3S8EA

Phosphorylation regulates assembly of the caspase-6 substrate-binding groove
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
263
structure length
219
Chain Sequence
b'MFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACSVYTLPAGADFLMCYSVAETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVDQRRVDSAIGKKQVPCFASMLTKKLHFFPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-6
publication title Phosphorylation regulates assembly of the caspase-6 substrate-binding groove.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 72
structure length 219
sequence length 263
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.4.22.59: Caspase-6.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3s8eA00
3EDQA 4PS0A 3QNWA 1NMQA 4HQRA 4QULA 2FP3A 1RHKA 4HVAA 1QTNA 3BIJA 3KJNA 1QDUA 4N6NA 4FDLA 4QU8A 4EHDA 2HBYA 2Y0BA 2H51A 2WDPA 4QUBA 2FUNB 1I51A 3NKFA 2J33A 3GJTA 1RHQA 3PCXA 3V6LA 2QL9A 3H13A 4I1PA 4FEAA 4JR0A 1RWKA 2HBRA 4FXOA 3ITNA 5LU9A 5IC4A 1NMEA 4ZVQA 1RE1A 4HQ0A 4QTYA 2CNKA 1RHJA 1NW9B 4NOKA 3KJQA 3S8EA 2H48A 4QU9A 1SHJA 4ZVSA 5IBPA 1NMSA 1SHLA 3GJQA 4JJEA 4JQYA 5LU8A 4QUAA 1RHMA 2C2KA 4QUHA 3R6LA 2DKOA 4I1RA 5IBRA 5H0IA 5IARA 3SIRA 4DCPA 1GFWA 3H1PA 1QX3A 3V55A 3R7SA 3NR2A 2J30A 1CVRA 1I3OA 4NBLA 1I4EB 2HBZA 4PS1A 1CP3A 4QUDA 2H54A 2J32A 3GJSA 4N7JA 2C2ZA 3D6MA 4D3XA 4JR1A 1SC1A 4EHNA 1KMCA 1I4OA 1GQFA 2XZTA 3IBFA 2CDRA 3E4CA 4N6GA 4AWBA 4M9RA 3R5JA 4N5DA 3H11B 5IAKA 2FQQA 5IAEA 3R5KA 1ICEA 4D3YA 5IBCA 4ZVRA 4QUGA 2QLBA 3H11A 1RHRA 4AW9A 4ZVUA 3P4UA 2HBQA 4IYRA 3NS7A 4D3ZA 3UOAB 3S70A 3V4OA 4NOMA 4JJ8A 3R7BA 3V6MA 2QLJA 4NOLA 4AWAA 5IC6A 3DEIA 4EHLA 1F9EA 2C2MA 5JFTA 1SC3A 3R7NA 5I9TA 3KJFA 3RJMA 5IANA 5IAJA 1M72A 1RHUA 4EHKA 2K7ZA 2CNLA 2XZDA 1RWPA 1RWOA 1BMQA 5IASA 1RWMA 1K86A 4QU5A 3D6HA 3H0EA 4JJ7A 4N6OA 4EHAA 4ZVOA 2H5IA 1RWXA 4NBNA 4ZVTA 1RWNA 3P45A 2NN3C 4NBKA 1SC4A 2AR9A 2CNNA 1F1JA 2H5JA 2XYGA 2XYHA 4PRZA 4DCJA 1RWWA 2J31A 5IAGA 4EJFA 2XYPA 4IEFB 1JXQA 1K88A 4EHHA 2CJXA 4NOJA 4ZVPA 4QUJA 5IABA 4PRYA 3V3KA 2QLFA 3DEJA 4EHFA 2QL5A 4LSZA 2CJYA 4JB8A 5LUAA 4DCOA 2H4YA 2H65A 4QUIA 2CNOA 5I9BA 3SIPA 3D6FA 4N7MA 3EDRA 3UO8B 3V4LA 2C1EA 4JQZA 4QTXA 1IBCA 2H4WA 3DEHA 2P2CA 3GJRA 3K7EA 3PD0A 4QUEA 5K20A 5LUBA 3PD1A 3OD5A 3IBCA 1PAUA 2C2OA 4QU0A 1RWVA 2QL7A 3R6GA 4FGUA 3DEKA 2Y1LA 1PYOA 4JR2A
chains in the Genus database with same CATH superfamily
5BN5B 2XA2A 3KEMA 4OJKA 3LDUA 3HHPA 2GPWA 3JQAB 3WLLA 1QF9A 3VZDA 5MDHA 2OK7A 2VCYA 4ID9A 3GWZA 5DNAA 1E7WA 3RHSA 3E2PA 5BT9A 1AS3A 1E9RA 3QITA 2BKLA 3DLCA 4L85A 5LBUA 3E03A 4KBGA 1F8GA 3V7FA 4LWPA 4F45A 1NUSA 2FUNB 4RW0A 3OVMA 4B7ZA 1WCYA 2P9QA 3GJ3A 2JFYA 1N7IA 3PUHA 2EP5A 1S1MA 2V7EA 3SDZA 1MC4A 1SIWA 2HBRA 4LTNA 1YQGA 4JL8A 3TIGA 3PCTA 2NQ2C 1LC3A 4LYYA 5JZOA 3TNYA 3DB1A 3ANTA 5IXSA 2QM8A 1T25A 3IHTA 4M37A 1RRPA 3SJBA 4AXXA 5IF3A 2QTNA 1NF2A 2QW0X 2W2QA 3K0KA 5DRYA 4G3XA 4KRYA 2BLNA 4QU9A 3R7FA 3WP1B 4DN6A 1FSZA 2IYYA 4OU5A 5F7ZA 4HB4A 5DBGA 1S8FA 1AU9A 5DHTA 1P1RA 3UTDA 2H7XA 4LPKA 4KK4A 3AXSA 2YHSA 4P5PA 3L01A 4GKAA 3SIRA 3SXJA 3R41A 5K6RA 3O26A 3N2EA 4FT4A 4JITA 4YJDA 3R9IA 1Q22A 1I7LA 4YIKA 2CCJA 3OA0A 4JOSA 4Z0TA 4B6SA 4MA5A 5FUQA 4FN4A 4LHVA 1GADO 1L6IA 3HDYA 5FPYA 3SPXA 3IPCA 1C7QA 2F00A 3O38A 1TJ5A 4QDZA 1Z73A 4LOLA 5IM4A 2C77A 3LBAA 5TLSA 5HF9A 5KSZA 2W5UA 5C8YA 1B23P 1YVDA 4JJGA 4EP1A 4NJEA 5A6VA 4HHEA 1IN1A 3H5NA 2O50A 1AG9A 2PG3A 4G9GA 3VHXA 2HSDA 3PFWO 4D3ZA 4NF2A 1I3CA 4G0OA 2ZRQA 3QWHA 1W25A 4ZN6A 1GARA 1SKQA 1VSBA 1GCUA 2OBNA 2OG2A 3KX2A 3GUZA 4KB5A 4TWRA 3QEAZ 3VPGA 3K09A 1TXGA 2WSBA 3OIGA 3OQPA 1SO8A 4WNAA 5DE3A 1XVIA 1ZJYA 4YV0A 5KC8A 2XZDA 2I9KA 3D8TA 2VJMA 1GL9B 3WHIA 2DJIA 2P5YA 4F5YA 2HIMA 3T8YA 2I1VB 3W5VA 3RTDA 1B43A 2A5LA 1X7XA 3W7VA 2XYPA 2M6KA 4WJLA 4ND4A 2IH2A 1HKHA 4A6XA 1N2ZA 4BNMA 3BTUA 2VDVE 3BS4A 3JD3A 1RLIA 5ALZA 3RWBA 2G63A 2XBMA 1EFRD 2OO7A 4MSUA 3M1IA 2GAFA 1EK1A 1BS2A 1MAHA 1GL7A 2F1RA 2PUVA 2VKQA 2ZRFA 4YJGB 1STOA 5F1KA 4BLUA 4B73A 4CV1A 1PTKA 5GOTA 4GUAA 2ZRIA 3R5FA 4OI4A 5B4TA 4WOCA 1PU2A 2GFHA 5B3KA 3N8HA 3ZQKA 5LYJA 3EZNA 1DEKA 2JLQA 2GD1O 4D7AA 3T3GA 2H85A 4LRYA 3A0RB 3QG5A 4YMIA 2YIVX 2B98A 2PT5A 3G68A 3IOEA 3QU5A 2BFEB 3PC2A 1KNXA 4NJMA 2XRMA 4BFCA 3QPAA 2Y2VA 3BFVA 1NUAA 3AYXB 1E5XA 2A9PA 2YYZA 4PSUA 1GZUA 2RGNC 2JIZA 4KCGA 2YJNA 1V39A 3FPCA 2DWCA 3GT7A 1AVTA 3QXXA 1DEHA 1QANA 1MABA 2CHVA 3RFCA 4LTMA 1EX1A 1NBAA 4YDRA 1AKTA 1BH6A 1ZW6A 2GRAA 3OFND 3TZCA 4X63A 3H2KA 4KBYA 5FA5A 1JV2B 4KH0A 4ZZ2A 3ROKA 1N2CA 2BFNA 1NRXA 2FR8A 5AKXA 1NPDA 1N1EA 1RE1A 2Q3EA 3DT6A 4X1KB 3BMQB 4BUJA 3QJGA 3TG8A 1NUTA 1DRVA 1QCCA 2QSYA 1A9QA 4CF6A 2ZWIA 3HCBA 2XOEA 1MB4A 4BIMA 5CH5A 2Z6UA 1CFZA 3EVFA 4MV9A 4S2EA 4ALIA 3AI2A 5TQ0A 4AJNA 2PWAA 2VNHA 3INNA 4FONA 4MZDA 3C3DA 1FRNA 3K94A 2XBLA 4OMUA 1IN6A 2C2KA 4QQNA 4JJAA 4DUPA 3F9RA 3Q3VA 1U0GA 3QYAA 4BFZA 4L4RA 1DIHA 5HDBB 1UZUA 4YRTA 2J8ZA 2I7XA 3CLTC 3DD1A 4KITB 2GRUA 1QP4A 1JNXX 1FRVA 3C8DA 2GYUA 2OO5A 4LXGA 4YT5A 5AK4A 2O7QA 2FK7A 4MW5A 4AF6A 2NVUA 4I08A 2WFLA 4RA9A 2WJ3A 4WLUA 3UZUA 3PPYA 1USKA 2EBHX 1KQFA 4H3KB 