3S88H

Crystal structure of sudan ebolavirus glycoprotein (strain gulu) bound to 16f6
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
220
structure length
220
Chain Sequence
EVQLVESGGGLVTPGGSLKLSCAASGFAFNYYDMFWVRQNTEKRLEWVAYINSGGGNTYYPDTVKGRFTISRDNAKKTLFLQMSSLRSEDTAMYYCARQLYGNSFFDYWGQGTSLTVSAAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16F6 - Heavy chain
publication title A shared structural solution for neutralizing ebolaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 38
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2011-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3s88H01
5IW6B 3K4ZA 3PWLB 4Z7NF 1N3NA 4QHNA 5TQ0H 5FF6B 3CFCH 3VFMA 4RFNB 4F9LA 1YYML 3KNBB 1ZSDB 3MRFA 1GIGL 4ALAL 1XCTB 3K2MC 3ZL4L 1ZANH 5F7WC 5F6HJ 1RIUH 5EA0L 2A0LD 1ETZA 3GJFB 4XBEL 5EIQA 3QUYB 2H1PH 1T89A 5GGRA 4YHOH 1KB5A 5D7LD 4CNIB 1ZLVH 3K4AA 3TBWB 2FR4B 5EU3A 3S97C 5D1QD 1KIRB 4NO5A 1A4JB 1DQJB 5E8OB 3TYGH 5B4MD 5I1AB 2DMKA 3WKMH 5DRXB 4PUBH 1HSBA 4DQOH 1D3CA 4Y19A 1UA6L 3CXDH 1OY3B 5JHLL 1XGTA 2W60B 3KLHD 1VGKB 1U91A 2X05A 1XGPB 4I48B 1C08A 4KJQC 4Y19E 5J6GA 3ARQA 4JQXC 5AUMB 1IC5L 1P7QA 4MJ6A 1I3VA 1QZ1A 4ODXB 4DKFL 3DYMA 4Y0GA 3ES6B 4UUJA 5DRWB 4RGOL 3JWNC 4KPHH 1CL7H 1A3LL 3Q6GH 4NO0A 4PJIB 1KN2H 1RZFL 4OZHE 4P5TC 3T1WA 1OTTD 4P59H 2AABL 5KW9L 1A64A 4Y5VC 2V7NA 4NN5B 1TZIB 4R7DB 3DBXA 1A9BA 1YDPA 5DO2C 4U7MA 1J0IA 1EEZB 3U6RA 2EDEA 3QUKB 1ZGLB 2CH8A 4QRRB 1BAFH 3P4OB 3OKYA 1IQDB 4WY7L 4OCWH 1GPOL 5IB3A 4LMQI 3NAAL 4X7CC 3F5WB 5F1IA 3QJFB 2A77L 3BZEA 2OJZL 5IHZA 4X7FC 2Y06H 3HPLA 4KKCD 5EU7E 4P2QA 5IWLC 2WW8A 3HMXH 4M8QA 1NKRA 1QVOA 3DRTB 1FZOB 4QF1A 3MYJA 4P2QE 1IEAA 5JOPE 5FK9A 1GC1C 3B9KD 5IB4B 3Q5OA 5IVZA 5BW7C 3QUXB 1U93B 4UV4H 1TZHB 4DZBB 3MV9B 1DBBH 2NQCA 2YA2A 3ARFC 4F2MB 5EPMB 1JGEA 1PEWA 3UPAA 5C0DB 3EUUA 4WO4D 5T1KB 1UM5H 4OD3L 1R5WB 2HT3C 3QIWA 5IJVA 1U95B 5I66A 4MQXC 3SO3B 1MIEL 4KROD 3ZHKA 5IEKB 5F9OL 5IV2A 4Z7VA 2WINA 3ULSB 1MRDL 4MQSB 4TSCH 4EXKA 4XNMA 4HH8A 3ZDXE 2DQDH 5HHQA 3SDYH 2X10A 4PBVC 4Z7VE 3MRQB 5DRNB 5DZLA 4G9FA 4PJ9C 5GS1B 4LHUD 4XPAH 4Y8AA 5F7KC 1N59B 4G9FE 5D71L 5ANMA 5JIIA 2DLTA 2R69L 3DV4B 5BS0B 3ZDZE 2FLBT 4MQ7B 3S96A 4APQB 1YNLL 1OD9A 3C5ZC 3P2TA 4WI9A 5ANME 3GI8L 2LQRA 2BDNL 1MWAA 1SEBA 2EO1A 2R4SL 4XZUB 5ICXA 4JY5L 3MREB 3W11D 5BQ7A 4ZUTA 2LTQB 5HGAB 3LAFA 5MEPA 2AJVL 2ZCLL 4KY1H 1Z3GL 2WM0A 3VFPB 2I5YH 2CXKA 3PV6A 4MAYC 2F74A 4LLDA 1A3RL 3DTXA 2WP3O 1X5KA 2AERT 1PKQB 3OG6B 1RZKL 5HBBA 3B9EA 2VQTA 2R2CA 3MROB 1CGXA 3IDUA 5FKAA 3O8XB 2AEIT 1CG9A 2FGWL 1P4IH 1W8OA 1DR9A 4IMKA 4XAWL 1CR9L 3LPFA 5I19H 4OCXL 3TZVC 5AAWA 1MAML 2VLJD 5D6CA 2WBJA 4HBQA 3HTLX 2I27N 3RFZC 5LAXA 1XF2B 1SYVA 5GZND 3V6BR 5F9JB 5HYFA 3V79C 1DFBL 3D48R 1WWBX 3WNNA 1KJ2A 2G5RA 1F58H 4MD0A 3W81A 1JZ6A 4KZEL 4JFEA 2JELL 2N4IA 2FD6L 3BKYL 1RZJL 2OL3L 3MUGB 5D7LB 4U1NB 5J8OA 3MA9H 3GGWA 3QI9D 3CFIC 4BQ6A 2DD8L 2WWMD 2XPGB 5D1QB 3QIUA 4JFEE 3GMRA 2AI0H 4GAYB 3SKJH 1B0RB 4D3CH 3VD9A 3Q6FB 3BD3A 5I0ZA 5I18H 2B1AL 2W65A 2BSED 1F3DJ 2YKLL 3BDXA 5DI8B 3RPIA 3UTQB 1KBGL 2O61B 4U1LA 4YWGH 3V6OC 1IGYA 1QHPA 1URLA 4K7FB 4NRXB 1RUAL 1KB5H 3O3DA 3RGVA 5IFHH 4PJXF 4BSJA 4M1GH 3VD4A 5IEHB 3NIDF 1R5VA 4QNPE 1HILA 5INCA 2IGFL 4HXBH 1SBSH 1LP9F 1MHPH 1C12A 5HY9B 2AK4D 4PGDA 2OXGA 1IT9L 4AT6A 1PW3A 1WVZA 1YC7A 3MGOA 3HS0A 1S9XB 2Z8SA 2AXFA 2ZG1A 2GTWB 3S34H 4G8GA 4OTXH 1B90A 3BW9A 3S37L 2ZPKL 2RJMA 1ORSB 2YBRA 1NLBH 4G8GE 4EI5C 3BXNB 2VDQH 2A1WH 4K71C 4MAUH 1I9IL 4ENED 4QHLA 3CXHJ 1S9VB 3TIDA 4BSWB 1CLYL 1HDMA 2YD3A 4OKDA 4D0DA 4YDKL 1RJYA 2J4WH 1U8QB 4ZPVA 1HIMH 3D69A 4F37K 5EZLB 4TUOB 2I60L 4OUOA 3ZKMC 3HI6H 5I17A 1VCAA 1EJOH 1G7QA 5GGSY 3WXVH 1I3UA 3RNKA 4DUVA 3JWOC 3BQUC 1ONQB 2EIBA 2VZVA 2DYPD 3BP7A 4OZIA 1QBLL 3HUJA 1YEKH 5CINL 5DRZA 1JZ3A 5IVNA 3B9KB 4PJHB 4OZIE 1UWEH 4GAGL 1KJ3H 5JUEH 3V52L 3HUJE 5D6DC 5ICZA 4ZS7H 5C92A 1ORQA 1V7NL 1VEMA 1OAUH 1QBAA 2APBA 4K23H 2FBJH 4NT6A 2OCFD 4WO4B 4A6YB 1A3QA 4DN4H 1ACYH 1BBJB 2YR3A 1YECL 4U3HA 3FO1B 3ZHLA 1U3HD 4KROB 2PTUA 5DTFB 1S7QA 5EUOF 1J88A 4QLRA 5C3LD 1DDHB 5I30L 5D9SB 1AGBA 4NCC1 1OSZA 4Z78A 5DS8B 1G1CA 4O2CA 5HXMA 4JZNB 3O2DA 4UILH 1P69B 4Z95L 1HI6B 3MLTA 3JTTA 1MCLA 2VQ1A 1BOGA 1TJIL 3KPPA 5F88A 3O4OB 5ESQA 3MNWB 4DKDC 4LHUB 1AXSA 3R4DA 3FT2A 2F5BL 4RGNE 1ZMYA 4FA8A 4KXZI 1PY4A 3SKMB 1S7UA 1QFPA 3FQTB 1FFPB 2D4FA 5GJTL 2GSIA 3CPLA 5GHWL 2AXGA 1N64H 2QQKL 3QPQD 4LAJH 1UH2A 5CIPB 2MCG1 3TJHC 5MENA 1JNJA 4U1IB 4N9GB 3MNVA 1UWGH 4LDLB 3GSNB 4PLKD 1J1XH 5MENE 3P3YA 1ND0A 4G6JL 3NFNA 3QCVL 4YDLC 2ICEB 3CFBA 4X98A 5TPWL 3NCYS 1UQSA 4RIRA 3I84A 4B41A 5IBTH 2A9MH 3ZKXC 4QGYA 3QNYA 1D6EB 3HA0A 1MWAH 4R4BB 2BC4A 2DL9A 1G7LA 4HULB 3U1SH 4FTVA 3DMMA 4XMPH 2O93L 3LKNB 4MB3A 3TPUB 1GL4B 1DE4B 3ECBA 5IM7A 1YEDA 4R4FH 4FTVE 2D7TL 4QOKD 5F1KC 5E2JA 5L2KA 5AZEL 1OTSC 5CD5D 3T65A 3LKOA 2VC2H 1OD7A 4JFYB 3SBWA 4JPWL 1LHZA 4UOJA 1ZA6A 5TQ2H 4PV9A 3ARVA 3H3KA 5L2KE 4MB4A 5CCKH 4PYGA 1NCCL 4JO2L 1FG9C 2V5RA 2EYRA 4AG4H 2NY4C 3DECA 1IBGL 1J1PL 4OFVA 2J8UA 4XMKH 4GRWF 1MELA 3B43A 3VRIB 1JPSH 3IFLH 4JHWH 2PTTB 