3S8FB

1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title High resolution structure of the ba3 cytochrome c oxidase from Thermus thermophilus in a lipidic environment.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s8fB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s8fB02
1KGBA 3NS0A 2BW4A 3CAPA 2IAAC 1UCQA 1ASOA 3NP4A 4YSAA 1BEXA 3TBCA 3UONA 1L9OA 2PP9A 1AAJA 1JXGA 4XTOA 2AZUA 2IWEA 3REYA 3RZEA 2YCWA 4YSRA 1R1CA 5B1JA 3OAXA 2NTWA 1N68A 1C8RA 5G54A 4DAJA 3EMLA 1S54A 5H2JA 2XVBA 4HYJA 2XV3A 4YSQA 1E12A 4TXVB 5I6NA 3S8FB 3CVBA 2WO2B 2X88A 4UAHA 2J57A 1PXSA 3S8GB 5EN0A 3UTWA 1X0SA 3T6XA 1IKOP 1QHQA 1NINA 4BXVA 3OM3B 1ETJA 4YSTA 3OE6A 1SF3A 3KW8A 4JHUA 4DP9X 3L45A 2YARA 2HRGA 2I7OA 4HALA 3NY9A 2I21A 4YSOA 2GC4C 4BV0A 1F50A 3OE0A 2YDVA 3P0GA 2EI4A 1RZPA 2B3IA 5B2NA 2QPDB 3FSZA 1CYXA 2VW6A 1ILUA 3HAQA 4LDLA 1NIBA 4KOBA 5I28A 2IDFA 4BWUA 2Y00A 1WA2X 2WO3B 3PAVA 1J9QA 2BW5A 1FFTB 2WSDA 3UG9A 4YVUA 3DIVA 1CUOA 3ERXA 4GP5B 3X3CA 3JTBA 3IBOA 2IDSA 2FNWA 4L0PB 1J9TA 1M57B 3UGEA 1E67A 4A2HA 1PNDA 2IWKA 1PNCA 1JZFA 4FA7B 2XV2A 4DPCX 2XX0A 3SBPA 4XT3A 3MX0B 4CSZA 4LDEA 1ASQA 1FBBA 3QJQB 4KNFA 2GSMB 2MTAA 2P80A 3CDZA 8PAZA 1EZLA 1AT9A 1NTDA 3NJLA 3S3CB 4AZUA 1PCSA 5B7FA 1W6LA 2VW4A 4A2GA 1GZMA 3PXOA 4WW3A 1AG6A 1AIZA 3D4SA 1RKRA 4DPBX 1C3WA 2NRDA 4PAZA 3AG4B 1SNRA 3UTVA 3SN6R 4E9YA 5A8EA 1L9SA 3IN2A 5B1KA 2WJLA 3QBGA 1KCWA 3N2JA 3NSFA 5F7BA 1NZRA 2YAOA 1Q5IA 3C9MA 2VM3A 1ID2A 3NT0A 3UADA 1IBZA 2Z55A 1AG0A 1MZZA 2DYRB 2JXMA 2CUAA 1U19A 1URIA 2ZIYA 2R7EB 5KKHA 4NAJA 2UXGA 2B08A 1B3IA 2VSMB 4QLWA 2TSAA 3CZUB 4HHGA 4Y9HA 2Y1AA 5IY5B 1PY0A 4M3HA 1BAWA 1TEFA 1JVOA 1NDTA 4A2DA 4A67A 4KNTA 2R4RA 4BXSV 4F2EA 4GY4A 4HCIA 1RZQA 5H2LA 2L6XA 3ZPRA 1M56B 2Y69B 1XMEB 1CWQA 2BP8B 4M4RB 4QKTA 3UTYA 3UZCA 1ZIBA 4YSSA 4GP8B 4GP4B 2PP8A 1GR7A 3PLYA 4Q89A 5FC9A 3UAAA 5I6KA 2J5WA 1PAZA 2BHFA 1S8LA 1T5KA 5D4HA 5JJJA 3VVKA 3RYMA 5H2HA 4PCYA 1AANA 2IWFA 1QHJA 4KLYA 3QJVB 1BQKA 2IDUA 1M9WA 1BM1A 3TA4D 5H2OA 4UANA 1IW6A 5I6MA 1CYWA 5AX0A 2PPEA 5B1JC 3EH3B 5AKRA 5B6ZA 4DKLA 1CURA 1PMYA 2PP7A 3ASOB 3AG2B 2A3TA 1GYCA 2UXTA 1NWPA 3CODA 1PLBA 3HAOA 2XXGA 5D4IA 3WI9A 2QDWA 1JGJA 3X1GA 2IH9A 3OQRA 2OV0A 1AZUA 5F7AA 3WNJA 3C9LA 4P5SA 2OCCB 4GYBA 4YSUA 3AG3B 1BXAA 3NJFA 5AFAA 1L9HA 2ZONA 2YXVA 1WA0X 3HEIB 3ZEVA 4KO6A 4X32A 5G28A 4G7SB 3NJKA 3PXLA 4J4QA 2F93A 4PXKA 5B35A 3ZPQA 1ZDSA 2YAMA 1XIOA 1AZRA 5I5MA 2CJ3A 1XB8A 2HXAA 1QNIA 3PDSA 4HWLA 1OCCB 4K9JA 4X31A 3ZX1A 4BUOA 1M0LA 1L9TA 4E9XA 1PLAA 1PY6A 2Y01A 3NJNA 5AX1A 3IE9A 2W8CA 3MBWB 4A66A 1VJMA 4UHRA 2KS9A 4QIDA 1A8ZA 3HANA 2BZCA 3NJIA 3TU6A 4G71B 4BDVB 4YSEA 2J4YA 5H2PA 1QM8A 1IXFA 5BR2A 2GC7C 4DP4X 4BK5C 2R4SA 5H2KA 2MRYA 3X1BA 3FT0A 4G7QB 5FJGA 2HLEB 3FU8A 4Q8BA 3WIAA 3CVCA 3FQ2A 4DP7X 4GYCA 5AWZA 3QJTB 3GDCA 3FQ1A 2PLTA 4N4YB 5B6YA 1TU2A 4EJ4A 5ETZA 5H2NA 5JJNA 4XT1A 5F8UA 3X2QB 1JZHA 3TBBA 3V2YA 3UABA 5AZDA 5B1AB 1HZXA 1OV8A 2ZXWB 4AKPA 3NYKA 4QI1A 5I6OA 1AQ8A 3HAPA 1A65A 1KBWA 2I1XA 2Y02A 3VHZA 1TN0A 3VI0A 1E65A 3NSDA 4A4MA 2H47C 4NC3A 3NJHA 4W9ZA 1M0KA 1WS7A 2TSBA 4HAKA 3HB3B 2VN3A 2FWLB 3EF4A 3CG8A 4MFHA 5AHZA 1BXVA 3NSYA 3OE8A 1JERA 1BYPA 2DYSB 1EHKB 3EHBB 4WAVA 3UACA 1OF0A 1SHXA 4A68A 2RH1A 2PPDA 1OCZB 1WS8A 2YAHA 2GI0A 2OJ1A 3WQJA 2ZOOA 2JFCA 1TKWA 4RH4A 3ASNB 2QT6A 1SJMA 2FT6A 2Q5BA 5B1BB 3X1EA 2HZHA 2KSBA 1X9UA 1P8IA 4KNSA 2WJKA 4YSCA 3NJGA 2YAEA 1BYOA 1OCRB 2CAKA 3WKQA 1AS6A 2PEDA 4AI7A 3QBIA 1KG8A 1IBYA 1NPJA 1A4CA 1X9RA 4AKOA 1HAWA 1IC0A 2RACA 1ILSA 4N8UA 2YCYA 3FU7B 2XU9A 1W6WA 1SF5A 2N0MA 4BWWA 1KDIA 3X3BA 2X72A 3PQRA 4PXFA 1N70A 3BVDB 5EHFA 1V55B 1L0MA 1J5DA 3FPYA 1O0AA 2FTAA 4DP6X 3QDCA 4DP2X 1R84A 4WTQA 4DP5X 2YCZA 5PCYA 3QJSB 2VSKB 3QAPA 3AY2A 5I26A 3JT2A 4A2EA 1C8SA 1BRXA 3PAZA 4FAAB 1X0K1 4MD1A 3FYEB 2AT9A 1MZYA 4P5RA 1JV6A 1PZBA 1JZJA 1QLEB 2HX7A 4DP8X 4NERA 1PF3A 1KGYE 1L9RA 3OMAB 2GHZA 4MBSA 1MG2C 2XUWA 3D12B 1ET8A 4K5YA 1DZ0A 2DY2A 2EIJB 4LDOA 2FQDA 2XYBA 4JQ6A 4JKVA 1KV7A 3C75A 3OMIB 4E9RA 1AR1B 1J9SA 3AG1B 1OE2A 3U25A 1I53A 1IW9A 2FQEA 1UAZA 5G2AA 1ZPUA 2XV0A 4BEYA 2BO0A 5TK2A 4N6HA 1PXRA 4IAQA 5A44A 4CSPA 3H4HA 4F2FA 3GXUB 3QJUB 3DKHA 1KBVA 2KSYA 5ITCA 5JJEA 4KNUA 4G7RB 5D4JA 4AMJA 4AKQA 4FBZA 3VW7A 2AANA 3OE9A 5B34A 1E5ZA 5G2CA 2LLNA 3ZIYA 1WA1X 1BRRA 2I7SA 1SFDA 2VM4A 4ZK8A 1ZDQA 4TL3A 2IDTA 3FU9A 2UX6A 3H4FA 1GY1A 3PWHA 3SBQA 3NYAA 3A7KA 1JZEA 1GUEA 3S3DB 2XXFA 2ZZLA 3DQBA 1J9RA 1KG9A 3RFMA 4NB7A 6PAZA 1E5YA 4MD2A 5B6XA 3AW5A 3MBVA 5DHGA 3FQYA 4X4KA 2FQGA 3NJMA 1AOZA 3AYNA 1AZCA 2BWDA 3T6WA 2YCXA 4G70B 1BQRA 2QPEB 2PPAA 4AX3A 2UX7A 1DYZA 5BR5A 1BRDA 1SFHA 1XJIA 2EIKB 2CALA 3NP3A 3QPKA 4W1TA 5H2IA 5G2DA 3S3BB 3QBKA 4BVNA 3AYMA 4IB4A 4XXJA 1JVLA 2I35A 2HRHA 2J55A 4XTLA 3FSAA 3PPSA 1GSKA 4KOCA 2BWIA 2R7EA 5B6VA 3PCYA 2DWSA 1TN5A 5DYSA 5I6LA 4HCGA 2DWTA 1KMEA 3QJRB 2ZWNA 3TASA 1H2SA 1IUZA 4IARA 4YSDA 5AZUA 4WKXA 3VGAA 3ODUA 2FQFA 4E9QA 1SHWA 2HX8A 3HASA 3OD3A 4N4WA 1Q5JA 1JFPA 1SDDB 2JKWA 3DTUB 1JZIA 3FSVA 1W8EA 2H3XC 2AFNA 1S52A 2E86A 3PAUA 