4AMBA 4IIJB 1MJFA 4L95C 4FE3A 2KLHA 2QV7A 1L5LA 2PWPA 3GPDG 3S81A 1RU3A 2COUA 2R6JA 2YDYA 3DAPA 1RBMA 5BVGB 4YECA 1T43A 5CYOA 1C1XA 2GMWA 4IVRA 3SS8A 5ALEA 1R6VA 1IDOA 3RC1A 5DGCA 3LDAA 3BXFA 3P2MA 1XQWA 4ZDJA 1UINA 3BEDA 3MUNA 4S3MA 3FNEA 2XBUA 2ZWVA 1R9JA 3EGXB 3GUVA 1V5IA 3TCKA 3IRUA 3B3QA 1N3BA 1P4AA 2PLRA 3CU5A 5AK6A 3ONVA 1Z6QA 1E98A 4JJ8A 3B53X 5MN5A 3I61A 3FMIA 1DWOA 1SUCA 5C3UA 2DY0A 3DMPA 1WL8A 2XA1A 5CFMA 5J23A 3ZHYA 1QYDA 2ISQA 3ESBA 2P9JA 3KJEA 2GEFA 3M81A 5IWCA 3KKKA 3LC0A 1P2DA 2H4JA 3ZWNA 3SGLA 2QRVB 4CKXA 2EZ4A 4ZT5A 2AKEA 1CUYA 3AB7A 4H3HB 1LVUA 1F4LA 2P5TB 2Q49A 5SY4A 1HNWB 4DTCA 4NBKA 2XYGA 4U7JA 2EERA 3RIGA 1GDTA 3EUAA 2RJNA 4JLUA 3BWBA 4LE0A 1LVGA 4ZODA 1WEHA 1Z7WA 3DLHA 3EWAA 4MTLA 3MELA 4ESVA 1HDZA 3IIJA 3OE1A 5DJ5A 5FLYA 4TT8A 3PXBA 3VGPA 3NH6A 1NHGA 4KMSA 1LDBA 4XD2A 3LS2A 5DNVA 3W5BA 3RVSA 2P2LA 4D74A 4F9EA 3GJRA 5F2NA 1JR6A 3FFWA 4GPEA 3I2JA 4AQYB 1DQYA 1G3MA 1RM0A 4Q4DA 3VZSA 3GV0A 3L7AA 3CR8A 3ZIUA 1N2OA 4HAXA 3FVWA 4IGFA 4GC9A 4UHDA 1X70A 4DOMA 3ICCA 4EG4A 4AM8A 3PTAA 1RJ9B 1TM7E 1EK2A 1SG6A 2ZPTX 5ALSA 1YGYA 3B5IA 4O2BB 3ST7A 4ZYXA 3PKIA 5K03A 2XNSA 4JUDX 4DC1A 1NVKA 3HBNA 1UBUS 1T8SA 4H77A 5CAEB 4P4LA 3D6VA 3ADDA 2P9HA 4Q82A 3QKSB 2OAQ1 1KYYA 1VBMA 3LIPA 1EFCA 3CRVA 4NMWA 4TVBA 2QUZA 3LECA 3AHJA 4NFYA 4PC3A 1MW8X 3PUIA 2MIIA 2OZVA 1LLDA 2LIVA 2AW5A 3UPUA 1CNMA 1G21B 2X19A 4M6WA 5KINB 1TCVA 2DBRA 5A1JA 1GUFA 1W2HA 2EWMA 3GIWA 1TLFA 2DEUA 1GO2A 3W3AA 4E22A 3JU3A 4LVOA 3DOFA 4YRPA 3U3ZA 4HXEB 3OZVA 4A3SA 1E1DA 2QVBA 4HX5A 5IFLA 1NAIA 2ORWA 3QPBA 4JJEA 4TTTS 3BE8A 4UJ3A 2XD9A 3L4BA 2SKDA 1YQDA 3PL1A 3KDPA 1VZ3A 1NULA 2XITA 2WAAA 4MLPA 3RT7A 3EMKA 1ZJZA 5FL3A 4LXIA 4M7OA 1ZUHA 1K63A 1U1GA 2AFIA 4R1PA 5H70A 2LWIA 5JO9A 1ACMA 1WW2A 2FMTA 1Z34A 3FSGA 5BNWA 3NDIA 2R86A 1DIBA 2VT3A 3CN9A 2MR6A 4L5BA 1R5BA 2Z3VA 3AF2A 3VR2D 2XODA 3PE3A 2P6PA 3QWIA 3X2SA 2B5VA 2EF1A 1BDIA 1A50B 1VP9A 4LV8B 1E4YA 3K0HA 4KQ9A 4X54A 3HYCA 4KXLA 1P39A 2NUTA 5JR3A 1ZVQA 2HK8A 4URZR 3TW4A 5HUJA 1H4SA 4FW9A 4EG8A 3GFGA 1X9IA 1EP2B 1HRKA 2FN7A 1YZQA 1DT5A 5KU1A 3O3MB 3A58B 3EG5A 4LRTB 1SEPA 2G9VA 3BORA 3SEZA 3NUZA 4QOFA 4U6QA 3LAWA 1UJ2A 3I76A 3FDJA 4NZOA 2IXDA 1Y81A 4XX0B 4Q48A 1T5DX 5TMBA 1BKSB 1XAHA 3R76A 3OURA 5JXGA 2R79A 3TOVA 2C04A 3TQRA 1ONPA 1C3LA 1T26A 2WR8A 3OJLA 4JY7A 5BN4A 4BE4A 3E82A 5LP6A 3A9TA 1XLUA 1Z2PX 4FFSA 1V11A 2DFDA 5IJ9A 1GGVA 1CQZA 1Z25A 2ZIFA 3ZWCA 1W88B 3ZI7A 4Z1MA 4C3UA 2FW8A 5B12A 5A03A 2OZLB 3QEOA 5D85A 2XPCA 4P0QB 3FFTA 4KV9A 4UHBA 1Y3DE 1ORHA 4L07A 4M89A 4UREA 4E09A 3DT8A 4B82A 4R6XA 2JAXA 2JC3A 2G06A 2X0KA 4DBLC 1JLMA 4DJTA 1OFUX 2O2GA 3B6IA 2R2AA 2KM1A 4CETA 4RF4A 3ZCTA 4EPVA 2H0AA 3ML1A 4GECA 4JC8A 5T6BA 5LMZA 2JLWA 4HNSA 4UCFA 4V1CA 2ENUA 1XCOA 5G40A 1AH2A 3A06A 1XRQA 3BJEA 3WQBA 3ICPA 1XKQA 4BBJA 3GJ8A 1GR0A 3UJPA 3U4MA 1EVJA 3T5MA 1YDFA 5C18A 4LRWA 1P74A 1HE2A 3M4YA 3R9KA 4R8LA 5TT0A 1FVOA 2H5EA 1U2RA 4E32A 5I7SA 4GYJA 4BO6A 5EE5B 4D41A 1ZAYA 1DAFA 4UTOA 5EJMA 2W6MA 2CEKA 1US8A 1FXUA 5FBVB 1PR2A 5FOWA 3LF2A 3PE6A 4MW1A 1DEXA 2P9GA 2FWIA 3QV1A 2QN1A 3ORSA 4LJSA 2FP4B 2W22A 2ZZNA 3BD6A 1TRHA 3SY8A 1VL5A 2J85A 4X1YA 4NU6A 4ENRA 3QMMA 1P9LA 3HVUA 3VTAA 4I9FA 3FCOA 2Z57A 3X1JA 3P0EA 2Z2IA 4MUGA 2BFFA 4RS4A 4D6XA 3IOMA 3KJZA 4PTLA 5I7RA 5L3SB 2I7DA 4O4IF 4NX2A 4C21A 4ZDIA 3EF0A 2Q4TA 3PFKA 3EQZA 2AMFA 3MT0A 2A5FA 2IPOA 5HTKA 2YW2A 4F9TA 3CSDA 3EVCA 4I1IA 2X3FA 4MWCA 3REGA 2RD2A 3H5WA 1AHHA 3QXJA 2DETA 3HH8A 4BMSA 2AQ8A 1I3OA 3BGSA 1NSYA 3GY0A 1YJ5A 5D51S 3H6GA 2AN1A 2WE8A 4HDQB 4N7JA 1CQJB 4YP5A 2CDNA 3GCGA 3WJ2A 1A4IA 2H7CA 2RH9B 1UKVY 2WD8A 3FYHA 5DHFA 4FFPA 4D9BA 3WJ7A 5JJ5A 2IOQA 4UDOA 3Q7RA 3UPTA 1P5HA 3W1VA 3KAKA 3I8SA 4D4GA 2XE8A 3B9RA 1GNVA 3G13A 4WJKB 2H2AA 2ZR8A 3CB2A 3QEJA 4RHUA 1OKKD 2CXNA 2X4LA 3P4UA 1GA6A 2XMBA 3TEJA 1Z7GA 5LIPA 2CF6A 4TLBA 1IPEA 4AJHA 3VHRA 2B92A 4CKCA 1DG9A 3RUPA 5M29A 2F59A 1BQ4A 4G4SP 1PNVA 2WYIA 2BY4A 4JCOA 4AECA 1CRQA 5KQLA 1SMKA 3TEMA 3KXLA 2JBAB 4Q12A 3JQAD 4FSDA 2ZUWA 4JI5B 3AJRA 4I9NA 1ABEA 3IQXA 3KLOA 4WCFA 5EPEA 5A4MS 3ZLBA 1LSOA 4L2IB 3RRXA 2XRYA 1NZFA 4GI3A 3JY6A 4WK4B 4LF7B 2IC5A 3KPUA 4HX2A 1EK0A 1HTWA 1OXUA 3AI7A 1M6VA 4NBNA 4TQ9A 5G41A 4C14A 1GTJ1 1YCDA 1PYGA 4DCJA 4LJ5A 3AL0C 3EQ2A 4EJFA 2R8BA 1M2JA 1YB6A 3WJAA 3QLVA 1X74A 2E6UX 1IQPA 1PWXA 4HB0A 4BJ5A 1ML4A 1UZLA 2P3OA 1R8JA 3UAYA 2QL5A 1GN8A 3GVPA 4NHEA 2Q29A 3C45A 2NSJA 3CUSA 5IVKA 3IUBA 2JVIA 2BEVA 5A9RA 5I6DA 3Q8WA 4QTXA 2ZVQX 2HXGA 3UUFA 1GWNA 1P44A 3DEHA 3PQ5A 5FPQA 4Z4CA 1EESA 2Q1XA 1ZD9A 1ADGA 1OBVA 2XE6A 3NNDA 1H05A 3PQ6A 3TVYA 5LOVF 1Z0IA 2JI6A 3I01M 1ZOLA 1SQGA 2NG1A 1B6SA 1J22A 1NUPA 1TYCA 1ECLA 2NV0A 2AJDA 2Q3FA 1X1TA 3ANNA 3BCSA 3GJYA 4FD3A 4YRDA 1GQOA 1XKXA 3KTAB 3S1AA 2IYTA 1J8QA 1RYYA 5BW8A 2QR2A 1CY8A 1NG1A 1QOPB 2R68A 2FMKA 1XPJA 4MI6A 5FL7D 1QRUA 1YKFA 3TX2A 2Z30A 2GD2A 1DX6A 2ZGVA 1NNI1 2IZ7A 3DM5A 3ZK8A 4D0GA 3QWFA 5F5LA 1SBYA 2DYKA 2KS6A 2QGFA 1OIXA 3F6RA 3KE9A 3AJ9A 4MWZA 2IYEA 3UAWA 4C0BA 4DA8A 3E9RA 4RVCA 2QOEA 3FPAA 5JD4A 3P26A 2QMHA 3RYFB 3WRYC 1C9YA 5IDWA 5AESA 2QYOA 4KQFA 5FJIA 5GMOA 3F3KA 