4X83A 2J8UE 2WUBL 2D0HA 3SDDC 1JK8B 5E2UL 2OZ4A 4L8CB 1DLFL 1GVIA 1KJ2H 3QDMA 3TBYA 1IZKA 5EBMA 1JHTB 1HKLL 2BY3A 4P5KB 4JDVB 4HAGA 2LU4A 3IRPX 3QDME 2R0LL 1G7PB 4P2OD 5IROC 1XR8A 2IEPA 4L3AA 5C0EB 2CGRL 3T2OA 2AK4B 1JBJA 1ZVYA 3G6JF 4LFHG 4NHCH 4WFFE 1B4JH 4NKOA 3KPQA 5SX4I 4XMLH 4FQLL 4FNLH 3JWDC 2R0ZL 4G42B 2OTUA 4ZUUA 1RAMA 3JZ7A 2FB4H 3JXAA 3BIBX 2ITCB 4Y16A 5JW3H 1V3LA 4JPIA 3QXAA 5HHPB 5DJYB 4HIEB 4WTXA 4TVPE 1U58A 2AJXL 3GSOA 1NDGA 1OW0C 1DN0A 2MCPH 1JZ7A 5GGSB 1R6VA 1KTRL 5BO1L 3TIEB 1KPRB 2EEDA 3OKKB 3IAPA 4AMKL 4HJGB 3SDAA 5I8OH 3EOTH 1FVEA 2DYPB 4D0CB 4NBZB 1SY6L 3PP4H 1FZKA 3VW3L 2PO6A 4LLYA 5FDYA 3DVIA 2EYSB 4X5LA 4OJFL 1L6XA 4WFGE 3AB0C 4YHKL 4G9DA 3IDYC 1GGCL 1OCWL 5A43C 4JFPB 4GKNA 3RWHA 2OSLA 1UB5B 1FIGL 3V5KB 1LO3H 2P49B 3K46A 1BIIB 2ZSWB 3KHOA 3SJVD 2DJSA 4K7PL 1FVDB 2EIZB 3MLRL 1JYVA 1N4XL 2VLKA 1J12A 1U3HB 3MRHB 2X42A 3UYOD 3C09C 4RBPH 3GIVA 2VLKE 3C5SB 5JORB 3FOLB 3L3HA 5DDHA 1RZGA 1FC1A 4RWYH 5GS2H 3WFCH 3KWWB 1Z9MA 4QYOB 2VQUA 2YD9A 4ZD3L 4R90H 4YHLH 3T3MF 5JW5A 2XTJC 4IM8A 1BZQK 2D7QA 4E5XA 1YEEH 3O4LD 2FEDD 5I1IL 1MFAL 2SEBB 3DXAD 3LRSB 2AEWA 1N7ML 2EDBA 1IAOB 4LP4A 4GW5B 4LCIL 4ORZC 1KGCE 1QEWB 3QO1A 3WNMA 3U4EB 32C2A 3O0RH 1DP0A 4RWHA 1RUQL 4UV7H 5DWUH 3TBSA 4CADB 1QRNA 3QEUA 4XBGA 4F8QA 4XC3H 1XZ0B 4OZFB 4S10A 2I9TB 4GW4B 2R1XA 1TCRA 2O5ZL 3TV3L 1QRNE 3OKEA 2YMXH 2BNUB 3QNXB 4XAKD 4N0UB 4LPUA 3ZT7A 3WHXB 2AJ3A 5ISZD 5GZOD 2VDNL 3ULUE 1JPTH 4K3JH 1J9CT 4LSTL 4Z0XB 3D3VD 3MOAH 3UJJL 4MJ5A 4NQEA 3HE7D 3SDXA 1T6VN 1DSFH 3IDGA 4M61A 4Y5XC 1C5DB 1SBBA 2PW1B 4NQEE 3SDXE 5K9QG 4YXKL 1G0XA 3MUZ1 3RJQB 3TO4A 3NFSL 1CLCA 4ZO8A 4XH2A 3S35X 3VRLE 3FL7A 4NN7C 3QH3B 1U8IA 4I18B 3KPNA 3L5HA 2OQJB 3DGCR 3V4UL 2YXFA 4ZFOL 1SEQL 3FQRA 3WJJC 4JY4A 3QIBC 3JV4B 1PJ9A 4X99A 4WDIA 5CGTA 3LIZH 2DTSA 3VXRE 3DJ9A 3PGCB 1I8KA 5HHNA 4U6YB 3VWKC 3CFKB 5IBLC 1MLBA 2ZOKB 1ITBB 3MR9B 2QKIA 1T83A 1AD9B 4XNUL 4P4RB 4ELME 2EDKA 5FM8A 3OGOE 1QNZH 3PWNA 3IFOA 2B20A 3RIFF 4C56A 4YE4H 4XNXH 3HI5H 4P2OB 4HHAA 2NY2D 3OPZL 1EO8H 4D9LL 2DQEH 4KKAD 4C56E 2VLRA 1CFTA 4HIIA 1Z0NA 5EC2A 5EOQH 4CVXA 1PSKH 2IQ9L 1G9NL 3BT2H 2V9TA 2PXYA 5GRUL 5I15L 2OZ4H 1I1AD 3EDEA 3U9PH 4NKQB 4NRZA 2L0DA 3PGFL 5BRZA 3Q0HA 5DGQA 4JZJC 2ZG3A 2BVTA 2UZIL 5FAAA 4N0CD 2XKNB 5LCVL 5BRZE 4GW1A 1KV3A 5E4IA 4LSQH 3DV6B 3RL1A 4MNGA 1HHHB 2WSKA 4M00A 2IPUG 4KMQA 1N5AB 5E94B 1PYWB 3EHBD 4RA0C 3HG1D 4UAOC 4F9PA 2OK0H 4MNGE 3VRJA 3CH1B 4K94H 3NPSB 4I8DA 3V9FA 1UVQA 1NC2B 3VFOA 2HMID 4AH2A 1L7IH 3MJ7A 2V2TB 2R4RL 2P42B 3WL9B 1Z9LA 4TVPH 3W9DB 2EIDA 5D7JA 1AQKH 5KTEH 2G75A 4LVNB 5J1SC 5IQ9A 4PJFB 5I74B 1RK1A 3L5WA 3V4PL 2EXWD 5LGHL 3D0LA 3SDCA 1EGJL 1J10A 2MQCA 3NCMA 4NQSA 4OLWL 5KVDL 1P84J 3SJVB 3EO0B 1A02N 1QR4A 5DJAA 1RURH 2ZSVB 4UT7H 1A7QH 3X3GH 1A1OA 3DO3A 1WTGT 3DX9A 3L6FB 3BESR 1FBIL 4Z7UB 5KS9F 4R2GC 1B6DA 1G6RL 3KYNB 5CJXC 5IKCB 3RI5F 1RZ8B 3L7FB 4Q6IB 1TVBB 3IDMA 3B83A 5D72L 3T0EA 4NOBA 1OSPH 1P6FA 5HVGB 2BNQD 2Z91B 3O4LB 4PJ8D 1NBVH 3I75A 3DXAB 4RFEB 3N85L 3T0EE 5LJYH 1NJ9A 3VDBA 4DGIL 1CXLA 2Z8RA 2DM4A 3LD8C 1AD0B 4WEBL 2C3VA 1D5MB 2OL3B 3V6FB 3EYQC 4K9EH 4EKXA 1AIFA 2GFBB 3I3EA 2P5ED 3T4AA 1FNHA 2YWZA 4PJBB 5IB5B 1T2JA 3FO9B 4NO3B 3OB0K 5F3BA 5ISZB 2BSTB 2DQJH 1WV7T 1OGAA 1S5HB 3D3VB 5DJ2A 4HFWA 1IM9A 1S7VA 1CGWA 1DLHA 2BOBB 2O5YL 3HE7B 1OGAE 1CFQB 2X1PA 3GSVB 4AEIH 4H25A 1AFVL 1K8DB 4MJID 3LHPH 5AD0A 1VKXB 2FNBA 1ZKAA 4M1CD 1MCPH 3QFJA 4NZTL 3EW3B 3MRGA 3ULUH 3CX2A 1IEHA 4XP1L 5TDPB 4BYHA 4ESKA 1PLGH 2LVEA 3O9WC 3V4VL 3WFBH 3QFJE 3QB7C 4PGCA 5HHOD 2F15A 1BVLB 3W9EB 5E08H 4LCUA 1F5WA 3KYMB 2R1YB 4ODVH 4S0SD 5E6ID 3DX6B 2J3SA 3BGMB 4NN6C 1UJ3B 2BNRA 1QLRA 1FYHB 3IFNL 5M7QA 2AJZB 5ACZA 1KFAL 3WDJA 1U3ZA 2YEZB 1YMMA 2XG4A 1HYSD 6FABH 1RZ7L 2EDWA 3ARBD 1RVFL 3MV8D 5DVLA 1YMME 2E6QA 3MRJB 1H5BC 4WHYG 2Z4QA 5F71A 3ZE2E 1FNLA 4C83B 4UI2A 4TUKL 4X6DB 1XF5A 3QXUA 2P46B 4KVCH 4L4TE 1NLDL 5F7DB 3IXTA 3GM0A 1F4AA 2EE3A 4ZODA 4RMRA 3MFFB 4ODSH 3QEHB 2R0KH 1YN7A 2J6EA 3EDFA 3O6FC 5GGVL 2NY2B 4X6EB 3RU8L 4TQEH 2VE6A 3MBXH 1E6JH 3FB7B 3W5NA 15C8H 2ESVD 2NY7L 3KLAA 1NFIA 4MCYB 5C0IB 1UZ6F 2B0SH 4YUEH 2IMMA 5T1DH 1T1YA 1I1AB 3NCCB 2NY3D 4PRDA 3SE4A 4QWWC 1IILE 1D5IL 4FFYH 5E6YA 5D70L 4Q0XL 3ARGC 2A73B 3ZTNH 3P4LA 4H1LB 4WW1B 1FHGA 5EOTB 3NIGF 1Q9KB 4L8SC 3M45A 5KZCD 1X4ZA 2Y9RT 4K7PY 1LK2A 5DUPH 3BPCA 4RDQG 4R8WH 1I9RL 5F9DC 1OL0A 5IK3A 2Q76B 3U0WL 1XIWD 1I1YA 5D2LF 3CDYA 3C08L 5GIRA 1QSEA 4E42B 1ES0A 1PKOA 3WKNA 3NFPA 5DUBB 2J7LA 3CZFB 3QULB 4UTAL 2J88L 4NKIL 5E5MB 1QSEE 1HXMB 1A4KB 3C8DA 3PNWB 2HJKA 4OZGA 1T5XB 2Z93A 4NGHL 2JJUA 3WJLA 2MKLC 4KKLC 3FB6A 4CVWA 4GBXC 4EIGB 4L8DB 1FPTH 3GK8L 2YPKB 3O2VL 1KC5L 4PJAF 2B5IB 2VB5A 1TETH 2ENSA 2NMSA 1PG7W 5C0BD 1KEGH 1JF6A 2E9IA 3GHEL 4ODBD 4AIZA 5GGUA 4H88H 4PJ5D 3BP6B 1LEIB 3IGAA 3AXLB 4JHAL 2FH6A 5IHLB 4MDIB 3TN0A 2PYEA 4PV8A 1MJ8L 3VWJA 1JGDA 1H0DA 5LQBH 1ZLSH 2AJSL 2ICCA 4KJQD 1A6UL 3PL6C 1L9NA 3H3BC 3P4MA 4ZQKB 1V8HA 2X70A 5EO1A 2BNQB 4NYLA 2EDTA 1OLZA 4PJ8B 3BDYL 1X5IA 1YNKH 4Y1AE 4X7TA 4HKBA 4PBWD 1W0WB 1Z0MA 2OI9C 4KTYA 3UCRA 4LEOA 3MV01 