2IDQA 3CDZB 2PCFA 4HZ1A 2LNLA 1R2NA 4UG2A 1MG3C 1V54B 2BP8A 5PAZA 4E9WA 5A7EA 1XB3A 1FA4A 1LN6A 1ET5A 1AZNA 4YL4A 3SBRA 3AZUA 4A2FA 4EF3A 4XTNA 2X87A 1KYAA 3NSCA 1ADWA 2YAQA 2Y03A 3FS9A 3CVDA 1DZEA 1X0I1 2NTUA 4DJHA 1KCBA 2CBPA 2YAPA 5I5JA 2VW7A 2UXVA 1OE3A 3KJ6A 1JOIA 4L6RA 3X1NA 2BP0B 1L9QA 2QDVA 5J7AA 1E0PA 5C1MA 3VG9A 1OE1A 2PPFA 5A45A 1P8HA 2XX1A 5B0WA 3WKPA 1NIFA 1HAUA 5AHYA 2JAFA 1GU8A 4YVNA 1YLBB 1QKOA 1GS8A 5G36A 2PPCA 4DP1X 1H68A 2YQBA 2VT4A 1KDJA 2H5UA 4HHWA 1VLXA 3X1FA 5LDUA 2DV6A 2IH8A 1RCYA 4E9SA 4E9TA 2HX9A 1ET7A 4X1HA 1L9PA 1NWOA 2BZ7A 2PCYA 2YAFA 1V10A 4JHVA 4ENZA 1F4ZA 4F7KA 5I6PA 1QKPA 4BDVA 5I5IA 2XWZA 2EINB 3NSBA 1GW0A 5B3SB 2KSAA 4JKNA 2ZFEA 2VMJA 1J5CA 5DHHA 2Z73A 2YDOA 1S51A 4AMIA 3ABKB 2JAGA 4GXFA 4KO7A 1SDDA 1S53A 3T6ZA 1JV7A 1AZBA 4BEZA 1E30A 5LWEA 2EIMB 3ABLB 1NICA 5ITEA 1PLCA 3H56A 2I85A 3QBLA 5ANHA 1JZGA 2CCWA 3KW7A 1PZCA 2I20A 2M3GA 2EILB 4OV0A 3HARA 1AS8A 1JXFA 3ZDWA 3N55A 1ZV2A 2YXWA 2G87A 4DPAX 1CC3A 4E9VA 3GYRA 4MQSA 1GY2A 1GS7A 1MGYA 3BQVA 3V9EA 1F88A 3ZBMA 5E9NA 4BWBA 2F95A 3QAKA 4EIYA 1P8UA 1ASPA 1AS7A 3T45A 2BP0A 2UXFA 3NJJA 5B7EA 3EH4B 1MDAA 2GB2A 7PAZA 4KO9A 2AVFA 1A4AA 3T6VA 1NIEA 1NIAA 5B7MA 1A3ZA 4HYXA 4G72B 4QRYA 3V9CA 4KO5A 2W88A 3FSWA 2FT7A 1OOWA 4DP0X 1AACA 2GBAA 3T9WA 4JR8A 5TGZA 3FYIB 3FU7A 3COCA 4L35A 3OMNB 3NY8A 4MQTA 2AZAA 2J56A 1XB6A 1BQ5A 7PCYA 3V2WA 2FJSA 4HCFA 5H2MA 4BWTA 3IEAA 1BXUA 2BRDA 3ABGA 1PZAA 3ABWA 3UAEA 3WNIA 2P80D 4GPOA 3PBLA 3T71A 3ABMB 4FPDA 4GRVA 4EA3A 5G53A 1NIDA 2FT8A 1GS6X 1HFUA 2GIMA 6PCYA 1A4BA 3G5WA 1JXDA 3IN0A 1AP9A 2HPYA 2Q9OA 4YSPA 3FPXA 1UATA 4GBRA 1WAEA 3UZAA 1F56A 1FWXA 1ZIAA 5TK4A 1FBKA 1M0MA 3UTXA 4UF7C 1S8JA 1NPNA 1TEGA 3AM6A 3WG7B 3DDLA 1OCOB 3SQRA 1VGOA 3EH5B 5B6WA 4HIPA 9PCYA 3QQXA 2XLLA 2Y04A
chains in the Genus database with same CATH superfamily
5I19L 5D5MA 4L37A 2Q0ZX 2FH8A 2Z35B 3ZHLA 4KAQH 5F7DA 4JFDD 4OBSA 5EU5B 3N40P 1N68A 4UNTA 2K8MA 5CJ5A 3K4DA 4NRYB 1S7TA 3C5ZD 3QBTB 4JQIH 4GG6E 5JIMA 5D72H 4APQA 1WIOA 2J57A 3IXAB 4U1IB 2I26N 3PDDA 1BPVA 3ILPB 3VFRB 2JXMB 4X9GA 4JFHD 2NY1B 4QYOA 5HHMB 4CU7A 2VDKH 3I6LE 1XH2A 4I18A 5D1XB 4DGYL 4F2ME 5L9DH 2O5ZH 4S1SL 4UNUA 5DQDH 5JZ7C 2FX8L 3MLYH 4JPVH 2VKXA 3RFZB 4FS0A 1CR9L 1TJHH 2PWFA 1O5PA 2R4SL 1A1MB 2I21A 1XEUA 2D03L 2GC4C 4H8WH 3SD5A 4CKQA 2PTTA 1EEYA 1HINL 4M8UA 5DC9B 4M1DL 1L6PA 4PB0L 4WFFD 5HGHA 1SJHA 5C7ZA 1NEPA 4U1HA 5D7EA 2MCMA 1EHAA 3KPTA 4G80B 3MLRH 2X9YA 1LWRA 2H8PB 1FFOA 3HS0A 4Q9CA 2SEBB 1ACYH 2CIKB 3E8UH 2A83A 2AK1H 1GGCH 3L4UA 3DHUA 5CNHA 2GABA 1OTTD 3IBOA 3QQNA 5ITBH 5DUMH 1B2WL 3BSZH 3MOQA 3TH4T 1JZFA 3CHSA 3EJCA 1K5NB 4Q74A 3SBPA 3MX0B 4XPAL 1XXDC 2Z34A 2OMWA 3P11H 5BRZE 1AP2A 3WS3A 4HUUA 3K0YA 1CFVL 2PYEB 2Z1PA 4LLVA 4OZGE 5I1DB 3GKWH 3W5MA 2ZICA 2KDYA 3ZRCC 2EE6A 1CD1A 4TLTA 3QZMA 3TF4A 3K6OA 1AXSB 5F72S 5T5FH 2WJLA 4J3UA 2GFBA 1HZHL 5C0BA 1E4WH 2JCCB 3UADA 5CN3A 2PYFA 5CZXD 3QUZD 3NABH 4RMTA 5K39B 4JGJA 4NAJA 4Q56A 1K2DA 1XHHA 2V5SA 4Q14A 4QF1A 4DEUA 2P5WE 1S9YA 3B34A 4QLWA 4PWJA 5IY5B 3U6XA 1QSFE 2LW3A 2WCPA 5T1DL 5I19H 4UM9A 4KK6D 2KQNA 1RZQA 3AQXA 3MC0A 2OJEB 1C5DB 3RLSA 3UX9B 5I6KA 1RI8A 5CD5C 1PAZA 4ODSL 1VRSA 2K9FB 4OFDA 4LKXA 5C09B 1M2VA 4KJWC 3ARFB 4L3FA 4YFLI 1CZ8H 2XG4A 1JWUA 1BM1A 3T04D 5F88B 1TQUA 4UANA 2XKNA 4ANUA 3E0GA 5CSZB 5MEOA 3FC8A 3ASOB 3QHFH 2WKLA 1SBSL 2XXGA 2UZYB 3OQRA 3BCDA 1IFHH 1UENA 3Q6FA 3VCLB 4GYBA 5AFAA 3CHXA 3L7FB 2YXVA 1EGJA 2XETA 3EYQC 5G28A 1RIVL 4G7SB 3MLZL 3IF1B 5EIVA 1H8NA 5CWSB 1UCBL 1ND0B 2YAMA 1VB9A 3V4VL 3WEOA 5EZPA 1R4XA 3BD3A 3U1PA 1AFVH 1BEYL 3LMJH 5EZIL 3GSNL 2Q7AA 4K9JA 3NIDB 3BRFA 1R3KB 2ADIA 2W60B 1I9IH 3FONA 4PS8A 1PLAA 2DW5A 3I6KB 4KQ3H 3WDJA 3MXVH 3RG1C 1VJMA 3D6GA 2ZUSA 2QR0B 3K2UL 5H2KA 1JK9B 1Z1WA 2JJTA 5C0CE 1JTPA 1U3YA 3LZNA 4O02L 4Z7WE 1HESA 3GIZH 2FSEB 4X6BA 1TITA 3UZEC 1AGDA 2UWEE 3FZUC 4WO4B 1WC7A 1UB5B 2WLZA 5D93C 2IQ9H 3ALWA 4XT1A 3QDME 2A6DA 3QCUL 2WXJA 1QEXA 3ZTNH 1XF1A 3WFEL 1XIWB 3VI0A 3FO9B 4NHCH 3CFUA 1ORSB 3DO3A 2TSBA 4HAKA 2NY3B 4IRSA 4GI9A 3EF4A 4HT1L 3BW9A 5BUAA 4NO5B 4WAVA 4ZAKB 4PJBA 4BKSC 2VDNB 1H3PL 4NJAL 2OJ1A 3LEVH 1CGWA 4QXGL 3NFSH 1MQKL 2X4UB 1N6VA 1SJMA 2J71A 5EF2A 3AADB 1DQMH 1TJGL 1X9UA 3ETBJ 3P4LA 2D3JA 2BINA 4NGHH 1SJVA 5IGXH 1TZIA 4C58B 4WUUD 2UVEA 4AJWA 1NGXB 2P47B 1KBBA 5AYQA 2L7EA 1E7VA 2YRBA 1LE9A 1U42A 2R0ZH 3D69B 3OKYA 2X5PA 1I9EA 2KZWA 1DBML 1ZLVH 1P7BA 5A2JH 1MFMA 4PXFA 2F15A 2KHAA 4HLZG 3SZ6A 4FQ1L 1RZJH 1J0JA 3MUUA 4HGWA 4JJ5A 4JVPA 2UY6A 4JKKA 3TO2A 4NO3B 1XF5A 3MRJB 4X5QA 3GXPA 4FAAB 1Z2KA 2VLKD 3CSGA 2AT9A 4HCRA 2JI3A 1J8SA 3WKML 4AG4L 5KAQG 1ZOXA 5ICXA 5EO0B 3ROOA 2DWEB 2ZWSA 4KRPC 2AEOA 1WZ1L 5F7NC 2YK1L 2GW5A 1UA6L 7TAAA 2WO4A 1EJ6A 3VGAB 4NKMA 2ID5A 4G42A 5C0AD 1NFDB 4NWUL 4JFPA 1U6AL 3A4FA 4LSVH 3EJJX 4A2MA 1ICTA 2FQEA 5A2AA 1TENA 5EB9A 3QUXB 1GYVA 5BQ7B 4X80L 4PLKD 5HD8D 1PXRA 2VDPH 3INOA 4G6JL 1Q9KB 2CO7A 4DVBA 2EAEA 3GXUB 4JM4L 3ZQ9A 5F7DB 2JJUA 4R2GB 5F3HA 1Q9LA 2W0FB 5DMGC 1FJ1A 4PJ7E 2XG5A 2HP4A 3BPLC 2APBA 5G2CA 3G9AB 5JQHC 2F53A 