3S8FB

1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
b'DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title High resolution structure of the ba3 cytochrome c oxidase from Thermus thermophilus in a lipidic environment.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s8fB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s8fB02
1OE3A 3RZEA 1GS6X 4MBSA 2X88A 3H56A 1M9WA 4HCFA 5B6YA 1OF0A 3VGAA 2PPCA 3NJNA 3OQRA 5C1MA 1W6WA 1PZBA 3V2WA 2DWTA 2FT7A 1WAEA 4YVUA 9PCYA 3SQRA 2W88A 1AANA 1SHWA 1SFHA 1IBYA 1M56B 1AG0A 4M4RB 2GC7C 2BRDA 8PAZA 2B08A 2GB2A 5B1BB 5B7MA 4HYJA 3ASNB 1ZIAA 4AX3A 4BXSV 4WW3A 1UAZA 1GW0A 3NY9A 4LDEA 2AT9A 5AX0A 2EIMB 5TK2A 4QI1A 1W6LA 3UACA 1E0PA 2HX7A 4N6HA 2TSBA 3ABGA 2PCFA 3EH3B 1E5YA 5B2NA 1CUOA 3X2QB 5I6LA 3ZDWA 2Y04A 1S8JA 1AG6A 3ABWA 3AYMA 1F50A 1BAWA 1KBVA 3N55A 1FFTB 1WS7A 1N70A 2FQGA 1TU2A 1OCZB 5B3SB 1OOWA 2M3GA 3IN0A 2HRGA 4HALA 3X1NA 5I5MA 3WNJA 1MDAA 1Q5IA 3MBVA 4XT1A 1JVOA 3FYEB 4W1TA 3CODA 5AWZA 2RACA 4DP2X 5BR2A 4OV0A 3AG4B 1MG2C 4YL4A 3UTYA 2NTUA 2BP8A 4L0PB 4DP5X 2KSAA 1P8UA 1GYCA 2PLTA 1ILSA 3IEAA 3PBLA 2XLLA 4DJHA 4HWLA 5B6XA 1SF3A 3OE6A 2QT6A 1AT9A 3S8GB 3NP3A 3TASA 1PXRA 2CCWA 3T6XA 5JJEA 2I20A 3PPSA 5I5JA 3SBRA 2G87A 1AP9A 3T9WA 1BQ5A 3UONA 1E5ZA 4UHRA 1JVLA 3CAPA 1A4CA 1JZGA 5B7FA 2L6XA 5B35A 3PAUA 3X3CA 1WA2X 2IDQA 2R7EA 2LNLA 1KGBA 1SF5A 2Y01A 2VT4A 1S53A 4GPOA 3QJQB 3UTVA 2ZFEA 2Y02A 2J55A 4BXVA 2GHZA 7PAZA 1AZUA 1PNDA 2I7SA 1TN0A 3HEIB 5H2IA 1JFPA 5AZDA 2NTWA 4X32A 5A8EA 3X1EA 1R1CA 1DZ0A 2XV0A 5IY5B 1L9QA 4JHUA 4YSRA 5I6KA 5PCYA 3CZUB 5G54A 5G53A 1I53A 2FT6A 1CURA 2JAGA 1M0MA 1GS8A 1PY0A 4DP7X 4QRYA 1KMEA 2F95A 2XU9A 1CYWA 3AY2A 1HFUA 3FU9A 3UADA 1IUZA 4EF3A 4GP5B 2YAEA 2MRYA 5ITCA 2YQBA 5JJJA 3C75A 1KCWA 3PQRA 1AZCA 1PAZA 1L9HA 3NJGA 2FQFA 2MTAA 2PP8A 3CVCA 2Z73A 3TU6A 3ZIYA 3NT0A 3ZBMA 1GY2A 2H5UA 1AZRA 1L9OA 4HHGA 5B1AB 1E67A 2J5WA 5H2JA 5H2LA 3S3CB 1E30A 1OE2A 2DWSA 2QDVA 1JXFA 1CC3A 2UX6A 4JQ6A 5BR5A 