5HYJA 4PRIA 4P5TD 2I25N 1EO5A 7FABH 4P2RD 1IQWL 3H9SD 2Y72A 4OUUA 5HYJE 2FBOJ 4PRIE 4XP4L 3S35H 4JQIL 4PG2C 5DO2D 1QA9A 2ZUSA 5IB1A 3V5HB 5IB2B 2P5EB 1HWGB 3C8HA 4ELKA 3N0PB 4BH7B 3CVHA 1M6OA 1GGIH 2V2XA 3QXDA 1INEH 1FNEA 4PB9H 4F7CA 4F9LC 2P48B 3MJ9L 1NGPH 5FECA 1YJDH 4FN0A 1OAXL 1MJ7L 1O5DT 2ERJC 5LWYH 3GRWA 4MJIB 1HEZB 3CMOL 4HWBL 5EIIB 5H94B 4NO2B 2HT4D 4KI5F 4NQCA 2Q87A 4BZ2H 2HTKC 2DAVA 1T89C 1Z9OA 5CBEA 4KQ3L 4PTTB 3FOMA 2G9HA 4NQCE 3QQ4A 3N1GC 5FA3A 6CGTA 1WBXB 5HHOB 1JCKA 3PWJB 2BVUA 5E6IB 4HC1L 3AU1B 3G6DH 5I8KL 3RVWD 2AXJA 3DLQR 1PFCA 3RNQB 3ARFD 4NM4L 1F4WH 3WV0A 3QA3B 2E7HA 2H45A 1DQQA 4HJJH 4GRLA 2HT3D 5E8PA 4MQXD 1P53A 2EE2A 4LSPL 3MJ8B 2I9LA 3CK0L 5I9QB 3TO2B 4FQHB 3MV8B 3IKCB 5LBSL 3OR6B 4ODHL 3W39B 4DKEH 1Q0XL 1P4BL 3LB6C 5I76A 1UYWL 4MMXC 4WHTA 3LN4A 2H3NA 2DQGL 3OB8A 1CDGA 3FFCD 1ZHLB 4PJEF 3D0VA 2VXVH 3TP4A 2GCYA 2CK2A 3MLVL 4X6BA 3WFEH 3UBXG 4JFFA 1T04B 1ZVSB 2WZPD 3T0DA 2DTMH 1YQVH 4OD1L 5E5RB 4F57L 4LU5H 5JW4Q 1HHKA 3C5ZD 2XY2A 2ATKA 4PJCA 4JG1L 5HGHA 4JFFE 3GKZA 2ESVB 1VSCA 4OBRA 5DEZA 4Z7WA 3UDWA 4TN9A 1MH5B 1U8MB 1NC4A 4LGRB 5C6TL 2NY3B 3UTTB 4R3SB 5ITBH 5MEOA 1CD1B 3G6AA 3QZWG 1YEGH 3UZVB 4Z7WE 5EU7C 4WNQB 2GY5A 2QQNL 4MAYD 5GRVL 4XCYA 2J6EH 4FXKA 1OM3H 5KZCB 3S6CA 4JVUA 3TM6A 4MXVE 5IQ7H 3NBNA 4BSVA 3SKOB 1NAKH 2ADFH 1MCSA 1XIWB 2CKNA 4L9LB 3RA7H 5IHBA 4P99A 4N90D 3BSZH 5DJXA 4PTUB 3TZVD 3IDXL 4RFOH 5FM5O 5E2WL 3EO1A 2IPKA 1T7YA 3V0AC 3EKCA 1LE5B 2NY5H 1SVCP 1FE8H 4GKSB 1GSMA 3MGAA 2ADIB 1F90H 3QIWC 2Z92A 4PRPA 3UC0L 1BFVH 1DQLL 1UKSA 1ZHKA 1MCOH 4PRPE 1M05A 3H9HB 2OYPA 3BWUC 2R23A 2YUXA 3MRCB 4HUWA 4ZTOL 2GUOA 3TYFB 1ZVHA 5C0BB 2I07B 4Z7UF 3AS1A 1EX0A 2X4UB 4PJ5B 4RNRB 5JMOC 1AP2A 2ADJA 4WW2C 5HGBB 1KSRA 1M7DB 4NQVA 1HH6A 2X1XR 4JDZA 4DOHB 3UBXA 3QHFL 4O58L 5LGKA 3QEGL 3WIIL 2XQBH 1P9MA 4U6HB 1NGXB 5C2BH 3NZ8A 1S78D 5BVPL 2DBLH 4CVZB 3GZKA 4Y4FC 4WHYH 3VGAC 2X4PA 3P4NB 2ZOLA 2OX5A 2AEPL 4JEGB 3QZWA 3VXQB 4FP8L 4P5TB 5F9AC 2MQ3A 1O7SA 2NPLX 4P2RB 1JWUB 1RHHB 3H9SB 1B9ZA 3QT2A 5IVXA 4OM1L 4EI5D 1MVFA 2Z35B 1YEIH 2NX5D 1A1NA 5F7NC 5IVXE 4IMKC 5ENWA 3RL2B 4NM8L 2XRAL 3OZ9L 2X7LB 4LCYB 2YHGA 3OJ2C 3NTCH 2WBJC 1D9KD 4Z7NE 1JNHB 2DQFA 1MCEA 4XNQA 1CZ8L 3QDJE 3OL2A 3STZA 3VH8B 1U42A 4KAQL 3HE6D 4M7LL 4UIMB 1CICA 4H5SA 3HFML 3CVHH 3GUTB 3KPOA 1IGCH 1KTDA 5I2IA 3QIUC 1DVFA 2X9WA 4XP5H 2DQTH 3IFPA 4HK3N 2VXUL 3RKDC 1K5NA 5J9PA 3TH3T 3SQBA 1NANI 3B5TA 3ARFB 1YPZF 5L0QC 1T1XB 5IGXL 2KQMA 2N1KA 4ZMAT 4M7ZC 3CC5A 4AEHH 4CDGC 4POYA 2NXZC 2WBWB 3OJDA 1UB6A 2CLVB 4NQDA 3TBVB 4QCIA 1CT8B 4QGTA 1NL0L 3ZLQC 5I1LA 5HVFB 4NQDE 1BQSA 3ABZA 4P9HL 2VXQH 3FFCB 4LRNH 1H3GA 5DJ6A 3IJYB 2V5YA 4UTBH 4KJWC 3RWDA 1UADC 3VDAA 1H3PL 4JO1L 1FO0L 1PG7L 4X4XA 3UTZA 3MA7A 3WUWB 3KLDA 1TJGH 2E27H 3MLSL 4KZDL 3QP3A 1JHKL 3WFHB 1MQKH 1O7VA 1B4RA 4WV1A 3C5ZB 4PRAB 1JPFA 1T80A 2OMNA 3GMOA 2QQLL 1A7PH 1ZXQA 5GJSH 3QHZL 3TJHD 4FABH 3KDMA 3H7BB 3RWJA 4CL7A 2HH0H 3VXPA 4WIQA 3E6HA 1FGNH 3DX7A 4MAYB 2ORBL 2IH3A 4CGTA 5J12B 2RFXA 4YFDB 1J0JA 2CLZB 1ED3B 3BEWA 4KK9C 2GHWB 1XR9A 2XZAH 5K93A 5K9KB 3ILPA 3ETBF 1G6RB 3I6LE 4LSSH 1NCBL 2FJGA 3KPSA 3UAJC 5EO9A 3I02A 4BKLB 2H6PB 2AGJL 4JRXD 3O3EA 4PJDF 2YPLD 1F6AB 3GSWA 3QCUH 5FYLE 1Y0LA 4NUJB 1VFAB 3H9ZA 5DJ0A 3TZVB 1ZT1A 3KPSE 5A2KH 4NDMB 3LPGA 4GT7A 4J23A 1FIEA 5F7HA 4PRHE 5TQ0L 1U8JB 4IBLT 4JFDA 1OTSD 5J06A 1WWAX 5EFIB 3MLYL 4NNPH 2OMBA 2YPVH 4POZC 3QPXL 4RZCB 5C8JA 1CFSB 4ZUWB 3C6LA 4JFDE 4F7EA 4TUJB 1WC7A 3DSFH 5DVOA 1ZANL 4M62L 3UZEA 3ZHDA 3S3SA 2YZ1A 1OP5H 1RIUL 2NY4D 4LCWA 1NMBH 3DROA 5IG7A 4JM2F 4W81A 3U83A 2JB6A 1I7TA 4YHOL 4RGNC 5FO9A 2OLDA 5EZJA 4EXPX 4UINL 3A67L 3LRGA 4LCWE 5CKAA 2ED8A 3NOIA 1TJHH 1Q8MA 5FGCB 3MO1B 1J86A 3M17A 3TYGL 2X41A 4CVUA 5KG9A 5E99L 1RZIB 1J05A 4M43L 3L7EA 3EYVA 5I6XB 4DQOL 3KS0H 2VR5A 1Q72L 4NP4H 1CBVL 4RGMB 1ZLUH 1KJMB 2VKWA 2JCCB 5CEZD 5CEYB 3VMOA 1IGIH 4K8RL 1NDMB 2VIRB 2W0FB 5ESVB 4XWGH 4OLUH 4XNYL 4IHOB 5FB8A 1DQMH 3MZTA 3UTPD 3J8F7 4YDJB 2ILLA 3AY4C 3PE9A 4ZPTB 4LVHC 5BXFA 4PGBA 3Q6GL 1MCJA 1OAKH 1KN2L 2AK1H 1KXTB 4M48H 4WGVB 1RIVL 4EI5B 2OR9H 3IDIB 5T3XE 5BOZG 4JO4H 4K71B 4U1MA 4ZUSA 3MACH 2NX5B 3DMMC 1Q94A 4F58H 1BECA 5JIPA 5SV3A 3QR2A 5FKPA 3OHXB 5FHBL 3NZHH 2Q8BH 3OKLA 1D9KB 4G8IA 1BAFL 3FMGH 1DEEB 3BKCH 3MRPA 3MBED 4OCWL 2FZ3A 3HNSH 3RWGA 3SBWC 2X4RB 4NWTH 4NZDA 1WIOA 2EH8H 3EOAA 4G8EB 4WI6A 3HE6B 4O2EA 3ET9F 1IE5A 3QG7H 2PUQT 1AQDB 1K3IA 4S1RH 2DQIH 5EBWA 1X5FA 3STLA 4ZOEA 2IFFH 2OBGA 1XF4B 2IQAA 4OT1H 4WU5B 4IOSD 3GDBA 4UV4L 4XXDB 5EOCJ 1DBJH 4DK3A 3U30C 3HI1A 1JF1A 5HVHC 5L2JB 4X5WA 3HC4L 4HIHA 4GO6B 4ZTPL 2IC2A 3F7YB 4OFYA 4XVJL 3VXUD 4HUMB 2FHCA 4PJXA 4J4PD 5H2BB 1MQ8A 1TIUA 3EJYC 2MPAH 4UNTA 4OI8A 3RTQA 4PJXE 3M1BB 4S1SH 4OQTL 3OTTA 2DQDL 1MFBL 3SDYL 1CF8L 2A83B 3AREA 3DX8B 1A7OH 4KU1A 4OAWA 4K94C 1XF3A 3KHQA 1ZWIA 2C26A 1A6TB 5C0AA 2VDPL 2CIKA 4Y16C 4TSAH 1OP3H 3SGDH 1X6LA 3OJMB 5C0AE 4U1JA 3UTOA 1JP5A 4EBQH 3FZUC 4LNRB 1LWRA 3LQZB 1A21A 2YD4A 2A6DA 1JTPA 3QRGL 5ERWA 4Q9CA 5FO8A 2IBBA 3PJSB 2YD5A 4P3DB 5ALBL 5D1ZA 5EBGA 4BZYA 3QEQD 5SWZA 4P46D 5E2TL 2I5YL 