1HCVA 1MLCB 4K9EL 4OM1H 5K1JA 5LO7A 1N5YL 4FTDA 1IB5A 2DIEA 3L3OB 1G7HB 2BNQD 1WEJL 4I18B 5D71H 2NSXA 3TNNA 1XR8A 2JKTM 4OZIE 1X5ZA 4FG0A 4M7JL 5FGRA 1JZ3A 3MBVA 3RVWC 4R7DB 3TYGL 1Z9OA 3DBXA 3NJMA 1UXWA 5FFOA 2CJTA 1WCQA 3RPBA 1BFTA 2WBJB 1BCIA 4Z8FL 2XTJD 2NY2C 3MROA 4HYTB 5IVXB 5BR5A 1SJHB 3MKGA 4HUNB 4LCCA 3NP3A 3QPKA 2YD6A 5H2IA 4BVNA 3JV0A 3QRLA 1NLBL 4I1NB 1CE1L 3HS0B 3VXOB 1DL7L 1LWHA 3FN0L 2QKIC 2HKFL 2NY5L 3WY3A 4ETYA 4ZYKA 3NG5A 5CGTA 2DMHA 2JJSC 5FUOH 2AJYH 1BQLH 4ADIA 3V6OE 5IB3A 2IGLA 4IJTA 2AKRA 2W80C 2IAMC 1Y1DA 2K3HA 3WS3B 3ML8A 4PJ5A 1NOAA 3EG9B 5E5LA 3RTQD 4XP4H 3VB9A 3T4AC 5DJ0A 4ABQA 1IKNA 1IM9B 3SGKA 1B0RA 2X0VA 2Y03A 4JKPH 1GJUA 5K9QI 2C9VA 3D0LA 4LCIL 4R4BA 5C0BB 1A6ZA 3U0PB 5BW7C 2QSCH 2QFRA 4A7GF 1BIIB 1LM8V 3VJ6A 5IQ9A 5IHZA 1YYLH 4QF1B 4G8GA 2KC0A 5F9JB 1PSKH 5LNGA 4YR6A 1R9FA 1QLFA 1V3KA 3D33A 4NRZA 4XNQA 4CMHB 2Z31B 4TNFA 4OFKA 3FQWA 4UM9B 3HVDA 1G7LA 1GGUA 4MJID 1BAFL 3VI3B 2G9KA 3LRGA 1CK0H 3DXAE 2KZKA 1AGFA 1TLMA 3X1FA 3DSNA 3T3PB 4FFYL 5D55A 4KPHH 4Y5VC 4ENZA 3SCMC 4RRPM 5I6PA 2XG4B 1JWUB 1YEKH 3NSBA 3N40F 3PHAA 3FKUS 4L8CB 2ZWZA 2KSAA 1QVOA 2VC2L 2Z9TA 4BFJA 2VMJA 4KTDH 4BE5A 3UGUA 3IVKA 4LSSL 4M5ZH 4Y0GA 4YXLH 1F4XL 1F42A 1PX4A 3FB5A 3IETB 2FIKB 5ITEA 3KPOA 4M5YL 5GRVK 4X8XA 2J1XA 4AIXA 1ECYA 1ZS2A 2P8PA 4PEEA 2HWZH 4WW2F 5DUPL 4ZO8A 2C9XA 2G2NA 4PY8I 2JTYA 3UTPD 1UFGA 4MX7A 4Z3IA 2DLHA 1CQKA 4F8QA 2Z8VC 1QBAA 2IANA 2ADIB 1ZAGA 3FONB 2HVJB 4EIYA 1EFXB 3HN8A 5LBGA 3HW7A 5DJDA 1TZAA 2ZJSL 3DUUA 4WFED 3GHEH 3LV3B 2AVFA 2C9AA 2IC2A 3X3FH 4IEFA 5JHDA 1I85C 3EYVA 2IBZX 4J2XA 4F8TA 1P9MC 3O6FA 4MB1A 1N18A 1JGEA 3IB4A 1YJDH 5FX3A 1J0ZA 1WC7B 3PJSA 2LABA 2GBAA 3OLIA 1N0XL 1NM4A 4PRAA 1DN0A 3F12A 3EBHA 2YD4A 4URTB 5IJKA 5C0GA 1QUNB 1RSYA 3DVIA 3C60B 3BAIA 3ABWA 1NC2D 1GIGH 2CJUH 3OJ2C 4MD4A 3BW9B 4PRIE 4XAWL 1RLBA 2X2IA 4LASH 4RGNE 4XN4A 3MLVH 2Y07H 1RD6A 5E24E 2K6WA 4XMVA 1P5UC 3MJ7A 2OMZB 1PEZA 3GZPA 4S1RH 1A4JA 1I3RA 4WK2B 3VXQA 2PTVA 5DHXB 4ZMAT 5CM1A 3O4LA 3VG9C 1TZIB 3GBDA 3AVEA 4WKZA 4K3DL 5IFAL 5DA0B 3D4YA 1ACZA 4LAJH 2HFGH 4WY7H 4HJGB 4YDNA 3M7OA 5KVEL 5CCKH 2C1PB 3EGXB 2KZBA 1VFAB 1LE9B 3F7KA 1KGBA 3O6ML 2Z3FA 2CO6A 2KPWA 3IMUA 2VUKA 4FNLL 1NKOA 2P43B 2P49B 4YHYC 3GRWA 1FFNB 2YRLA 1YECH 5ALBH 4FQCL 1R0AH 2C9UA 3OAXA 2XVBA 4R90L 4MAYA 3L54A 4HGWB 3TC9A 2QGEA 4FF9A 4MD0B 3TO2B 1WCBA 3CVBA 2AQ2A 3MACL 2WO2B 5HHVH 5JW3H 4TUUA 3S8GB 3ZK0A 5GRYA 3VQ1C 4NYLA 2ISDA 2X3CA 2OYLA 2R29H 1KZYA 4EDWH 6FABH 1SLVA 2IGFH 4F9PC 3V9FA 3SOBL 1KCVL 4XBEH 3KW8A 2X4OB 4CJ0A 2W38A 4NKMB 4G42B 1JDDA 3OJDA 2ZXCA 4YSOA 3ML9A 1E40A 4KKAD 2YD3A 4MMXA 5CZKA 4GUOA 2BVPA 5EDXA 1HH6B 1MCOH 5EBMA 3TZVD 1CYXA 4K2UL 3IDJA 4CN1A 3HAQA 2CO7B 2W9EH 5F7EH 2YPVH 1Q9LB 1KJ2A 4UTAH 1BD2D 1X5HA 4ZFGH 5C07A 1FJ1B 1FFTB 4KTEH 1JRHI 2XG5B 4P2RB 3WO4C 1HDMA 3I9PA 1ZE3C 5D96C 4LHUG 3C9NA 3MODH 4RDQF 5T1KB 2B2XL 1J5IA 4A2HA 3C09C 1NCDL 3EYSL 5E5UB 2EH8H 4N6RB 3TFKD 3GBNH 2WNKA 4CSZA 5E8EA 4UV7L 2VB5A 5GZOC 5B7FA 5FCUH 3F6JA 3VDCA 1AIZA 4YXKL 4P23D 4G6FB 3WLWD 4JFQA 5BOJA 3AG4B 3CH1A 3ZDZE 4JFDE 5ICYB 3BH4A 4WU5A 2F18A 4LCCB 3LS5H 4XNUL 3VM7A 2O5XL 4LSUH 4DKEL 5CBEB 4DT2A 3U2SA 1N12A 4OJYA 1E4JA 2CSPA 4JFHE 5FV2A 4PRPA 4ZYKB 2EC9U 2OJZH 1F3JA 1TIUA 2Z7UA 3BC9A 3ARDA 1UD5A 3PV6A 4I3SH 4QRAA 1GYAA 2X1OA 2D0FA 3MGAA 4DGIL 4POZC 1CD0A 3UZCA 1IFRA 4KK9D 4PJ5B 1I1RA 2YFNA 3VFUA 4PJ8D 2KYIA 5J6GA 2BP5M 3CSYA 4YWGL 1BVLA 5JJJA 1QI5A 1PDKA 4I1RA 5DJ0B 2VIRA 2IWFA 35C8L 3EFFB 3QJVB 3ZDXB 4X6EB 3TT1H 4XBMA 5L8KB 3QFJB 4FMFA 2R0KL 3SE3C 4R4BB 3E1F1 1U8IB 4AH2A 3M1CA 5FUCC 5L0QC 4XNMA 2VH5H 3HE7A 1EK3A 4OJFH 5EU6D 3HAOA 1KTJA 1DVTA 5IHZB 2EDQA 2QDWA 4G8GB 2FBJL 2HRLA 5CP3H 5DQ9A 3VTTA 1AO7E 2R56H 4DNLA 4A7GA 3QUGA 4XNQB 1C7TA 3T1FA 2Y1VA 3HG1D 5HVHB 1I3UA 4PJXE 1G7LB 2F93A 1FDLL 4MXWH 1JE6A 4WWKA 4M6ML 3FT4A 1UZ6E 4X31A 2AABH 1AGFB 1Z3RA 4BUOA 3DSNB 2DWDB 5MENA 1O6TA 5DJAA 1NEZA 3MLPA 2XWBB 1E8ZA 1A8ZA 3CFBA 2B1HL 3PG2A 4QRRD 4YSEA 1EEUA 1JF5A 3IMBA 5IW3A 4DN4L 1OD9A 1QVOB 2WK2A 2XRAL 3X1BA 3EOTL 4GRLB 2NY6B 4H8VA 1HX0A 5LHDA 3LN5A 3DTXB 2YFOA 1TJIL 2VITB 3LB6D 5JR1L 1AHWC 4FFWD 2XCMC 3V0AC 3FCSA 4ORZC 2CGYA 1X5IA 3HNTL 4D2NA 3RL2A 4JFFD 4OLVH 4KKPA 2ADGA 2V2XA 3KBFA 2Y06L 1JGLH 5BZZA 3L4TA 4LSRH 4MX7B 4OI7A 3JWNE 3CSFA 3LKNA 5D7JA 2IANB 2GAZB 4B9FA 4WW2A 1V7NL 2WQUA 3EHBB 5I8KL 3T08A 2ARJB 4JDVA 1U58A 5DJDB 5E94B 1PVHA 4K9EC 4DIXA 2H1XA 1XAKA 3WUWB 1I9RL 2MQ0A 3ARGD 4IEFB 3DBSA 3BT2L 1N9PA 5IESL 1P8IA 1M42A 3O3UN 5DWPA 5AWNL 3SE8L 1JGEB 3NJGA 4AEIH 2CAKA 3VSTA 4CN4A 2XZCL 3TT3H 4MMZA 1KG8A 4NQED 3PJSB 2BK8A 5B39A 2E27H 1E43A 4PRAB 1DN0B 2XU9A 2AK4A 3F12B 2RCSH 1CXKA 3SOTA 1ZA6A 4FKEA 1K4CA 1JHKH 4OLZH 4X83A 3V6FA 3BVDB 2VR5A 5TQ2L 4IQHA 4YN3A 1A7OH 5C2UB 3CLFH 5F6IC 2E4FA 4F8NA 2LFEA 4WTQA 4QHKI 5FK9B 4ALAH 5IB1A 1ZHBA 2ADFH 4P4RB 3R18A 2NY5C 3OSVA 5DD5H 1XGUA 4WFGE 1MPAH 4HU8A 2VDLH 2XTSA 4JDZB 5D1QA 3HUJB 2V9TA 2AI0L 1I8AA 5KTEL 2JQMA 1BJMA 3QCVL 1QYGL 3O4LB 4K5YA 5DD0L 4PCTA 2A6JA 4WKZB 1Y7VA 2XN0A 2CMRH 3L4VA 3NN8A 