1YLBB 1R2NA 3PXOA 1PXSA 5A45A 1HAUA 2PPEA 5G2AA 3ABLB 1EHKB 3AZUA 4YSCA 3KJ6A 4AMIA 2WSDA 1NPNA 2PPDA 2XV3A 1E65A 3FQYA 4HIPA 5B1JC 3UABA 4E9WA 3IE9A 2DV6A 1BYOA 5F8UA 5H2NA 2FT8A 1FWXA 3D4SA 3QQXA 1GUEA 3ZPQA 4J4QA 1J5DA 4HAKA 3QBLA 4GP4B 4NERA 3U25A 2VM3A 4MD1A 2PP9A 1RCYA 2KSBA 3T6VA 4BEZA 3QJTB 5B1JA 4Q89A 3NSBA 1VJMA 4G70B 2VSMB 1BXVA 4KO6A 4A2EA 3WQJA 3CVBA 2Y1AA 4E9SA 4IB4A 1KG9A 2AZUA 4JKVA 4XTNA 1SDDB 1BXUA 2CBPA 2ZONA 5LWEA 3CDZB 4E9QA 1AZBA 2BWIA 1AQ8A 4YSAA 1L9TA 2R4SA 4G7SB 1BRRA 2UXTA 4E9VA 3FSAA 1NTDA 2DY2A 2IWEA 1JOIA 3NYAA 3UZAA 1L9SA 1S54A 5H2PA 2JXMA 2VW7A 3FSVA 4W9ZA 4HHWA 5AX1A 5EN0A 3PWHA 1ASOA 3WG7B 4IARA 3DKHA 1CYXA 2I7OA 3NJFA 4F2FA 1LN6A 2QPEB 4FA7B 3BQVA 4JKNA 1IW9A 1QLEB 4Q8BA 1S52A 2BHFA 1VGOA 1H68A 3DIVA 4AKOA 3AM6A 3NJJA 3T6WA 1ADWA 4ZK8A 2Y03A 4DP9X 5I5IA 2FNWA 4FAAB 2GC4C 1A4AA 2IDUA 1BRDA 3ZEVA 3BVDB 1PCSA 4KO9A 4QKTA 1BQRA 3FQ1A 3AW5A 2I21A 3WI9A 2YAPA 3EHBB 2X87A 1MZZA 1AS6A 1W8EA 1X9UA 3V9CA 1JZIA 4HCGA 4YVNA 3N2JA 3DTUB 4IAQA 3X1FA 1H2SA 2FQDA 2WJLA 1NWPA 3X3BA 4G72B 2HX9A 4EA3A 1WA1X 1A8ZA 5TK4A 4BWUA 3MX0B 1S8LA 3FSWA 4K5YA 1WS8A 1AZNA 1IBZA 2ZOOA 5ETZA 5F7BA 2JAFA 3NSYA 3UZCA 3DDLA 3X1GA 4G7QB 2A3TA 3NJMA 2FQEA 2QDWA 1IC0A 3IN2A 2XXFA 3EH5B 4N8UA 3GDCA 4X31A 2X72A 4LDLA 3FPYA 4A4MA 2ZXWB 3X1BA 3SBPA 1JERA 1SFDA 2XVBA 3UTXA 2YAQA 1ET7A 1NIBA 3REYA 4FPDA 5DYSA 2BP0B 4HZ1A 3OMAB 4GYBA 4DKLA 5B1KA 4GP8B 3HANA 4UG2A 5TGZA 4MQTA 2BWDA 3H4FA 2YDVA 2ZZLA 1J9QA 3NJKA 3JT2A 1DZEA 5H2OA 1JV6A 3NY8A 4X4KA 4ENZA 4KOBA 2IAAC 4XT3A 2H3XC 1PY6A 5H2MA 2EINB 1M57B 1SDDA 2IDTA 3AG1B 1P8IA 1KBWA 2PPAA 3OE0A 1MZYA 2YAOA 3CDZA 4KO7A 4YSSA 5H2HA 2ZWNA 2VMJA 1AAJA 1URIA 1UATA 5G28A 2XV2A 1E12A 4BVNA 2P80D 4EIYA 5H2KA 1PF3A 2I35A 1NICA 2W8CA 2YAFA 5B6VA 4P5SA 2WO3B 3RFMA 4KLYA 1S51A 3T45A 2YAHA 3AG3B 4QIDA 1R84A 3UAEA 4DPCX 2VSKB 4M3HA 4MFHA 1C3WA 2F93A 4MD2A 1A4BA 1AIZA 4G7RB 3KW8A 1ZDQA 5I6MA 1ET5A 1HAWA 3MBWB 4BWWA 5KKHA 4QLWA 1V55B 5B6WA 2JFCA 1QHJA 