1SM3H 3SDAC 3LH2L 4MA8L 1X9QA 4MD5A 5SWZE 1NMCB 1BX2B 5ESAA 1YNTA 5MEQA 1N0XL 2XACC 5CZXC 3W0WA 3UPCA 2HRLA 2PO6C 4J8RA 5IMKB 3CFEB 4WTZG 2Q6WB 3BKMH 1FV1B 2JK5A 4OZHF 4L1DA 1C16A 4O00A 3W0WE 5DXWA 4JRXB 3VCLB 2YPLB 4KWUA 1JHLH 3D39A 5JXED 1XT5A 3VGBA 2IALB 3IETA 4N1HB 5I19L 1BFTA 4MD4A 3MMEB 3EFFB 1N6QL 3D39E 5DMYA 4IOFC 4Y89A 3HAEB 3C60A 5JQHC 2WIMA 3EAKA 5EUOA 3BEVB 1F11B 5FYLH 5IOPA 5LGJB 3QIBD 2NY4B 3K81A 3RZWA 5KN5A 4LKCB 5C0CA 1QSFD 1F58L 3U36A 5EUOE 2C1OB 2HG5B 3X14A 3D9AH 3FN0H 5AG8A 3VWKD 3OKOB 4TNVK 3MA9L 5T1LD 5C0CE 4G5ZL 4K9EC 1VADB 3B6SA 4M6OL 1KJVB 4P0DA 4QTHB 1BIHA 2GT9A 3O3AB 4JKPH 4KKBC 2X2YA 5I18L 1BBDL 2EZ0C 3T0VA 2E7BA 1R3KA 4PP2A 4FRWA 2CLRB 4ZFZB 4KJYB 1ACZA 1PEZA 4QHMB 4YWGL 5HHVL 4E41A 2CIIB 1HHGA 1KN4H 4ONHA 2ARJA 4YHZL 1KB5L 2JIXA 3BHBB 3FRUB 2K3TA 4M1GL 3ZE0E 3E1F1 4E41E 3L3GB 1LVEA 4G43A 5CHNA 3ULUC 4HXBL 1SBSL 5KSAA 2VXTH 2ENYA 1UC6A 4D2NA 3BP4B 5IW6A 3GSXA 1D5XB 1FNGA 1N6UA 4AL8H 4HK3J 2G60H 1KLGA 5KBNC 4NHUA 3SGJA 1I7RB 3KNBA 1U8LA 2OM5A 2OP4H 3DURB 3G5VB 2IBZX 5IMLA 2ZUVA 2FSEA 5GRJL 1NLBL 2VDQL 4WTZA 2A1WL 3O6LL 3ULVE 2P47B 3MRKA 5MHSD 3TO4C 5CJQL 5AWNH 4OGYL 4WW2F 5DFTA 4UQ3B 3MBEB 1GZPA 3IDJA 5E5UB 5T3XH 4JRYD 1HIML 3RDTC 2FR4A 2BERA 4GKZB 3HI6L 1KIRA 1WTLA 1A4JA 1BZ9A 1R3HA 5DD5L 5L7XH 4MHHG 2E9BA 1ZHNB 5I1AA 2NZ9D 4WFEE 5T33H 3FQUA 2MNUA 4KKNA 4P5MA 4PJ7B 3WDHA 1B3JA 1JPGA 3JTSB 3AB0B 3IDYB 1YEKL 4Y88A 4F37F 3S88L 5SWSD 4OCMC 4NIKB 3HC0B 4JREC 3G5ZB 1EHXA 1KJ3L 1T83C 1CDJA 5T3ZD 5D5MB 5E9DD 4MLSA 3L3IB 5DRWA 4K23L 2FBJL 2UY6A 3VXUB 1E4JA 3OR7B 4ERSL 4ZDHA 3BD4A 2BSSB 4XPHH 3UMTA 2CDEB 3R06B 5HJ3B 4HDIA 3G08B 1WISA 4HW6A 1H3TA 3LPWA 3QQ3B 3MRBA 1IGTA 1TZIA 2H8PB 3WFZA 1DJSA 4DJMA 3G6JA 1XGQB 4OKVB 2MHAA 1WCBB 1PQZA 4UILL 3QUKA 2VTFA 3G6JE 3M07A 3QG6A 2Q7YA 4C4KT 3P4OA 1AC6A 1WWCA 4IMLB 4XRCB 5FDWB 5C07D 3LKQB 1BWMA 3F5WA 4ONGH 1I1CA 3QJFA 1MREH 5FYKL 1X6NA 3CLFH 4U1SB 1MJUH 3BIKA 1N64L 5D4QA 1VDGA 3EYQD 4I4WB 5C0GA 3SE8H 3N9GL 4RAVB 4D8PB 3QEQB 1JI1A 4P46B 4LRIA 5E2VH 1RJZB 4X7EC 2BVQB 4H26B 1HH9A 1Z9SA 4HUVB 4L3CB 1JWMA 3MV9A 2W9DH 5EWIH 5D7JC 4GXVH 1NEZB 4KUZH 4JLRB 2A9ML 2Z31A 4I0PA 2H2PD 3BISA 1JUFA 4J1UB 1SJHB 1MWAL 4Y5XB 3MV9E 2DWEB 3L9RA 1MFCL 1BQLH 4PGZA 5D7KD 3GJFK 4S1QL 5DHYB 1TCMA 3SDCC 4FFVC 5GRZA 3ULSA 1M71B 1S5IL 3HR5A 3O9WD 2MQ0A 4R4FL 4IIQA 3TGXA 4NN7B 1AE6L 4X4YB 3E2HB 3OGCB 3U0TA 4PLJC 3BPOB 5EUKB 4LMQE 1KTLA 4N0RA 2VC2L 4ZFGH 3VXMD 1LQSR 4HS8H 3FT4A 4XCEA 5A16B 5TQ2L 1A6VL 1ITCA 1EA9C 1HN1A 3QIBB 3MOQA 3GBML 4F3FA 1QSFB 4X9BA 2WWKO 4AG4L 4XGZB 4MQ7A 1QFWM 4LLMA 3SGEI 2QADC 3VWKB 5T1LB 5JQ6H 2GY7B 3L3JA 2WIIB 1QFWL 3T0EC 5C0NC 3LMJH 4XMKL 5EC1A 3MREA 5ITFB 5HGAA 1M7XA 3OAUH 3T3ME 1JPSL 3FFDB 3IFLL 4JHWL 1FORH 1RPQA 3IVKA 5C6PB 2AV1A 1YJDC 1KJ2L 1BD2D 4YBQC 4OGXL 4OFPA 5JDJA 4EQ2A 3ALPA 1PKQA 3WUZA 4HUUB 3BZ4B 1A0QH 3BP5B 3PHQA 3O8XA 4HWZB 4MVBC 1EHAA 1PKQE 1TMCB 5F70A 1XFPA 3LKPB 4UT6H 4NHCL 1K4DA 5ID1B 4ORGB 3RUGF 3ARGD 3MOBH 3OV6A 4U6TA 4JZJB 3KPLB 3CLEL 4J6RH 3KYKH 1IC4L 3GMNB 2FB4L 3KJ6L 3QUMH 4OD2B 2P8MB 3UEZA 4NNYA 4ODWB 2YA0A 3CUPB 3F7VB 4NNXB 4BH8A 3GMPB 4UAOB 1GZQB 3LS4L 5D7LA 5M94B 4JRYB 1J8HA 2MCPL 3OXRB 1GOHA 2J5LB 3NABL 5D7LE 4HCRA 4EVNB 1B0RA 5F21B 3PDGA 2E9JA 4YHIB 1MNUH 5I8OL 5I1DB 1UCBH 5C2UB 4XPFH 1PZ5B 4XCNB 2CDFA 1OGTB 2VSDA 3MXWH 3K80A 5FUZH 1D6VH 5SWSB 3CNKA 2NZIA 4CN6A 4MSWB 4V1DA 2ADGA 4LF3A 5IEHA 3SPVA 3QXTA 4D9QE 1EHLH 1S9YB 1ODAA 4LHUG 2X4OB 4I5BA 2DQCH 5DHVA 2EDHA 3PWUA 3O6KH 1R3JB 3MRMB 3U4AA 1X5AA 4GRWH 3R1GL 1P7HL 1V5JA 3S36X 4AK1A 1A1MA 1ORSA 2N7AA 2CKBA 1Q0YH 2OJEA 1UXWA 1QR1B 3PL6D 3ZSTA 1M1SA 3WFCL 1HQ4A 4FG6D 5EORH 5TH2B 3ELAT 3E8UL 3MXVH 3E6FB 3SE4C 1E4WH 4XVTL 5C07B 1T03H 2EEAA 5DD0L 1NFDB 1YEEL 1AKJD 1I3GH 4NKMA 5IFAH 3ROOB 1T20B 2NY5C 1WBYB 4NZJA 5F1NB 5MI0C 3IU4H 3CU1A 3LD8B 4FFZH 4XI5C 1UZ8B 5IBUG 4AENB 2ZUYA 1U8NB 3O0RL 5TE4L 3LEVH 4L5FH 4UV7L 3QDGA 5DWUL 1Z5LB 4F7MB 2ZKHH 3B9KA 1B6UA 1KPUA 1KPVA 3QDGE 1OAYL 3TBTA 4UB0H 3RAJL 5F96L 1A6ZA 2VN4A 5J11B 3LKRB 4KC3B 1L0XA 5E95B 1CDHA 3CXHK 4DVRL 1JPTL 4K3JL 3IRZA 4WO4A 4M5ZH 4U1KA 2NW3B 2DJUA 3EZJB 3FO1A 1DSFL 2HTKD 1AH1A 1MCBA 3MRRB 3UTSA 4K3DH 4EN3B 3O9WB 4O9HL 5F7EH 4X4MA 5GGRY 4EOWL 4KUCD 1HQRA 3UTSE 4PBXA 3BPNC 3GHBL 1LO5B 4DK6A 3MNWA 1KIPA 3VXMB 3TN0C 5DUMH 4Y19D 4P48A 3VWJC 5KS9A 1OF2B 1OHQA 2HJLB 2IMNA 1Q9LB 2XWJA 3JV6A 3SQOH 3UYRL 3HMWL 1JTTA 2A9NH 4PREB 5F72S 2B4CH 5KS9E 3T1FB 3PWVB 1FL3B 3RKPA 5KVFL 1NAML 3TEUA 3LB6D 4RRPG 1H5BB 1P7QD 3HN3A 5CIPA 1CK0L 3H0TA 2B2XH 3MLZH 1O0VA 2HKFH 2BCKA 3GSNA 3LVEA 2ICEA 2VL5B 5CMAB 1BD2B 1CXIA 5A2IH 2QSVA 5D6DA 3NGBC 1T5WB 4YE4L 3W2DH 4XNXL 4D0BB 2A6JA 4JN1H 5F7FA 1D6EA 1F3DH 1DQDH 4HZLB 4R4BA 5DEGA 2DQEL 3U4BH 2QV2A 3VFWB 4AEEA 3FONB 5EOQL 5F7YC 1PSKL 3TPUA 1A6WH 1DE4A 3BT2L 4DVBB 2YXMA 4NC1E 2OZ4L 5F7MC 1GC1H 3ARGB 4RAUB 1W2KT 3EGSB 4JG0L 1WITA 2CR6A 5JR1H 4L8SB 2W9LA 2FCBA 4N8PA 3EYSH 3L3KA 4JFYA 5JO5B 3ZDYF 1GAFH 1VHPA 3EYUL 5JOPD 3EIFA 4X6CB 3Q3GA 4GSDH 5D7SH 5FA4B 3ZSSA 4LSQL 2BY1A 5CS7A 3S5LA 3JUYA 4ZNEA 3T8XB 4Q9RH 5CBAB 2MJWA 5SWQA 3G9AB 