4K5PA 2EIJB 4NOFA 4OLYH 1VESA 3GB7A 1S5IH 1C12A 2CLVA 3R1GH 4MCYA 4XBPA 5F9DC 1I53A 3QHZH 5IWLA 3HLKA 4U4IA 4O58H 1RP8A 5T8IA 5ALCH 3U7YH 4GAGH 5A16A 2IFFH 4MJHA 4EBQL 5BV7H 5IFJA 4U6HA 3SD2A 4AMJA 4E0RA 1T03L 3STLB 4HJ0C 3SB3A 3G5YA 4JRYA 4MAYB 3D7PA 4C83B 4RX4A 1E5ZA 4HD9A 2X0WA 3R4RA 1WCBB 1CGTA 4MRBA 2X41A 3WHXB 3FTVA 1PG7X 4NYLB 4ES8A 4M7KL 2UX6A 2WNXA 3MV9B 4H8UA 3QIWC 3FO0H 1QFUH 5F96H 4J39A 4N22A 1OAXH 2HG5B 2EIZA 4N5UA 3LNFA 4FQQB 2KQMA 5DSCA 1KWKA 3TBYA 5DHDA 4LCVA 6PAZA 3OJDB 1JN6A 2NY0B 1CDUA 3BP7A 2JK5A 4Y5XC 1OAZH 4MMXB 43C9A 2F58H 3I50L 4CJ1A 3HC4L 5EBMB 1T22A 1VA9A 2Q3AA 4OLXL 5K9KA 3WJLC 3ZGHA 1NCOA 3PDOA 5J4MA 4X9BA 4Y9BA 1FAIL 1XJIA 2WYHA 4YLQT 5HYQA 4Q9RL 3S34H 2J8UB 3KE0A 2XPZA 2I27N 2NCEA 3T0EA 1VERA 2VLKE 2QADC 1HDMB 4XVTH 1SYVA 5ACLA 3APNA 2FL5A 2YLKA 5CLXA 1SHWA 5DHEA 3BPNC 4Y5YA 4HC1A 1JZIA 4TQ8A 1S52A 5E8EB 1ZANL 2NZ9D 4XOBA 3FB6A 4L3CB 1OWRM 1Z6JT 1IFGA 3QWQB 1FA4A 2ZPKL 4PJGF 4GXVH 1I8LA 2J12B 4LRNL 4I3GA 4XOEA 2HYMA 1BZOA 4JFQB 1JYVA 3BDXA 3CH1B 2YAQA 1S46A 2IADB 3SPGA 1AY1H 3D9AL 1E5AA 4FABL 1O7DE 3QRBA 4ELMF 5DURD 1LTXA 1A9EA 2DJ4A 2OMYB 3Q7JA 3SBWA 5I1IH 1E0PA 5GGTH 1RURL 5KANG 5DTFA 5D7KD 2WKGA 4OIAA 2JKSA 4XCEA 1L7TH 4QHNA 2BNQE 2XX1A 4PRPB 1AJ7L 3WKPA 3RWIA 1Q4NX 2NY1C 1OQXA 3GINA 3EDJA 3LEXA 4YHLH 3PV6B 5D1XC 2WQSA 2ZKHH 3ROLA 5C0IB 4ZI8A 3MSPA 2VMCA 2V3DA 3RFZC 3QIUD 2IPTL 2OLDA 4H20H 1RUAL 2HB0A 4FI6A 3HIZA 4I5BA 4N2NA 2XTJE 5GPRA 3VNZA 2XQYA 1ZS8A 2YAFA 1I31A 1INDL 3PWJA 3QDGA 3TJHC 3BX7C 4RISH 2VIRB 4PS7A 2G5RA 1EJOH 5B8CC 1FV1B 6CGTA 5TQ0L 1IE4A 3VFNA 4JY5H 5T3XD 5B3SB 4HJ0D 1A3RL 1DQDH 5E2TH 3WTSA 1J5CA 4AH2B 2G30A 3HBGA 3LZFL 4XNMB 1ZVYA 2XN1A 3F7VA 2J88L 3HE7B 4NO2A 3IJ8A 1YRKA 2ADJA 4KO7A 4UOJA 5GHWL 3MGTA 4P3DA 4U0QB 4LSPL 4LVEA 1E4HA 2QQNL 1K9TA 3B7UX 5DQ9B 3SKUD 4ATTA 3LIZL 2BVTA 1L0YA 1NICA 1V5JA 4PSPA 5KSAA 3UTTB 1UACH 1A9VA 2X4QA 3T1FB 3LKQA 2F7OA 3TWYA 4OR1A 1BM3H 2APVA 3TLRA 1NFIA 5AZ2H 4E9VA 4F58L 4F37K 3BESR 4L1BA 1NBQA 4WWKB 3PQYE 2VXUH 3FMGH 3FT4B 4ZMOA 2MOQA 1E5BA 3LKPA 5TDOB 3QAKA 4G7VL 4UT6L 3FT3A 3CFBB 3OAYK 5IW6B 4X6DA 3HAEA 5EO9A 2I25N 1JPST 3P4MA 4JO1H 1JV5A 4XPGH 5I75B 1IL1A 1X5MA 3D39A 3V4UL 3ELQA 1CL7H 4M61B 1A5FL 3ZDYF 3EJZC 4X6CF 1UVQB 4HCRL 4YFEA 3QWNA 2EXWD 3B7RL 3P30H 1HQRA 2V2XB 3QAZB 3H3KA 3C8HA 4FXKB 4P3WA 4DVRL 3WTVA 4JN2A 1FYTD 3LKNB 1A6UH 4M1GL 1U8LA 3IFNH 1QFHA 3HRZA 4ZSOE 4OQTL 1U58B 3ARFC 4WTWA 4RFEA 5FIEA 1ZT4B 2QSVA 1WWAX 3O2VL 3BP4A 3M07A 3VG0L 2DH3A 4I3RH 1TFHA 4B53A 3FQTB 2OR7A 2DQHH 4MMZB 1NH6A 4UDUA 1UM6H 1SVCP 5B6WA 2JELH 4IOFD 1MCHA 2PW1A 3H42H 3HE6A 4W81A 1IJNA 3BWAA 3K0WA 3V6FB 3L3GA 3R06B 2IWEA 3SDYL 5IBTL 3RZEA 3ILDA 1P0SE 2VTFA 3CX5K 4JHAH 2YQ2A 5IMMA 1NCJA 5H2JA 3HI1A 5HHXH 3FQXA 3SIKA 1U93B 1TTAA 4FXGB 5A6IA 1ERNA 1QFOA 2VN7A 4M29A 1QHQA 1P4IH 4W9KC 2AJSH 5HDWA 4HJSA 4AV5A 5CFAA 2O6DA 2BERA 2PR4H 3V0HA 2HT2D 4OSUH 1M2OA 2PWHA 3OWRA 3IK2A 3KH3A 2HRPL 3VXSE 3IDXH 3NIFF 3NN8B 2VLMD 4GSXA 4WO4C 3GB7B 1MCDA 1C12B 2CLVB 15C8L 4MCYB 4HWEH 2P52A 5A16B 1XH3B 4N0FA 1XIWC 2QPDB 1WD8A 1NIBA 2DTML 5IFJB 1W0YT 2KH2B 1A21A 2NY3C 1N2RB 5E1AA 5I28A 1OAYL 4E0RB 4N2CA 4HWBH 4OF8A 3EW3B 1MXDA 1XF4A 2WO3B 4JRYB 4FD0A 1R19A 4Y4FD 3V4LA 1FCCA 4ZAKC 3QNXA 3JWNH 3ULVC 3BUTA 1QI3A 1MFCL 4OW6A 2NLJA 5TPWH 2BIHA 4F5CA 4MNHB 1DQVA 4JKLA 1EZSA 1XR9A 1BFSA 1WF5A 4Z9KB 2Y7MA 2E7BA 4OD2A 1FZOB 2GSMB 3HC3L 2EIZB 5C2BL 5DSCB 2VDOH 4WEBL 4XMTA 2N7SA 1OALA 5HGAA 2IQAB 1FL3A 1JN6B 2WZ6A 2DQIL 3I9GL 3MRMB 1RZGA 2AHIA 4JB9L 3W9EA 3TV3L 43C9B 4FP8H 3WE6A 3UMTA 4PAZA 4U33A 3O2DH 3UPRA 5LXVA 2COQA 1F97A 3HAEH 2Z65C 1LP9B 1BMGA 3ZE1F 4K5NA 5EUOE 5LWYL 2Y36H 4FQJL 2ZIYA 1N7ML 2OXGB 1B4TA 1L7IH 1CF1A 4B0MB 3BGFC 5CU9A 1M7DA 3CZUB 2FL5B 4Y9HA 3APDA 1KLUA 3VGEA 4M3HA 4Y5YB 1QWUA 4OJCA 3UROR 1S9VA 1NUGA 1VGKB 4LPWA 3VGAC 1A3LH 4FRWA 1OL0A 4I2XE 4QGYA 5KVFL 3Q8CA 3FXIC 5EF0A 3VXTB 4YH6A 4ODVL 1HOCA 2X7LA 5KVMC 4BD4A 2NUPA 4PJGA 5CSGA 1M3JA 1BD2E 1D9KB 1P2CB 3DX7A 5I6MA 3MN8A 3KPRD 1A66A 1PLGH 4X4XA 2H6PA 2CDGA 1A9EB 1AR2A 2DQEL 3QDJA 4LPYA 3L3HA 3BZEA 3ZO0A 5D4IA 3S0PA 3X1GA 4ELMA 4QKXB 4QHNB 5EOQL 5LCVH 3L3OC 3PWUA 4NT6A 4N86A 2ICEB 3V5DA 4JDTH 4GKNA 3LEXB 2ZONA 4I18C 5IV2B 3QI9A 2VUYA 3QIBA 2J73A 3MYZA 3IKCA 2DMCA 4OCXH 4NUJA 5AW3B 5KYXA 1DLHA 2EE3A 4X98A 1T1WB 3BPOB 4OQ1A 2B0SL 4HXBL 4I5BB 4PLJD 1ZS8B 4OCWH 1OAUH 3QDGB 5E4IA 4QIDA 3D1MC 3HANA 1XWVA 4RNRA 5LBSH 3OTTA 2B77A 2PNDA 2NY3D 1E27A 2K70A 5BS0E 5E8DH 4OLUL 3H0TB 4XP1H 4G9FE 3RGBA 3HS0C 3MJGX 5BVJB 1P1VA 2WVUA 4LLQA 2WUBH 3D25B 3MYJB 4P3DB 4XOCA 5EN2B 5FGBC 3FQ1A 1JJUA 4ZMTA 1EEQA 1SQ2N 1C8QA 4M9PA 4U1LA 2X4QB 3N1GC 4FFZL 3LKQB 1SUHA 3BDYH 4ACPA 1NFIB 5TTRA 3NAAL 4N2DA 4AQEB 2GSGB 3N42F 3W2DH 4B5ZA 3WTTA 3LKPB 1K5WA 1SHXA 1IGCL 4PV9A 3RX7A 3LH2L 5A2LH 4IMLA 2HFEA 2DYPA 3QISA 5GGSA 3KEHA 2ZOOA 4X6DB 3WIFB 4EUPA 2YQGA 5JHLL 4J3OD 1KEGH 3L5JA 2VAJA 3P4MB 3MV7B 1BQHA 4GMTL 2FT6A 3X1EA 1IL1B 2HZHA 5DS8A 3L5IA 3MA7A 2K78A 1IGJA 2VCOA 3DOIA 5DVPA 3DK2A 4AW4A 1PKOA 1UXMA 3HMWH 4UIMA 5KJ7E 4LLUA 