2FB9A 2QX9A 1DAGA 2IEDA 4FIZA 2IYSA 2JGDA 1D2HA 4RETA 4Q1AA 3GZJA 1OPXA 3I1FA 2BKAA 4PLGA 5BQPA 1ZR2A 4C43A 1YNSA 4U2CA 5DWVA 4DMFA 4CGYA 2OHVA 3OTWA 1U3DA 2A0YA 2R6FA 3EHEA 1FF9A 1XN1A 3O7MA 3LUCA 1R6TA 3AIMA 5L4NA 4DCTA 5GAJA 3DE5X 1E1RD 1MB2A 4PONA 3WGKA 1MX5A 1XTTA 4QX6A 2OHXA 1K6XA 5ERYA 521PA 4X20B 3KAQA 4B71A 5JSFA 2QPTA 3ZVKA 1R0ZA 1Z6ZA 3GLUA 7YASA 1XZIA 2X22A 3TWOA 1JAHA 3GDOA 1PNOA 5JJCA 5F3WB 2O20A 1Z9BA 1HY3A 3Q6MA 4KC0A 4BQIA 1KDVA 1S96A 1PZMA 1PR3A 1EGQA 1W30A 4YXFA 3ONWA 1ZRMA 4Z51A 2DERA 2AK3A 2BE9A 1Q0ZA 4YAKA 4AJ2A 4EQ6B 2JLBA 1CJTC 2V7WA 3B9QA 5HP4A 1X13A 1AQLA 3W5UA 1VDZA 4BZZA 1PR4A 4REMA 2QP9X 5DASA 4IMIB 5JS8A 4JA0A 3EXHC 4DUYB 2ZSKA 4D0SA 1Z0JA 3A6DA 1OXKB 4IZ6A 5CNJA 4EK9A 4E15A 3O4IA 4PBRA 1AQUA 4OYHA 3RVLA 5DTIA 3B70A 2GEBA 1UBHS 1HMYA 3WGYA 4B4OA 1BZYA 2CF5A 4FX2A 4NZYA 5HEKA 4QASA 3T4UA 1XZGA 3VR6A 1GT6A 1OREA 1Z5ZA 1XROA 2BVNA 3P4YA 2WJWA 2EFEB 3AEKB 3OJFA 1CQXA 1ZG3A 1S2IA 4KXNA 5LQDA 3SYLA 3L4KA 4GSYA 2YJZA 2JNWA 3CMCO 1PR9A 3ABRB 1X9GA 2XAAA 3EWIA 3IT2A 3UXYA 4AMZA 3RIMA 4FE7A 3LQYA 1L1QA 4JKIA 1P4SA 2BP7A 3ZYCA 2B4TO 4QYTA 1I2BA 2HREA 5CXXA 1XIVA 2B2XA 1Y6RA 2KE5A 2ZSIA 3UT5A 5AUOB 3CGGA 4L8WB 2A5GA 5LUAA 1ZSVA 2YFKA 3I9V1 1S01A 3N2LA 4GVLA 2EBUA 4RF5A 2C8LA 3HCEA 4JHXA 2EJBA 1FFEA 4MYCA 1QQTA 3X43A 1V43A 3WV5A 1BWSA 1F1BA 1IY1A 1VECA 3EY4A 3EZ7A 4PO8A 1FP4B 4QDOA 2PZFA 4QBHA 4X44A 3IH5A 4R83A 1BTOA 2JH3A 1TT5B 1QAQA 1QHHA 1WXWA 1XFDA 2Q1YA 2R1VA 1QH0A 3B48A 3KSMA 2ZYTX 1DU4A 4S24A 5F52A 3EISA 4DCSA 3K6SB 5DM60 2A86A 3OPVA 1HI9A 2Y8EA 1TTPB 3QTLA 3S2SA 2HNAA 1PRYA 4N0PA 1RHKA 1L8QA 1E9AA 1GA1A 5AQ1A 2AOVA 5TPZA 4DIKA 4YQZA 4EF5A 2QU7A 3N0WA 3VO1A 2X58A 2VF4X 2B30A 1LNQA 5EJGA 5M5BA 2RHJA 2VFAA 5C1DA 4UBKA 1CR4A 2GBCA 2ISCA 2J5RA 4UTNA 5LQMA 1YFJA 1OR8A 4WJZA 1TFUA 2QAIA 1NXVA 3RVMA 4BKRA 5CFLA 2O57A 2WILA 3CTPA 3H9JA 1O94C 1XCGB 4UUNA 4G25A 1W36D 4ZRDA 4BLVA 4MQEA 1HLFA 1CR6A 3FYUA 1NM5A 5HILA 4URXR 3VSEA 2ZI6A 3H1BA 1JHRA 2Q8QA 1T4CA 2YXNA 3PT5A 5FHQA 4ZCLA 3FI0A 1QIIA 2PT9A 3NXSA 1CQIB 1ORIA 4ZCSA 2GN2A 2C7GA 2JHGA 5TQJA 2QD5A 5EGNA 5JWRA 2C2YA 4NYMQ 1KSHA 1UMCA 3R6DA 2AMJA 2Q1UA 3PDIB 1Q14A 4NWIA 2CLDX 4URWR 5AVYA 2HCRA 4LVCA 1E2BA 1WU7A 3G6WA 1D2RA 1I2DA 3HBJA 3NR2A 4WEQA 4HVTA 1UBFA 4Q15A 4CTKA 2V0GA 4J1NA 3AFNA 1XDUA 4M7WA 1E4OA 1WXHA 4XX1A 1FUIA 4FNMA 4CM7A 3M1AA 3RIYA 4D3XA 1NKSA 4AMVA 1A8HA 2CT8A 4D8WA 2QIPA 1OWOA 1TD1A 2TECE 2O7RA 1XX6A 3W0LB 1ZGHA 3NEJA 4FBMA 4ND8A 4CMIB 1IJKA 3HB0A 1R50A 3VJKA 2H2IA 2C0PA 4OY3A 1T3GA 3DLAA 1NONA 3JAKB 3NOOA 4LXXA 4HK4A 5DNUA 3T7JA 2QLBA 1UEIA 4XWYA 3BCHA 5HWSA 4G5HA 4A27A 5C37A 4BVGA 1FYEA 1X7ZB 1NV9A 4HMOA 1PEAA 1YO6A 2YZNA 2GBPA 4HQNA 3WLOA 2PFSA 3DEYX 3T3PB 4BN0A 2V6MA 1JQJC 3K9NA 4EYSA 3FNQA 3ILXA 3EGCA 1ND5A 1OYVA 1UJNA 3IR5A 4TKMA 1JDSA 2BD0A 2WYWA 2E5FA 4CQMB 3U44B 1MBZA 2Q21A 1GFSA 1HRDA 4B6FA 5IT9A 1G4UR 1RWNA 1XCPA 4KVFA 4IZIA 4NENB 2GRJA 1ES9A 4MA4A 2FSVC 1JU3A 3ADOA 3QFFA 1EDDA 2PVCA 3CRZA 4YCLA 3RVNA 2BCGY 5KYXA 2C20A 3G0OA 1JJVA 2GCOA 1M2HA 1P0PA 5DWQA 2YWJA 5EVCA 4C0LA 1YZUA 2N46A 1A8QA 3QU9A 2C99A 3DLBA 1BX0A 1AUQA 1SPBS 4IDFA 2AHOA 2XUJA 1T13A 2CL6X 3KJHA 1J0BA 3WGLA 3RU9A 2OKCA 2R47A 3DS8A 1S3GA 2PRSA 2DFPA 3WK6A 3R20A 1O3YA 3K0CA 4PU0A 4BLOA 4X97A 5KNCD 3EXIA 2BMAA 4F6RA 4D0LB 4CKZA 3NT2A 4JNCA 2QNBA 2AZDA 4CV2A 4E08A 2NQ8A 3O82A 4EG0A 1FFHA 1PZFA 3TECE 3SF0A 3E1SA 1XRNA 1AHNA 5AW2A 1R6BX 4IHJA 1X8KA 1UBEA 4B87A 5HRUA 3CLRC 1E0SA 1SKBA 1TJ3A 1DOZA 5A3JA 1U9CA 2NU6A 4EZEA 3TOZA 1QCDA 2QQEA 3HM2A 3R8CA 1YAJA 5COBA 3K1AA 4V39A 2A92A 3EVDA 1KMQA 4DV4B 3G2HA 4JT8A 2GYWA 1RWKA 2ZM6B 1KFCB 4K9RA 1CZRA 3HR4A 3QJYA 4JB2A 4Z8YA 4S04A 5DM70 3W8EA 2O2YA 3NPMA 1F12A 3D7MA 3L8CA 1CUAA 1N5LA 1OFGA 3WK8A 5JW6A 1ZICA 3U26A 3IDQA 1WDKA 4A36A 2G1AA 1Q7RA 1JSCA 3PUYA 5A4KA 2QN6A 3LWNA 4DXHA 3AZQA 4MKHA 1OA0A 1A4XA 1VCIA 2QTHA 4GBED 3X1MA 2F8SA 4D81A 2Q4RA 5FAXA 5IC5A 3VC3A 1FEZA 2EIXA 4P83A 3SNHA 3O90A 1XRLA 3CCFA 4K6CA 2NSHA 1KO1A 3ICOA 3IR6A 2XUFA 2EQBA 4OHRA 1KU6A 5DYTA 5IARA 5JVDF 4V0QA 3NANA 4Y7CA 3AUFA 3E1GA 4UU0A 5FI0B 4N0DA 4K9OA 1Y8RB 4KO8A 3X1DA 4OAPA 1QAOA 1CVRA 1I7PA 3JD1A 4I4TB 1MEEA 3CT4A 4LDJA 1PP4A 2ZUBA 4YRZA 1P7YA 2GK7A 1ZUWA 2JKYA 2P6MA 2WP0A 3JAWA 4RPCA 1GYRA 3C1UA 1L5GB 1J39A 1VPEA 3CURA 3K31A 2JATA 1D7AA 3R23A 5LVAA 1TAHA 3BERA 2QRGA 3LZDA 2CDRA 1DT3A 4P5EA 5EJFA 4BDSA 1NV8A 3MJDA 1M3SA 2BHNA 3H83A 3IDAA 4PGHA 2AJ8A 4UCXA 4Y6OA 3WOVA 4AMUA 4OX9Y 2PKCA 3FVQA 5C7YA 1ZJ6A 2DY1A 3RYHB 1QXSA 2HQRA 2ISSD 1JLKA 4OIMA 3H2YA 2BSAA 3RC2A 2P2YA 3DTTA 3I1YA 4G0XA 1AMOA 4HYEA 1SOVA 1UJBA 1KOLA 1JKMA 3ZZTA 1MA3A 1NG9A 2GZMA 2MYNA 3B9BA 4EHLA 3NOVA 4NHOA 4MUFA 1JX6A 2I22A 1KYVA 3AP2A 1ZUNB 5AVJA 2B6NA 2V6JA 2VDWA 4X6XA 4QVGA 3AEUB 5E7IA 1KI6B 3QVGA 3ZE8A 4TQUS 1EDBA 2UDPA 2IIBA 4PHFA 3VH3A 3RS3A 4WKBA 3ZCSA 1I3MA 4UVEA 4DEXA 2DWQA 3TF5A 4MARA 1M2WA 4AJ9A 1AD2A 5ESWA 1NA5A 4JWTA 2YV3A 3G23A 2R4UA 5EXPA 4ZKEA 3ZE7A 5FXMA 4ASUD 1IB0A 4CLHA 5HIMA 1JG6A 4OQLA 3T7AA 3QUTA 1QAMA 1EJ2A 2COKA 2FSGA 3NDJA 1GGMA 4G81A 1N78A 2CJYA 2X2PA 1IAQA 1DKPA 3CLTD 3ZGLA 1X7WA 4IICA 3WLTA 