2OK0L 1OWWA 1FGVH 4H8WL 2CXGA 4GFTB 4ZNEE 5A2JH 4PIRF 3REWA 2FO4A 3VRIA 5CJ5A 1VACB 2P5WA 4M1DH 2ITDB 1L7IL 4RMUA 4FQJL 4GRLC 3QIWD 4L8CA 5M95B 2P5WE 4GLRH 2KBGA 1G7IA 4KDVA 1JHTA 5KTEL 2G2RB 2HT2C 4LIQE 3WS3B 3D25A 2WV3A 2L7UA 4G9FD 4RRPA 2R2HA 1U8HA 4HCRH 3VFNA 3MUY1 1FCGA 3OG4B 5E1AB 3GJEA 4LGPB 1G1YA 1QFUH 1RK0B 4Y4KA 2RR3A 3P9LA 4HQQH 1K4CA 5TGBB 2W92A 3TFKC 3HC3H 1A7QL 2BOCA 3B2VH 5FOBB 1T4KB 5ID0A 4OGAC 4KGLA 2QEJA 1FLRL 4KRPC 3QQ9C 5FGBA 5B39G 3PL6B 1U8KB 3UDWC 5BVJB 3OKNA 5DJYA 3RWIB 4X0KB 4HIEA 3CX5J 1UZ6E 1OSPL 1L0QA 2YUWA 5DHVH 1AKJB 3MV7B 1AXTL 3TIEA 2R0WH 4AM0B 3QJHA 2R56H 5DK0A 1BJ1J 4HWNA 4Q9BA 3NIGE 1ZS8A 4I13B 4ELMF 2CKBH 3U0PB 5J56B 5D2LA 4YX2L 4MWFB 5GISH 5CZVL 1UJTA 1T1ZB 3IXAB 1N3NB 4QHNB 5TE7H 1X44A 4G6AC 5D2LE 2WBJD 4M7KH 4Z0BH 2R2EA 3AM8C 3MRFB 1FAIL 2DQJL 1EAPA 1UB5A 3MRNA 4OIBA 2XT1B 2ZSWA 4HT1L 4WJ5B 5JHDA 4KTDL 1FVDA 5CSZA 2H9GB 1ETZB 1KOAA 4AEIL 3P0YH 3MRHA 5GGRB 3RY5A 1KB5B 4WI8A 4PJAA 5JHDE 5ALCH 4UIKH 3GBNL 4TOYL 5HTSA 5JORA 1H3XA 5EU3B 3FRPG 4HIXL 3QIUD 4NO5B 2X4QB 3NMEA 1ADQL 3RKDD 3KWWA 4QRTA 4PGJA 2PYFA 2QR0A 4JFOA 3BJLA 4Y19B 1RMFL 3RX5A 1U91B 2XICA 1J5OH 3LRSA 4N8CH 1FLTX 4OM0H 3RGVD 1EUUA 5HDLA 3WCYA 2VNCA 1R0AH 6FABL 5HHMD 1P7QB 1ZT4B 4MJ6B 5AZ2L 1U2HA 5B39A 4NUGL 1IC7H 2A74A 3GSQA 4N1EA 1TTFA 2DRUA 4BA8A 7CGTA 4KJWD 1P1ZB 2VRAA 4ISVA 4KVCL 5KOMC 5IT2L 4GG8A 5AYUH 4G8GD 3P30H 2V7NB 3QNXA 5I71C 3V5DB 2Y5EA 1A9BB 4YQXH 4JZOA 2R0KL 2AKRA 5EO0A 3U6RB 1SHMA 2B1HH 4X5XA 3G5XA 3BD5A 5CWSA 4TQEL 2R2BB 3G5YA 3MBXL 4G3YH 2ED7A 3NACH 4R97C 2EDQA 2VUOA 4NZRH 5IB3B 3VG9B 1OOAA 2B0SL 2EYTA 4CJ0A 5T1DL 2UWEF 3TC9A 2BY2A 3SN6N 2UZXB 5F1IB 3TVMD 1E27A 4QXGL 3K7UA 3BOVA 4ODUA 4KK9D 4I18A 2ZJSH 4ACPA 5LXGL 4M8QB 1QVOB 5DUPL 1CICC 4QF1B 4CRPA 3MYJB 4R8WL 4KI5E 5FK9B 4F8TA 3UAJD 5FM5M 1DVFC 4OV5A 1KTKE 5A3IC 1JF5A 3PGCA 5GS2D 2ZNWA 1RFDH 4U6YA 4YO0A 3FRPA 3F62A 3S36H 4YHYC 1CDYA 1JGEB 4OF3A 2ZOKA 3NA9L 3MLXH 4W4OA 1AD9A 4MNHB 4D94A 3P73B 4KRNA 3QIWB 1F4XH 5IJVB 4POZD 5TFSH 5I66B 1AR2A 2D0GA 5IV2B 2PW2A 4Z7VB 2WINB 2F8XC 3BH9A 4XNMB 5HHQB 1IL1B 3CZJA 1FPTL 4PR5A 4RGND 4G9FB 4S2SB 2FDBP 1JN6B 2VZ3A 5DVNA 1TETL 4HWEL 1IGMH 3ROLB 4U4BA 1KEGL 2R1WA 5ANMB 1QFWI 4KVNL 4XPGH 3CH8A 4Q97A 4LIQH 4QRUA 4H88L 4U33A 1CFVH 1KELH 3S96B 4WV1C 5DF0A 5IMOB 4NJ9L 5E8NB 1QYGH 3Q1SH 1MWAB 5I1EH 1IEBB 4J3TA 3LEYH 4R9HA 1ZLSL 5ICXB 4JGMA 1LE9A 1Q38A 4HPYH 4ZUTB 5MEPB 2XKNA 5MEND 5DGRA 3DV6A 3VGAB 2E7CA 1D5ZA 1KCLA 1QLEH 3QRFM 4U7SA 1T22A 3PV6B 2JF1A 5E4EC 3DTXB 3LRHA 1YNKL 3SKNA 4AYFA 1IMHC 1X5XA 4Z76A 1JFQH 1NC2A 1J7VR 2XFXA 2VDLH 5FKAB 7FABL 1MSPA 1UEYA 1CG9B 4XHJC 3W9DA 3S35L 2HN7B 3LQAL 1DBML 4FXGB 3DMMD 4UOW1 2QHRL 3O41A 5D6CB 1X3DA 1GGIL 4P23C 1WSST 3RWCB 2BRRH 4PB9L 5IR1B 1NGWA 4U6VL 1NSNH 1JYNA 1NGPL 2XZCL 3C6LC 1KJ2B 3QWOB 4I0CC 2ZSVA 1EBAA 2PKDA 3GGWB 2Q7NA 3L6FA 1AY1H 4Z7UA 3QIUB 2W91A 2C1PA 5IKCA 4PGEB 1B0WA 5DLMH 2W65B 1TVBA 4Z7UE 1I7ZB 4OF0A 5L0QB 5INDB 1OARH 2KUTA 4M7ZB 3RPIB 2GITA 3G6DL 3KPRA 2PR4L 1F4WL 2LFGA 2HWZL 4NSKA 1WBZA 5TE6L 3RGVB 3KPRE 4HJJL 3JWDH 1FNSH 4QY8A 4O02H 5HHMB 4YC2C 1DZBA 1X5LA 3CSBA 1HILB 2UUDH 5INCB 4WFFD 5LKNA 1AD0A 4Z5RB 4JJ5A 4AT6B 2X4TA 3EJJX 2OL3A 3RPKA 4QEGA 4X7DC 3OAYK 4OLZL 2AXFB 4G8GB 5IB5A 2XG5A 5BCAA 2A6IA 3BW9B 2VXVL 1QOKA 3EJZC 3I6KA 4H1LG 2M1KA 3ZL4H 3WFEL 1S5HA 1TQCC 4TVPD 2BOBA 1YQVL 4Y16D 5EA0H 3LSOA 4QHLB 4XBEH 3R8QA 2P45B 3TIDB 1HDMB 1WWWX 3D3VE 2V7HA 4N0YL 4NPYB 4ZPVB 2NLJB 3D69B 3T3PF 1AC0A 1MFEH 3TVMB 1G7QB 1YEGL 1CU4H 4HX1A 5CJXA 1UKQA 3RNKB 3SDAD 2EC9T 2GIYA 3NCBB 3UX9B 3BP7B 1CDCA 4XNZC 4OZIB 5CZXD 4WFGD 1NUDA 1ZA3A 5JHLH 1UJ3A 2PO6D 5IQ7L 3HUJB 4QRPA 5DRZB 3ZYZA 1TQBB 3RWEB 2AJZA 4Y2DC 5DYOA 3TNMB 2Q3ZA 1NAKL 5ICZB 3RA7L 1WK0A 1YPZA 4UBDD 2UYLB 4RGOH 4NT6B 3BSZL 5DD1L 4IOFD 1YPZE 4X6DA 3VGHA 4RDQF 2AABH 1FE8L 4OCNC 5KW9H 1S7QB 1F90L 1OAQH 1KXVC 4X6DE 3RTQC 1A7BA 1OSZB 1EFQA 4Z78B 1BFVL 3D5OF 4BUGA 2VQ1B 1LDPH 3PIQA 4LPYA 1MCOL 1BOGB 1UKTA 4RGNB 5C08A 5JZ7C 2YOCA 3KPPB 3ARYA 5ESQB 5F88B 4BQ9A 1AXSB 3AREC 3FT2B 2YRLA 1EO7A 1U8OA 4WY7H 1GPOH 5C0IA 1S7UB 4KKBD 1V3MA 2APFA 1KGCD 1CDUA 5DMJB 5EU4A 2OJZH 3MRDA 1V7ML 2GSIB 1J0HA 2X5PA 2A73A 1KIQA 3CPLB 2AXGB 4GG6F 1YA5A 2NYYC 5I75C 1HHJA 2DM2A 5MENB 3P11H 1QRND 3VXSA 3MNVB 1JGLL 5C2BL 3WXWH 5ILTL 5D1ZC 3ULUD 3OJVC 1ND0B 5FXCH 3NFNB 4HJ0C 3WBDA 3VXSE 3CFBB 4X98B 4LVHB 4LCCA 4RIRB 3I85A 5DUBA 4G80A 4OD3H 3DNKA 4ZUVB 4NQED 2BC4B 1G7LB 2X40A 1RU9H 3B3IA 5F9OH 3DMMB 4PJDA 1T5XA 1YEIL 3ECBB 5DD3H 4X8JA 1YEDB 1NAMB 5DMIH 3QQNA 4PJDE 4L3ED 3TO4D 2X89D 3AS2A 3T65B 3LKOB 3MLWH 1ZA6B 4PV9B 2Z9TA 3C60C 1ZTXL 1BOYA 1BQHG 1JNLH 1X5YA 1LEIA 1OTUC 1AGCA 4JM2A 4MZ3A 1S9KC 4MDIA 4DKAA 5JNYA 2BDNH 5D93C 4CBPA 1VFMA 2R4SH 1A9EA 2J8UB 3A6CH 3CVHL 5FOJA 1EMTH 4JY5H 1XAUA 1MFNA 3D18B 2AJVH 2IPTL 2ZCLH 4XP5L 3F58L 1Z3GH 3SE9L 4UU9B 3U7YH 5FYJL 4H20H 5BJTA 3U30B 4M9PA 2BJMH 1A3RH 2IJ0C 3FHAA 2D9CA 2BFVL 5EBMB 4AEHL 2C7UA 1IAKB 4Q9QL 4C56D 2AJUH 1RIHL 4IS6A 3UXFA 2QLVB 2VAAA 1XR8B 2AVGA 1FFQA 1RUKL 2VLRD 2VDOH 1E4XH 1I9JL 4PY8J 3U9UA 3K74B 1CR9H 3DI3B 1CVRA 2VXQL 