4HK0A 4F3FA 4HISA 1QSED 3BN9D 3FFCE 2GUOA 1WD9A 4Y16B 1HQRB 4JVUA 4L4VA 4NM4H 1Z3GL 4X6CA 4HS6A 1UD6A 3JTSB 3TA3A 1FZKB 1T4WA 3GJFK 5EHFA 4IRZL 2CQVA 3N9GH 5DK0A 4BQ6A 5FB8A 4AM0A 4M6OH 3ZT7A 1WISA 3QUXD 4L1HA 4AK1A 1R84A 3HRZB 2CCVA 4QRRE 3C6EA 5KS9E 2XXCB 1IT9L 43CAA 4R2GD 1X0K1 4PJEA 5IK3B 2FGZA 2Z92B 4FHBD 1QLEB 5JNYA 4DH2A 4S0HA 3KPQA 1T66C 4UV4L 1MEXH 1T83A 5KJRH 3G08A 5C0RH 3QWOA 4Q58C 3F58L 5D70L 1BFVH 2VDRB 4I0CC 4OZFH 1WFNA 1Q0YL 1N5AA 5LN8A 3DX1A 2YMTA 3LXUX 4PJIF 4BFBD 4JFFE 2PW1B 4E41B 3VFOA 2V17L 4HG4J 4JRXA 3QJXA 1CDHA 5IB5B 3OPZH 2XIIA 4TOYH 5DFAA 3V7AG 5HJGA 4PS4L 3L3GB 3MRFA 5AKSA 5DJXA 2JTDA 1CGSH 3BKML 2AEPH 3W11D 5E7BA 2AERT 4FJ6A 2WBJD 1ZTXE 3A6CH 1QW9A 5HGBA 4JG5A 3TM6A 3UTOA 4PJFF 4UQAA 1EUTA 2F5AL 1UUNA 3UZVA 4PJDB 3K3QA 5FW7A 2JJTC 5FYKU 1MHPH 5GRZA 2H2SD 3WIIH 1B0IA 2DQUL 5AD0B 4NQEE 5GGUA 2CHXA 4NQCA 3VXRE 3RFMA 2P26A 3G3LA 4JGUA 4KVNL 3MMEA 4GW1A 1ZD6A 4N5ED 4F7EA 4XH2A 1QSZA 2PW2A 2HT4D 3FOMB 1HTYA 3LZRA 3HS9A 4HPOH 1OSYA 4N0FB 5SV3A 1DYZA 3STZA 1DSFH 1RVFL 3ZL4H 3BHBA 1C9SA 3MGOB 4IRSC 5E1AB 3QORA 2BXYA 5FYLL 1KBGL 1XF4B 3WFHA 4P3CH 3LDBB 4XCNA 1IM9D 4J4PD 5DT1L 2V2WA 1TN5A 3P77A 3TASA 1G6RB 2DN7A 1OM3H 2D3LA 4AGOA 2OSWA 2CUMA 3GMRB 4K7FA 3HASA 1IJ9A 3K91A 1SDDB 4AXWB 3N50A 5E6IA 4LEXH 5EU3A 2EDFA 1KNOA 3QEQD 2MPVA 2GK0A 3K5RA 3CVHA 1XSOA 1E5UI 2OSXA 3L3DB 2KI6A 2Z31D 2J2ZA 5HGAB 5F7YC 1IQDA 2WXOA 1DBJH 3WMQA 3WE6B 2WXKA 3VFTA 5GRUL 3UPRB 3CVDA 1DZEA 2NTUA 4RDBA 2EDHA 4OGAD 1OPOA 1OAQH 5DFWH 3FN3A 2W65A 4PW9A 1L9QA 1YY8A 4L4TB 3U30B 3DGGA 4OAWA 4N2EA 2VR6A 2CG9X 3SDXF 4JZNB 3WIHH 2AMUA 1JPTH 3MOAL 4CVZA 5AZEH 1KLUB 2F0CA 4KFZC 4PHZA 4TUKH 4NQXB 4M62L 3VXUD 1QKOA 5GRJH 4L1TA 1S9VB 5C0FB 3DJTA 1SY6A 1R46A 4N8PA 4WFHD 4C59B 1OSPL 3KVDD 3ZKNC 1TO5A 3RURA 3HB3C 4ZODA 3RJDA 4ADGA 1VGEL 4XOAA 2QV4A 3Q0HA 3ZYZA 1HOCB 2X7LB 5ISZA 5ID0A 1XCWA 2NUPB 3OAYH 4H8PA 5CJOH 1FL6A 3RWJA 5EEYA 5GGVH 3DX7B 1DQLL 1Y18A 4HJJL 5LGYA 4NQDA 3S88L 2YUZA 1DJYA 2H6PB 3BI9X 4X4XB 2FJGA 3GBML 4AMIA 4LBAA 3L3HB 3WGUB 3BZEB 5JW4Q 3R4DA 4O9HH 5ADPH 3RDTD 3AUVA 2EIMB 3DO7B 2APTA 5CR8A 2L04A 4F33A 1VFBA 3V5DB 4GKNB 4M7LT 3QI9B 1A7PL 1AS8A 4HOXA 5EWIL 4NUJB 1O9VA 2YXWA 1TTUA 4FMKA 4X98B 5GS1A 5SWZE 1NDMA 3LYRA 3SYCA 5E9NA 1P4BL 4RSYA 2J4WL 3OKKA 3PWVB 4RETB 1AYOA 1ASPA 1P69B 3LQAH 2F54B 3CNKA 3QG6A 4RNRB 4V1DB 3C60D 1RHHA 4LCCC 1D2OA 5LGHL 4TVUA 5A3ID 1YYMH 2ZWKA 5HI4C 3CCHA 1HHHA 5IKCB 3HMXH 2NXYB 3G6AA 2GEEA 4DP0X 1OCWH 4K8RH 1MIEL 3BKCL 4YZWA 3O0LA 1WG3A 3Q8EA 1A6WH 2OL3A 3PJNA 1QNZL 1ZXKA 2JF1A 1E2VA 4IRJD 5LDSA 3OR6A 2WVSA 1BQ5A 2YHGA 3D3VD 3O6LH 5HDQL 3TPUB 2BRDA 2PABA 3BISA 2V2TA 4XB8A 2CXGA 3GTNA 2XIDA 4TV3A 3MJ8A 4XWOD 3T2NL 4FPDA 1U8CA 3CFQA 1UWGH 4BH7A 5AAMA 1IKNC 1W72L 2BRRL 2C7UA 1U8MA 4KITB 2ICCA 3RZCA 3GEFA 4Z7VF 2WIIB 1S5HA 3F62A 1AP9A 2AXWA 5F3BA 5I66B 3UZAA 2ZF9A 4Z7NE 1A2YA 2BM3A 4UTCA 5DVLA 1BHGA 1UM5L 1A22B 5C3LD 1FRGH 4QGTA 1MUJB 4UF7C 3U9WA 4WHYH 4LLUB 4KU1A 3QQXA 4HK0B 4F3FB 2GUOB 1JIBA 3CGTA 3LS4L 3VXMB 4QAMB 2OMBA 3T0AA 3UJTH 3IU4H 1JNNH 5I1AA 1DUYB 3WAJA 1YN7A 2WXFA 3BZ4A 5DK0B 1CICA 1R1CA 1MI5E 4YO0B 5D2NA 4PR5B 4DKTA 3WXVL 5C70A 5IQOA 3I3EA 1D5XB 4ODUA 1E12A 1MREH 2BSEA 5IQNA 4JPSA 4YDKH 2L8AA 5E5MB 5T1MA 5JOPE 2HMIC 1MRCH 1Z0MA 43CAB 3BZ5A 4PJEB 4LQFL 4W4OC 1NINA 4ZMXA 5SWSA 4OZ4B 2NY6C 3PHSA 4P2RD 1TZHA 1WAAF 3G08B 3BMVA 2Y23A 5KVDH 5GGQH 5T1KD 2HRGA 3KWWB 3UZQB 3ECWA 4RZKA 1JMXA 4JDEA 2M1KA 3G04A 2YSTA 3HC2A 4MS8C 5AEAA 3VFOB 5CEZL 4OF0A 4J2QA 3UAJC 5BJTB 1XQ4A 4R7VA 4U3XA 4LDLA 4PJIA 4LPVA 5HDBE 1IKFH 3MRFB 3INUH 2IDFA 5JXED 3W9DA 3PAVA 1JGDB 3EGDA 3EHBC 3EDEA 1ONQA 3A6BL 5TE4L 4FG6C 1WPCA 1ODUA 3HI5L 5JLZA 4PJFA 3VFVA 3WFBH 3RWFB 1F3DH 1ASQA 2P80A 3QJQB 2MTAA 1KWGA 1KC5L 1AT9A 2ZP8A 5E2VH 1RH8A 3HC0A 4E5XB 3KYKL 4JL2A 1XF2B 3NCBB 4XH2B 4UILH 5KOMC 5MHSE 4MDIA 5IJKC 1FG9C 4GSRA 1L9SA 3HBQA 3VYNA 4XPBL 4DFIA 3BHBB 5IOPA 1IGFL 2VERA 3C9MA 1IM3A 3QORB 1IAOB 4UB0H 1AQKH 3ESOA 4LOEA 4JHWL 3E8VA 3WFHB 5EOCJ 4DO5A 3EYUH 5HI3C 3VRLE 3WY4A 2DICA 4A6YA 2UXGA 3P77B 1CU4H 3NA4A 4JCWA 2VSMB 1BBDL 3UJJH 3QFJD 3ILEA 4D0DA 3NZSA 5DK3A 3RZWA 4K7FB 5M7QA 5FGSA 1PJWA 1I7UB 3QXDA 4PGDB 2WY3B 3HZVB 2F2HA 3JV6A 5D8JL 2FJFA 4BXSV 2EH7L 2GK0B 3CVHB 4GAYA 3LY6A 3RY4A 2XWJA 4XO3A 5IBLD 1J8HA 2J2ZB 5J12B 3PS6A 3O0RH 1RUQL 2HAZA 1IQDB 1ESOA 1T89A 4KLYA 1GYWA 5I74B 3VFTB 1QABA 4LK4A 3ARWA 1WAPA 2XWDA 4FYQA 1PX8A 3DLQR 3EH3B 4FQ2H 1FH2A 2W65B 3MKKA 4MAYC 4TL4A 1PMYA 4S11A 1VF5C 4OAWB 4QTFA 1JF1A 1XGQB 3LQZA 3WI9A 1JGJA 4M00A 3ZE1B 4O2CA 1ZTXH 4WK0B 4CC4A 4CVZB 1V3MA 4GRLD 3D8MA 2YPLD 3QO0B 3SDXA 4FN0A 3EYFA 4TTDC 1UOLA 4UBDC 4PXKA 2Q86A 1L0QA 5KVGE 4HP5A 3IAQA 3LZPA 5DD3L 5HI5D 2PO6A 2R39A 4W6YB 1MCWM 1VENA 4QNPE 5CN2A 4JFZL 1CGUA 4MMXC 3PWPE 3V4PH 3VSVA 4J5VA 3UAJD 4BFEA 1UH2A 5CILH 5ISZB 2ZYRA 5ID0B 2W81C 1KLFB 4IOSA 5BR2A 3VH8B 3RWJB 1FSKB 3II2A 1NKGA 4BUQA 2MRYA 4G8FA 4N20A 1JRHL 2FJGB 3RB7A 1U8QA 4NQQA 1NJ9A 2XNAB 4JFXA 1TU2A 3DX6A 2X2YA 1JGUL 3II1A 1QLEL 3ZTCC 4F33B 1MNUL 1VFBB 4JBSA 1OV8A 