5I9BA 1YHNA 2RHCA 3IEKA 3W2HA 3UO8B 2V7VA 3UJAA 5BSEA 1YHZA 1YDGA 2YCBA 2ZATA 2ZSAA 5HJEA 1DI0A 2FFHA 3MWJA 4I55F 2WHXA 1Z6GA 3FZQA 3K7EA 1X7DA 4TLDA 3M6FA 4NULA 4N0QA 1N9ZA 2OO3A 5CT6A 4PZ9A 5TQ2A 3AUKA 3U6BA 1PZNA 5EJ2A 4XGRA 3RJTA 3VR3A 2D6FA 1NVFA 3PJFA 4C4YA 3N70A 4CW7A 1CRWG 4IZHA 1E2LA 4KFSA 2DG2A 3HNOA 4GWGA 4EFKA 4K2AA 4G84A 4CQLA 4QU8A 2DLDA 1NLYA 4A6EA 3U61B 1FLNA 3IAEA 3EDCA 1Q7CA 2Z56A 4CGZA 1ITZA 1JHDA 5CURA 3Q5DA 1FTNA 4DZRA 2QE7D 2OBLA 3PX2A 1XMPA 2BHLA 1LS1A 1ZK1A 2RHBA 3AH8A 5CGQB 1AT1A 2YHIB 3PNBA 3LWDA 1EI9A 1R5JA 1Y3FE 2CBZA 3PUKA 3SLRA 2FZLA 2I1LA 1KI3A 2D2VA 1JQAA 4F21A 4TKVB 5HGXA 5DGDA 3RV3A 5JHHB 3LWBA 2QBYA 3FUUA 3R5TA 2PKWA 4RKEA 3RUCA 4B3BA 2PL3A 1XB2A 4FZVA 3MT9A 1I2CA 4IRXA 4MPRA 4Q9JA 2I3DA 1AUOA 3V4VB 3CCBA 4WI1A 4ZZIA 2A30A 3AL3A 4QQRA 3CUWA 4XVUA 1KBOA 1GT91 3QKRB 5LP6F 5A3QA 2DPGA 1GQQA 4OTZA 4OQDA 3WTCA 2NYAA 4CMBA 4YXWA 4U39A 2Y66A 4HLUA 3ZDEA 4MW7A 4S0XA 1RQRA 1FMTA 1DX9A 2H54A 3NC0C 2F1OA 3C7AA 4N1AA 5FTMA 3KOMA 1TLLA 3CPSA 1TA0A 3TJRA 1CZHA 5BNIA 3DKRA 1RPJA 1AXGA 2JFFA 5JALA 1FP6A 3PA8A 3DBHA 2C0QA 2EFHB 3QX9A 5HJ7A 3IALA 4DR4B 2Z4RA 2J3HA 4TT3D 1WHTB 4NYMR 1WMEA 3KT3A 2JGNA 3LZCA 4FNGA 1NAHA 5DHPA 3RVDA 1A9YA 1L4BA 3FYSA 1KFKB 4TTAA 1SXGA 2PZBA 4H1WA 4KWIA 4IDDA 5F23A 1NPYA 2IPXA 3SHOA 4UTRA 1QGZA 2Q99A 5LJLA 4ONEA 4GMXA 4RAOA 4H7PA 4RHTA 4AN1A 4XGNA 5DK4A 1QR2A 4XYGA 1OI2A 2I65A 2YWEA 4ZO9A 2XF2A 3OFSA 1N7JA 1U99A 5EFZA 3EULA 4NAVA 4YCNA 5CH3A 5HFJA 1MGOA 2G4LA 2X9QA 5LQJA 2F9LA 2WAXA 4FLFA 3UM9A 1K8ZB 3VBEA 4A0SA 1FQJA 4YJ2B 1RXVA 5H82A 1QQBA 3WJ1A 5E6UB 1FJGB 2VHVA 4K05A 3IDSA 3TJMA 2GWRA 1T4GA 1D2GA 3UKJA 3VZBA 4DNOA 9ABPA 4JMLA 4QARA 4GKBA 1P61B 1KS2A 4L16A 4Q4JB 1VHJA 3AUXA 3T9AA 4RHCA 5C52B 4ARIA 1ZDMA 5ESXA 2I03A 5HCNA 1LBHA 4HAVA 2H8KA 1MF7A 3KTOA 4LSZA 1TW3A 1OX4A 1CRZA 1SXJB 3AESA 3HP1A 5AD1A 1NVWQ 3EG9A 3KLPX 3CG4A 4TV9A 2PSEA 1Y37A 1Q3HA 3VTZA 4B7XA 1K0FA 5E9QA 5MN4A 4UHHA 3ZNQA 2FPPB 1H3EA 4IFTA 1Q50A 1YH3A 2Z6AA 3N53A 4X66B 3O93A 1U8CB 3BRWA 4QU0A 1UXIA 4BO2A 2D1FA 2D5CA 2XECA 3ILSA 4Q39A 2Y1GA 2FA9A 5ERGB 2VJLA 3VO9A 2AN3A 5DLQC 5A4DA 2FEMA 4DLUA 3N7TA 2PYDA 2X9LA 2ZITA 5K1ZA 3LUGA 2DPXA 4Z9BA 3VKUA 4D80A 1JUDA 2WIBA 5KKNB 2WNSA 3MWYW 2ZAYA 1ST3A 3B20A 4KDEA 4U7GA 2V1XA 1M7HA 2KHZA 1JXAA 2Z2ZA 4M38A 1RYNA 3D2LA 3VC1A 3VR1A 5ITWA 1J0DA 3UMMA 4OEHA 4FHEA 1OV4A 4J1QA 2IUUA 2CSUA 1TTTA 4JB3A 2HA0A 1KBQA 4R1TA 3TXAA 5GJBA 2C82A 2AYXA 2RBEA 1FPMA 5KTKA 1N5OX 2FSPA 4IDOA 1JSXA 5JMWA 3T0GA 4CRWB 3UAVA 4KYIB 4R3NA 3VR5D 4ARBA 3CZRA 4L6AA 1UK9A 2SKEA 1VLJA 2ZPAA 3EMDA 3FTQA 1O96A 3JV7A 4TV8F 4A03A 1JDNA 5B53A 4JUAA 2G67A 3VGJA 2SICE 1Q0UA 3STVA 3BCRA 2AH5A 4UQPA 5AKHA 3FNHA 4P54A 4CR7A 1BDBA 1JECA 1EFVA 3RTCA 1P62B 2JJQA 4X00A 3WY9A 3ZTYA 3FKSD 2QMYA 4YTEA 4UOZA 3CKYA 3HJCA 4R1SA 3F3SA 1N9GB 2MSEB 4HC4A 3EIUA 5EJEA 2BJWA 1DRJA 3LWZA 1YJAA 1X8JA 1E0KA 4IH9A 5CLHA 3WMGA 4YLYA 5BN3A 5KYGA 3LP5A 2DSTA 5JY1A 1A8IA 1VYVA 1MX3A 2PNFA 3AFGA 3BFXA 4RKYA 2BR5A 4QDXA 1G8AA 2PWYA 4N5DA 3MJ4A 3L77A 4GAEA 5EIFA 4CNQA 3WKAA 2IU0A 4NMMA 4CKEB 2HSGA 5CK5A 2WZQA 1MHPA 3L7KA 3R3HA 1N5JA 1W0JD 3H5OA 3W2FA 3WQRA 1SQFA 3ZCXA 5IZCA 4M8IA 4MI3A 3S28A 2Q1WA 1PEKE 1WY7A 2XMZA 2O2SA 3L6DA 2BOVA 1YBFA 3OPXA 2RI0A 4AF8A 4KGZA 4OJNA 2WE7A 5LPNA 1Z22A 1NC3A 3CCCA 4K6HA 4Z7NB 4DRZA 1P91A 1ZITA 3L0CA 3ZE9A 4QEDA 4ZJZA 2J6BA 4LC0A 1F3LA 2GB4A 2WT8A 4J0HA 2VTBB 3I6BA 1L7XA 4WFIA 3PRKE 2IUTA 1YT5A 1RP7A 3NTRA 2FPOA 2FX3A 2QT1A 5B6PA 3EMVA 1TX4B 2C83A 2WYOA 1HL7A 4LYHA 2Z04A 3QTBA 2WQ6A 4MXDA 4DVJA 4ER7A 2BL4A 3B6ZA 1V1RB 2EV9A 1IOLA 4KIFA 5I8ZA 4EG7A 5IT5A 2YZGA 4JL5A 4UUAA 4EYQA 3DAOA 3S1SA 4OKNA 4UBIA 4YDHB 1THZA 4UULA 5IN5A 3RC7A 4XDYA 5DK6A 3KPVA 1AKRA 4V0NA 3NTQA 1D07A 2QTVA 5EESA 4F3KA 3BXOA 3U48A 5DBHX 1OT5A 4QUJA 1LY1A 1BN6A 4G4SO 3S44A 3HVHA 3DEJA 3I58A 3MBIA 4EPXA 2P6RA 3CKMA 5CUQA 4QQ8A 2HFKA 3DZKA 2XCTB 5KTRA 1OXVA 1ZA1A 5DGHA 3TD2A 1B1AA 3VNBA 5G3ZA 2R00C 2W2PA 4ZDWA 2M6RA 1FY2A 2FUG6 3OC6A 4BHTA 1Z35A 4PLZA 1K3TA 1RKVA 5IAAA 1NJ1A 5KJFA 3VPDA 4D4IA 1ZIPA 1MOPA 1L7BA 2IHTA 2XX3A 4KE7A 1OLXA 4QDUA 3G7UA 4D4LA 4IDBA 5B3JC 1JR3D 4YRFA 4BX2A 4G85A 2WWYA 5K7SA 5EIXA 4YFVA 4JASB 1LNZA 2Z83A 3DDNA 3G9TA 4DBZA 1QF6A 1VSTA 2PGAA 4NMXB 3RNOA 2ZE6A 2PUCA 1DC8A 5ESDA 4Y2VA 2PUFA 2BFMA 5FJJA 2POQX 3UEOA 3L7OA 1JDBB 1MKYA 4U00A 2OM2A 5EN4A 2W4QA 1KK1A 4EMBA 1SPXA 2V6BA 2RAPA 4AC9A 1W44A 2W6ID 3C8MA 2Q4DA 2B2CA 2M98A 1II0A 5EKDA 2OCKA 3MBOA 1G19A 2INGX 1NYTA 1V3UA 2ONZA 2CFSA 1JIJA 1ZM9A 3UWMA 1XHFA 4D8TA 3N5KA 1J4AA 1AQ6A 3EOZA 1UEJA 5FO0A 4X5OA 5F7JA 2DR0A 4MCJA 4XPZA 1OH8A 3AF1A 3L05A 4EZBA 1YBMA 3T12A 3K9WA 4IDHA 4AYWA 4DV3B 2R5NA 2GZ2A 4BCDA 2LR0A 3GQBB 5PGMA 3HCAA 2SBTA 3T1OA 4D92A 1XMIA 5K3FA 3K2EA 3O4GA 4PIPA 1OX6A 1WF3A 5G1NA 1WBDA 4JI4B 2FFJA 2RFLA 4QUHA 5TPWB 4CQMD 3FIJA 1KQOA 3WYDA 4OQNA 2XXBA 4A0QA 1E9BA 4DADA 5J47A 1T0UA 1UDRA 4EELA 1BD3A 4NZZA 1XRPA 5IJ0B 5CHEA 1H23A 1V1MB 1EG2A 1RE0A 3SFZA 3M5WA 4CCAA 3KU4A 1HDIA 5IYZF 1H2BA 2YY7A 1RYHA 1ZY2A 2ZYAA 3WA7A 2C7QA 2XKJE 4NBTA 4TS9A 5ECGC 1OROA 2JD2A 3CPJB 4C88A 3K8OE 3L8DA 