4NKOB 3KPQB 4OCXH 3GKWL 5KSAC 2PXYD 1HNGA 2YC1A 1FCCA 1MAMH 4K3EH 4UTBL 4ZUUB 5BRZD 3SGJC 3V8CA 1T21B 1C7SA 2VITA 1WF5A 5K9OA 2E27L 3ULVC 1DFBH 4Y16B 1RULH 2IANA 2JELH 3CJJA 1RZJH 2OL3H 1U58B 3GSOB 4YBHA 1A7PL 1NDGB 3QUYC 4CMHB 3BAEH 4PTTA 4PLOB 4MGXA 2IANE 5I1JL 2CK0H 3VFTA 3DPBA 4HMDA 2VDRH 1L7TL 2V17L 1FGNL 3SDAB 1WBXA 1TVHB 2B1AH 4DW2H 1EEYA 1FVEB 3GEWB 2OS7A 3ARUA 4S0TD 4HH9A 3GFUA 4XP6H 1FZKB 5D7JD 5HHOE 2PO6B 3CSGA 1MFDL 4LLYB 4OFKA 1BQHA 4R0LA 3QA3A 3HZVA 3GSRA 1FRGL 4G9DB 1WZLA 3PP3H 4U3CA 4FQIH 2WLZA 1CI5A 4GKNB 1T2QH 2IGFH 4FFVD 3SDCD 2OSLB 3QCUL 5KJRH 1KLFA 5KAQG 1XEDA 1ZHLA 3MCKB 3NIFF 3C9NA 1P5VA 1JIBA 5FUOL 4NNPL 2D7PA 5DDHB 3L3HB 1RZGB 5MERA 1SY6A 4Y2OA 1I9IH 4PY7B 2QADD 1FQ9C 4M6NL 4TRPL 2ESVA 3T0ED 5JW5B 4OF5A 4JVWA 1RHFA 4OSUH 4WVRA 3SY0A 4E5XB 4X80L 3UTTA 2QQQA 1G7HA 2ESVE 3Q48A 4URTB 4ZSOA 3KPTA 1NH6A 4WNQA 2KH2B 3ORJA 4JAMA 3UTTE 2D7OA 1X7QA 3I6GB 3QO1B 4YBQD 4ZSOE 32C2B 2H32A 1G84A 3DARA 4NP4L 1QRNB 4FQ1H 3DVNB 3QEUB 4XBGB 1H9VA 2R1XB 4GAGH 1TCRB 3QDHA 1IGIL 4LLWB 4XC1L 5F3HB 4MVBD 4KV5F 4LRIC 3H3PH 3FN3A 4LQFH 2AJ3B 4Z8FL 1INDL 5DT1H 3FQXA 1T0PB 2R29L 1IM9D 3ILQD 4UQ2B 4XPTL 4MJ5B 4NQEB 4QKXB 5TF1L 2Z31C 4I0PC 4OZHA 1LE5A 3VH8G 3IDGB 1EPFA 4M61B 2MWCA 2ADIA 2RGSA 4FQ2L 4HUXA 5I30H 4CU8A 3SO3C 3QFJD 5JDSA 1KUMA 4XVUC 2B4CC 4L3EB 3TO4B 5I1KL 3FB8A 1AGEA 1KCUH 3NZHL 2Q8BL 3FQNA 4IIQC 5CJOH 1U8IB 3KPNB 3FMGL 2F5BH 3BKCL 2WUCL 3HNSL 3VD3A 3FQRB 3CFJA 2BNRD 3KYOA 4PJGF 2X4UA 4PJ5A 3I9GL 4M8VA 4X7SL 4NWTL 2DLEA 2EH8L 1BFOB 4WDIB 3TT3L 5HGBA 5GJTH 1M7DA 1YMMD 4GH7B 2BHZA 4PJ5E 3QG7L 1I8KB 2QQKH 1MCDA 3BN9D 4APQC 1X5ZA 4W70A 2XY1A 3FT3A 3AVEA 2BVYA 4JREB 4U6HA 2DJ4A 5J57B 2DQIL 1MLBB 4OI9A 2QKIB 3T77B 1I3RA 2HLAA 3QAZC 5DA0B 3QCVH 4OT1L 1AO7D 3PWNB 5TPWH 3EO9H 3IFOB 3I2CL 3WUWG 2GJZB 3BUYB 4C56B 3HKFA 1N26A 4HHAB 2OTPA 4ZFOA 2YRPA 1RHHA 1AR1C 3H9SA 2MPAL 2VLRB 1S7TA 3HNVL 3MJGX 1K8IB 5EC2B 3O8XC 1BP3B 4CVXB 1WZKA 2EDJA 3H9SE 4LPXA 2PXYB 3OXSB 3RL2A 4ETQA 2E7MA 5IUSA 4QTIL 1CFBA 4OCRL 1JMZA 4H0GA 5GSRB 5BRZB 4AQ1B 1ZEAL 1F4YH 1UM6H 4JPWH 4N5UA 4O4YH 4ZYKB 1CD8A 4MA3A 3VI4F 4NFCA 1UXSA 5E8EA 3F7RA 4JO2H 4GW1B 5DK2A 3NVQA 4MNGB 3SE3C 5L8LB 2A0LC 1IBGH 5B22A 4EBQL 5FCSH 4WW2A 3DOSA 4N68A 3VRJB 1NKOA 3GUTA 3MQIA 1NCAH 1LO4L 2C3GA 3U82B 2BZDA 2YD1A 3LKSA 4S11A 1UVQB 3VFOB 3T2NH 3MJ7B 2WUBH 2JJTA 1SM3L 5E2UH 2CRIA 5D7JB 3BO8B 4Y4FA 5DR5L 1FAKT 5IHUH 1G9ML 2G75B 4XT1C 4OCYH 5IQ9B 1T3FB 3U2SA 4ZG1A 2CLVA 2R0LH 3BKML 2Y6SC 3TBVA 3MGTA 3MX0A 3SDCB 2CGRH 1J0YA 1JHLL 5T5NF 2ZUTA 4KGJA 1OQXA 4HD9A 1DUZB 1UFUA 2HVJB 3PWPB 2R0ZH 4C58B 1A1OB 2Q20A 4L4VA 4OF6A 3TN0D 3FFCE 2PYED 3VWJD 3WUWA 5FYLL 3WFHA 3UP1A 3WEXA 4K55A 1ZGLP 4L4VE 2QADB 3UZQA 2ARJQ 3BH8B 1NUFA 4PRAA 3IDMB 4WI5A 3JV5A 3T0EB 3FN0L 4DGYH 1T7ZA 3H7BA 3I75B 3T09A 3KR3L 2NY6C 4JFHD 1CLOH 4L1HA 4JKPL 4XCCH 1JZ8A 2CPCA 2MMXA 1NJ9B 4PRID 4PRNA 4PLNC 4OFDA 4PRBA 4JHBA 2APVA 1TZGH 1C7TA 1SY6H 1ED3A 3RVVC 4TNVF 1IRAY 2C3VB 4H0HB 3AFLA 4OJFH 3B9DA 1AIFB 4YHKH 1GGCH 1G6RA 3B9KC 2EECA 5CFHA 5ADOH 5IF0B 5F3BB 3CVIH 1X5GA 3ARSA 1FIGH 2WAHA 3B8YA 2VXTL 4NUJA 1CD9B 1VFAA 5FYJD 5DJ2B 4HFWB 1IM9B 1S7VB 1INQB 4NDMA 2MFNA 1BFSA 4EUPG 1N4XH 4JO3L 4AL8L 1U8JA 2G60L 4WO4C 4H25B 2H32H 4N90E 4YIQA 5EFIA 2COQA 5AD0B 4YGVA 4NQCD 4KROC 3QFJB 4TUJA 4Z6AT 2IADA 3MRGB 8CGTA 3EOBA 1X4XA 2IH1A 2XA3A 3L3OA 2EE6A 4PGCB 4LCUB 2DKUA 1VFOA 5JIHA 3O4OC 4F80A 2BNRB 1QLRB 3RIAK 3VFGH 4MS8D 3TNNA 5ACZB 5L7XL 5FIEA 4GRLD 1YMMB 1KB9K 2E3VA 5FGCE 1MPAL 4AEFA 5BMFH 5T33L 4XHQA 2HT2D 3F7QA 2Z4QB 2P8PA 2NY1D 3W11C 1XF5B 1LEKA 1N2RA 1MRFL 2O5ZH 3IXTB 2W0FA 1AO7B 1BM3L 5DHXB 4K3GA 4HZAA 4KQ4H 4U1GB 2VDNH 3D1MC 1YN7B 4LSTH 1V3KA 2P4AB 5GQBA 2DL2A 3TFKD 4XPHL 3NCJL 5DJ8A 2VE6B 1D5BA 2XNAA 4OGAD 1C5CH 1Q1JL 4KRPD 3IDIA 3KLAB 3QQ9D 4NC1C 4MCZA 1NC4D 2VDMH 1GHFH 3RUGA 2XYCA 2YD6A 3BE1H 3OHXA 1FZJA 4LOUC 5I8EB 2XZQH 1D9KA 2K9UA 2FX8H 3PUCA 3HCVA 3RUGE 4C59B 1R24A 2HFGH 5MI0B 1SJEA 1LK2B 3BPCB 4EUPA 5J3HD 3GSUA 4ONGL 4JJHA 2CR3A 1MI5A 3JSSA 2GJ6A 4W68A 5IK3B 4BFIA 3HE6A 35C8L 3JUZA 2QBWA 4Y4HD 2VAJA 2B8OT 3CD4A 4OFIA 1MI5E 2GJ6E 5L9DH 1DANU 1VPOH 5DQJA 1ES0B 2KZWA 3NFPB 3S3PA 3SE8L 4YAQA 3MC0A 5E2VL 4XNUH 3ZE0F 1CLZL 3MV11 3IU3A 4FQPA 4MXQD 4OZGB 4LLAA 3HAEG 4WTWA 3WE6B 2YK1L 2Y25A 8FABA 4PRPD 2WBKA 5EWIL 5I1GL 3VJ6A 3MRLA 4XBPA 4KUZL 3FB6B 3STBA 3AY4A 4D9RD 2OXHA 3H42L 3OPZH 3KJ4C 5H2BA 2EKSA 1BQLL 4LASH 2HFTA 2FWOB 4LEXH 1H3WM 4YDIH 3MLPA 4F7TA 3BRDA 3BWAA 3HPJA 1G9NH 4LPTA 4DGVH 5GRUH 4Q7DA 5I15H 1OAZL 1XH3A 3ULVF 1A8JH 4GQPH 3IGAB 2IG2H 3NA4A 4Y4KC 3PGFH 3TN0B 2PYEB 4PV8B 3VWJB 1JGDB 2BVOA 4ZFGL 3O2WL 2VLJB 3QNZA 3L5XL 4M5YH 1A6TA 5I1HL 1QD0A 5LCVH 5FGBC 3L1OL 3P4MB 4I9WD 1JYXA 3GO1L 3O3BA 4NJAH 4NYLB 4X7TB 3LMJL 4JR9L 4LEOB 4TPRH 4PRIB 3QI9B 4GMSL 2R4RH 4OUUB 3RY4A 2D31A 1U2CA 1BX2A 1QA9B 4IOIA 5IB1B 2CJUH 3DIFA 2CRYA 3V0WH 5KVGL 1G9EA 3I3BA 2VH5H 3CFEA 3WMSA 4ELKB 3U46B 1NANH 3CVHB 1FV1A 1M6OB 2V2XB 3QXDB 2FHBA 1QPXA 3V4PH 2C4FU 3AROA 1FNEB 4UDUA 1WT5A 5HYSB 5KSVB 4JRXA 4F7CB 1IKFH 4OLWH 4RISH 4PJIF 3LOWA 4UT6L 4Z7QF 1FZMA 