1G7JA 2ZXWB 4NUMA 2NX5D 3LPWA 4A4MA 1WUZA 1XGRA 2H47C 3JWOC 4W9ZA 2VDRL 1WS7A 3GTVA 1CL7I 2VXQH 1KTLA 3GJFH 3MFFB 2DLEA 5GS1B 1NDMB 4XHJD 1QD0A 2WTOA 3LRSB 2EICA 1PZ2A 2WGXA 3RB5A 1MCBA 1BYPA 4LCWD 3VGHA 1JK8B 3OKKB 3K2MC 1A6PA 3ET9F 5BRQA 3L4ZA 4U3SA 1AGBA 2VDPB 2VLRD 1WUNT 3WJJA 1RHHB 2IF7A 1P7QA 4J12A 1G6VK 2QT6A 1B88A 3CUPA 3DYPA 5K9OA 4XODA 4CBPA 4F7PB 4KDWA 3QPXL 1JV2A 5JA8B 1RZKH 4XNYL 4GIOA 5BMFH 2BVQA 3JV5A 3GXFA 3G6AB 4XO5A 1IBYA 4MJ2A 5E51A 3GZOA 4B41A 5A6LA 1VHPA 4UINH 2JH2A 1KB9J 3CMGA 5F97E 3VB8A 4TULH 1SEQH 4OM0L 1KDIA 2OL3B 4FL4B 3WTUA 5KW9L 2EEBA 4MKMA 4LPUA 1EWHA 5J11B 4BKTC 1L0MA 3KPPA 3FPYA 2V2TB 3W56A 4MJJA 5I30L 3RA7H 1IGYA 2KZ1B 4UUJB 4P4KD 5GGRB 1T0OA 3VRJA 2Z8SA 4BH7B 5JYLA 1TQVA 3IS1X 1N59A 2MKWA 4BSWA 3AY2A 4NNPL 3KDMA 4LNVA 3AROA 5GS3A 1A47A 3S3SA 1S5HB 3NIGB 4OFVA 1LQSR 5EC2A 3WFCH 3W0WE 1A2YB 1L9RA 3D5OF 4Z7VA 1ZHLA 3HE7C 1MG2C 3P9MB 1NEZG 3IJYA 3GSOB 1BJ1H 3IGFA 3LKOB 1V7MH 2PCXA 4S1DC 1G6RL 1Q9WB 2IEPA 2UY7A 4N0RA 4NLAA 4Z78A 2ENJA 4HPYH 4PW3A 4TNEA 2AJVL 1BX2A 3AG1B 3H3PL 2EKSA 4U6XA 3U25A 4ZUSA 1UAZA 3MV9D 3OLGA 3QO1A 5EG6C 3SY0B 3QRFM 2O5YH 1EANA 1KJ3L 1T7VA 3P2BA 4TQEH 4XBGA 5I1AB 4Z0XA 4OF6A 3SE9H 4WWKC 4D3CL 1L6XA 3BZ4B 1CICB 4YBLB 4LLYA 2NY0D 3LHPL 3QYNA 2F1BA 3VDBA 4ODUB 2NY4D 4GW4A 1YPZE 3EJYC 4U1GC 5T1MB 3V0FA 3EOAA 4Z7QF 1BRRA 3JVFC 1MAJA 1KLGA 3T8MA 1ZDQA 4CDGC 5I75C 1ZJBA 4AYGA 4LRIA 5C1MB 5SWSB 3MLXH 4MB3A 4GINA 4YXHH 3WDIA 1JZEA 5CKAA 4U1SA 1FO0A 4U4BA 5L7XL 4FQLL 3L3KA 1D7CA 3AS2A 3KGRA 4XP9L 3RUGF 3TBTA 1MAMH 1VSCA 3FQYA 1MH5A 3V5HA 2H32A 3BAEH 3NA9L 4PP2A 4GG6B 3A23A 5GIRA 3G04B 2BOBA 2H9GA 2J6EA 3BD5A 2H7WA 3DECA 3QAZC 5E6RB 4NC2B 4XVSH 3O6KL 1R5WA 3AMLA 5INDA 5T1LA 1JFQH 3NCWA 4FXKC 3I02A 5KEZA 1RULH 4D9LL 4F2MB 1EAPA 1MHCA 2A6IA 5D7JC 1F45A 3W9DB 4HH9B 4WW2C 5B39G 3BPCA 1M9SA 3EGDB 1DVFA 1ONQB 5KYWA 3F6IA 3UPCA 4Y8DC 2P9RA 1AQDA 4JK0D 1KIPA 4YSDA 3P9WB 4TPRL 4FCHA 3OD3A 4HIJA 1RAMA 2EVJA 3AM8C 4PRDA 5JLZB 4PJFB 3VFVB 2H3XC 1Z5HA 4JQXA 2YGPA 1EJ8A 4ONGH 2PCFA 5KYYB 4MMZC 3FN9A 3HC0B 4K55A 1T0NA 3VMPA 5DMKB 5AKVA 2DDQH 5GS0H 4MDIB 3WEAA 4OFYA 3ECVA 2VR3A 1OHQA 4FNRA 5IOPB 2X53A 5FYLD 5I1HH 1ES0B 1RMFH 3QHTC 3KJ6A 3QJFA 4J8RA 5K59F 3VWJD 1DVXA 5EMYA 3WENA 1KTBA 2A9MH 1VZIA 3GXNA 5BRZB 4BCYA 2IOOA 4PJCF 5GZND 4EPSA 4KAQL 5GSRA 4D0DB 1YA5A 5D1QC 3ZJAA 1WK0A 2Y9RT 3QXDB 3L4CA 1F5WA 2CA4A 3NACH 4YUEL 3JV6B 2FJFB 3LPPA 1T7XA 4FC3E 2Q3ZA 5GGRY 1EO7A 4JQIL 5D7IF 1A7RL 5D7LE 5EBGA 4GAYB 3EO1B 2X1XR 1FE8L 1IAKA 1J8HB 1H8OA 3FQUA 4G1EA 4WRLA 5KSBF 1SXCA 1MCLA 4RAVB 4AL8H 4KXBA 1RSFA 2DQMA 2VDKL 3VFPA 4JFTA 5IWLC 2P5WB 5L9DL 4AVJA 2O5ZL 2BIQA 4JNXA 5AB9A 4JPVL 1QSFB 4JL1A 2WWKT 1TJHL 4GQQA 2B1AH 4XVOA 1RPQA 4KZCA 5FKAB 4H8WL 1JF6A 5I16A 2ZYIA 1JF1B 3WAKA 2DWXA 4IBUA 1TETH 1YQVH 3L4YA 1AYRA 4F8OA 4O2CB 3W37A 3MLRL 1PZCA 4WNJA 1QG3A 3C6SA 2BSRA 3SDXB 4IBQA 3N1PC 4FQXA 2D0GA 2A5UA 1RZ7H 5CP7A 3ZMRA 5F9AC 2AK1L 1AQHA 1RV6X 3K4AA 4NZFA 3QRGH 3QQ9C 3OXRA 5ITBL 4W70A 1F88A 1KEMH 3BSZL 3SE4C 4ESKA 4LGPB 5I17B 1C5CL 2XN2A 3Q1SH 2VQ1A 2UXFA 1NC4D 4RDQG 3OQ3B 1YN6B 4I77H 3AREB 3PP3K 3ELAT 4GH7B 2J6WA 5DJ2A 5G2NA 3N0PB 4HOWA 1NIEA 4G8FB 4MJ6B 5INCA 3PXJA 3GKWL 4F20A 1U8QB 5DYOA 1NJ9B 2KLRA 5AW0B 3QDAA 4M1CC 3UG3A 5B3JE 2CBQA 4LLMA 5T5FL 3UG4A 1NAMH 3DX6B 3FH7A 5FYKH 3X3GH 4JM2A 4I13B 4XGZB 2LU4A 4Y5YC 1F1AA 1E4WL 4IK7A 2FO4A 1G7JB 3R7QA 3C6LB 3SKNB 3UL4A 3HBZA 5FHAL 4WFHE 3NABL 1S9WA 1IAMA 2YJQA 4M93B 1ETZA 1EAOA 1KTLB 1EFQA 5HVGB 3IGUA 4GUCA 3PBLA 5I0ZA 4GRVA 2R4RL 1I8LC 2CBOA 2Y2TA 3QNYB 5F1KC 3RNQA 4JKMA 5MEPA 4U3SB 1FNSH 2ICWJ 5IB4B 1AD0B 1DDHA 2JVUA 2FHBA 2X70B 3ULUD 2BNRA 2AQRA 1P7QB 2IFGA 3QDMB 3N85H 4MA3A 3VWKA 4GBRA 3CUPB 5D7HA 3BEVA 3NH7H 4AZ8A 1FWXA 1LHZA 1ZIAA 5K9OB 5M94B 3SBWC 3RVTC 2DS4A 3KBEA 3QXAA 1M0MA 5I18H 3GPEA 2XQYG 5IHBA 1DJSA 3F7LA 2BVQB 1H3WM 3B1TA 4LL9A 1AE6H 1B3JA 4J3BA 3THMH 4C4KT 1IE5A 2P5EA 2ICEC 3FFDA 4OLEA 1BF2A 1CDJA 4LKCA 4PJAF 3KEDA 5HHOE 1PD1A 3QHFL 4X99A 3DRQB 2EXYD 3CJJA 1YNLH 2VQ4A 5IMOA 3P54A 1CGVA 3PGCA 1IBFA 3KPPB 1G0XA 1CBJA 2X6CA 1VKXA 4YHPB 4AUUA 2NTFA 1IFHL 4NFBA 3BPOC 3KCWA 2XV3A 3QPQC 4PRHA 3UJIH 2VLJA 2VM9A 3VRJB 5B38A 1N59B 4BSWB 4EMZA 5EF1A 5IOKA 1A14H 5EFIA 4ISVB 2R2CA 1AFVL 3LMJL 1FHGA 4R26L 3A3YB 4Z7VB 1C1EH 1I9IL 2FD6H 5DFTA 4KQ3L 1I8MB 2O61A 1XBRA 1GC1L 1FL5B 1S7UB 4KH2A 4HALA 4Z78B 3HAEG 4ZUSB 5I76A 1BX2B 5IHWA 2EKSB 5KSAC 2IBBA 1T5XB 3HLAA 3QZOA 4YPGA 3P0GA 3I75A 2ZF8A 5F9OH 5HGDA 4KY1H 1ILUA 4O2FA 3CVHL 4NI6A 1NBVH 2Y00A 4NQSB 4OLWH 2ZXEB 2YBRA 4E42A 1I3VA 2X89A 3E38A 3UG9A 4GW4B 3MAWA 2KBGA 4Y4KD 1ZA3B 2ZX7A 3ZTNL 5F2FA 2C7FA 3EOAB 4QHLA 1S7SA 3Q06A 2VISB 2UVFA 2WM0A 2DKUA 2FNWA 4PJHE 5DVOA 4F57H 2VRQA 1KLGB 2R69A 5DFVD 5AW5B 4HLEA 2Z6FA 2KKQA 1ZSDB 4PWIA 2V7HA 3BQUA 4G7YH 3KM2A 1E8WA 4BH8A 4PCKA 5JHMA 5CAYB 4KNFA 4PJ9A 3CDZA 5AOJA 2N4IA 4EN2A 1U8OA 4NN6B 3B3BA 3TBTB 3LEVL 5L2KA 1G7IA 2DH2A 1MCKA 4BQCA 1KPRA 3NFSL 1MH5B 4HJUA 1GZMA 2K0RA 4KVCH 2WZAA 5CEZD 1DQML 3RUGA 4L1SA 1GPOH 4ZS6D 3IAGC 3UTVA 1YYCA 2BOBB 1UD3A 