OS5A 4JW1A 1EYHA 5EX0A 2G46A 3D9MA 4B94A 3PDNA 3TG5A 3T5VA 4Z4PA 1E96B 3CSTA 5CMYA 2X6IA 1NA3A 2XPZA 2C2LA 2RG8A 3I4RB 3MV3B 4M3OA 5D0OD 3PS6A 2WXNA 4NJ5A 4NQ0A 4YNPA 3CK8A 3HVEB 1MT6A 3U9WA 3D3MA 4APOA 3ASGA 4JHJA 3APFA 2X6JA 3I5PA 4CDNA 3F9ZA 3PUKA 2XGSA 2QFCA 3FH8A 3CGHA 3CHMA 1UW4B 4H7XA 3FH7A 4I1MA 3CSFA 4I9CA 4GZCA 2BF0X 3OAWA 5KJLA 5A7DB 4N3CA 4BWRA 4LDGA 1N6CA 4UWLA 2XPIA 3M53A 4EBAA 2LSVA 3ASFA 3MCXA 5T0MA 1Y8MA 4HLEA 4G25A 4UWKA 2QY7A 2YQ8A 2J09A 2VGXA 3RKVA 5T8IA 3HNAA 4QEPA 3FUMA 3LVQE 3VLFA 4U63A 2Y3AA 3FUIA 4D10C 1MVXA 3D9PA 2WXMA 4JEUA 4KVOA 4I51A 3SW9A 3GZSA 2JEKA 4PUCA 1ZU2A 5F6KC 2FEZA 3MX3A 1H2UA 4MKTA 2VSNA 5JHAA 4U8HA 3ZYLA 3B13A 2J08A 2XHEA 4I17A 3CVXA 4U0ZA 2VSXE 1PEGA 5AJLA 4I6EA 2I9CA 4U0SA 4JXTA 4Q94A 3KEZA 4G2VA 3ONLA 3L16A 1FCHA 2E2EA 2VQ2A 3B7TA 3FUNA 3ONKA 4WUYA 1FVFA 1N52A 3IKOB 4AV7A 3SI5A 4U04A 4E6HA 3AS4A 5LFAA 4WNFA 2KZTB 4A1SA 4AEZC 4E47A 3ENEA 4I9EA 2HR2A 4G23A 2MHKA 2ONDA 2Q7FA 4L7TA 3P1UA 3FUKA 2CG3A 3WXXA 2J9QA 2KCVA 3UQ3A 5CMWA 4XI0A 3TXMA 3M55A 4I43A 3KMJA 3VV0A 4GYWA 2Y4TA 3K9IA 3D9KA 3ZYMA 4IULA 4J8OA 4GYOA 4AVXA 4HVBA 4H7YA 2WQHA 1HXIA 2XGMA 3DALA 4ABNA 3JUIA 4I6GA 3ZW3A 1N54A 1JUQA 2AXUA 4O30A 2YHEA 3CLJA 3F9WA 4G24A 3MJWA 4ACKA 4J83A 5J08A 1Y6IA 1L5JA 3KD7A 3NZSA 3OPEA 3Q5MA 5FQ6A 5HI7A 3LJ3A 3ML8A 4MI0A 3C98A 1KT1A 1DNPA 1IYGA 5A23A 2PM6A 4HS2A 3ZRHA 2VGXB 3FTUA 1Z6TA 3FY4A 4YNMA 3RRNB 4AIFA 3L17A 5BV0A 3PREA 3D9IA 2NXPA 4F53A 3CVYA 3RO2A 3Q49B 2X6KA 3LVRE 4J8DA 5D0QD 4BTBA 5CHEE 5KJKA 5LP0A 3LCAA 5G55A 5BNWA 1E8WA 4MLPA 2CHWA 1E8ZA 2KATA 2WMOA 3FU5A 4I2WA 3OXLA 5FQ8A 5G04C 4GA2A 3UX4A 2V4LA 3CR3A 5ARFA 2FF4A 3QAQA 4O6FA 3FEXA 4Y6CA 3AS5A 4KT6B 4EZJA 4WNGA 4GMJA 2OV8A 2VJ8A 4FC8A 4CCAA 1IQUA 5FTPA 4URKA 2RFIA 1HZ4A 3MGBA 4UWGA 5JIYA 5AENA 4CT0A 3FWVA 4XE0A 3VTXA 4A1GA 4C9BB 1N3JA 3QNKA 4ME2A 4J0UA 5T0KA 1E8XA 2FO7A 1H2TC 3CQGB 3FTWA 4A55A 2IJGX 2WXOA 3PNLB 4EECA 1MVHA 1OWMA 2YINA 2L6JA 3CVUA 2W5ZA 3M59A 3U64A 3MEKA 3S2AA 4A3VA 3MA5A 4FJYA 3AU5A 5FZQA 3U4TA 3CVWA 2I1JA 2XEVA 2C0LA 2ILRA 3CK7A 1LF8A 4GZ5A 4OVVA 4BT8A 2BQZA 3LEWA 5LCWJ 4DLQA 3NQPA 1ELWA 2NSZA 5FQ4A 3UT8A 2UWJG 1OWNA 2CFUA 2IF4A 2J07A 2PZIA 3ASHA 3FULA 3MKRA 4L1BA 5AJDA 4DI4A 5T5GA 2GRMA 3OOIA 3Q4AB 2XGOA 4K03A 2AXZA 3D9LA 3FP3A 4KBQA 4GCOA 4ANUA 1UN9A 1WM5A 2PM7A 2JLBA 3GW4A 1UJJA 4DK5A 3ZEFA 3HIZA 3RIBA 3TJPA 4NVQA 4AU7A 4GZDA 3CKCA 3QB2A 4CGVA 1INZA 2XPYA 3ASDA 5LSXA 5BUZA 3QARA 2VTBA 2MOWA 1NP7A 3SGHA 1JPLA 3QJZA 3SD5A 2YHCA 4DJAA 3KAEA 4AOFA 4GU5A 3ZIMA 2KC7A 3FUEA 4PS7A 4TUUA 3HYMB 1OWOA 3CIAA 3CQCB 2UY1B 5AIJA 1B89A 3EJNA 4J7IA 4JDSA 1ELKA 1E8YA 1DVPA 5TH7A 2WXRA 1A17A 5T4YA 5TTFA 4GA1A 2X38A 3ULQA 4CT4A 5FWQA 3LYAA 3KS2A 2IGQA 3DPDA 3RJVA 3D9NA 2F69A 3APDA 4AJWA 3SHFA 4RVBA 2Y4UA 3L13A 4U0UA 1VDYA 3B7SA 3HHMA 1H0AA 1HFAA 1HS6A 4RG9A 4BSXA 3MKQA 3PEVB 4GZ6A 4HFGA 1WY6A 3KMTA 4HOUA 1QZ2A 3FTSA 4F1SA 3G2SA 3S7FA 4JC8A 5AYFA 1OWLA 3NF1A 2PQRA 1TJFA 3FHEA 3L54A 3IEGA 3PE3A 2CHZA 3VUZA 2AWIA 4I1AA 4FU3A 4UQZA 4L2YA 2WXKA 3RU0A 3G2WA 3QC1A 2J4DA 4AXHA 3EP0A 3JCKC 5C2YA 4ACLA 5BW8C 4Y6WA 5E75A 4FA6A 3F9XA 4OYSA 3TGOA 2WPVA 3R9AB 3ESKA 1ML9A 3I3NA 2WXGA 3IHVA 3CVVA 4J8EA 4UI9K 4G26A 5LX8A 1IHGA 4R7LA 4FMUA 4IJDA 3CKBA 1UG3A 3ZHEA 2EQXA 5F5EA 5KJMA 3UT7A 2LAIA 4LERA 3KMAA 4N39A 1SQMA 3S8PA 3MO2A 2PQNA 4EPZA 1Z3XA 5M72A 2WQ7A 2VGYA 3D9OA 3SZ7A 4ATGA 4EZKA 4FHKA 4GMLA 2R5SA 4UWFA 4WWOA 5A6CA 3LY8A 4GPKA 2I1KA 3S7BA 3ZFWA 2W5YA 4F3VA 3PZDA 2P58C 4L23A 3IBEA 1SZAA 4Q69A 4LUNU 1SZ9A 4LEUA 4JZYA 4WNDA 4J8FA 4K0RA 2FULA 3LY7A 4NRHB 3GYZA 3PRZA 2IOSA 3E4BA 5E76A 4AP2A 2KCKA 3MZLB 3AS8A 3O48A 3GZ1A 4P29A 3S7DA 1W3BA 1KLXA 4DLOA 5BT1A 3UMVA 4FLHA 4LRZA 2J4BA 4XI9A 2GW1A 4CDRA 4OVUA 2JV0A 1HF8A 3OXGA 2E0IA 3FFLA 3L6AA 3QKYA 2WXIA 1MUFA 4XZ4A 3K5KA 1UJKA 3ZXSA 1HH8A 2MRIA 5ARGA 1XGWA 2VSYA 2WXFA 3VLDA 2QPWA 3ZYKA 4CDMA 2WB2A 1PAQA 5F6LA 2IFUA 2OVFA 3CVQA 5ANRA 3I4GA 4G1TA 5LSZA 1KT0A 2XQ0A 1H19A 4LCTA 3FTXA 3Q15A 2VSOE 3CVLA 3HVEA 4XKCA 3UUXA 3CVNA 3F9YA 4BUPA 2R59A 4DI3A 1WAO1 4EZLA 4C0MA 3CK9A 3FDHA 3Q47B 4J6IA 5C1DA 3M54A 1H6KA 2C0MA 4BY6A 4B8CB 3JQ1A 3U3WA 3ZGQA 3UPVA 3SWCA 5T3RA 2M63A 2V0PA 3GZ2A 1HG5A 3N71A 4QFVA 4BX9A 5LCWC 2XCBA 5JJTA 4MI5A 3LPZA 4N2SA 2RD0A 3LY9A 3G2VA 1MQSA 2CFZA 3OTNA 3T8MA 5FJYA 4BTAA 3O4ZA 3L08A 3QWWA 4FLBA 1HX8A 3EDTB 1NZNA 4KXKB 3SNXA 