1GTRA 2E89A 1DXHA 1RQ2A 2WUWE 4AG5A 1RLTA 3PQ2A 2VRWA 1LKZA 1VC2A 1B0ZA 3KDSE 3LHDA 3TIFA 4F91B 1E7YA 4MKFA 3SX2A 4A2WA 1FFAA 1F0KA 2H92A 1BQEA 2XCUA 3IIEA 4XIGS 4AT1A 4XIYA 4LRSB 3QEBZ 2BSQA 4DQDA 3PPWA 2VDMB 2QJOA 1F9EA 2ZQ5A 1A7KA 3PHIA 2J6HA 4JCCA 4KJZA 4CEIB 2F1JA 1NX9A 2PX8A 4MW2A 1S2OA 1H8HD 3DSRA 1KI1A 4MIKA 2OLKA 2CHUA 5KOYA 1V26A 4OLBA 3V3TA 4UE3S 5JU6A 3EDMA 4C4OA 2CJPA 1K9VF 2Q5LA 3UXHA 3UT0A 1BE6A 2R3SA 1IK4A 1GU7A 2IYAA 3BH7A 4HNAA 4R05A 3VU9A 4E7OA 4KOEC 1S8NA 4YRBA 1VI5A 4ZVPA 5ALTA 3DXXA 1K5GA 3OECA 1RQGA 2VA8A 3FE2A 4AIRA 1JG3A 3VU0A 3MS2A 4RPHA 3HL4A 4Y2RA 1A2BA 1COWD 1NOKA 4KGXA 1MB3A 3GFRA 4CG2A 5KTSA 2XY4A 3D8SA 3T15A 2VPPA 4MVXA 3RF7A 5K0TA 4I1UA 2FPXA 4EAQA 1N7HA 5CIYA 3D3WA 1T1EA 4A1FA 2IPLA 1EFPA 1KO4A 4QOSA 5B57C 1MX9A 3FUXA 1RM3A 4RIIA 2ATXA 4ITVA 4LKOA 3RT9A 1CUBA 2JI4A 2CKMA 1UMDA 5JWOA 4MJ7A 2Q1SA 3IEVA 2OTCA 3HFGA 4TTSA 1TCAA 4CM3A 4CNBA 1GTSA 2YX1A 1JI3A 3KB8A 3DE2X 1XVTA 3IBYA 4MWBA 5E6RB 4HDKA 2WMYA 1K2VN 1P1HA 1IOVA 1I33A 2JKVA 2XCOA 4M0EA 4XPIB 4RYDA 4L0DA 2FDCA 3CZ9A 1N2CE 3AETA 3NKFA 1ZZGA 1AKWA 1DBIA 121PA 2P67A 2HNKA 1V0JA 3UAXA 2C9OA 2JHPA 2RGGA 2PZKA 3ZCRA 1QIHA 5B2FA 1R6XA 3IODA 1WTCA 2FSVA 5KX5A 3KSZO 5B3AA 3R5SA 1WP9A 2OFPA 2LD4A 1QTQA 2VDPB 4KSBA 3SS7X 4G0YA 4NH4A 4X8LA 5H02A 3TEFA 1B26A 3WL8A 3ZLJA 1BKDR 2PN1A 1TD9A 5TVKA 3FA2A 3IB6A 4C3VA 3LNTA 1J1IA 3H1TA 3DUFB 2NU9B 5LNK1 1E1CA 1AMUA 3DF9A 1EFRA 5IDYA 1KZGB 1VP3A 2RK6A 3V34A 5C4GB 3HA3A 3O95A 1WSAA 3Q9NA 5EZYA 5MFZA 5BO5A 3WA6A 4U3JB 3AUTA 4TGLA 1DAEA 1AKEA 4JT4A 2BGIA 1M1XB 4ZHQA 2NLOA 3E48A 2PBRA 3H42B 3VX4A 1AHPA 4RPJA 2D3WA 5LQAA 5ADHA 4PHHA 4J4BA 3NXKA 5E0KB 1EVZA 2G7ZA 4EB3A 3C3MA 3RVJA 2IT1A 2P3QA 3AIIA 4S2UA 2ERXA 2BFBB 4QBTA 4XZ3A 5LZ8A 2OV1A 3K1TA 2AOXA 4EATA 1GZHB 1VDMA 1W0KD 1KZYC 3BB4A 4L8YA 5FUBA 2QN9A 2W2MA 5DSTA 1O4VA 2PS0A 1M0SA 5DF1A 3U7RA 1CZNA 3DV2A 1NVEA 2C7RA 4LOKA 2V9ZA 4H1TA 1JJBA 4Y2SA 5DFAA 4HV4A 3R9XB 3PQFA 3RT1A 2WSSD 4MAMA 3GAFA 3CUUA 1Z7BA 3OQIA 4OFZA 5EHZA 1BDMA 4PC6A 2FRDA 3SSMA 3B2NA 4AG3A 2OAP1 1IM5A 4IHJF 1G5FA 4OJQA 2W8BA 3LT1A 4RZIA 4QXAA 1SC3A 5EPUA 2YC2C 2FX2A 3H5VA 4IJQA 3DVAB 5CT9A 1DBPA 3VOAA 3SVLA 4DRXB 2A0FA 4MV8A 4O08A 4RLHA 1I6LA 4D3DA 3MS4A 4ME6A 1BN7A 1ZK0A 3QI7A 1D2CA 1IWPB 2IU4A 3KQWA 4ZMBA 1CZKA 2Q4EA 2I66A 3AFIA 5EI5A 3SZOA 2RGWA 2HH9A 3EXG2 4Z5XA 3T3NA 1B15A 2X0FA 2GEKA 1GXSA 3DC2A 3B52X 1GDHA 2OGUA 3H65A 4J0KA 2E4YA 3QRWA 3BTOA 1B8PA 1ID1A 2R4QA 3CX6A 3LX8A 3SFVA 3X1WA 3P9XA 3QXHA 5HQ3B 2XUGA 4UHCA 4W1PA 5K0BA 4HZUA 4IXMA 2H2DA 3E84A 3AWIA 1DC4A 1T5HX 3S68A 1QO0D 4AU1A 1MG5A 3S2GA 2PGOA 3EVAA 4X95A 1VSUA 4XA8A 1Z2AA 4F3TA 2HAEA 3LBNA 1AS0A 1WZ2A 1QDEA 3RARA 5DI3B 1TIKA 1SUAA 4MWTA 5LDGA 1QYIA 3F96A 5TB5A 1NBME 1QU2A 2Y93A 1EEXB 1DELA 4KEAA 6ADHA 1KSJA 3PQ8A 1S7CA 2BI8A 5AK3A 1B41A 3W90A 2GTPA 3QNWA 4P3NA 3NNSA 2EEZA 1ESZA 2R8EA 3F5SA 1X0XA 5CEJA 3N2NA 3LRPA 1WV1A 1VJGA 3F7MA 4JLDA 1QZ3A 2KX7A 3BIJA 3DV9A 4LY0A 1M2OB 1QG2A 3OE7D 2XT9A 4DIOA 1PR6A 3KWLA 3PUVA 2RBGA 4RD3A 4UU7A 3RS4A 2XMGA 1CDEA 1A4RA 4LMRA 4L5CA 3GCXA 4A1OA 3ZIAA 4ZZ3A 2R48A 3UUWA 3L4SO 5FD8A 5K3BA 4F5EA 1XMQB 1A69A 2WYVA 3E4DA 4FXOA 4TM7A 4F2WA 2WTMA 2D00A 2H9YA 3DBIA 4H0CA 1Z07A 3E53A 4ZQIA 4IO0A 4TUYB 1ZNXA 1UMBB 1QS0A 4INPA 3RK0A 3Q8KA 1EIWA 1RRKA 2EEPA 2I71A 1C1DB 4QTYA 1FQOA 2GKOA 3IESA 4PNPA 2ZSEA 4GVXA 4M9ZA 2R6CA 4MMZB 2VHZA 2H48A 1OBCA 2NIPA 2ZIWB 4JBGA 3CBQA 4U2FA 3AVUA 4MGHA 1JVBA 2BR4A 3FHJA 4LVNA 3OKPA 1NURA 3K0AA 2IL1A 1L5KA 4LCJA 5J4YA 1VRVA 2ZBGA 4OK5A 2XNJA 5BWCA 1QNLA 5SYAA 3T7CA 1YR3A 5JAIA 1VL8A 1GUAA 3X1XA 3Q7SA 2O0LA 4IKOA 1UT5A 5U4XA 3WNVA 3U3DA 3R7SA 1XR3A 4TL7A 3EFOB 2QDKA 5KWJA 1S6YA 3PPVA 1GUBA 4OHMA 1RKQA 1DUVG 3PUJA 1AOXA 4JYZA 4G1UC 2D0DA 3A7DA 2H4FA 2ZE7A 3WV4A 3FNBA 2R9VA 1R8QA 2EBFX 3B78A 4A6DA 2GS9A 4WZZA 4DGQA 3S6JA 2K7FA 4K5QA 4KUHA 4D6YA 1OGJA 3VZPA 4MVJF 1SXJD 1JHQA 3B1FA 2WU1A 1SC6A 5AVSA 4OVKA 2WUEA 1CUUA 1GQYA 1WABA 5A9TA 4B5LA 1JI0A 1YZVA 1EEHA 2D74A 2VDQB 3CLRD 3KAPA 4FFOA 4TLAA 2NUAB 4ALLA 4EWLA 1I1QB 4AS3A 3UGTA 5T57A 2C03A 3G8CA 5FNVB 4D0NA 2O8EB 4RIFA 1K8YB 1NN0A 2FDRA 1GLNA 4JOQA 1ZYUA 4B6QA 2HHHB 4Z53A 4BCBA 4KXFB 3KFXA 1CUWA 1NQUA 2C4TA 2AFVA 3K2BA 1TUBB 2W2LD 2W93A 5EJ6A 1UXKA 4UXIA 3B36A 4TTVA 2DGDA 1K6IA 1UKZA 1XNGA 1ZN2A 2JANA 4RY2A 3HPRA 1IVYA 1OU4A 1EAMA 4ZCPA 3HGTA 3DUWA 1KZ4A 4GWKA 2UAGA 3T0FA 2X15A 2D2FA 2WC1A 1P4RA 1P2SA 2X1HA 3EA0A 3Q2KA 5I9IA 4LAFA 4RFVA 1K68A 1XZFA 4RQTA 2DT5A 1C9NA 2P2ZA 3I01A 2CMFA 2EZTA 3CFYA 1LBQA 2ZIXA 3NWPA 3FPFA 1AGPA 2ZRMA 2YJ3A 3F6BX 2BKEA 3MWDB 1FMLA 1FE8A 4LZPA 3LPAA 2G09A 1ISFA 2RGDA 2ZB3A 1R0LA 2A3NA 2CLLB 3STWA 4BGVA 2UVQA 1BVYF 2DJ5A 2PFKA 3DC7A 4LDPA 4HQKA 1BU5A 2BEKA 4LDZA 4IVPA 4RK5A 4YB8A 1AKMA 2OQIA 3L0OA 1IWOA 3ZKWA 1Z0DA 4IRMA 4FMBB 3A4MA 4QTUB 4A0RA 3BXGA 5LC1A 721PA 2C7OA 3HUEA 3JVEA 4IEIA 3VJLA 4O0MA 2J0SA 4X7PA 4D4HA 4DKXA 1H2YA 1KU0A 2V8OA 3K2QA 3QY9A 4DFDA 2P90A 1YTUA 3DWIA 3EAFA 3O4RA 4WXPA 1GIAA 2VJQA 1P6XA 2PZLA 4M36A 1HZZC 2DXIA 4MWGA 3W9BA 3IXMA 1IHYA 2HI0A 2JIPA 3P0IA 3QUAA 4P36A 3VJRA 2A6PA 2ZR7A 4FDAA 5EZ5A 2IXAA 