4Z7UE 5IGXL 5INDB 2YUWA 1R5WB 3ILQD 2MCPH 1KCWA 3UERA 4MWFA 2VM3A 1ID2A 3Q8FA 5G4MA 3UTSA 2NYYD 4KV5F 4OZIB 3BPCB 2F7QA 3HRZC 2R0ZL 1DVFB 5EU4A 1G84A 4HH8A 4MJ5A 4WWOA 4PD4K 1B3IA 1AQDB 4EZLA 1D9KD 4XMKH 4FHKA 1YQ2A 4HIJB 3HN3A 2V5YA 1RZJL 4B60A 1B0GA 2XZAL 3GM8A 3EDKA 3NVQA 4XXDB 2QPFA 4YSSA 3C5ZA 3K81A 3HCVB 1GR7A 3OL2A 1RL1A 3FT9A 3N3EA 1T0NB 1RUPL 3HE6C 3VVKA 1GHFH 4X0NA 2XWXA 4PCYA 3TA4D 1DLFH 5LQBH 3CD4A 1DTUA 1EZVY 1GOHA 1CYWA 1CURA 3F7YA 1DE4A 3QJFB 4J8RB 4LSVL 2QGBA 2UXTA 1ZHNA 3BKJH 3MLTB 3US0A 5E9DE 1NWPA 5IEKA 4QPEA 4NKDA 5D2LF 3V79C 2VDPL 5F7AA 4OF3A 3CFCL 5GSRB 5DEFB 1HJBC 1BXAA 5TE6H 4PJCA 4MNQD 4NXSA 4FLHA 5AVTB 2CJ3A 2Q1EA 3B2VH 5IJVA 2W9LA 2QHLA 4XNXH 3NEEA 2EO1A 4G1EB 5KN5A 2HTKC 5D7IA 4XMLH 3CX2A 3NJNA 3VFPB 2OL3L 3JWDL 5D71L 5JTWA 4K7PH 2KS9A 3NJIA 1B4RA 4W68A 2Q8BL 5KSBA 3IMSA 4DP4X 3TGXA 1OZUA 2L3BA 3SY6A 4PJXA 5I0WA 3EUUA 2NR6D 5DR5L 4ES9A 1HH9B 4L8DA 5IM7B 3LDBC 2FBRA 3RBGA 2X1PA 3MV11 1FORH 1QRKA 2M2DA 5F1IA 3MV7D 4XPHL 5H35B 3PIQA 4XB7A 1LL1A 2VDLB 3GIVA 2LHAA 1G1KA 32C2A 4UAOB 5B1AB 4DPRA 1AR1B 2BSRB 1KBWA 3E9TA 2Y02A 3VHZA 3L3IB 3O8XD 4U2ZA 5EBWA 4FA6A 4L8BB 3NJHA 4N25A 5BZWB 1R5VB 5E6ZA 1F4WL 4QOKE 2AV7B 2PETA 4Y16D 4DKDC 5DJ6A 2AJYL 3RGVB 1BQLL 5BNXD 2H26A 1KUMA 3FHAA 4CC1A 5JW4N 3DRTB 1TUPA 5DJ2B 2I9TB 4MGXA 4TUOB 5INCB 1U3HB 3B9VA 3U30C 4ZPTA 2VQUA 4JO3H 3MRKA 5E4AA 1OCRB 2EEFA 2GJ6E 3MJ9A 1UXLA 4ONFH 3IAPA 4ZTEA 3VRIA 4DHLA 5TFSH 4JKPL 3AXLA 4AKOA 4JM0A 4LLMB 4PTTB 1TQWA 4DGVL 1B9KA 4XVJH 4X7DC 4JM2B 1CPUA 1M1XB 4G6AD 3B5TA 1YO4A 4BZ2A 4NRXA 2QSCL 2VL5A 3MNVB 4PG9B 4UWQB 3AS0A 3U0WH 3ECBA 3GUFA 4OJAA 1YYLL 1ETZB 3APFA 3WU1A 2A9NL 1PSKL 4YHMH 3QDCA 4AVKA 4E41D 2FB4H 3RNQB 2IWGA 4DTGH 3L48A 4UNIA 3QAPA 1LXMA 1DDHB 5AOIA 5I26A 2ZSWA 4P5RA 3IJEA 4MA3B 1URLA 4N0YH 3BEVB 1FP5A 1QHOA 1T3FB 3OMAB 2HPOA 3FO2B 4FFVD 4GAJH 4K3JH 1RK0A 3QXAB 4FX5A 1S2EA 1LD9A 3GSUA 4AYID 4BGDA 5JUEH 1DDTA 4YMPA 4PRIB 1YEKL 3M86A 1UKQA 4RGNB 4KI5C 3S36L 2EACA 2CO2A 2P5EB 4MCNA 1HKLH 1SYSA 4KTDL 2R2EA 2Z1KA 4LKCB 3QI9C 4ONHB 4X99B 4FQIH 4M5ZL 2NZ1A 1UCTA 3PGCB 5CZRA 5FO9A 4LCUA 4KNUA 4PJAA 1NCHA 2NTFB 3LIUA 4ZW6A 4N6QA 1DBKH 2BHYA 2X6MA 4PRHB 2VLRE 4XP5L 5B38B 1LEIA 3BIKA 4ZQTA 1WA1X 1P4UA 2JE8A 2APFA 2AXGA 4ODWB 3OGCB 2YA2A 5DD1H 3GS4A 3PWHA 4OIBA 4W9GC 1GUEA 3DQBA 1IEBA 4MZRA 3MA9H 2NXYC 2X1QA 5EPMA 4P07A 3TTYA 1AD9B 4EUPG 5IREA 3GHEL 2P42B 1T04B 4R7NA 3ZE2F 1HXMA 3X3FL 1BQHG 5CEXA 1AOZA 4R4FH 4XC1L 4B6ZA 4EQ3A 2PPAA 1N4XH 5HGDB 5I6XB 4K3EH 2E75C 4KROB 3GPSA 5F9WC 3PL6B 3X11A 4GUPA 2WANA 3S3BB 3NFNB 2YBRB 3Q2LA 4LF3B 4N3TA 1PJ9A 4WUUA 4E42B 3N43B 4XTLA 3U6RA 3FCGA 4MHHG 1KB5H 4NAQA 2WZ5A 4MB5A 4QHLB 5AL8A 1KCRL 4D9QE 1UEMA 1PGRB 4OZHE 3LXAA 4P59H 4BUHA 3WN5B 5HY9B 4TNGA 3L9BA 1QFPA 1GIGL 5F0LB 2CJUL 4L4TD 3DTUB 3TBVA 4Z7QB 1XTLA 3TIEB 4LASL 1JBJA 4I9XA 3GO1H 3CDZB 1CFBA 2A7BA 2LNLA 1HQ4B 1U8OB 4E9WA 5L2KB 5DO2D 4WWNA 1CF8H 2YJLA 1OT2A 2VLKA 1T5WB 1XZWA 1KYAA 2G5UA 1LO2H 3ZZQA 3TA3C 3AWFA 3L1FA 2RHEA 2CBPA 2AW2A 4H26A 1WFTA 2YAPA 4Y2OB 1Q94A 2GG1A 2HFGL 4WY7L 4Y7OC 3D0VA 5C0AA 4L6RA 2V9QA 5EU4B 3UYPB 5SV4A 2C5DC 3QUMA 1S3KH 4MJ5B 3K4ZA 1P8HA 5AOMA 2J8OA 4H1LA 3LEYL 1YECL 5ALBL 4B50A 3ZDZB 4JFDB 1T83C 3MRQA 1B0GB 1Q0EA 5J9PA 2OI9B 4U0RB 4AUYA 5LJYH 5IQ7L 2EYSA 1KXTA 2R29L 1M1SA 3QP3A 5E7FA 1JD7A 4FLRA 4WJ5B 4EDWL 6FABL 1V10A 2IGFL 5E23A 4EZJA 1T1ZA 3QK0A 1EJFA 4PVLA 4XBEL 3UPAA 4F92B 5C6TH 3UBXA 5HHQA 1Q8MA 1Y0LA 2Y6SC 3PP3H 3F7YB 1DE4B 3B9KD 2YDOA 1H8SA 2E5EA 3MV8E 1ZHNB 2F54D 4MVBD 4QRSB 4V1DD 5DCCA 1MCOL 4NKDB 4OV5A 4IBYA 3LXCA 4YX2H 3VFWA 2I85A 2BSSB 4P9MH 3DUSB 5D6CB 2GJRA 4UTAL 3N06B 4PJCB 1N64L 5D2LA 3NCJH 4ZFGL 1BV8A 3F3HA 4GRWE 4KTEL 4UQ2A 1JPSL 5LG6A 2ZCZA 2QGCA 5IJVB 1N8ZA 3VGBA 1MGYA 4GSDH 4L2LA 3ETSA 5KN5B 4BELD 1X4YA 2PXYD 4LAQH 4UOW0 3MHZA 1XD1A 1AO7B 1TZGH 2GIYA 3CVIH 2VE6A 4AV4A 2EDKA 3QORC 4PJXB 5FCUL 4WZ9A 2K3TA 5DK2A 4L8DB 1I7RA 1FC2D 3H85A 4G72B 3TXAA 3GJEA 1SVBA 2VZOA 3RTQA 2BJMH 3KH4A 1BYNA 1GC1C 1L5GA 1F1DA 4AJ0A 1ZT1B 1HIMH 3GIVB 32C2B 2OZ4A 1OHZA 5DVKA 4UM8A 4HPHA 5J13B 4AT6B 5H2MA 3ZKSD 3QUZB 4Y19D 4R96A 4XCFH 4IIQB 5SX4H 4NCC2 1G9EA 5DRZA 4LHQB 7FABH 4XI5D 2OJZL 2ZCHH 4RFNB 5E2WH 4FZ8H 3VXMD 2DL9A 1DANT 4I3SL 6PCYA 2XY1A 3GT6A 1DJIA 1UUSA 2EEAA 5I74C 4O5LH 4MJIA 2AAAA 2Q9OA 3RHWF 3ORJA 1F56A 4IJ3B 4N24A 1M53A 5A2KH 2G2RB 3CZKA 3GMPB 3KXFD 5CINH 4ZPTB 3C5JB 4PYHA 4JX0A 3IYLW 3MRKB 4AQAA 2E7LA 2F1EA 2J20A 5AW6B 3T0XA 1G1CA 3AXLB 1Q1PA 3WG7B 3KPNA 3TT1L 4PBWD 2KT6A 1D5IH 3WV0A 3ZE0E 1CG9A 3BLPX 4D0BA 3NP4A 1ZPLA 2VH5L 4HWNA 5JW5A 4MMYA 4OJFL 2P8LB 3ZL2A 4U31A 3X12B 2VOTA 5EOTB 3QEGH 3U36A 5B4MC 5G54A 1ZV9A 2J1KA 4TLSA 5I6NA 4YSQA 4XN8A 4ABUA 5AVSB 2EP6A 3CN0A 2YUVA 4A2LA 2NQCA 4UAHA 1INEH 3G5XA 2ZSWB 4MXWL 1FSKC 4TUJA 2ZUQB 2AABL 1RJLA 1RZJC 1BF8A 1QWNA 1TF4A 3ZYOA 1RK0B 1WSST 1LD9B 2DLFH 3GSUB 4Q2ZA 2H1LM 3L45A 5F7KC 4RMRA 1KJMB 3NY9A 2P3YA 2ZYSA 1R24A 5E0QA 3IPBA 4Z6AT 3B7YA 5IMKA 5JIKA 1SYSB 3WFZA 2R2EB 2EI4A 2ICWA 1I8IB 3APMA 3VXNA 3GFUA 5EORH 2AF2A 2GIXA 1Q0XH 