1TEZA 3APCA 4HOQA 1JWFA 4FULA 4XKBA 4APFA 2L0TB 1HU3A 1EF1C 3FU3A 1XQHA 3FH5A 4RSYA 3FTVA 3EIQC 1FVHA 3FUFA 3MO5A 3QK0A 4FJZA 2HYZA 2I2OA 4YVOA 5AYWD 4C0EA 4IJ8A 4QENA 3L22A 1E90A 2XRZA 3D9JA 3RAYA 4V3IA 3RQ4A 3CHRA 2KZTA 3PH0C 4JPSA 2CG2A 4Q96A 3T5XA 1HO8A 4TV3A 3TG4A 1QNFA 4KMOA 4F7AA 3NZUA 4ANXA 4I1OB 3FU0A 5FZRA 3RRUA 4B8AA 3DBSA 3UT4A 4UWHA 3QDNA 4GCNA 1PY1A 3LS8A 1U3DA 2BTDA 1HG2A 4JLGA 1HE8A 5EKQD 4AY6A 5DIZA 1N6AA 5F59A 2V8SE 4TRQA 2YNQA 3RO3A 4HXIA 4KZ0A 1BPOA 4PDXA 2DCPA 3EHNA 4J8SA 4A3TA 1EDUA 4YNDA 4ANVA 3CBOA 1EPUA 3BG1B 2IONA 3U66A 2BUGA 2XCCA 5EDSA 2LAHA 4I2ZA 1O9SA 1ELRA 3PE4A 3ZPJA 4UI9J 3EIJA 4GA0A 2FI7A 3MV2B 1ZKKA 2OVBA 4JA7A 3IV0A 2IQCA 3RK6A 4ILHB 4UI9C 1X5BA 2VTBB 1Z3YA 3SF4A 3B7RL 5JHNA 3SBTB 1XNFA 2X6HA 3B7UX 3BEEA 3CVPA 4NACA 2IOLA 5EX3A 5J90A 5FZSA 3URZA 5HQ8A 3JQ0A 3M58A 4WWPA 4AY5A 4PS8A 5FQ7A 5JJ6A 3M57A 4IN3B 3HDXA 3AU4A 2VYIA 3ZN3A 4NURA 5EG2A 2AXVA 2WXJA 3CHSA 2PL2A 4ILIA 4XX5A 2HM8A 3MYVA 3TXNA 3FTYA 3ZYQA 4CEMA 2AVPA 3BO5A 4B0ZA 4YPAA 4BFRA 4GZ3A 4XIFA 2J49A 3FTZA 3PNTB 3CBPA 3FEYA 1OUVA 3FUJA 3LXUX 4AM9A 4B89A 4JVSA 4YPUA 2A5UA 2OOEA 4YPEA 4I6JA 2WXHA 2HO1A 5BV1A 2WXLA 1MHQA 3CEQA 5G05J 2LSUA 2KM4A 3M5AA 2GRLA 4UQXA 4G11A 5BPPA 3MKQB 3LDZA 5JHBA 2LO6A 4MS6A 5G05C 3QWPA 3FU6A 2ZU6B 2R3AA 3QWVA 4GAAA 4YVQC 4BX8A 4IYPA 3RRMB 2WXPA 4HOSA 1H3IA 3TAXA 1GW6A 3TL5A 4KZCA 1YA0A 1JWGA 1QQEA 4N5CA 4QEOA 1E7UA 4HORA 4KYOB 4L2LA 2XRYA 3IHXA 5CPRB 3FUDA 1UN8A 5DBKA 4JEHA 4BT9A 3RJWA 4FADA 5CCMA 2A4ZA 2NC9A 3G2UA 5G04J 3R7RA 4KVMA 3LKUA 4MRUA 4DPRA 3VTYA 3MO0A 2AW6A 4W9RA 4GB9A 3PVLA 2WXQA 3BG0B 4WAFA 2IU1A 3FUHA 4ANWA 3S7JA 3JYSA 2GGFA 1ZBPA 4N3BA 5CCLA 3ZHEB 1S0PA 3SBSA 1P5QA 2UY1A 4J7FA 1IQRA 1OWPA 3G2TA 3PUJA 1NA0A 1H2VC 2WMNA 5FT9A 2WM9A 4JHKA 4ILGA 4CRWA 5KJNA 4WWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNI A;  3OXF A;  4N2Q A;  2V5F A;  2O8J A;  4CGW A;  2DBA A;  3QOU A;  4UQY A;  5JJ7 A;  5TEG A;  1PC2 A;  4RZ0 A;  4EQF A;  3FPD A;  3CV0 A;  2FBN A;  1TJC A;  4U07 A;  4WNE A;  3M56 A;  3CBM A;  4JL0 A;  5JJ0 A;  4H12 A;  3DB5 A;  4N3A A;  4GYY A;  2KCL A;  4RG6 A;  4JHR A;  4HOT A;  5JIN A;  4C1Q A;  2I6H A;  4JA9 A;  3OS5 A;  5EX0 A;  2G46 A;  4B94 A;  3PDN A;  3TG5 A;  4Z4P A;  1E96 B;  1NA3 A;  2C2L A;  3MV3 B;  5D0O D;  4NJ5 A;  4NQ0 A;  4YNP A;  3CK8 A;  1MT6 A;  4APO A;  3ASG A;  3F9Z A;  2XGS A;  2QFC A;  4H7X A;  4I9C A;  5KJL A;  5A7D B;  4BWR A;  4N3C A;  4LDG A;  1N6C A;  2XPI A;  3M53 A;  2LSV A;  3ASF A;  5T0M A;  1Y8M A;  4G25 A;  2YQ8 A;  3RKV A;  2VGX A;  3HNA A;  4QEP A;  1MVX A;  4I51 A;  3SW9 A;  5F6K C;  1ZU2 A;  2FEZ A;  2VSN A;  4I17 A;  4U0Z A;  1PEG A;  4U0S A;  4G2V A;  1FCH A;  2E2E A;  2VQ2 A;  4WUY A;  4U04 A;  3AS4 A;  4WNF A;  4A1S A;  4E47 A;  4I9E A;  2HR2 A;  4G23 A;  2MHK A;  2Q7F A;  3WXX A;  2J9Q A;  2KCV A;  3UQ3 A;  4XI0 A;  3M55 A;  3KMJ A;  3VV0 A;  4GYW A;  2Y4T A;  3K9I A;  4J8O A;  4GYO A;  4H7Y A;  2WQH A;  1HXI A;  2XGM A;  3DAL A;  4ABN A;  4O30 A;  4J83 A;  4G24 A;  3KD7 A;  3OPE A;  3Q5M A;  5HI7 A;  4MI0 A;  1KT1 A;  1IYG A;  4YNM A;  2VGX B;  4AIF A;  3RO2 A;  3Q49 B;  4J8D A;  5D0Q D;  4BTB A;  5CHE E;  5KJK A;  3LCA A;  5BNW A;  2KAT A;  5G04 C;  4I2W A;  3OXL A;  4GA2 A;  5ARF A;  2FF4 A;  4O6F A;  4Y6C A;  3AS5 A;  4WNG A;  2RFI A;  5FTP A;  1HZ4 A;  5JIY A;  3FWV A;  3VTX A;  1N3J A;  4ME2 A;  4J0U A;  5T0K A;  2FO7 A;  1MVH A;  2W5Z A;  3M59 A;  2L6J A;  3MEK A;  3MA5 A;  5FZQ A;  3U4T A;  2XEV A;  2C0L A;  3CK7 A;  4BT8 A;  4GZ5 A;  2BQZ A;  5LCW J;  1ELW A;  2UWJ G;  2IF4 A;  2PZI A;  3ASH A;  3MKR A;  5T5G A;  3OOI A;  3Q4A B;  2XGO A;  3FP3 A;  4KBQ A;  4GCO A;  1WM5 A;  2JLB A;  3GW4 A;  3RIB A;  4AU7 A;  4NVQ A;  3CKC A;  4CGV A;  3ASD A;  5LSX A;  2YHC A;  3KAE A;  2KC7 A;  3HYM B;  2UY1 B;  1B89 A;  4J7I A;  4JDS A;  5TH7 A;  1A17 A;  5TTF A;  4GA1 A;  3ULQ A;  3LYA A;  3KS2 A;  2IGQ A;  3RJV A;  2F69 A;  2Y4U A;  4U0U A;  4RG9 A;  4GZ6 A;  3KMT A;  4HOU A;  1QZ2 A;  3S7F A;  5AYF A;  3NF1 A;  2PQR A;  3PE3 A;  3IEG A;  3VUZ A;  4I1A A;  4UQZ A;  3RU0 A;  3EP0 A;  5BW8 C;  4Y6W A;  3F9X A;  3TGO A;  2WPV A;  3R9A B;  3ESK A;  1ML9 A;  4J8E A;  4UI9 K;  4G26 A;  1IHG A;  4FMU A;  4IJD A;  3CKB A;  3ZHE A;  5F5E A;  5KJM A;  3KMA A;  4N39 A;  3S8P A;  3MO2 A;  2PQN