5D4IA 5FC9A 2WO2B 3FT0A 1TEFA 1P8HA 5G2CA 3PDSA 3KW7A 1GSKA 4GY4A 3VHZA 3QBIA 1KCBA 4UAHA 1T5KA 3CVDA 1KV7A 2BO0A 4YSTA 1V54B 2BZCA 1JZJA 2CJ3A 4G71B 4AZUA 4KOCA 3HAQA 3QDCA 1XIOA 1WA0X 1XB8A 2YXVA 1L0MA 1DYZA 3ASOB 2VN3A 5DHGA 5ITEA 1BRXA 3S8FB 1F88A 1NIAA 1RZPA 1NPJA 4BDVA 4NC3A 4BK5C 1NIEA 5B0WA 1JZFA 4PXFA 4K9JA 3V9EA 3HB3B 2BZ7A 2AVFA 2IDSA 3NSDA 4WTQA 3PAZA 4GYCA 4YSDA 2UXGA 4NB7A 2IDFA 1OE1A 4F2EA 5I26A 1MGYA 1M0KA 3D12B 2H47C 2AZAA 1PZCA 2IH8A 3QPKA 3P0GA 2DYRB 2J57A 1F4ZA 1OV8A 3UG9A 4E9XA 1TN5A 4BWBA 1JZHA 2TSAA 1X0I1 5DHHA 4GBRA 1GU8A 3CG8A 1BXAA 2BP0A 2FTAA 4TL3A 2XYBA 3NJLA 5D4JA 3UGEA 2GI0A 3FS9A 3NJHA 3UAAA 1X0SA 1GS7A 2I85A 1QKPA 4AMJA 3ERXA 2WJKA 3OE9A 3HAPA 2GIMA 2E86A 2DYSB 1TKWA 1KDJA 1XJIA 5FJGA 1NIDA 1QKOA 2UX7A 1ZPUA 1HZXA 1RZQA 2CAKA 1UCQA 3S3BB 1GY1A 5AFAA 1J9RA 4MQSA 4AI7A 3UTWA 2KS9A 1PMYA 4BWTA 1FBBA 3DQBA 2FJSA 3T71A 3QAKA 1AR1B 2VW6A 2PEDA 3IBOA 1JGJA 2YARA 2N0MA 4A66A 4BV0A 1C8SA 1KGYE 4NAJA 1BYPA 1NZRA 3QJVB 4DPAX 4A68A 1J9TA 4DP8X 2PCYA 1NWOA 4KNSA 1X0K1 2YCYA 5AHYA 2HRHA 3EF4A 5I6OA 3AG2B 2XXGA 5AHZA 3S3DB 2CUAA 2Q9OA 2Y69B 1JXDA 4CSZA 4E9YA 4YSEA 4A2FA 4A2DA 1F56A 2HZHA 2J4YA 3FPXA 4BDVB 4DP0X 2YCXA 3NJIA 3OMNB 1SJMA 4KNFA 3H4HA 2Z55A 4Y9HA 3VI0A 4KO5A 7PCYA 2YCWA 5A44A 4BUOA 4L6RA 1IW6A 4RH4A 2UXFA 1BM1A 4KNUA 3HAOA 2EIKB 3WIAA 2XWZA 2IH9A 1GZMA 3NP4A 4N4YB 3FU7B 3GYRA 3NSCA 4HYXA 4DPBX 5E9NA 2RH1A 3OD3A 3EH4B 4X1HA 2CALA 3TBBA 1ILUA 4AKPA 3FQ2A 3QBGA 1PLCA 1ZV2A 5LDUA 4DAJA 2Y00A 5F7AA 1A65A 2EILB 2R7EB 4YSOA 5G2DA 2OV0A 1JV7A 3SN6R 1AOZA 3FSZA 3PLYA 1FBKA 1RKRA 3RYMA 4BEYA 5AZUA 2ZIYA 2VW4A 3ZX1A 1Q5JA 2I1XA 3QAPA 2GSMB 3C9MA 3ZPRA 1KDIA 5G36A 1J5CA 3GXUB 1ID2A 2AFNA 4A2GA 3OM3B 4DP1X 1ZIBA 4UANA 2NRDA 6PAZA 2OJ1A 4GRVA 1OCOB 1XMEB 1GR7A 2JKWA 3WKPA 3WNIA 1BQKA 1O0AA 2GBAA 1EZLA 1ETJA 2HPYA 3VVKA 4JR8A 5I28A 3EMLA 3NS0A 2FWLB 3JTBA 3HASA 3OAXA 1SNRA 4A2HA 1PLBA 4PAZA 3OMIB 3G5WA 4UF7C 3QJUB 5B34A 2BW5A 3FYIB 4DP4X 1SHXA 1N68A 4YSQA 