4HV8B 3K46A 4AUJA 1ZWIA 2QKIA 4HUKB 5GS1C 1TCRA 2AXFB 2OXHB 1Y6MR 2MFNA 4ICXA 4QD2E 4QHUB 4XN9A 2JJSA 4JFEE 1TCMA 1LEIB 3SJVE 3BIKB 4MBRA 3CXHK 4OLVL 3X13A 2AXGB 2MNWA 2K7QA 4OUUA 2XN9D 4NO0D 1PNCA 1Q1JH 2NNAB 4CNIB 3KJ6L 1CQYA 4ODXA 1NC2A 5C92A 2ILLA 3DX2A 4WUKL 1USZA 4JR9H 3OB0K 3FH8A 1U8JA 5EPMB 4UT9H 4APQD 3FQNA 5FR3A 1W6LA 3WXWL 2RR3A 4A2GA 2GSIB 1HXMB 4U1MA 1AI1H 5HYJD 1OGTA 5CEXB 4FL4C 3JWDC 4DOHE 1JNLH 1KF9B 4XVUC 3GC3A 2X38A 1PBYA 2ZAGA 1GTNA 4GW5A 3MZTA 1N8OE 3TT3L 2BMKB 3RPKA 3X11B 3NT0A 5ACZA 5ICUA 1AG0A 2I07B 1URIA 2EDBA 2EYTA 2RCSL 2EUVA 5AAMC 2ZD0A 3KS0J 2OBGA 3FOLB 1JHKL 4IBTA 5E56A 3CZSA 3MJ6A 3TBVB 4A2DA 1MHEB 1T80A 3CLFL 5JHAA 1SM3H 4NQUA 5ICZA 1X7SA 4ALAL 4Y5VA 3D07A 4NKIH 4NUPA 2ADFL 5ACMA 3IS0X 5DD5L 3PLYA 4BZ1H 1MPAL 3M17A 3UAAA 2VDLL 1ADQH 1S7VA 2BHFA 2VLKB 5D4HA 4DETA 4GO9A 4GNKB 1TYJA 5E08H 2G9HB 2P8MB 1CICC 1Q94B 1S5IL 2IPKA 3D0VB 4HLZH 5DUJA 5C0AB 3TCLA 3GBLA 4CSSA 1XGYH 4P9HC 3QUMB 4O58L 5ALCL 4GAGL 1FCGA 3X17A 5DRNB 4P5SA 4U1JA 4DAGH 4NIYE 4H1LB 4OFIA 3TZVA 1NAKH 4MQXD 3E7JA 2WTRA 1IAIL 3DYMA 2WWMC 3KPSE 3MRQB 1R5IA 1R34A 2PWEA 4GBXB 5E6YA 3CHQA 2VJXA 3UCRA 2Z64C 1W8OA 4NXKA 2YGOA 4O4YH 1SUJA 1MW3A 1KXTB 4YGVA 2ED8A 3RAJH 3ZZ1A 1I85A 2WUCL 3IE9A 1UYWH 3CV5A 5JIHA 1BVNT 5I2IA 2BNQB 1P9MA 4Q4IA 5F96L 1B9ZA 2W9DH 3HZKA 5E99H 1IBBA 5DWUL 3UBXB 5HHQB 1Y0LB 2CZNA 4JPQA 4HSCX 2R4SA 4XO8A 4N0CD 3FU8A 4MD5B 1X7QB 2D9CA 1NCNA 3BZDA 4P23A 3CFJA 1KFGA 4HK3J 4OV5B 2XTJB 4GKOA 5JJNA 3HVNA 1EZUA 3PABA 2XQBH 1JZHA 1K6QL 3UTZA 3HAPA 2VZVA 4UQ2B 1CO1A 3B8YA 1XSKA 1X9LA 4XVTL 2DJMA 2RBLA 4YC2C 3O3BA 4HUVA 4XXCA 5AHZA 3H9SA 3O45A 1C16A 2DYSB 5EZLA 1CVRA 1WGOA 1C5BL 2EQDA 3ARXA 2PPDA 3HFMH 2R9HC 3M8OH 5DYFA 3N44F 2CDEB 5GJTH 1BXXA 3OKNA 4Q6YA 3LRHA 1IC7L 3WEXA 4RH4A 1N6QH 4PGEA 1F00I 3FQ4A 4YAQB 4Y9CA 3II3A 5DK2B 1BA9A 1EX0A 3J2PA 4GXVL 4PJ8A 1JPGA 2VDQB 3KPMA 3GJEB 3PQYB 1QR1A 4Y1AD 4KJYA 3CSPA 1J86A 1AY1L 5C8JA 1HAWA 4F24A 4AM0Q 2E6JA 5CEYA 4XMXA 1DJWA 3QFDB 1BZ7A 4JS7A 4BHUI 5I1IL 4UM8B 4NZUH 1NA8A 2ITDA 4KQ4H 3A24A 2GTQA 4Q9BA 1HCFX 4R96B 1J5DA 1KENL 2WSKA 5EU6A 1L7TL 2XI9A 3MLWH 5GRVL 5CJQH 4YHLL 2ZKHL 2BIIA 1T89C 4GFTB 3ZL1A 4N2KA 3HG1A 1J1XL 1BRXA 1DANU 2X1WL 2IBZY 4MJIB 3Q01A 1I7TA 4MZIA 2NOYA 3ZT5A 2OCFD 4H20L 3MXWL 1OGAD 1P4LA 2A9DA 4NERA 5BXFA 3VI4E 3CZLA 1OSZB 5KYUA 2XUWA 1BSIA 1W0WA 1XTMA 1MLBA 3DROB 4RISL 1EJOL 4GB9A 4M5SA 1CI5A 1NANH 2WXMA 3KPNB 4TRPL 2ZNWA 4CC4C 4JY5L 2V8LA 4ZSOB 5HYEA 4HKXA 3D30A 3QCTH 1ZPUA 5E2TL 5I1CH 3K6SA 1CG9B 2J25A 4PMEA 3RVVC 2J43A 5TE7H 4KHTH 1QX1A 4IAQA 1DEEB 3A6OA 3DOSA 4D0BB 5BO1H 5JW5B 3OKMB 4KRLB 1U8PA 1BVNP 1GA2A 1UFUA 1G9NL 1QASA 3MBED 1F3RB 1NGYA 4GRWH 5EC1A 5EIIA 1F13A 1MAKA 5B34A 5IQMA 3MU3A 4HS8H 4I9WE 1H6TA 4A38A 3QVAA 4PWFA 2COVD 1BM3L 3AFLA 3BGMA 3KWVA 4XTRD 2DTSA 4JFFA 3V4VA 5GZOA 4P0DA 2VXUL 2OYKA 3GSNA 1SDYA 4HETA 3L7EA 2HTLD 3D48R 1BBJB 1YEJH 3FAWA 1KYFA 4G1MA 4XN7A 3T0BA 1XGPA 2YR3A 1R24B 4JO4H 5JXAL 3BAYA 4XPGL 3Q3GB 1MIML 3HPJB 2YCXA 3C6LC 4IBLT 2EDRA 2ICWB 4O02A 1BP3B 1XVSA 3CFIC 1NEUA 5BOPA 1CL7L 1JTOA 4M93C 1ZWIB 4XNBA 4W1TA 2E0PA 4JE4B 3QEHB 1JVLA 2E8ZA 2FX8H 3E80A 1Z9LA 2EABA 4TSCH 1IBHA 2H4EA 2Y1ZA 4NQEA 3VVWA 4AC2A 3PCYA 3EGSA 4Z5RA 5I6LA 2ZWNA 3X13B 1YNTB 3HG2A 4Z76A 4QRTA 1D3CA 4XP6H 1Q5JA 2ENQA 2XA3A 4ODXB 5BRZD 4IK6A 2JQZA 2VO5A 3R0NA 2IDQA 1UOWA 2VABA 1MY5A 1XT5A 3ECUA 3FQNB 2FLRT 1MFVA 4N2AA 4U1MB 3EJTA 1IBDA 2FX9L 2CUIA 2HN7A 4YL4A 3SE3A 1FI8C 4XTNA 3KHQA 2KLSA 4DO6A 1RU9H 2MWCA 1DUZA 1WIPA 3BD4A 1ADWA 3KLQA 1UZ8A 5D1ZI 3ZE2B 1DN2A 1C8PA 4QXUL 1X0I1 3V0WH 4GW5B 2CDFB 4XPAH 1UM6L 2BP0B 1KPUA 1LK3H 1XL4A 2MJWA 2P5WD 2JELL 3IDIA 1GZQA 2X4NB 4LSDA 2WIMA 4P05A 4LIQE 4X8JA 9CGTA 3PREA 4QT5A 4QO1A 4QRPA 1QSFD 4G8EA 3CTTA 3WTYA 4X8CA 2ZSVB 2G4EA 3MLSH 1U8HA 4BRVA 3MBXL 1YLBB 1HU8A 1FVDA 1GS8A 2B5IB 1GW6A 2CRZA 1KDJA 2H5UA 3E9UA 2H41A 5HHME 2DV6A 3M17B 1S7VB 1NGPH 1H0DA 1P4IL 1SXZA 3GKZA 2BY1A 2PR4L 2X4SA 4OSUL 4YK4B 1P84J 4ZMLA 4S1QH 1XDTT 1AHWA 5KBPA 2WXNA 3M6DA 4M7LL 1GL4B 1XCTA 2V9RA 3TCLB 5FWRA 2BNUB 3SDAB 2OMNA 4HWEL 2JAGA 1AGCA 5F8RC 3ZUCA 1AZBA 4N0UA 4ODSH 5I1KH 3ARED 4RMWA 1YY9D 5ANHA 3TZVB 2CCWA 3KW7A 2WTRB 4WIQA 1BD2B 2AQQA 1JXFA 5D4QA 4DPAX 3GYRA 1ZLDA 4NN6C 2WINA 5IBUB 5TPWL 1E9OA 5FECA 1ZE3H 2F95A 2Q76A 3QJHA 3B5GA 3PUCA 2CGZA 3P2DA 3OXSA 3C5SA 2ZOTA 3HZKB 1BOGB 5C0CD 2O6CA 2VDOL 2YN3A 1T1YA 3TP4A 1ZEAL 3RU8L 4HYXA 3HOGA 4WTZA 1FG2A 1DVFC 1FBIH 3ARZA 3CQPA 3MNZA 4ZPVA 4FP8L 3CFJB 3B83A 3CDGB 3NIDF 1Z9SB 1MXGA 2Y3NA 4L3ED 3T9WA 5L4JA 2JCCE 3PABB 2BHUA 3KNBB 1CFNA 4WNQA 3K2UH 5FDYA 1BVKA 2AZAA 4J7RA 2J56A 5BS0B 3V2WA 2GEQA 4H5SA 3NCYP 5DHVA 1Z5LB 1PW3A 3GUTA 4HUVB 3VW3H 4NPYA 2YD9A 3QFGA 5J8OA 3O45B 4NLHA 5GGVY 5EZLB 4HSAC 1NIDA 2HT3C 4FTVA 3WTWA 2VWEE 2EO7A 3QXWA 5JOEA 3QCUH 2DPKA 5DGRA 1SHSA 3VUAA 4EN3D 3OKNB 2HPYA 3WEXB 4YSPA 2UUDK 3QIUA 3V6OC 1NM9A 1VDGA 3BXNA 4Z3EA 4H0IA 2GCYB 2WXRA 4QAWA 3ES6A 3VFGH 2DMKA 4PJ8B 1NCWH 3HG3A 3KPMB 4HT1H 3ASWA 4U6TA 4KJYB 4UIKH 3Q2VA 1NPNA 1QBLH 5C8JB 3EH5B 1P1ZB 4FCAA