A;  5M72 A;  2VGY A;  3SZ7 A;  2R5S A;  5A6C A;  3LY8 A;  4GPK A;  2W5Y A;  3S7B A;  3ZFW A;  4F3V A;  2P58 C;  4LEU A;  4WND A;  4J8F A;  3LY7 A;  4NRH B;  3GYZ A;  3E4B A;  2KCK A;  3AS8 A;  3O48 A;  3GZ1 A;  3S7D A;  1W3B A;  1KLX A;  5BT1 A;  4XI9 A;  2GW1 A;  4CDR A;  2JV0 A;  3OXG A;  3FFL A;  1MUF A;  3QKY A;  3K5K A;  1HH8 A;  5ARG A;  2QPW A;  2VSY A;  5F6L A;  2IFU A;  3CVQ A;  4G1T A;  5LSZ A;  1KT0 A;  3Q15 A;  3CVL A;  3UUX A;  3F9Y A;  4BUP A;  3CVN A;  1WAO 1;  3CK9 A;  5C1D A;  3Q47 B;  3M54 A;  2C0M A;  3U3W A;  3ZGQ A;  3UPV A;  3SWC A;  3GZ2 A;  3N71 A;  5LCW C;  2XCB A;  5JJT A;  4MI5 A;  3LPZ A;  4N2S A;  3LY9 A;  5FJY A;  4BTA A;  3QWW A;  4KXK B;  3EDT B;  1NZN A;  4HOQ A;  1XQH A;  3MO5 A;  2HYZ A;  4YVO A;  5AYW D;  4IJ8 A;  4QEN A;  3RAY A;  3RQ4 A;  3TG4 A;  5FZR A;  3QDN A;  4GCN A;  4JLG A;  4AY6 A;  5EKQ D;  5DIZ A;  1N6A A;  5F59 A;  3RO3 A;  4YND A;  3CBO A;  2BUG A;  2XCC A;  4I2Z A;  1O9S A;  1ELR A;  3PE4 A;  3ZPJ A;  4UI9 J;  4GA0 A;  2FI7 A;  3MV2 B;  1ZKK A;  4JA7 A;  4UI9 C;  3SF4 A;  5JHN A;  1XNF A;  3BEE A;  3CVP A;  5EX3 A;  3M58 A;  5FZS A;  3URZ A;  5HQ8 A;  4AY5 A;  5JJ6 A;  3M57 A;  4IN3 B;  2VYI A;  3ZN3 A;  5EG2 A;  2PL2 A;  2AVP A;  3BO5 A;  4YPA A;  4GZ3 A;  4XIF A;  3CBP A;  1OUV A;  4YPU A;  4AM9 A;  2OOE A;  4YPE A;  2HO1 A;  3CEQ A;  5G05 J;  2LSU A;  3M5A A;  4UQX A;  5G05 C;  3QWP A;  2R3A A;  3QWV A;  4YVQ C;  1H3I A;  4HOS A;  3TAX A;  1YA0 A;  1QQE A;  4N5C A;  4QEO A;  3IHX A;  4HOR A;  4KYO B;  5CPR B;  5DBK A;  3RJW A;  4BT9 A;  5CCM A;  2NC9 A;  5G04 J;  3MO0 A;  3LKU A;  3VTY A;  4W9R A;  3S7J A;  3JYS A;  1ZBP A;  4N3B A;  5CCL A;  3ZHE B;  1P5Q A;  2UY1 A;  4J7F A;  1NA0 A;  5FT9 A;  2OND A;  3F9W A;  5KJN A; 
#chains in the Genus database with same CATH topology
 2LNI A;  3CHP A;  3DPY A;  2IO2 C;  3SFZ A;  4IRU A;  1U3C A;  5LOZ A;  4EQF A;  4GTT A;  3VLE A;  2R17 C;  3ZVV A;  5ANL A;  3M56 A;  3CBM A;  3CHO A;  3R7Q A;  4EBA G;  5JIN A;  4GYY A;  2LUH A;  3EHM A;  4JW1 A;  5EX0 A;  2G46 A;  3ISM C;  4B94 A;  4Z4P A;  1YCS B;  5CMY A;  3UIO C;  1SVX A;  2X6I A;  2XPZ A;  3DXK G;  3MV3 B;  3PS6 A;  4NJ5 A;  3CK8 A;  5CRU A;  2X6J A;  1AP7 A;  2V4H C;  3F9Z A;  3FH8 A;  3CGH A;  3CHM A;  1UW4 B;  4H7X A;  3UKR G;  4I9C A;  3RKV A;  2VGX A;  4U63 A;  2WXM A;  1SW6 A;  2LXL A;  5F6K C;  2GRN B;  4U8H A;  4U0Z A;  4G2V A;  2LXM A;  3ONL A;  1MX2 A;  4AV7 A;  4WNF A;  4A1S A;  4AEZ C;  3ENE A;  4I9E A;  2HR2 A;  5AAR A;  3WXX A;  2KCV A;  3UQ3 A;  4XI0 A;  3KMJ A;  3SFX A;  3HXE A;  3K9I A;  3ZYM A;  3SQV A;  4AVX A;  1JUQ A;  4J83 A;  3B95 A;  3DSV A;  3NZS A;  5HKP A;  3Q5M A;  4MI0 A;  1TNU A;  1IYG A;  5A23 A;  1MJ0 A;  4HI8 A;  4XEI G;  3RRN B;  4AIF A;  5BV0 A;  3D9I A;  4BTB A;  3F6Q A;  5CHE E;  5G55 A;  5BNW A;  3OXL A;  1O1R A;  4GA2 A;  2V4L A;  5ARF A;  3DEP A;  5B1B E;  2OV8 A;  4DRX E;  3MGB A;  5AEN A;  2H6I A;  3VTX A;  3DSW A;  4A1G A;  3QNK A;  4J0U A;  3C3R A;  3CQG B;  2IJG X;  4EEC A;  2YIN A;  3U64 A;  3MA5 A;  2I1J A;  3CK7 A;  2R05 A;  3LEW A;  4DLQ A;  5EYL A;  1ELW A;  1OWN A;  4DI4 A;  3MKR A;  3FUL A;  4K03 A;  4YDO A;  2AXZ A;  4KBQ A;  2PM7 A;  2RKK A;  1INZ A;  2XPY A;  2VTB A;  2MOW A;  1NP7 A;  4DX5 D;  3QJZ A;  3KAE A;  4HI9 A;  2KC7 A;  4PS7 A;  1BLX B;  4RQI A;  3CIA A;  1B89 A;  1DVP A;  5TH7 A;  1A17 A;  3NOG D;  1N9A A;  4GA1 A;  4CT4 A;  3LYA A;  3KS2 A;  2IGQ A;  3D9N A;  4RVB A;  3MKQ A;  4GZ6 A;  1QZ2 A;  3T9K A;  4UUC A;  4JC8 A;  1DCQ A;  1OWL A;  2PQR A;  1TJF A;  3TWR A;  3IEG A;  2CHZ A;  4BSZ B;  2P2C P;  3RU0 A;  4AXH A;  3JCK C;  5BW8 C;  1TN7 A;  2WPV A;  1KZO A;  3CVV A;  1JCS A;  2IEJ A;  3ZHE A;  5KJM A;  2LAI A;  4LER A;  4N39 A;  1SQM A;  3MO2 A;  2PQN A;  2WQ7 A;  4ATG A;  4FHK A;  1WG0 A;  4F3V A;  2P58 C;  3TWQ A;  4LUN U;  4LEU A;  1TNB A;  3ZKJ A;  3LY7 A;  2KCK A;  3MZL B;  3O48 A;  4GTR A;  2J4B A;  4OVU A;  2JV0 A;  3TWV A;  3QKY A;  3K5K A;  1UJK A;  4GTV A;  2P9I G;  4CDM A;  4CZ2 D;  1KT0 A;  4XKC A;  4LCT A;  2XQ0 A;  5FIO A;  2XEH A;  2VSO E;  3CVL A;  3Q15 A;  2ETC A;  4EZL A;  1WAO 1;  4C0M A;  5C1D A;  1H6K A;  2C0M A;  1OT8 A;  4BY6 A;  4B8C B;  5KWD A;  3UPV A;  3SWC A;  5T3R A;  2P9P G;  2V0P A;  3GZ2 A;  4QFV A;  3LPZ A;  3SY2 