1W0VB 5FECB 4LARL 4JRXE 5F8QC 3MUJA 4LSUL 1W72A 3BZFA 4KK6D 4NQCB 4JN2A 2FJFA 3AS0A 1U3HC 4J6RL 4WCYH 5CBEB 3PGDB 1CICD 1S9WA 3FOMB 1G6RH 3QUML 3K0WA 3GM8A 5SX5K 4LKCA 3QQ4B 5FA3B 3EFDL 2ZUUA 1DVFD 2HG5A 5A3ID 3P9WB 1NGQH 1FG2A 4BFBD 3LY6A 3O3AA 1DQQB 1F2XK 2OTWB 3HZKA 2ZUQB 1I1RA 4GRLB 5E8PB 3MRIA 3MJ9A 1MNUL 1UCBL 2PNDA 4XPFL 2I9LB 3F12A 5ECJE 2VABA 2UY7A 4M93B 5HDBE 4ZFZA 3MXWL 4HWBA 4AQOA 2VJXA 3TA3A 3DUUA 4WHTB 3LN4B 5IFJB 2NY1B 4MNQA 3SO5A 4KHTL 3ZKQD 3SGKA 3U7WL 3D0VB 1CIUA 1AJ7H 4PLKC 4MNQE 4LSVL 5F1OB 2GCYB 4WEMB 3V2AR 1EHLL 5JPNB 4G6ML 4X6BB 1QQDB 2NY0D 2DQCL 4HC1A 3B2UD 3O6KL 1HHKB 2APWA 1ZV5A 4PJCB 1AFVH 5HGHB 2P7TA 5CKGA 5EOCH 3G5VA 1CGTA 4Z7WB 4L8BA 1F2QA 1TXKA 1NC4B 1EXUA 4LPVA 4CKVX 4OF7A 1Q0YL 1U92A 5MEOB 1QBMH 4ZNCD 1I4FB 5EORL 2LABA 1F8TL 4XCYB 4FXKB 5H35A 5EZIH 2HKHL 2J2ZA 5CD5C 3MBEA 2RAMA 4I18C 4KI5C 3I6LD 5IFAL 1BPVA 3SEPA 4Z77A 4BSVB 1KFAH 1TLKA 1YYLL 3ZDYE 1ZK9A 2YZ8A 5FYLD 4XHJD 1S8DA 1RZ7H 2BX5A 3KPSD 2VISA 4Y4HB 1KG0A 5GPRA 4JDTL 2W0KA 3L95A 1HHIA 3LEVL 5I0DA 2ZKHL 3HC0A 4TUKH 3QO0A 1AGFB 2IPKB 3EO1B 3O2DH 1NLDH 4JFDD 5CP7B 4W4OC 5GS0H 4N8VG 4UB0L 4EUPH 2ICWI 1FFRA 2Z92B 4PRPB 3C6LD 3L3IA 1FDLH 2XN9D 3VXUA 1ZHKB 3MSPA 5GGVH 1IVLA 4J4PA 1T2XA 2K7QA 4LCWD 4JFQA 1ZLWK 4JKWA 1JNNL 4HUWB 3UROR 3VXUE 5HHXH 4RX4A 2NY7H 3RZCA 4XCFL 1A6AB 5DD6A 2V9QA 5F7EL 3OKDA 1QTYT 3OAZK 4OKVA 1AP2B 1MHEA 2ADJB 1FVCB 5D70H 4Q0XH 4MX7B 1HH6B 3RX8A 4FMFA 4WU7A 4JDZB 3T0XA 4QOKB 5F97E 3UBXB 2YN3A 1VENA 2ZP0T 2XXCB 3RDTA 3BPLB 2BVPB 2A9NL 5CP3A 5JXAL 3WLBA 4NFBA 5D7IB 2X4PB 3QYCA 2ZOLB 3VXRA 3LV3A 1U9KA 2ICWB 3VE0B 4Q74A 2W59A 2AAVA 4UTAH 5T3XD 4NKIH 2HKFL 5CILH 3KPMA 5DA4A 4EI6A 2BVQA 4H26A 3EJZD 4ELMA 3AMKA 2DF3A 5IVXB 2UVEA 3A6BH 1C5BL 4U0QB 5T5FL 3W2DL 1A1NB 5ENWB 2RB8A 3FO2A 4LVNC 1DQDL 5J6HA 1XMWA 2DWEA 3O2VH 1U8PA 4R97B 3WO4B 3BRGC 1KC5H 3C6SB 3THML 2ATPA 3U4BL 5DHYA 5JXEA 3FO0L 3SGDI 1RUPH 4CW1A 2DQFB 3GHEH 1M71A 3DRQA 4XNQB 1JRHH 1GC1L 4JB9L 4N8VA 1FJ1A 4HKJA 1FL6A 3EYSL 4I1NB 2AJSH 3KPOB 4FZEH 4B0MM 5C7XL 1NPUA 1QUNA 4XVSH 5I2IB 5K59F 1DVFB 2BMKA 1A6UH 3IFPB 1P7KA 1K5NB 4IJ3B 2ZZUT 3SCMA 4AY0A 1NCDH 5IESH 2H41A 2NNAA 4YHYB 4MXWH 3BDYH 1FGVL 3CC5B 2Q8AH 2JKXA 1W72H 3ARPA 2PCPA 2FEDC 5GRVK 3OJDB 1UB6B 4OFYD 4LSRH 5F7LB 3TT1H 4HBCH 2R8SH 3INUL 3OX8A 4QCIB 4WWKD 2RBLA 3RTQD 3BJ91 4PJHF 3S7GA 2GSGB 1RI8A 2DQHL 3X11B 1RZJC 2EO9A 3P77B 5ADPL 3BZ4A 3BP5A 3ARED 3RWDB 4HWZA 3DETD 1AHWA 3IB4A 4X4XB 3UTZB 3T0AA 3MA7B 2NY0B 4FQQB 3U48A 4L29A 3MJ9H 2D2OA 4ORGA 1R5IB 1OAXH 4GS7C 5C0AD 1QFUL 3NH7H 4WV1B 1Y18A 2X6MA 1YN6A 4HQQL 1JPFB 1KNOB 3CMOH 2DM7A 4HWBH 3GMOB 3KPLA 3HE7C 2GTZB 2NYYD 4KQ3H 3KDMB 1MHCB 3GMNA 3RWJB 1KT2A 4YR6B 5JLZA 3VXNA 1T66D 2UWEA 3E6HB 3DX7B 3CSYA 5D1ZD 2IH3B 5SWZD 2RFXB 2FL5A 2V2WA 5CUSH 2UWEE 4HC1H 1IZJA 3BEWB 4HXAL 2KZ1B 1UM4H 5MHSE 4R96A 2R0WL 1XR9B 2R56L 3W0WD 3E3QE 1FO0A 5IP4A 2R15A 4RQQA 1UJ3C 1FSKC 3ILPB 4LLVB 3FHQA 2EKJA 4TVSa 4FZ8H 2FJGB 3KPSB 4LSPH 2CKBL 2FIKB 3O3EB 2HAZA 5JPMA 4ODHH 4CMMB 1Q0XH 1Y0LB 4O5LL 3D39D 3ZKNC 5KSBB 3QFDA 5GISL 3RX7A 5TE7L 3L5IA 4JFDB 2BSRB 4M7KL 1DBKL 4Z0BL 1J8KA 3AAZA 1N5YL 3C60D 5C8JB 1S9YA 3C6LB 3MLVH 1F3RB 2XN9B 4F7EB 5K9JH 5JA8B 3T4YA 4F57H 3ALXA 4LCWB 1R3JA 5C0CD 3DROB 5IG7B 1MCCA 4JG1H 2JB6B 2NY2C 1U3JA 3WYRA 3HZYA 5EZJB 4UIKL 4M7JH 5C6TH 4HS3A 4IRSA 3DWTA 3M17B 1XCQA 3S98A 2DM3A 3H8NA 2QQNH 5TH2A 5KG9B 5GRYA 3OKMA 5E03A 5IW1A 3CFDB 2X09A 2AV7B 5D96C 3B9VA 4E41D 3IJSB 5E00A 4YC2B 1Q9WA 4O2FA 4TTDC 4OM0L 1FFOA 1KLUB 2JIXD 2VSCA 1R0AL 2FX7L 3MUHL 5FB8B 1KENL 4KHXH 1U8NA 4ZAKA 4HIJA 2LAGB 5BXFB 4LCCC 1Z5LA 4PGBB 2E5EA 3IDXH 3EDJA 3RVTC 3HLAA 5E2WH 2DDQH 4PS4H 2DOCA 5AYUL 4L4TA 3TCLA 3P30L 1OWRM 2GAZA 1TQCB 4WUKL 3HB3D 3LKRA 4U1MB 4ZUSB 5CP3H 3UC0H 1Q94B 1DQLH 4OLYH 2X1WL 2B1HL 1H3VA 2NW3A 2DLIA 3OKLB 3JWOL 4G8IB 2BRQA 3MRPB 2JJVA 3P0VL 4NZRL 4EN3A 5CAYB 1VFBA 1ZT7A 3RWGB 4Y5YA 1FNFA 5EBLB 4C55A 5ACMA 1MVUB 4WFED 4B50A 1LO5A 3MTRA 4R6UA 1KCRH 4O2EB 4JM2C 4XP9L 3ZYIA 1PZUB 2AXHA 3A0OA 4ZXBA 2NW2A 2DI9A 3WDIA 4DTGL 5ELIA 4QRQA 5C70A 4WUUD 4PREA 2XWBB 2IQAB 4YXLL 3B9AA 1UWXK 3HI1B 1JF1B 4I3RL 1FH5H 4X5WB 1PD6A 1IC1A 4HIHB 3S36L 1BJ8A 1CCZA 3MLXL 3HG1B 1F3JA 4PJXB 4WWKB 1Q9OB 2QSQA 3OB0H 2EDDA 1F4XL 2AEQH 5TFSL 3RTQB 2F54A 5TDNA 1K2DA 1LP9B 2G5BA 3O45B 3S4SB 4M9OA 4DN3H 5HYQA 1T5WA 2JJWA 1EFXA 1BLNB 2F54E 3IDNA 4NM8H 4P9ML 4Z7OF 3AREB 4YPGA 3U7AA 5DQ9B 3VFWA 4LLQA 4BZ1H 1XF3B 4N5EC 4RMQA 5ICYA 1ZWIB 1LK3H 3GB7A 5C0AB 3GIZH 1IAIH 1A22B 4I0KA 3EDKA 2CIKB 2O5XL 3GMQA 2P24A 1UENA 1CFVL 1KELL 4N9OB 3OF6A 5C9KA 3H2WA 5BZWA 3M8OL 3BGFB 1QYGL 5I1EL 3ZZ1A 2VLME 3QCTL 5F1SA 1OP9A 2Z0BA 4M1CC 5ERWB 5FO8B 1BJMA 3PQYA 3K2UH 5D1ZB 2Y7QA 4YK4C 3T3PE 1QLEL 1CS6A 4OQTA 1REIA 2AJYH 3PQYE 4MDJA 3VGEA 5CBAA 1R3IH 1ZLVK 4P57A 4MD5B 5IGXH 5MEQB 5ESAB 1XGRA 1YNTB 4M3JA 4Y1AA 3W0WB 1DCLA 1QKZH 4F33A 1IGJA 3SGEH 2Z31D 4I0PD 4R0LC 1VACA 1C16B 1TENA 4YHMH 4OI7A 3P40A 1Z2KA 4EDXA 1ZE3C 3D39B 1SJVA 1T7WA 4XVUD 2W0LA 5GXBB 4EDWL 1HWHB 1T0NA 4MD4B 4NRYA 3BMWA 3QWRA 3OSKA 1XGYL 12E8H 3RJDA 4NQTA 3LZFH 2DI8A 2BRRL 