5KTYA 4N0MA 3WQSB 2QTGA 2UYOA 5JYEA 1U63A 2C31A 3KZXA 2GCGA 3WADA 4UEJA 3UJ7A 2X42A 4LQCA 3K9BA 3OZAA 3R0ZA 3BD8A 4YO7A 2AC7A 3D6UA 3IPRA 1JIQA 2V1UA 2XUKA 3PDCA 4B35A 4IO1A 5KNBH 3LFUA 2HW8A 4C4SA 3GLIE 4LNHA 4IJ6A 4KGVA 3K1YA 1CS0A 2AK2A 5C46F 4JI0B 5B1HA 3U3OA 1BFDA 3F6EX 2FEXA 1XVAA 2DBYA 5IBRA 1IB6A 3FRJA 4H1VA 2B99A 4BEVA 3KUDA 2AJLI 1K9SA 2G72A 1OU0A 1XZJA 4EOGA 4O4IB 1IOZA 4ZYWA 3OQJA 1O0SA 2B36A 4LHEA 3ZQ4A 4KO1S 3UB2A 5FTWA 1Z3IX 1KJNA 5ALQA 1XRSB 2I6UA 3A9SA 4UAGA 4C7JA 3L92A 2IDKA 2C9ZA 1E3WB 3D4OA 4XOUA 4TV9F 2JHAA 3SF8A 2X2FA 4WOBA 4HDSB 2P68A 1OFHA 1SUSA 4HEJA 4GPIB 4M7PA 3TLGB 1FJXA 2FPGA 2FX5A 3DBLB 4GG1A 3WRXC 2DTDA 3U4GA 4XKJA 1NR7A 3FMOB 2EAUA 3NT5A 4BUZA 3RYCB 4CLOA 3I4LA 3LHKA 4J3JA 4FOLA 5EHGA 3UENA 3NS7A 2GTIA 4AYTA 1IIBA 1GPUA 2IU6A 4FEGA 1C0PA 1H69A 1NN5A 2D13A 2G82A 2PCJA 2WWTA 1QF7A 1FDVA 4YV1A 2FYTA 4ZI2A 2CMGA 3IT0A 3OQNA 3BC1A 1D8AA 3R7NA 1WTAA 1EDOA 1S0UA 3RUFA 2NUPB 2VPZA 1HL3A 2V0CA 3HB1A 4X7RA 3TLEA 4PC2A 3KQPA 3UMGA 4Z4EA 4L4ZA 5E8RA 4MHTA 1BEUB 4MP8A 3DE4X 5J2UA 1JEYB 2XYHA 3CE9A 1V37A 3AEQB 4MR8A 3FTNA 3QU7A 5FI3A 1HDGO 3OZEA 5SV2A 1T36B 4ZOCA 2LNDA 3REQB 6GPBA 1F6WA 2WMOB 3DTNA 1AB6A 3GL9A 5EYPB 2F1IA 3UQZA 1LI4A 2QL6A 3JARB 2B8NA 4H2DA 1G4AE 4HGOA 1Z29A 4U4AA 5ALDA 4MUKA 4BFSA 4EO7A 1F0NA 1L7OA 1V4NA 3JQ7B 3PPXA 4RKFA 4G09A 4KFRA 1W85A 3UHOA 4JENA 2VPXA 2B4YA 2DHCA 3K0FA 1NR5A 4NKRA 4UOEA 1TJNA 2JFBA 3I30X 1GZ4A 2IKQA 3OZSA 2KJQA 1ZVKA 2C3OA 2ZAMA 3MJTA 1AUPA 1Z74A 3NJ8A 1Y1PA 2IQIA 5SICE 2VXBA 3LQFA 5EWJB 4CDNA 2QRKA 1MXFA 4O2AA 3ZHOA 4G1BA 3HLKA 4KR2A 1X38A 3UGQA 3LUPA 4O5OA 5LOVB 1NGSA 3W78A 4CMAA 2JFUA 2FP3A 1L9XA 1TL7C 5IHPA 3EW7A 4AJ4A 3M5CA 3KVVA 4UM9B 5BN5A 4Q4HB 1IQUA 3VDNB 2GBLC 4DM3A 1GD1O 3JQAA 1KC3A 1PFVA 3LY7A 3ZHZA 4N40A 2RK4A 1SVNA 2DUWA 4TS1A 5K5EA 4CL8A 3S7TA 1K06A 4JJ6A 3TLKA 3W5SA 3H75A 5JE8A 4R9SA 3RVKA 2VLBA 2P75A 2P9BA 3DKKA 5ISMA 3A4IA 5DLYA 3PNYA 1PNRA 3BHIA 1QFYA 1XQ6A 1CHNA 4HQ0A 2AZMA 3VHQA 2RCYA 2X8LA 3W5HA 3URMA 3N8NA 4LYDA 3PHBE 4MW4A 3MGKA 5JO0A 2P4QA 3L1UA 1A04A 5EZSA 2HDNB 4RTKA 2BBTA 1ZOIA 1IQ0A 2FEKA 4MGZR 4A8HA 3QXSA 4UE6A 3ZLVA 2H1OA 4MV5A 5BR8B 2FY8A 4EGJA 1SRRA 2HU7A 2RJOA 1S9HA 4JEMA 3RSOA 2BBWA 3A37A 1V7ZA 1OA1A 2FSUA 1IN4A 2Y92A 1AUVA 3N0TA 4I4IA 3L6EA 1USIA 1KZHA 1Y8QB 5KNBD 2BGJA 3DOCA 4DE5A 5FLKA 5AOCA 1O5TA 3UV7A 2CNWA 4RMJA 1C8KA 1CUEA 2HQ1A 1DDGA 2HWWA 1V8FA 1DQPA 2OORC 3ILHA 2EW2A 4JU9A 1HDXA 2WVHA 3KUUA 4PX5A 3ROEA 1JDVA 1MMFB 2QRLA 3S2YA 2OAEA 1CQPA 3S8YA 4OG2A 3MCAA 1MZVA 5AKEA 3GPBA 1N1MA 1QWSA 4TVSA 3NM6B 2OQVA 1XZMA 2M32A 3DB2A 1E58A 4M9QA 1YWGO 4ARZB 2G9UA 4QRDA 3DE1X 4X6UA 5SZIA 1AK2A 2FHPA 1W4RA 5GWXA 5L4LA 4ND5A 4FBLA 2X76A 1PUIA 2Y68A 3MJCA 3NC4A 2GN9A 2AB0A 3OT1B 3S27A 4EY5A 2F62A 3AI1A 4O1IA 1LA2A 4UAJA 2PXCA 4XYBA 3R7BA 1QIEA 1H42A 3GFFA 3U13A 3IEXA 2BKXA 1X94A 3AOEC 3ETEA 3HJUA 3LH5A 5BUQA 1FW6A 2P5UA 1OSNA 1R5OA 1UEXC 2IPNA 2YJ4A 3USCS 2PLNA 3AR6A 4HWSA 2BEJA 2R84A 3W5AA 3P9IA 3NALA 2B4RO 2IXTA 4JJ7A 4Y6PA 4D5GA 5HZMA 4HI0E 5KVQA 2R5WA 4XR9A 3H05A 4NICA 2Z6VA 3UK6A 1D0IA 3UJNA 4PYRA 5FPHA 2HKIA 1E1RA 2IDMA 3N05A 2JGRA 1GZ5A 2C92A 4MYSA 1F2DA 4MWSA 3T1VA 2PX0A 2J45A 2SHKA 1CIVA 2JDID 2R7KA 2WFZA 1DAPA 1R00A 5FUXA 2VYVA 3KKQA 3SSAA 3TTSA 1I7DA 4DR6B 4HRAA 1T15A 3T5TA 1HBJA 5A4FS 3KB1A 4PZYA 1MN6A 1NU8A 3TNDA 2XRFA 1YE5A 3PS9A 1DO2A 3PX7A 3RUDA 2ET6A 3RBAA 4PZLA 5BSRA 1YFKA 1MFZA 2PTHA 3OAAA 3IA7A 4CM9D 3PD1A 1ATIA 1IUKA 2SECE 1QHXA 4YJGA 1SU7A 5IM5A 1I80A 3KVOA 1HTTA 1D4AA 1HFKA 1M0TA 2QX4A 5J63A 4B43A 3MQ4A 1VJTA 5FBZA 4MO9A 5H3CA 3THRA 4X62B 2PL1A 4GI5A 3DBVO 4NXMB 4C1NA 2Y27A 3BXEA 1VE5A 3ILYA 3NKLA 1GAWA 3EK2A 4IGIA 3RRJA 1ZC4A 3GK3A 3HXQA 2BFEA 1DE0A 1YJCA 1KK0A 2EGHA 2YINC 3II6X 2GZAA 1YR9A 3NYWA 4Z0PA 5C32A 2JGJA 4YH1A 5JDIC 5HVNA 4DQXA 4TKUB 5B1IA 3KSBC 1QZTA 2IRWA 4HRVA 4DLKA 3BZBA 3NRCA 5GVRA 1T9GR 2OWDA 2G5TA 4BVKA 4QD3A 3PVSA 3ZI4A 1ACLA 1P5ZB 4FB4A 3VDQA 2GPBA 5GADl 3OPYB 4LZAA 3FBGA 3KHKA 4Q9HA 1KY5A 3S2UA 1FUYB 1A5TA 1V16B 3N7UA 4C7KA 2R65A 3I1IA 3J7AC 4TZ0A 1NY5A 4L3WA 3RVQA 2CWDA 1EVYA 1E8DA 3JRWA 3UUGA 1QOQB 2A8YA 4X1KA 3WP0A 3BMQA 4L28A 4ABYA 5A02A 4BE7B 1SUEA 3GEMA 1TC2A 1N3LA 3IEIA 3TQFA 3WL7A 3PITA 2FUEA 4UTVA 4IIVA 4GOOD 4QJ3A 1JE1A 1LFDB 3WAKA 2HA5A 1XKLA 1Z5VA 2H29A 3K9LA 1SCAA 2AG8A 3I2KA 4U6SA 5CFZA 3WNCA 2Q0XA 4QJ5A 4ZI7F 1IY0A 2DHDA 2ODBA 1KJJA 3SN6A 4DSOA 1CYEA 2MDTA 5C8ZA 1OGIA 2B34A 1U81A 4Q37A 4BIIA 3TZBA 4XSHA 2G71A 5EPOA 3P9PA 3OO1A 1SIOA 3R1IA 4CMEA 5L3ZA 3WDKA 3WMWA 1CY2A 2EZ9A 2OSBA 3DLPX 3JTMA 1H4VB 1Q0SA 4ZAVA 3TM4A 2J3MA 4QPPA 1Q15A 2B37A 3FW1A 5C0OE 4EFNA 3GLRA 4IIJA 2O9JA 1MGPA 2FQ1A 4JC0A 3HR7A 3U80A 3WYGA 4CM8B 2F4VB 4CLXA 1H93A 3GXOA 2Z1DA 2HXSA 3C7DB 3GFQA 3VM6A 5BVGA 2E5WA 1E2FA 2WVGA 3K32A 3KWJA 3PEEA 2YWRA 4IYRA 5I5EA 3UOAB 4FW8A 4YRSA 2GXQA 1L5WA 4MR9B 1A77A 1T1IA 5KNDH 3U4IA 4U1RA 5I3CA 1SOAA 1Y6QA 3HO1A 5TQVA 5LIRA 2DUMA 4L15A 4HXYA 3EGXA 2Z4TA 2OENG 5SYMA 1PWZA 1WXDA 2ZYRA 3FOBA 3GJ7A 3R3VA 4AUKA 4ZVKA 2ACVA 2ILTA 1Z13A 3C6BA 6LDHA 4LISA 2KI5A 2DOKA 4MRNA 4F46A 4YRMA 3N74A 3FLEA 2H5IA 3OWXA 4F0JA 