A;  2RD0 A;  3G2V A;  2CFZ A;  5FJY A;  4FLB A;  4KXK B;  3APC A;  4HOQ A;  2ZIS A;  4XKB A;  1BI8 B;  1XQH A;  4RSY A;  3FTV A;  3MO5 A;  3QK0 A;  5AYW D;  3RAY A;  2KZT A;  3UTM A;  4GTO A;  1K1A A;  1HO8 A;  4ANX A;  4OAV B;  2EIK E;  1PY1 A;  4HBD A;  1HG2 A;  5EKQ D;  2JAB A;  2YNQ A;  4HXI A;  4KZ0 A;  2DCP A;  3AG3 E;  3BQO A;  3BG1 B;  3U66 A;  2BUG A;  2XCC A;  2LAH A;  4UI9 J;  2IQC A;  1MX4 A;  2Y0B G;  3B7U X;  5EX3 A;  2IOL A;  5HQ8 A;  3JQ0 A;  2GRQ B;  4EHM A;  2AXV A;  3CHS A;  5KNH D;  3TXN A;  3FTY A;  1N4R A;  3BO5 A;  4B0Z A;  4XIF A;  2A5U A;  2BKK B;  3EU5 A;  1AWC B;  4TXR A;  5BPP A;  5JHB A;  4HQD A;  2ZU6 B;  2R3A A;  2P9K G;  4GAA A;  4YVQ C;  4BX8 A;  5B3S E;  4IYP A;  3RRM B;  5CEA A;  3TL5 A;  1YA0 A;  1JWG A;  1QQE A;  4HLL A;  4BT9 A;  2RFA A;  3G2U A;  4DPR A;  3MO0 A;  2AW6 A;  4GB9 A;  3WG7 E;  1RW2 A;  3V30 A;  5CCL A;  3DST A;  4LNU D;  1OWP A;  2WM9 A;  4JHK A;  4ILG A;  2L9B A;  5ENN A;  4CGW A;  2DBA A;  2CHX A;  3QOU A;  3E34 A;  1TNZ A;  4FP7 A;  2B6C A;  3UIN C;  2FBN A;  4FHJ A;  4U07 A;  4WNE A;  3CHQ A;  5JJ0 A;  4N3A A;  2KCL A;  4JHR A;  4E85 A;  3PEU B;  3ZUV B;  3KSL A;  3DWL G;  1EYH A;  3TG5 A;  3T5V A;  2GRP B;  3BU8 A;  5BXO A;  1BI7 B;  4M3O A;  4NQ0 A;  4X8Q A;  5D2M C;  4APO A;  4JHJ A;  3APF A;  3I5P A;  3FH7 A;  2BF0 X;  4BWR A;  4LDG A;  2XPI A;  3M53 A;  2LSV A;  4HLE A;  4G25 A;  2QY7 A;  3DSS A;  5T8I A;  3HNA A;  4QEP A;  3VLF A;  4D10 C;  5FIN A;  3D9P A;  4KVO A;  3SW9 A;  5JHA A;  2J08 A;  3CVX A;  4I6E A;  4U0S A;  1FCH A;  2VQ2 A;  3ONK A;  2ZGD A;  4E47 A;  2P9U G;  2Q7F A;  4L7T A;  2CG3 A;  5CMW A;  3M55 A;  4I43 A;  3VV0 A;  3C3O A;  4GYO A;  4GTS A;  2ZGG A;  2WQH A;  1HXI A;  4TXP A;  4G24 A;  3PZ4 A;  3ML8 A;  4HS2 A;  3ZRH A;  2VGX B;  3PRE A;  4F53 A;  5ENQ D;  2DZN A;  3RO2 A;  3Q49 B;  4J8D A;  5D0Q D;  3UM1 A;  5HRY A;  3NB2 A;  2IO3 C;  5LP0 A;  3LCA A;  4MLP A;  3UM0 A;  4N5Q A;  2FF4 A;  3QAQ A;  5ITZ F;  1X81 A;  4Y6C A;  2NYJ A;  1N11 A;  4FC8 A;  2BED A;  4CT0 A;  3E30 A;  2DZO A;  3EHR A;  4HRL A;  4ME2 A;  4O60 A;  1H2T C;  2EIJ E;  3TWU A;  5EN5 D;  3S2A A;  3CVW A;  4BER A;  3U4T A;  2BQZ A;  5FQ4 A;  1QBQ A;  3Q4A B;  4GCO A;  1UN9 A;  4YDY A;  3GW4 A;  3TJP A;  4AU7 A;  4GZD A;  3CKC A;  5LSX A;  2ZIR A;  3QAR A;  3SGH A;  1JPL A;  1OY3 D;  1JCQ A;  1QYM A;  5D66 A;  3FUE A;  1UOH A;  1OWO A;  3CQC B;  2UY1 B;  5AIJ A;  4J7I A;  4JDS A;  1E8Y A;  2WXR A;  5T4Y A;  3NBN B;  2X38 A;  3ULQ A;  4LNB A;  3SHF A;  1N0Q A;  1VDY A;  1RZ4 A;  3B7S A;  1H0A A;  4YDW A;  4RG9 A;  4BSX A;  1WY6 A;  3TWT A;  1IHB A;  3D9H A;  3C72 A;  3AAA C;  3L54 A;  3PE3 A;  4GPM A;  4I1A A;  4FU3 A;  4UQZ A;  2WXK A;  3G2W A;  3EP0 A;  5C2Y A;  1TNY A;  5EID A;  3F9X A;  3TGO A;  3R9A B;  3I3N A;  2WXG A;  3IHV A;  4ZFH A;  1N0R A;  4IJD A;  3KMA A;  2R02 A;  5KBA A;  3S8P A;  2VGY A;  3D9O A;  4O1P A;  4WWO A;  4GPK A;  2W5Y A;  3S7B A;  3PZD A;  4L23 A;  1SZA A;  4Q69 A;  4K0R A;  3HRA A;  2DVW A;  1LD8 A;  3PRZ A;  2IOS A;  4AP2 A;  5E76 A;  1YYH A;  5ENO D;  4DLO A;  4ATZ D;  5BT1 A;  4FLH A;  4LRZ A;  1FT1 A;  4XI9 A;  2EIN E;  4CDR A;  4F1P A;  3R9M A;  3OXG A;  3FFL A;  1MUF A;  2WXI A;  4XZ4 A;  3ZXS A;  2MRI A;  1XGW A;  3ZYK A;  2WB2 A;  2IFU A;  3V2O A;  4YDE A;  5LSZ A;  1WDY A;  3F9Y A;  3CVN A;  4DI3 A;  1N95 A;  3Q47 B;  3M54 A;  1OCZ E;  2M63 A;  4G8L A;  4BX9 A;  2F8Y A;  5LCW C;  2XCB A;  5AQ9 A;  3LY9 A;  5EIL A;  1NI1 A;  2J8S D;  3KEA A;  3T8M A;  4BTA A;  3O4Z A;  3L08 A;  4BES A;  1HX8 A;  4BEP A;  2L0T B;  1HU3 A;  3FU3 A;  3E33 A;  3FH5 A;  3EIQ C;  1FVH A;  3FUF A;  4FJZ A;  4YVO A;  2I2O A;  4IJ8 A;  4QEN A;  1E90 A;  3AG4 E;  3RQ4 A;  2XZD G;  3EHQ A;  2R2L A;  3PH0 C;  4BET A;  5AQB A;  4Q96 A;  4KMO A;  4I1O B;  4GCN A;  1U3D A;  2BTD A;  5DIZ A;  3B7B A;  2V8S E;  3RO3 A;  4GTP A;  2P9N G;  2P9L G;  2ZXW E;  4YND A;  2ION A;  3TWW A;  1IKN D;  1O9S A;  3PE4 A;  3ZPJ A;  2FI7 A;  4ZHB A;  1D8D A;  3PZ3 A;  4UI9 C;  1Z3Y A;  3ZU7 B;  1XNF A;  2X6H A;  4NAC A;  3BEE A;  3M58 A;  3V2X A;  5FZS A;  3URZ A;  4WWP A;  4AY5 A;  2ETA A;  4PS8 A;  5JJ6 A;  3M57 A;  2VYI A;  3ZN3 A;  2PL2 A;  4XX5 A;  3ZYQ A;  4CEM A;  4BFR A;  4GZ3 A;  3PNT B;  3CBP A;  1OUV A;  3FUJ A;  4YPU