3C60B 4N0FB 2V5TA 1FO0H 1PG7H 5EUOB 4LLUA 3WD5H 1NSNL 2IBZY 3MLSH 5E1AA 4YNYA 5KN5B 5DVKA 5D2NA 1KCVL 3PDOA 4L9DA 5C0CB 4JKKA 3X14B 1G7MB 5D2NE 3QHZH 5IVOA 1YEHH 4JFXA 1AY1L 5J1AA 1RSFA 3B6SB 1P4LA 1AI1H 1U8KA 4I77H 3KAAA 4J7RA 5GGQH 2GT9B 2DKSA 5HDQH 5BVJA 1MOEA 5DLML 1S7WA 2X1OA 5CEZL 4MZ2A 5D7IF 1OARL 1KYOK 4B7LA 4MYWB 1GGBL 4GG6A 5CLTA 5I1CL 3MV7A 1OVZA 4ONHB 2ARJB 4GG6E 2JIXB 3JWDL 3X13A 3QUMB 3MV7E 4O02L 4WGWB 1NCBH 4G43B 1AGDA 5HDOA 3Q2CA 2AGJH 4HGWB 3GMLB 2F19L 5EZOL 1LO0H 5IMMB 1N8ZA 4L9LC 3KYAA 1T1ZA 3IXAA 3GSXB 4LKXB 1FNGB 5L6YH 3ARBB 1KLGB 4NHUB 3MLYH 1U8LB 3T0WA 3JVGA 5IMLB 5CLWA 3QPXH 4K2UL 2FSEB 1WEJH 5JOFA 4M62H 5F7UA 4PJ9D 4WJ5A 3CX5K 4KMTH 3MRKB 2H9GA 2F53D 2XA8H 2XXMB 1NMAL 1GZPB 3IDJB 4UINH 4HSQA 3A67H 1J8HD 3MFGB 1F97A 1DBAH 3CDGB 1MFEL 1EDQA 2X4QA 1BZ9B 1CU4L 1R3HB 1WIUA 3PDDA 4JPKL 5GSVA 5E99H 4M43H 4AJ0A 1CWVA 3FQUB 4F7PB 2FYYA 4KH2A 4P5MB 1JPGB 1Q72H 1F00I 2XKUA 4DCQA 4GRWB 1CBVH 3ISWA 2FJHA 2Y6SD 4WUUB 4D9QD 1T0MB 4HF5L 2EXYC 1JGVL 4K8RH 5I16A 4V1DD 1H15A 3RVUC 1OB1B 4XNYH 3WNOA 1ZT4A 4KDTA 1QPPA 3VXOA 4ZDHB 3ZE1F 1A14H 1P1ZA 3MCG1 4HDIB 1NBYA 1RIVH 3QXWA 4U49A 1KEML 3V5DA 3MRBB 1IGTB 4PJFF 1OAQL 1YMHB 3G6JB 4TULH 3AM8A 4MHHI 2MHAB 5FO7A 1D7FA 1PQZB 2I24N 1I9EA 1HYRC 3CGTA 1LDPL 1H8SA 5FHBH 2R2BA 1X5JA 1JZ5A 2VUYA 3QG6B 2Q7YB 1VA9A 4Q58C 4WEUD 1NCUA 1KXQE 4OCLC 2NY6D 1C1EL 1UEMA 1K6QL 5CEXA 3TWCL 2YUVA 3K4DA 3BIKB 3RVVD 5B8CA 2A6KA 2HT4C 4R7NA 1CTNA 5C0GB 2Y36L 3QDGD 3P11L 4WI3A 4ZS6C 3V0VB 1YC8A 2P8LB 4FQXA 2DLGA 3WXWL 5CSBA 3D85A 1MUJB 4MQTB 1HH9B 4JCMA 3LS5L 4OZ4B 1G9NC 1CN4A 3HZMA 5GGTL 2JJTC 1JWMB 2X9YA 2DLFL 3RVWC 3HC4H 2KKQA 5KSBF 4ZTPH 2C9AA 4N1CA 4XVJH 2Z31B 4I0PB 5AYQA 1JUFB 4GMTH 4MNHA 3P73A 3L9RB 3LDBC 1GCFA 2L4OA 4OLVH 4U3XA 5HGGS 1RU9L 3REVA 2GW5A 1B0GA 3UTSD 4DZ8A 5E8DL 1BJ1H 4Y5VB 4PJBF 3HR5B 5DD3L 3OWEA 5B38G 4OQTH 1JV5B 1MFBH 1IL1A 5DMIL 1CF8H 4IIQB 2IWGA 5FYKE 2X44D 3GI9L 3U0TB 3UJIH 4S2SA 4FFWC 2FECL 4NCDA 1KTLB 1JN6A 4HKZB 1QSVA 3FCTA 3MLWL 3FT4B 4XCEB 3ROLA 3WN5A 3NIFE 2VDPH 4F3FB 1JNLL 4NQUA 2F5AL 1QO3A 3QDJA 5ETUA 4LLMB 1NGZA 5IMOA 3ZKMD 4W6XB 2HRPH 4GUPB 1I85A 3L3JB 4FOMA 5E8NA 1IEBA 1H3UA 3A6CL 1XGUA 1EMTL 5AAMA 3QRGH 5EC1B 3BQUD 2F58H 3DGGA 4XXCA 3QAZB 5ALBH 4GLRI 4KK5C 4WFHE 3U7YL 5E2TH 4H20L 2BJML 3IVKB 3LH2H 4MA8H 2AV1B 3PHOB 2AW2A 3WSQL 3VFSA 5J12C 1KCSL 5EU5B 3ARDA 2D03H 1N0XH 4TSBL 4P2YA 2VZ1A 4U05A 2AJUL 1S7SB 1RUML 2IFGA 3S3JA 1P2CB 4YEFA 4J3WA 3PHQB 4HAFA 5DJZB 2EICA 2Y07L 4YDVA 4QXUH 2HFEA 5IJKA 3GRWH 4NKDA 5C0JA 2VDOL 1E4XL 2HN7A 3FB5A 4FXGA 4X6DF 2CUMA 1K4DB 3MLUL 4JFZL 1LD9B 1HSAA 5CJ8A 4KV5E 1A2YB 3O6ML 1NBZA 1N6QH 4LOUD 1B88A 4DAGH 1HXYA 4GQ9H 3WIFA 4K3EL 4HMEA 2HJFA 3RWCA 2CDGA 5IR1A 3D2UA 5CD3B 5DJCA 3R0NA 5KVEH 3UPRA 1MLCA 2CO6B 5TDOB 4PJ9B 4UDTA 1QLFA 4NNYB 4HUNB 3QWOA 2F53B 1RULL 4M03A 3NN8B 4BH8B 4EJ1C 3I50L 3CDCA 4NWUL 1J11A 3MODL 1BEYH 5T1MA 4G5ZH 3BAEL 1J8HB 2WK2A 5B38A 1A7NL 3X3FH 2CK0L 4M6OH 25C8L 2VOTA 4PGEA 4PJGA 2VDRL 1CDBA 1EH9A 4Q2ZB 4LHJB 1BBDH 2P5WD 1I7ZA 4G7VL 4DW2L 5INDA 5MP6H 3EYOA 4HV8A 2BXYA 4PJGE 5T3ZL 2CDFB 4XP6L 3RWFA 3PF2A 1BVKA 5I6XC 5HHVH 1S3KH 2DQUL 5T5NG 1I7UA 4HKXA 4YHZH 3WIHL 2X4NA 5L88L 4RGMC 2HVKA 1S78C 3L3DB 4V1DB 2ADGB 4LF3B 4ODTL 3WLWC 3SPVB 4FQIL 4M7LT 1T2QL 1EAJA 2DB8A 4Z5RA 2EDOA 5KJRL 4E0RA 4I5BB 5HHME 4YXHH 2IAMA 4OB5H 5DHVB 4U1HB 1G6VK 3PWUB 4Y4KD 4PRHA 2GK0A 3AGVA 4AIXA 1QSZA 1KB9J 4P23A 3BVNA 5GRJH 1A1MB 2HTLC 2C5DC 3FAXA 3CFCL 2CKBB 1RJLA 1QFOA 2OJEB 1UXWB 3O6LH 5JW4M 4QRSA 1HQ4B 4U31A 5CJQH 5HYIA 4OGYH 4W4NA 3DVGB 2NY6B 4NPYA 3WHE1 1MJJA 2NLJA 5TJWK 1D9KC 5HI5C 4OSUL 4NKMB 2R39A 3DUSA 2H1PL 3TVMA 4G8FB 5DSCA 1T7VA 5DD5H 5GS0C 3FQWA 3VI4E 3VG0H 1IGFH 4LBEB 1NCTA 3HE6C 3QDGB 1LNUA 3SDDD 4PYHA 3WKML 4FQ1L 3S88H 4PUBL 2D4DA 3RWEA 4P4KA 4BK4A 3TNMA 1KPUB 3GMMB 1NEUA 5DVMA 1KPVB 3CXDL 1T1WA 1YUHA 3IJHA 3TBTB 1A6ZB 5EN2A 1IKNC 3H3PL 4LQFL 4MMZC 43CAA 2UYLA 5HGDB 3X12A 1WAAF 3VFUB 5DT1L 1JWSB 2WP3T 2Q86B 4ERSH 4C54A 4U1KB 1R3LA 5JHDD 2NCMA 1DUYB 5DJDA 2C3HA 4JANA 3LN5A 4KPHL 1CL7L 2W9EH 4I2XA 3UTSB 3EYFB 3NPZB 2OR8A 1IM3A 4P59L 1HQRB 1YY9C 4I2XE 1ERNA 1KCUL 4CN4A 1BREA 5CJOL 1KIPB 2HLFC 3MCLH 5KS9B 4UT9H 3LEXA 3QSKB 2XWJB 3JV6B 5FYKH 1JYWA 1FYTA 3IF1B 5BZDB 4IRJA 4YFLI 2BHYA 1WQVT 1FYTE 3BQUB 3H0TB 2Y06L 3WNPA 3N9GH 5EU6A 3FTGA 5DMKA 2NXYC 2YSSA 4PB0H 2BCKB 3HMXL 4Y2DA 4DEPC 2C3XA 5JA9A 5EU6E 3EO9L 2QSCH 3G9VA 1MHHA 2A6JB 1NMCC 4MA1C 1E28A 4ZUVA 3VXTA 5DEGB 1MFCH 5IBUB 1DBBL 4S1QH 5A2LH 1MAKA 1WT5C 3BKJH 1UM5L 5FCUH 1ZAGA 1BGXH 1H8OA 1S5IH 3OQ3B 4GRMA 4HFUH 1NAMA 4NQXB 1AE6H 3LN9A 4WHDA 2FATH 3DSNA 4TSCL 1QG3A 1F4YL 3L3KB 1UM6L 4O4YL 1E0OB 4KI5D 5F6IC 1A6VH 3GBMH 5I8CA 4HK0A 1FN4B 3Q3GB 2BP3A 2XTJD 3AS3A 3S5LB 4XPAL 4RBPK 3QUZA 5SWQB 1QFWH 1A47A 3ARRA 4PG9A 5D1XA 3REWB 3BYTA 1NCAL 1K3ZA 1I8IA 4TNWK 3D18A 2FO4B 1WICA 3TH4T 1LEGB 3T2NL 1PDKA 3VFRA 2P5WB 3KLSA 4UU9A 3KXFA 1BZ7B 4YHNA 1MCFA 3VGFA 1X5HA 4KY1L 5IHUL 4OGXH 3KXFE 1G7IB 4YDLB 1IAKA 4J3XA 3KJ4B 3BI9X 2DBJA 4OCYL 3D25B 5J1TC 2QJDA 3TA3C 5DEFA 1HCFX 1G0YR 3ZKXB 1L6ZA 3SGKC