4UTPA 3TBHA 1G8PA 1HNZB 2QRVA 3F46A 3VVMA 1XJCA 2FOLA 4NR0A 5LWQA 3EBOA 3I6ZA 3BMXA 3FH0A 1R10A 2DQKA 5CFNA 1JHPA 4YHHB 1SU8A 2EP8A 4HR7A 3THYB 1M2EA 2GD6A 1D2AA 3GLTA 2AW3A 4R8SA 1CZOA 4ERXA 4MDEA 3EDRA 3NBAA 4G1MB 4OBEA 4YUYA 4ZCTA 2H4WA 3NGMA 5EZYF 4TMKA 4Q03A 3LYAA 5TMPA 4KXUA 5AI8A 4F11A 1U7HA 1GSOA 3BJRA 2FETA 2J9GA 2IELA 4HTAA 4IX9A 5H83A 1PQ4A 5LUBA 5BVHB 4NBRA 5JZBA 1KI8A 2XAUA 1SKMA 1IZYA 4NE7A 1OZ0A 3VNVA 1Z0ZA 3C3XA 4EGCB 1U3GA 3GI1A 2ZCUA 3COWA 1YVEI 3D0KA 4FMCF 3P9KA 1TEHA 3GD5A 3S8MA 1BKYA 4MVCA 2PX3A 1GRRA 3NU1A 1G3IA 4FT2A 1Q1NA 3CNQS 2A9OA 2PVPA 2JFVA 5KQMA 1RJ9A 3KKZA 1RCUA 5M2QA 5B1EA 3BYZA 4JZKA 4KU4A 1J49A 2ZBPA 4L3OA 1UOQA 4CTNA 1U2SA 4O2BA 3ZBQA 5JCZA 1HK7A 4DA0A 3T3EA 1RLMA 5DRTA 3TUIC 3MJRA 4B3TB 3LVRE 1NVUQ 4N3AA 5CTAA 4CCSA 5CAEA 1RZVA 5JOQA 5JNLA 3QKSA 4FMDF 4KJXA 3T94A 1VL6A 5AUNB 4OAOA 4BJ6A 1QGED 3IPAA 1TW2A 4WNIA 2GK4A 4GEGA 1GY8A 1K66A 2AUNA 2EXXA 4PBTA 4GKVA 4TLCA 4TWIA 1G21A 1J0XO 3HA5A 1G7SA 5JROA 3W9YA 1ZH6A 2VPYA 2PSHA 1EP1B 1R6DA 3NC1C 2HIHA 1YJQA 3TO5A 2JJ8A 5D3MB 4DLZA 4E46A 4L75A 3CLHA 1D5CA 1L7PA 3DHWC 3TXXA 1Z4MA 5KAMA 3CQ9A 1ZMRA 1IIRA 1JPNA 5J9FA 2ASVA 4D9EA 2ST1A 1TKAA 5LZ9A 2WKWA 4D9FA 4DPLA 4FYXA 2Q8NA 4N7RA 5AWFC 2JH9A 3P71T 1W19A 1Y6ZA 4GFDA 3VR4A 4RPIA 5KNCA 2A5YB 3F4LA 2QXUA 5IJAA 2MR5A 4DLTA 5JPCA 5TEWA 5KNLA 5JVDB 2GHRA 3GAZA 3HDQA 4GMKA 4M0CA 5ARDA 4AG6A 4BP9A 4YV2A 3DL7A 1DJNA 3V1MA 4C06A 4G67A 1XZPA 1AN0A 1E3DA 1N9KA 1TU4A 2WSMA 4FQ8A 4S1VA 5IMBA 4BMNA 5IW8A 1GGEA 5C80A 3QJ5A 1CETA 1CEQA 3D7SA 1YCGA 5FRDA 3SC4A 3QFTA 5FBLB 4BTLA 4HBGA 3L8EA 5H80A 3T4EA 3ZWBA 4B79A 2JGKA 2XMCA 3I9LA 5BY2A 3H2SA 4FDMA 3KQSA 3P52A 5HF8A 1KRHA 1TTHA 2VUIB 1FSFA 3WB0A 4MEAA 1RJEA 4DDMA 5L6MB 4PAMA 1S02A 2QHXA 2F3RA 2P0YA 3KFVA 2QUJA 4RSGA 4X93A 4YMSA 1MRSA 4LYGA 2QD3A 1IG3A 1XYGA 2H9IA 3AEYA 5EQJB 5C1BA 4Z4FA 3AVWA 2Y67A 4B3JA 2BFDB 2FMXA 4G86A 4EVRA 2WB2A 4YS6A 5IASA 1U5BB 2OVFA 4IH4A 4LHYA 2PFGA 2BIFA 3OQMA 3RSGA 3LC2O 2CWWA 1Y7TA 4XX0A 1JDPA 1LQUA 4HEA1 3TCXB 3WWYA 4BN4A 4H7JA 4QICA 4YAIA 2FN4A 5INTA 2JI9A 2AR9A 2P0EA 5HZKA 1R12A 3ECCA 2OCIA 4KPYA 5GM2A 1EP9A 4KXWA 4M8KA 2OCAA 4DJ5X 3LUFA 1UBJS 3GO4A 5ALUA 4N8SA 1B6RA 1QV7A 3Q87B 3Q3HA 1I36A 1W88A 1KVUA 3DE7X 4W9NC 2VOJA 3S55A 4MVJE 1T9DA 3U9LA 1JDZA 2OZLA 3DEAA 1A8PA 1U4OA 4UUOA 4AN4A 5HUQA 2ZRGA 1ZCJA 1ZM2A 3B13B 1O58A 3B89A 1E6CA 4G1CA 1U7ZA 1K08A 5DO9A 1CUJA 2ZJ8A 5I7OA 4HQFA 4UPEA 2I4NA 1NW4A 1KIMA 2GF0A 3GDGA 3GG9A 3PNSA 4DYHA 2Q0HA 3TMKA 1ECCA 3QA3E 4IINA 4GQIA 1NOIA 5KYTA 4OREX 3U3JA 1N0WA 1T10A 1N2JA 1Y34E 2B9EA 1WG8A 3DZGA 1T5LA 4I55B 4UEOA 4P3XA 4HNUA 2W42A 4Y2XA 4HVAA 4QHYA 2QAGC 5I9NA 4BNGA 4KQXA 4QOHA 1BWRA 2ZYGA 3ROTA 5BSHA 2X5JO 4FVTA 2YV5A 1ULSA 2FGKA 1Z37A 2Y0BA 5CLGA 2F9FA 1DCKA 3BTSA 4Q3EA 3ZHSA 3QPWA 4BEJA 2B82A 3AHDA 3INGA 1RHQA 4EDFA 3VJMA 5G2OA 5WRFA 5L51A 3H8JA 3C5EA 3F74A 3DZFA 5E1OA 2MU1A 3C7TA 4BE9A 2AFHE 2VKTA 3QSGA 4ASUA 1TI7A 2A35A 3A1VA 4DM4A 1YVRA 2HPHA 2CKDA 1NF3A 1OXMA 2PH3A 3CVJA 2Q7DA 1UPCA 4G5XA 1XAJA 1U2DC 2O3JA 2ZDQA 4BB9A 3ZWOA 5K8VA 2FP4A 5D87A 1ZX1A 1H0HA 5EG5A 1XZQA 5FBWB 5AVUA 4NXNB 3LC7O 1BDJA 4EGAA 1ARZA 2NO6A 1OFVA 1T5SA 1V4VA 3VYRB 2G5PA 1Y48E 5E4FA 3O0DA 5GQSA 5L3SA 3UATA 2E4UA 2V7XA 3U5TA 2IZ5A 3V8NA 5I9LA 3M82A 3DVSX 3BIOA 3IERA 1V6SA 2P69A 4WGGA 5DWDA 4FPXA 3W8FA 1GGFA 1NQAO 1H9AA 3BL6A 3ACDA 3T61A 2CYAA 4JB0A 2W83A 4OQPA 3T35A 4YP9A 3D2AA 3DBRB 1CQJA 4G97A 4RZXA 4I5IA 4XR4A 3T3MB 4D3YA 3Q8MA 4G63A 3SICE 4KN8A 1HYGA 2WW8A 4JXXA 1P72A 3PHGA 3TIIA 4J3NA 3OTOB 1GPYA 4X6YA 3EC7A 2X8JB 3FVTA 1IYZA 5CMLA 3VPFA 3K35A 1MOSA 1SFRA 3HN7A 4KL8S 2J3LA 4MUNA 1H94A 4NG4A 4O5AA 5H3HA 5A6SB 4EGFA 3ESYA 2ODEA 3SLKA 4DT1B 1U0FA 4BVJA 1VMKA 2B7LA 4WD3A 3DE3X 1FLDA 2ARKA 1T2DA 4BKQA 3QBJA 1K7EB 4CR6A 2I34A 3IKMB 1SBHA 1SUPA 2QWXA 4O2RA 4FM9A 2ZUEA 1X92A 2JBAA 1KI7A 3CNHA 5I9MA 4WRRA 5D01A 3TL2A 1G2IA 5K0FA 2ZQYA 3V2GA 1NOJA 5AICA 3MD0A 1FC0A 3Q7QA 4YAWA 1HG1A 4L2IA 4PFKA 3HUUA 4D02A 3W3ZB 1J70A 1U8UA 3IP5A 4FS3A 3U60B 3FVVA 3HYSA 4LMAA 1KR2A 2X5KO 3L79A 2P78A 2PWZA 1NFQA 3HB4X 2HF7A 3PYLA 3QXGA 1RCFA 4I6GA 2WFMA 5G4KB 2NNWB 2XOXA 1XMVA 3N3AC 4KQEA 3S99A 2C5BA 1ZWLA 3BIXA 9ATCA 4QXQA 2VI5A 4R2IA 4KRGA 4U2GA 1YA8A 1S4MA 2FWPA 3SOPA 3GGDA 4DLWA 4F8JA 1K7FB 2XHEA 3UANA 1IULA 1R9MA 1T34A 1DKOA 3H8WA 3QVOA 4NECA 1U1EA 3CLSC 3CSSA 3ZV4A 3HWX1 1IK6A 2QL7A 2WG0A 1ULUA 2GQ0A 3BN3A 4W5RA 5K0SA 1RC8A 2CHFA 2DZDA 3VPSA 4CF7A 4DXAA 1A88A 3U2QA 5JAZA 1CY1A 1PEYA 4FP9A 1Y7LA 3L7BA 5E38A 5KMGB 3OZTA 4FWTA 1FJHA 2OCDA 1KJ9A 4W82A 1P2FA 3KTAA 4NY1A 4J3FA 4UPDA 2P9EA 3GT0A 1BYUA 5CXQA 5KO2A 4DTIA 2HGZA 2J9RA 3BGVA 1ELOA 1I2AA 2RKBA 2BUBA 4M21A 3GH3A 2CXUA 4UHFA 2FZ5A 3DR3A 3SX0A 2AE2A 1YGPA 2IW1A 3AT1A 2E2WA 3NW9A 3G8AA 4L6CA 2PYZA 1FZQA 4X90A 4DAOA 2VTBA 1IRIA 1ZD5A 2R751 3CVYA 4JI8B 1QG0A 3HB7A 3HFSA 1YS9A 2I7VA 1BU8A 4NOKA 3RYFA 4B7UA 2QD1A 4RLSA 1E6MA 2LBPA 3KVRA 2GN4A 3LNCA 3SE7A 3ZV5A 1MO3A 1B0UA 5DBEX 3WWCA 5LMCA 1B00A 2HCTA 4FGSA 4RJIA 2GPAA 2UUPA 4RABA 2F3PA 2QW8A 5CK4A 2PD3A 3FR8A 3M0EA 1AZSC 2F3SA 3L6CA 4TV8B 4B3HA 4BRSA 4CIWA 1XI2A 