A;  4JVS A;  2OOE A;  1MHQ A;  5G05 J;  3M5A A;  2GRL A;  4G11 A;  3Q75 A;  1A5E A;  3QWP A;  1S63 A;  1H3I A;  2WXP A;  4MBG A;  1GW6 A;  3DSX A;  4N5C A;  1E7U A;  1IXV A;  4KYO B;  4HOR A;  2XRY A;  3RJW A;  4JEH A;  4FAD A;  5CCM A;  2A4Z A;  2NC9 A;  4KVM A;  3LKU A;  1O5M A;  4W9R A;  3PVL A;  2WXQ A;  3BG0 B;  3HG0 D;  2IU1 A;  4TXQ A;  4F6R D;  5ENP D;  1IQR A;  3LJN A;  3PUJ A;  1NA0 A;  1H2V C;  5FT9 A;  3OXF A;  2L0I A;  2V5F A;  3ESL A;  1DC2 A;  3HXD A;  4UQY A;  5TEG A;  4PS3 A;  1PC2 A;  2DIW A;  3CV0 A;  1TJC A;  3EU9 A;  5G2N A;  3Q73 A;  4JL0 A;  5KCM A;  1V54 E;  4HOT A;  2WVI A;  2F8X K;  1E7V A;  4PH4 B;  4HRM B;  4JA9 A;  3D9M A;  3PDN A;  1E96 B;  3UIP C;  3CST A;  3Q7A A;  5CBO A;  2C2L A;  2PNN A;  2WXN A;  4YNP A;  1Z5S C;  3HVE B;  3U9W A;  3ASG A;  1NFI E;  4CDN A;  3T8K A;  3CSF A;  3OAW A;  5A7D B;  4N3C A;  1N6C A;  4UWL A;  1MX6 A;  1Y8M A;  4UWK A;  1Q2Z A;  2RFM A;  3FUM A;  1MVX A;  3IXE A;  5JMN D;  4JEU A;  4I51 A;  5ENT D;  4PUC A;  3Q78 A;  2OEV A;  4MKT A;  5EIB E;  2XHE A;  2HE0 A;  3TWS A;  4O1O A;  2E2E A;  3ASN E;  1N52 A;  5LFA A;  3SI5 A;  3AS4 A;  1LD7 A;  4G23 A;  4GTM A;  2J9Q A;  4GYW A;  2Y1L E;  2Y4T A;  3D9K A;  4IUL A;  4H7Y A;  2XGM A;  3DAL A;  3JUI A;  3ZW3 A;  1N54 A;  2AXU A;  4O30 A;  2YHE A;  5J08 A;  1Y6I A;  3KD7 A;  3Q9U C;  3OPE A;  3W9G A;  3UXG A;  3C98 A;  1DNP A;  4YNM A;  1Z6T A;  5BXU A;  1V55 E;  1FT2 A;  3Q79 A;  2X6K A;  5IY5 E;  2CHW A;  1E8Z A;  5FQ8 A;  3FU5 A;  4I2W A;  5G04 C;  3UX4 A;  3JXJ A;  3L82 A;  2P9S G;  1KPS B;  4O6F A;  4J8Y A;  3FEX A;  3AS5 A;  4KT6 B;  4EZJ A;  4WNG A;  4GMJ A;  2RFI A;  2VJ8 A;  5FTP A;  5JIY A;  3V31 A;  1ZB1 A;  1NL4 A;  3FWV A;  4XE0 A;  1N3J A;  1E8X A;  2FO7 A;  3DSU A;  1MVH A;  1OWM A;  3MEK A;  4FJY A;  2XEV A;  2C0L A;  2ILR A;  4BT8 A;  2EIM E;  3E37 A;  4K5B A;  2UWJ G;  2CFU A;  2IF4 A;  4C48 B;  5AJD A;  4L1B A;  5T5G A;  2GRM A;  3OOI A;  4B93 B;  3D9L A;  4ANU A;  2JLB A;  1UJJ A;  3ZEF A;  4NVQ A;  1YMP A;  3QB2 A;  4CGV A;  3ASD A;  2DYS E;  3SD5 A;  4U96 D;  3ZIM A;  4TUU A;  3HYM B;  2AJA A;  2H6F A;  5CER B;  1ELK A;  5HS0 A;  3PZ1 A;  2QC9 A;  5FWQ A;  5AQA A;  3APD A;  2Y4U A;  3L13 A;  4U0U A;  5H7P A;  3HHM A;  1HFA A;  1HS6 A;  2XS1 A;  3KSQ A;  1TN6 A;  3HXB A;  3FTS A;  4F1S A;  3S7F A;  5AYF A;  4HNA D;  2QZA A;  3FHE A;  2AWI A;  4L2Y A;  1N4S A;  4ACL A;  5E75 A;  4FA6 A;  1ML9 A;  3J5P A;  3SFY A;  4J8E A;  4G26 A;  1IHG A;  4R7L A;  1UG3 A;  2EQX A;  1OXJ A;  1O1S A;  2R03 A;  2BKG A;  5JA4 D;  4EPZ A;  1Z3X A;  5CRV A;  1OCR E;  3SZ7 A;  4EZK A;  5A6C A;  3LY8 A;  4OAU C;  2DYR E;  1SZ9 A;  4WND A;  4NRH B;  5CED B;  3GZ1 A;  4P29 A;  1W3B A;  1KLX A;  2GW1 A;  2E0I A;  3L6A A;  2QPW A;  5ARG A;  3VLD A;  1PAQ A;  3DRA A;  1S70 B;  1BD8 A;  3ABL E;  4BUP A;  3C3Q A;  1JCR A;  3CK9 A;  4J6I A;  5ENR D;  3N71 A;  1MZC A;  5JJT A;  4MI5 A;  3AJI A;  1N94 A;  3OTN A;  1LTX A;  3QWW A;  3EDT B;  1TEZ A;  1JWF A;  4FUL A;  4TUM A;  2HYZ A;  3L22 A;  2XRZ A;  3NOC D;  3ABM E;  2CG2 A;  3NAW A;  4TV3 A;  3TG4 A;  1QNF A;  4DX7 D;  4F7A A;  3NZU A;  3ASO E;  5AN8 A;  3UKU G;  3FU0 A;  3RRU A;  4B8A A;  2IY0 C;  4JD2 G;  1HE8 A;  4AY6 A;  1KZP A;  4A3T A;  3EHN A;  1EDU A;  3CBO A;  4ANV A;  3Q7F A;  3C5R A;  3ULE G;  3IV0 A;  1X5B A;  2VTB B;  3SF4 A;  3UM2 A;  3SBT B;  4K5A B;  3HDX A;  2XEN A;  3BUA A;  4NUR A;  5EG2 A;  3MYV A;  2AVP A;  3DEO A;  1D8E A;  2J49 A;  3FTZ A;  3FEY A;  4YPE A;  2WXH A;  2HO1 A;  5BV1 A;  2WXL A;  3CEQ A;  4UQX A;  3MKQ B;  4K5C A;  4CYM D;  2LO6 A;  5G05 C;  3FU6 A;  4QQI A;  4HOS A;  4KZC A;  3X2Q E;  5CPR B;  3FUD A;  1UN8 A;  3R7R A;  3VTY A;  2OEW A;  4JB8 P;  4WAF A;  2XS8 A;  3JYS A;  1ZBP A;  3ZHE B;  3SBS A;  1P5Q A;  2UY1 A;  3RAU A;  2WMN A;  2OND A;  4CRW A;  5KJN A;  4U8Y D;  4N2Q A;  2H6H A;  1K1B A;  1S64 A;  2O8J A;  3ML9 A;  5JJ7 A;  4RZ0 A;  3P2B A;  3FPD A;  2X3M A;  2VGE A;  4RLY A;  4H12 A;  2XZT G;  4G8K A;  3DB5 A;  4RG6 A;  2WQ6 A;  4C1Q A;  2I6H A;  2X6F A;  3IHY A;  2MYO A;  3OS5 A;  3ABK E;  1NA3 A;  2RG8 A;  3I4R B;  5D0O D;  1MT6 A;  3D3M A;  3PUK A;  2XGS A;  2QFC A;  4I1M A;  4GZC A;  5KJL A;  1U2V G;  4EBA A;  3ASF A;  3MCX A;  5T0M A;  2YQ8 A;  2J09 A;  3LVQ E;  2KBX A;  2Y3A A;  3FUI A;  3GZS A;  2JEK A;  1ZU2 A;  2FEZ A;  3MX3 A;  1H2U A;  2VSN A;  3ZYL A;  3B13 A;  1O1T A;  4I17 A;  5B1A E;  4U95 D;  2VSX E;  1PEG A;  5AJL A;  2I9C A;  3ZNG A;  4JXT A;  4Q94 A;  3KEZ A;  3L16 A;  3B7T A;  3FUN A;  4J7W A;  4WUY A;  1FVF A;  3IKO B;  4E6H A;  4U04 A;  2KZT B;  3W9F A;  2Y69 E;  2MHK A;  3AG1 E;  4DX1 A;  3P1U A;  4L9P A;  3FUK A;  3TXM A;  1TN8 A;  4J8O A;  4HVB A;  1N4Q A;  4ABN A;  1TNO A;  4I6G A;  5ENS D;  4HRN A;  3CLJ A;  3MJW A;  4ACK A;  4LSZ E;  1L5J A;  2GRO B;  2FO1 E;  5FQ6 A;  5HI7 A;  3LJ3 A;  1KT1 A;  2F37 A;  2PM6 A;  3FTU A;  3FY4 A;  5AQ7 A;  3L17 A;  3CVY A;  2NXP A;  3LVR E;  5KJK A;  1TR4 A;  1E8W A;  2KAT A;  2WMO A;  3CR3 A;  4LNG A;  4DUI A;  1FPP A;  4CCA A;  1IQU A;  4URK A;  1HZ4 A;  4UWG A;  4C9B B;  5T0K A;  3FTW A;  4A55 A;  2WXO A;  3PNL B;  2W5Z A;  3M59 A;  2L6J A;  3CVU A;  5EYP F;  4A3V A;  5FZQ A;  3AU5 A;  4OVV A;  1LF8 A;  4GZ5 A;  4LG6 A;  5LCW J;  1OCO E;  3NQP A;  2NSZ A;  3UT8 A;  3SO8 A;  2J07 A;  2PZI A;  3ASH A;  3DXM G;  2XGO A;  3J5Q B;  3FP3 A;  2GRR B;  1BU9 A;  1WM5 A;  4DK5 A;  3HIZ A;  3RIB A;  1N4P A;  5AAO A;  1MYO A;  5BUZ A;  2YHC A;  4DJA A;  4AOF A;  4GU5 A;  3EJN A;  5TTF A;  2XEE A;  3DPD A;  3RJV A;  2F69 A;  1DCE A;  4AJW A;  2QYU A;  2F0Y A;  3PEV B;  4HFG A;  5CEC B;  3KMT A;  4HOU A;  3G2S A;  3NF1 A;  3VUZ A;  4HB5 A;  3QC1 A;  2J4D A;  4Y6W A;  3L9T A;  4OYS A;  1D9S A;  3ESK A;  3HXF A;  4UI9 K;  1K3Z D;  5LX8 A;  3TWX A;  4FMU A;  3CKB A;  5F5E A;  3UT7 A;  5M72 A;  3RSE G;  4GML A;  2R5S A;  4UWF A;  4M7C A;  2I1K A;  3ZFW A;  3AG2 E;  4U7E B;  4A63 B;  3IBE A;  4JZY A;  4J8F A;  2FUL A;  3JXI A;  3GYZ A;  3E4B A;  3Q9N C;  3AS8 A;  3S7D A;  3UMV A;  2V5Q C;  3UI2 A;  2ETB A;  3JUE A;  1HF8 A;  1HH8 A;  2VSY A;  2WXF A;  3UM3 A;  5F6L A;  2OVF A;  3CVQ A;  5ANR A;  3I4G A;  4G1T A;  1H19 A;  3FTX A;  3UUX A;  3HVE A;  2R59 A;  3FDH A;  3JQ1 A;  3U3W A;  3ZGQ A;  1HG5 A;  1SA4 A;  3E32 A;  2B0O E;  4Z68 A;  4N2S A;  1MQS A;  5CBN A;  1NZN A;  3SNX A;  2H6G A;  4U8V D;  4APF A;  1EF1 C;  4C0E A;  2EIL E;  3D9J A;  4V3I A;  3CHR A;  4JPS A;  4GTQ A;  3T5X A;  5FZR A;  3V79 K;  3DBS A;  3UT4 A;  2L6B A;  4UWH A;  3QDN A;  4JLG A;  3LS8 A;  3HXC A;  1N6A A;  5F59 A;  4TRQ A;  2OCC E;  1BPO A;  1K8K G;  4PDX A;  4J8S A;  4GMR A;  2DWZ A;  1EPU A;  5EDS A;  4I2Z A;  1ELR A;  3EIJ A;  4GA0 A;  3MV2 B;  1ZKK A;  2OVB A;  4JA7 A;  3RK6 A;  3EUV A;  1SA5 A;  4ILH B;  3ZXP A;  3B7R L;  5JHN A;  3CVP A;  5J90 A;  5FQ7 A;  4IN3 B;  3AU4 A;  2KXP C;  2WXJ A;  4ILI A;  2HM8 A;  4YPA A;  4B89 A;  3LXU X;  4AM9 A;  4I6J A;  1H6P A;  2LSU A;  2KM4 A;  4DX2 A;  4NIK A;  3LDZ A;  4MS6 A;  3ULY A;  3QWV A;  1TYQ G;  3TAX A;  4QEO A;  3IHX A;  1H6O A;  4L2L A;  5DBK A;  5KNG A;  5G04 J;  4MRU A;  3PZ2 A;  1G3N B;  4DX6 D;  3FUH A;  4ANW A;  3S7J A;  2GGF A;  4N3B A;  1S0P A;  1OCC E;  4J7F A;  2A5E A;  3G2T A;  3F9W A;  4WWN A;  2QYJ A; 
#chains in the Genus database with same CATH homology
 2LNI A;  3OXF A;  4N2Q A;  3CHP A;  2L9B A;  2L0I A;  2V5F A;  3ESL A;  5ENN A;  2O8J A;  3ML9 A;  2DBA A;  2CHX A;  3QOU A;  3SFZ A;  4UQY A;  4CGW A;  5JJ7 A;  5TEG A;  4PS3 A;  4IRU A;  1PC2 A;  1U3C A;  4RZ0 A;  4FP7 A;  5LOZ A;  2DIW A;  3P2B A;  4EQF A;  3FPD A;  3CV0 A;  2FBN A;  1TJC A;  3VLE A;  2R17 C;  3ZVV A;  4FHJ A;  4U07 A;  4WNE A;  2X3M A;  5ANL A;  5G2N A;  3CBM A;  3M56 A;  3CHO A;  3R7Q A;  4EBA G;  4JL0 A;  3CHQ A;  5JJ0 A;  4H12 A;  5KCM A;  4N3A A;  4GYY A;  2KCL A;  4RG6 A;  4JHR A;  2WQ6 A;  4HOT A;  3DB5 A;  5JIN A;  2WVI A;  4C1Q A;  4E85 A;  3EHM A;  2I6H A;  3PEU B;  2X6F A;  3IHY A;  1E7V A;  4PH4 B;  4JA9 A;  3OS5 A;  4JW1 A;  1EYH A;  5EX0 A;  2G46 A;  3D9M A;  4B94 A;  3PDN A;  3TG5 A;  3T5V A;  4Z4P A;  1E96 B;  3CST A;  5CMY A;  2X6I A;  1NA3 A;  2XPZ A;  2C2L A;  2RG8 A;  3I4R B;  3MV3 B;  4M3O A;  5D0O D;  3PS6 A;  2WXN A;  4NJ5 A;  4NQ0 A;  4YNP A;  3CK8 A;  3HVE B;  1MT6 A;  3U9W A;  3D3M A;  4APO A;  3ASG A;  4JHJ A;  3APF A;  2X6J A;  3I5P A;  4CDN A;  3F9Z A;  3PUK A;  2XGS A;  2QFC A;  3FH8 A;  3CGH A;  3CHM A;  1UW4 B;  4H7X A;  3FH7 A;  4I1M A;  3CSF A;  4I9C A;  4GZC A;  2BF0 X;  3OAW A;  5KJL A;  5A7D B;  4N3C A;  4BWR A;  4LDG A;  1N6C A;  4UWL