1BSVA 5CEFA 4RZ3A 1PJ8A 4PAWA 2FW6A 3QVUA 1Y8CA 3H4TA 4MPJA 1ILEA 3ILVA 4IF4A 4LDNA 4P35A 5D84A 2NV2B 1PSDA 4J4HA 4X20A 5TS2A 1VG8A 1AKUA 1YR6A 4KQGA 4NCIA 3E9YA 4DQLA 5BV2P 1J0CA 3ZG6A 2VO1A 1Z5PA 1LX6A 3O3NB 3WLNA 1ODKA 2ZE8A 1N6HA 3BWYA 3P2JA 3AO0B 1R27A 3GEPA 5E4YA 1MQAA 3WBBA 1G17A 2XT0A 4OHPA 3WGHA 2QMZA 3GLFE 1NTOA 3GN1A 4R9NA 5AXCA 3REOA 2VF7A 1FTSA 4UFNA 4CEHB 2OESA 3HQ4O 4O2AF 3OZCA 4AN0A 3C3AA 5ICMA 4EQ6A 1T1RA 4BMDA 3T9DA 4R9UC 2GK6A 3HFJA 4AROA 4LYAA 3C1OA 4B0OA 1ZBDA 3VZQA 4GMHA 2RGAA 4LG1A 3VR5A 2GZ1A 4K1XA 2M1ZA 3B7GA 1M72A 5EAIA 1M67A 1N2EA 2Z6QA 4ESOA 1FOEB 4HQLA 5AXDA 3ASVA 1GZ6A 1BWPA 4OMCA 2CLKB 1LLCA 1M9NA 4M88A 4PHGA 1ZCBA 4OO3A 4A8TA 4RJJA 4JI2B 4B74A 3LBYA 4ENUA 2BEUB 2CV1A 1YXMA 4YO8A 5F64A 1SG9A 2P9ZA 3AEKA 2WVJA 4IEFB 1Z18A 5BV0A 1HT1E 2FSFA 4UCQA 4IGEA 3VU8A 1LGYA 1RRMA 5T4HA 4OLFA 2CVPA 4INZA 4KQWA 4IDGA 5T4BA 4C6SA 5IXYA 4IJVA 1MOZA 1GUZA 1Y1KE 2C95A 2WMNB 1W87A 2R7LA 4QDTA 5ER9A 1O97C 3LW8A 5KDLA 5IMSA 2I4RA 2PGLA 3TLBA 2CCKA 5EHNA 2HMWA 2E5LB 4KAAA 7REQB 2XXAB 4XWTA 3NH9A 4XWOA 5TIIA 4FYIA 3DJYA 2D5BA 4K8RB 3R6GA 3UUEA 1JKIA 4B2PA 3JQFC 1MR3F 4YDQA 1LV8A 2WF7A 1N75A 3EIHA 1CR2A 4RA6B 4DLRA 1PL8A 1FP4A 1H6DA 4U9IS 4X7MA 3FMVA 3AOEA 1K1EA 1TT5A 4Z8XA 2VCHA 2CDCA 3FBWA 1TMOA 3ENZA 3V2HA 1EZZA 2P1DA 3M33A 5FLEX 1NVDA 3BGWA 3T52A 1Y5LA 3A6ZA 4PCAA 3C3EA 4IJMA 1GSAA 1QYWA 2V9CA 4BVAA 1ZOOA 3D1JA 5IH3A 5FYQA 3FSEA 1H3NA 3V6LA 5ELLA 4L9SA 2G25A 3I92A 3W34A 4CF3A 4D57A 4JBHA 1A76A 5JAOA 3GU3A 3AF6A 2FPRA 3FTEA 4Y2PA 1T0BA 1TPYA 3GEEA 4BEBA 5CB4F 5A5VA 3GFTA 3Q4GA 4OLHA 2YY5A 4X45A 5A5GA 1XYVA 3ZOKA 1N0HA 2FPIB 3TAUA 3WWZA 1J8DA 4HN4B 2JJ2A 3UTCA 3I39X 3TPCA 5JG7A 1IHOA 4OI2A 4OQMA 3L8HA 3TR0A 4E3ZA 1XALA 2C8JA 4IVNA 1A7JA 1W4BA 4NQRA 1Z16A 4BO9A 1FNBA 2PUWA 8ADHA 4X3OA 1V7QA 2DKOA 1PL6A 3W4IA 5KVCA 4EG1A 2JIMA 2ONYA 4GSLA 1CQIA 3E3MA 2C2GA 2EL7A 2F64A 2X4IA 1G6KA 1NU6A 1XF9A 2CFOA 2O0MA 5J58A 3U6KA 4TM8A 1LBIA 3HJBA 3N39C 3PDIA 2O2ZA 4ZYVA 1SCIA 1JR3A 2J32A 1VLVA 1QHEA 1LTQA 4HGRA 1P19A 1SCUB 1PTJC 4GUDA 1T5OA 4X92A 4Y0NA 4UQLA 3J81A 1L8XA 4BVLA 3WB2A 1N8TA 1ODIA 1VJDA 4HPWA 4B9EA 3PVCA 4J1TA 4JLSA 4P0TA 1Q0PA 3I9V6 3SP1A 3ZJYA 4NE2A 1TJ4A 2AD5A 4CMIA 5IYZB 1QM5A 2IQ5A 2WMDA 3A2LA 4AW9A 3QOFA 1EGVB 3SQNA 3AF3A 2R60A 4WY2A 2B8TA 2V3CC 3JAKA 5CT8A 4Y9RA 4BY9E 4I14A 3HKEB 2W0MA 5IFKA 1D6SA 2EP7A 3W05A 4X1IB 4ETWA 4WOJA 4I9HA 3L18A 5DBFA 3VMMA 3WXMA 1X7ZA 1OAOC 4PSAA 4PQEA 3ZJVA 5TDHA 1APBA 1SZCA 1ZNYA 5L9AA 1TVKB 3ND8A 4OGGA 3VNQA 4EECA 3CVWA 3MNFA 2JLAA 3CEHA 1LPOA 2R8ZA 1M5TA 2ZPUA 4GP7A 4RU1A 5FADA 1R15A 3EARA 3FG9A 4CQMA 1PF7E 3U44A 4EBBA 5JBIA 1USVA 3M9WA 4BBZA 2BE7A 5LSAA 4R16A 4K9PA 3LXMA 5REQB 4NENA 1C4KA 1TUGA 3IQZA 2VUTA 5DOZA 1YL5A 4OXXA 1L1RA 1TIPA 5CG2A 3JXEA 1CJMA 1F8YA 4MLZA 1IL0A 1SWWA 4RY9A 1TOAA 1ZKDA 3CX7A 4K88A 2OECA 4XXHA 3OMLA 4NZNA 4PWYA 3GJ4A 1WVGA 1IATA 1RKBA 3MEQA 1I5RA 3QLJA 4UUBA 4DYVA 3M6AA 1CS4C 1ZO8A 1N0IA 3O4FA 1I2ZA 1AGNA 4HVLA 1RACA 1TK3A 4GI1A 3WR5A 3SQWA 3OZDA 3G8YA 4RTPA 2IOFA 1CY4A 3VSDA 4XVRA 1DINA 1EFDN 5IXJA 2AXNA 1NMQA 1UC4B 2M6LA 5C1OA 4P93A 1SXQA 4OKIA 3VR0A 1PI3A 3VFDA 3RRMA 1YJXA 5DPMA 3RCBA 1P8AA 4J7XA 5JH7F 4IIJF 2EFGA 1U0NA 4X24A 3ZV3A 1EM6A 1NVMB 4A0GA 1KDZA 2C88A 2J33A 3SX4A 3TFQA 3BWXA 3OWHA 3ZW9A 1OXSC 2Y9PB 4LJ6A 3KS9A 1Q3KA 4TLMB 1G18A 4WXHA 4YRGA 4JXJA 5CFQA 1P0IA 1MXHA 1FFSA 1G98A 1XCMA 2PRZA 2H18A 4GWLA 1J00A 4WPGA 1NQ5A 4TRMA 1KP3A 1KZ9A 1VHTA 2I4LA 3D02A 3PKJA 3UICA 4DPMA 1NW7A 4W8GA 1E59A 3LKDA 3UIEA 1GKKA 3FHLA 4ZQBA 5C35A 3G5TA 1X1CA 4EPRA 4PQFA 5IKOA 1FYXA 1COWA 1YU9A 1K98A 1KS9A 2CMDA 2JCYA 1AM4D 1L7VC 2OMEA 4G23A 2O4CA 4A2PA 4D9NA 1U7WA 4J6FA 2NMVA 5F98A 1BHSA 1YD7A 1LU9A 2IITA 3ME5A 1I30A 4PG4A 4TYQA 4Z7QB 4BU0A 4DR1B 2QRMA 1O9GA 4E12A 1B0PA 4KBFA 4MICA 4QECA 5ULLA 3GRZA 4PS1A 5DNWA 3LUAA 3RUAA 1BX1A 2W6QA 5C2JB 1JZSA 2YWFA 4EUHA 2IS4A 5AHOA 5AW7A 3B6EA 1Y8RA 3G0CA 1U3UA 4C0SA 3JSAA 4TWJA 4V0OA 3TGPA 4I4TA 4FYYA 2PMEA 3RANA 4JLKA 5LZ7A 4CZ2A 3G0HA 2OR3A 2ZYDA 2FQQA 4HDRB 4KQ2A 1E6LA 1E18A 3I2YX 4F4IA 5I7HA 1JIKA 3MB8A 3RS9A 3OP4A 1L5SA 2FPMA 3VPXA 2A1TR 4PXYA 2EW8A 3RNLA 4Y9SA 3KXPA 1XWWA 3OEHD 4PSKA 4HUJA 2FE1A 1DC3A 2YV4A 2HWUA 2Y4OA 1GVHA 2A0XA 3ANLA 1M34B 2L0XA 5CX1B 2WJVA 4EY7A 2VQDA 5IWAB 1ZLYA 3RYHA 1C2TA 3DMHA 1U2GC 1M5UA 3HGQA 3NHKA 1JTVA 3ADKA 2GPJA 2VXOA 2Z08A 2IWHA 4EEXA 1QYRA 1LSSA 3H2ZA 4BBPA 4D9JA 2DPHA 3L7DA 1RBZA 3E9DA 5CG1A 10MHA 3TOSA 3MTDA 1EFKA 2GM5A 1OUMA 2O5CA 3OLWA 4JJ4A 1ZUNA 1OBHA 4NFSA 3NIFB 4QNRA 2WZDA 5HXAA 3AEUA 5IJXA 1KI6A 2WD7B 2B8EA 2XWJI 3IVGA 4D9GA 5FEUA 5JD6A 1YS2X 1OLSB 2K87A 2PANA 2QQFA 5DM2A 4KXYA 3D5EA 4WZAE 7GPBA 1N6OA 3PNMA 4UMDA 5ENZA 5D7BA 3ASYA 1GZ7A 5JD3A 4N5MA 2ECKA 4XSGA 3GFVA 5B7PA 2OFFA 2GCPA 5GTDA 3D6FA 4EKIA 3T9EA 5IHXA 1LDEA 3FHOA 3CWQA 1W0KA 3HMQA 1E8NA 1Z12A 4U2EA 4CKBB 1Y6GA 1DAHA 3EPHA 2FRXA 4Z2AA 1ECJA 1WD5A 1UDBA 4AULA 5GIPE 1NMZA 2XQGA 3GC6A 3KQYA 4K3VA 4QJBA 5DP2A 4B2IA 4JYAB 2O8NA 3N2KB 1SB9A 3LT2A 3EE6A 5K2MA 2F7SA 3ZJ5A 3VISA 4N12A 3GEGA 4CIDA 1XCJA 3MM4A 5HZHA 2ZWOA 3MJFA 2NTVA 3K2IA 2R8YA 1Q6ZA 2HBYA