A;  2XPI A;  3M53 A;  4EBA A;  2LSV A;  3ASF A;  3MCX A;  5T0M A;  1Y8M A;  4HLE A;  4G25 A;  4UWK A;  2QY7 A;  2YQ8 A;  2J09 A;  2VGX A;  3RKV A;  5T8I A;  3HNA A;  4QEP A;  3FUM A;  3LVQ E;  3VLF A;  4U63 A;  2Y3A A;  3FUI A;  4D10 C;  1MVX A;  3D9P A;  2WXM A;  4JEU A;  4KVO A;  4I51 A;  3SW9 A;  3GZS A;  2JEK A;  4PUC A;  1ZU2 A;  5F6K C;  2FEZ A;  3MX3 A;  1H2U A;  4MKT A;  2VSN A;  5JHA A;  4U8H A;  3ZYL A;  3B13 A;  2J08 A;  2XHE A;  4I17 A;  3CVX A;  4U0Z A;  2VSX E;  1PEG A;  5AJL A;  4I6E A;  2I9C A;  4U0S A;  4JXT A;  4Q94 A;  3KEZ A;  4G2V A;  3ONL A;  3L16 A;  1FCH A;  2E2E A;  2VQ2 A;  3B7T A;  3FUN A;  3ONK A;  4WUY A;  1FVF A;  1N52 A;  3IKO B;  4AV7 A;  3SI5 A;  4U04 A;  4E6H A;  3AS4 A;  5LFA A;  4WNF A;  2KZT B;  4A1S A;  4AEZ C;  4E47 A;  3ENE A;  4I9E A;  2HR2 A;  4G23 A;  2MHK A;  2OND A;  2Q7F A;  4L7T A;  3P1U A;  3FUK A;  2CG3 A;  3WXX A;  2J9Q A;  2KCV A;  3UQ3 A;  5CMW A;  4XI0 A;  3TXM A;  3M55 A;  4I43 A;  3KMJ A;  3VV0 A;  4GYW A;  2Y4T A;  3K9I A;  3D9K A;  3ZYM A;  4IUL A;  4J8O A;  4GYO A;  4AVX A;  4HVB A;  4H7Y A;  2WQH A;  1HXI A;  2XGM A;  3DAL A;  4ABN A;  3JUI A;  4I6G A;  3ZW3 A;  1N54 A;  1JUQ A;  2AXU A;  4O30 A;  2YHE A;  3CLJ A;  3F9W A;  4G24 A;  3MJW A;  4ACK A;  4J83 A;  5J08 A;  1Y6I A;  1L5J A;  3KD7 A;  3NZS A;  3OPE A;  3Q5M A;  5FQ6 A;  5HI7 A;  3LJ3 A;  3ML8 A;  4MI0 A;  3C98 A;  1KT1 A;  1DNP A;  1IYG A;  5A23 A;  2PM6 A;  4HS2 A;  3ZRH A;  2VGX B;  3FTU A;  1Z6T A;  3FY4 A;  4YNM A;  3RRN B;  4AIF A;  3L17 A;  5BV0 A;  3PRE A;  3D9I A;  2NXP A;  4F53 A;  3CVY A;  3RO2 A;  3Q49 B;  2X6K A;  3LVR E;  4J8D A;  5D0Q D;  4BTB A;  5CHE E;  5KJK A;  5LP0 A;  3LCA A;  5G55 A;  5BNW A;  1E8W A;  4MLP A;  2CHW A;  1E8Z A;  2KAT A;  2WMO A;  3FU5 A;  4I2W A;  3OXL A;  5FQ8 A;  5G04 C;  4GA2 A;  3UX4 A;  2V4L A;  3CR3 A;  5ARF A;  2FF4 A;  3QAQ A;  4O6F A;  3FEX A;  4Y6C A;  3AS5 A;  4KT6 B;  4EZJ A;  4WNG A;  4GMJ A;  2OV8 A;  2VJ8 A;  4FC8 A;  4CCA A;  1IQU A;  5FTP A;  4URK A;  2RFI A;  1HZ4 A;  3MGB A;  4UWG A;  5JIY A;  5AEN A;  4CT0 A;  3FWV A;  4XE0 A;  3VTX A;  4A1G A;  4C9B B;  1N3J A;  3QNK A;  4ME2 A;  4J0U A;  5T0K A;  1E8X A;  2FO7 A;  1H2T C;  3CQG B;  3FTW A;  4A55 A;  2IJG X;  2WXO A;  3PNL B;  4EEC A;  1MVH A;  1OWM A;  2YIN A;  2L6J A;  3CVU A;  2W5Z A;  3M59 A;  3U64 A;  3MEK A;  3S2A A;  4A3V A;  3MA5 A;  4FJY A;  3AU5 A;  5FZQ A;  3U4T A;  3CVW A;  2I1J A;  2XEV A;  2C0L A;  2ILR A;  3CK7 A;  1LF8 A;  4GZ5 A;  4OVV A;  4BT8 A;  2BQZ A;  3LEW A;  5LCW J;  4DLQ A;  3NQP A;  1ELW A;  2NSZ A;  5FQ4 A;  3UT8 A;  2UWJ G;  1OWN A;  2CFU A;  2IF4 A;  2J07 A;  2PZI A;  3ASH A;  3FUL A;  3MKR A;  4L1B A;  5AJD A;  4DI4 A;  5T5G A;  2GRM A;  3OOI A;  3Q4A B;  2XGO A;  4K03 A;  2AXZ A;  3D9L A;  3FP3 A;  4KBQ A;  4GCO A;  4ANU A;  1UN9 A;  1WM5 A;  2PM7 A;  2JLB A;  3GW4 A;  1UJJ A;  4DK5 A;  3ZEF A;  3HIZ A;  3RIB A;  3TJP A;  4NVQ A;  4AU7 A;  4GZD A;  3CKC A;  3QB2 A;  4CGV A;  1INZ A;  2XPY A;  3ASD A;  5LSX A;  5BUZ A;  3QAR A;  2VTB A;  2MOW A;  1NP7 A;  3SGH A;  1JPL A;  3QJZ A;  3SD5 A;  2YHC A;  4DJA A;  3KAE A;  4AOF A;  4GU5 A;  3ZIM A;  2KC7 A;  3FUE A;  4PS7 A;  4TUU A;  3HYM B;  1OWO A;  3CIA A;  3CQC B;  2UY1 B;  5AIJ A;  1B89 A;  3EJN A;  4J7I A;  4JDS A;  1ELK A;  1E8Y A;  1DVP A;  5TH7 A;  2WXR A;  1A17 A;  5T4Y A;  5TTF A;  4GA1 A;  2X38 A;  3ULQ A;  4CT4 A;  5FWQ A;  3LYA A;  3KS2 A;  2IGQ A;  3DPD A;  3RJV A;  3D9N A;  2F69 A;  3APD A;  4AJW A;  3SHF A;  4RVB A;  2Y4U A;  3L13 A;  4U0U A;  1VDY A;  3B7S A;  3HHM A;  1H0A A;  1HFA A;  1HS6 A;  4RG9 A;  4BSX A;  3MKQ A;  3PEV B;  4GZ6 A;  4HFG A;  1WY6 A;  3KMT A;  4HOU A;  1QZ2 A;  3FTS A;  4F1S A;  3G2S A;  3S7F A;  4JC8 A;  5AYF A;  1OWL A;  3NF1 A;  2PQR A;  1TJF A;  3FHE A;  3L54 A;  3IEG A;  3PE3 A;  2CHZ A;  3VUZ A;  2AWI A;  4I1A A;  4FU3 A;  4UQZ A;  4L2Y A;  2WXK A;  3RU0 A;  3G2W A;  3QC1 A;  2J4D A;  4AXH A;  3EP0 A;  3JCK C;  5C2Y A;  4ACL A;  5BW8 C;  4Y6W A;  5E75 A;  4FA6 A;  3F9X A;  4OYS A;  3TGO A;  2WPV A;  3R9A B;  3ESK A;  1ML9 A;  3I3N A;  2WXG A;  3IHV A;  3CVV A;  4J8E A;  4UI9 K;  4G26 A;  5LX8 A;  1IHG A;  4R7L A;  4FMU A;  4IJD A;  3CKB A;  1UG3 A;  3ZHE A;  2EQX A;  5F5E A;  5KJM A;  3UT7 A;  2LAI A;  4LER A;  3KMA A;  4N39 A;  1SQM A;  3S8P A;  3MO2 A;  2PQN A;  4EPZ A;  1Z3X A;  5M72 A;  2WQ7 A;  2VGY A;  3D9O A;  3SZ7 A;  4ATG A;  4EZK A;  4FHK A;  4GML A;  2R5S A;  4UWF A;  4WWO A;  5A6C A;  3LY8 A;  4GPK A;  2I1K A;  3S7B A;  3ZFW A;  2W5Y A;  4F3V A;  3PZD A;  2P58 C;  4L23 A;  3IBE A;  1SZA A;  4Q69 A;  4LUN U;  1SZ9 A;  4LEU A;  4JZY A;  4WND A;  4J8F A;  4K0R A;  2FUL A;  3LY7 A;  4NRH B;  3GYZ A;  3PRZ A;  2IOS A;  3E4B A;  5E76 A;  4AP2 A;  2KCK A;  3MZL B;  3AS8 A;  3O48 A;  3GZ1 A;  4P29 A;  3S7D A;  1W3B A;  1KLX A;  4DLO A;  5BT1 A;  3UMV A;  4FLH A;  4LRZ A;  2J4B A;  4XI9 A;  2GW1 A;  4CDR A;  4OVU A;  2JV0 A;  1HF8 A;  3OXG A;  2E0I A;  3FFL A;  3L6A A;  3QKY A;  2WXI A;  1MUF A;  4XZ4 A;  3K5K A;  1UJK A;  3ZXS A;  1HH8 A;  2MRI A;  5ARG A;  1XGW A;  2VSY A;  2WXF A;  3VLD A;  2QPW A;  3ZYK A;  4CDM A;  2WB2 A;  1PAQ A;  5F6L A;  2IFU A;  2OVF A;  3CVQ A;  5ANR A;  3I4G A;  4G1T A;  5LSZ A;  1KT0 A;  2XQ0 A;  1H19 A;  4LCT A;  3FTX A;  3Q15 A;  2VSO E;  3CVL A;  3HVE A;  4XKC A;  3UUX A;  3CVN A;  3F9Y A;  4BUP A;  2R59 A;  4DI3 A;  1WAO 1;  4EZL A;  4C0M A;  3CK9 A;  3FDH A;  3Q47 B;  4J6I A;  5C1D A;  3M54 A;  1H6K A;  2C0M A;  4BY6 A;  4B8C B;  3JQ1 A;  3U3W A;  3ZGQ A;  3UPV A;  3SWC A;  5T3R A;  2M63 A;  2V0P A;  3GZ2 A;  1HG5 A;  3N71 A;  4QFV A;  4BX9 A;  5LCW C;  2XCB A;  5JJT A;  4MI5 A;  3LPZ A;  4N2S A;  2RD0 A;  3LY9 A;  3G2V A;  1MQS A;  2CFZ A;  3OTN A;  3T8M A;  5FJY A;  4BTA A;  3O4Z A;  3L08 A;  3QWW A;  4FLB A;  1HX8 A;  3EDT B;  1NZN A;  4KXK B;  3SNX A;  1TEZ A;  3APC A;  4HOQ A;  1JWF A;  4FUL A;  4XKB A;  4APF A;  2L0T B;  1HU3 A;  1EF1 C;  3FU3 A;  1XQH A;  3FH5 A;  4RSY A;  3FTV A;  3EIQ C;  1FVH A;  3FUF A;  3MO5 A;  3QK0 A;  4FJZ A;  2HYZ A;  2I2O A;  4YVO A;  5AYW D;  4C0E A;  4IJ8 A;  4QEN A;  3L22 A;  1E90 A;  2XRZ A;  3D9J A;  3RAY A;  4V3I A;  3RQ4 A;  3CHR A;  2KZT A;  3PH0 C;  4JPS A;  2CG2 A;  4Q96 A;  3T5X A;  1HO8 A;  4TV3 A;  3TG4 A;  1QNF A;  4KMO A;  4F7A A;  3NZU A;  4ANX A;  4I1O B;  3FU0 A;  5FZR A;  3RRU A;  4B8A A;  3DBS A;  3UT4 A;  4UWH A;  3QDN A;  4GCN A;  1PY1 A;  3LS8 A;  1U3D A;  2BTD A;  1HG2 A;  4JLG A;  1HE8 A;  5EKQ D;  4AY6 A;  5DIZ A;  1N6A A;  5F59 A;  2V8S E;  4TRQ A;  2YNQ A;  3RO3 A;  4HXI A;  4KZ0 A;  1BPO A;  4PDX A;  2DCP A;  3EHN A;  4J8S A;  4A3T A;  1EDU A;  4YND A;  4ANV A;  3CBO A;  1EPU A;  3BG1 B;  2ION A;  3U66 A;  2BUG A;  2XCC A;  5EDS A;  2LAH A;  4I2Z A;  1O9S A;  1ELR A;  3PE4 A;  3ZPJ A;  4UI9 J;  3EIJ A;  4GA0 A;  2FI7 A;  3MV2 B;  1ZKK A;  2OVB A;  4JA7 A;  3IV0 A;  2IQC A;  3RK6 A;  4ILH B;  4UI9 C;  1X5B A;  2VTB B;  1Z3Y A;  3SF4 A;  3B7R L;  5JHN A;  3SBT B;  1XNF A;  2X6H A;  3B7U X;  3BEE A;  3CVP A;  4NAC A;  2IOL A;  5EX3 A;  5J90 A;  5FZS A;  3URZ A;  5HQ8 A;  3JQ0 A;  3M58 A;  4WWP A;  4AY5 A;  4PS8 A;  5FQ7 A;  5JJ6 A;  3M57 A;  4IN3 B;  3HDX A;  3AU4 A;  2VYI A;  3ZN3 A;  4NUR A;  5EG2 A;  2AXV A;  2WXJ A;  3CHS A;  2PL2 A;  4ILI A;  4XX5 A;  2HM8 A;  3MYV A;  3TXN A;  3FTY A;  3ZYQ A;  4CEM A;  2AVP A;  3BO5 A;  4B0Z A;  4YPA A;  4BFR A;  4GZ3 A;  4XIF A;  2J49 A;  3FTZ A;  3PNT B;  3CBP A;  3FEY A;  1OUV A;  3FUJ A;  3LXU X;  4AM9 A;  4B89 A;  4JVS A;  4YPU A;  2A5U A;  2OOE A;  4YPE A;  4I6J A;  2WXH A;  2HO1 A;  5BV1 A;  2WXL A;  1MHQ A;  3CEQ A;  5G05 J;  2LSU A;  2KM4 A;  3M5A A;  2GRL A;  4UQX A;  4G11 A;  5BPP A;  3MKQ B;  3LDZ A;  5JHB A;  2LO6 A;  4MS6 A;  5G05 C;  3QWP A;  3FU6 A;  2ZU6 B;  2R3A A;  3QWV A;  4GAA A;  4YVQ C;  4BX8 A;  4IYP A;  3RRM B;  2WXP A;  4HOS A;  1H3I A;  3TAX A;  1GW6 A;  3TL5 A;  4KZC A;  1YA0 A;  1JWG A;  1QQE A;  4N5C A;  4QEO A;  1E7U A;  4HOR A;  4KYO B;  4L2L A;  2XRY A;  3IHX A;  5CPR B;  3FUD A;  1UN8 A;  5DBK A;  4JEH A;  4BT9 A;  3RJW A;  4FAD A;  5CCM A;  2A4Z A;  2NC9 A;  3G2U A;  5G04 J;  3R7R A;  4KVM A;  3LKU A;  4MRU A;  4DPR A;  3VTY A;  3MO0 A;  2AW6 A;  4W9R A;  4GB9 A;  3PVL A;  2WXQ A;  3BG0 B;  4WAF A;  2IU1 A;  3FUH A;  4ANW A;  3S7J A;  3JYS A;  2GGF A;  1ZBP A;  4N3B A;  5CCL A;  3ZHE B;  1S0P A;  3SBS A;  1P5Q A;  2UY1 A;  4J7F A;  1IQR A;  1OWP A;  3G2T A;  3PUJ A;  1NA0 A;  1H2V C;  2WMN A;  5FT9 A;  2WM9 A;  4JHK A;  4ILG A;  4CRW A;  5KJN A;  4WWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...