4XTOA 1X9RA 1IXFA 2J56A 1OCCB 2YXWA 1NINA 4YSUA 3FU8A 4XTLA 2UXVA 1XB3A 2EIJB 4HCIA 3NYKA 3PCYA 3SBQA 1M0LA 1QM8A 2VM4A 1PZAA 3TBCA 2IWFA 3COCA 3A7KA 1ZDSA 3L45A 5PAZA 1NIFA 3T6ZA 1V10A 4L35A 2BW4A 3C9LA 4PCYA 2YDOA 3QJSB 1CWQA 1FA4A 5EHFA 4FBZA 1C8RA 1AACA 1PLAA 5AKRA 1ASQA 2KSYA 2R4RA 2AANA 3VW7A 2PP7A 3ABKB 3AYNA 2B3IA 4KNTA 5I6PA 5ANHA 1QNIA 4E9TA 4JHVA 1AS7A 5I6NA 3V2YA 4N4WA 1NDTA 5A7EA 4A67A 3HARA 2OCCB 5J7AA 1B3IA 1L9PA 1XB6A 3VG9A 2Q5BA 4AKQA 2YCZA 1J9SA 2HXAA 4CSPA 1QHQA 1VLXA 1A3ZA 3QJRB 1AS8A 4YSPA 4TXVB 2XUWA 1KG8A 4XXJA 2BP8B 3FU7A 5B7EA 3ODUA 4WAVA 4P5RA 4E9RA 2XX1A 1TEGA 3ABMB 1BEXA 2QPDB 5B6ZA 1JZEA 3NSFA 1MG3C 4WKXA 1ASPA 1PNCA 2YAMA 4PXKA 1KYAA 5D4HA 2IWKA 3QBKA 3PAVA 1OCRB 4GXFA 2EI4A 1IKOP 4EJ4A 1JXGA 2HX8A 2LLNA 3TA4D 6PCYA 3WKQA 2PPFA 2XX0A 4F7KA 4DP6X 2P80A 5JJNA 3PXLA 4LDOA 1ET8A 2HLEB 1U19A 3OE8A 1L9RA
chains in the Genus database with same CATH superfamily
2WVVB 5T1DL 1AE6H 1HH6A 5GZNC 5CILH 3IJSB 1LGVA 3B2VH 3CC5B 3ABZA 3GBEA 2OXHA 4O2EA 3VXRE 3WEMA 3V2WA 4K9EC 2FJGB 3Q2LA 4NGHL 4NKMA 2ZNXA 4MA8L 5A2AA 5EZOL 5EF1A 4W9LC 1AANA 4D0DB 1A6UL 1IBYA 1Y1UA 3W9EB 1AG0A 4A6YH 2CM6A 2BRDA 4QCIB 4AY0A 4LP4A 43CAB 5MEQB 5EU7E 1ZIAA 2B1AL 2WJ5A 5FXCH 4TL4A 2JI2A 4LNRA 4ODWB 2OYLA 1BYNA 3E0GA 4IS6B 3T0WA 5I0DA 2A6DB 3FZUD 5GGRY 3SOBH 3MLVL 3ABGA 3MRNB 4C4KO 1UXSB 2PCPB 3K0YA 3L9BA 4Y16B 3ZIMA 5IW6B 2AK4B 3RVXC 5LAXB 2ED7A 2BM3A 4HJGA 1WS7A 4UM9D 4PGDA 5DMGC 1VF5C 2NUTA 3ROOB 1QW9A 1KG0B 1TO4A 4HGMA 4TF4A 4XPGL 4U33A 4OI7A 1MJJA 1CXHA 2VRQA 4WEMB 2E47A 2VXSH 1TCRA 4H1LB 5DYOB 3WNJA 3PWVA 2F7QA 2RFXA 3MBVA 4XT1A 1H6TA 1Q1PA 4YDNA 3VQ2C 1CQYA 4QXUH 1N9PA 2VT0A 3LS5L 2VRKA 4F9LC 1CD1A 3QZMA 2OFQA 2BP8A 1PG7W 2KSAA 1ZT1A 4PRNA 1MEXH 2OSXA 3UBXA 3BSGA 5ETUB 2BVPB 4LDOB 4X5QA 2P1YA 3IEAA 3DOIA 4PI2A 5HVHC 4KKLD 4Q9QL 1IGJA 2J8UB 4O02A 4KV5F 3GZKA 1DQLL 3BWUF 4Z7OE 2DW5A 3F6IA 1XXFC 2NDGA 2P45B 1WISA 2JQAA 1JPTH 3EJPA 2NT0A 4L4VE 5B7FA 4PP1D 5J3HC 5FO9B 3RG1C 3UZEC 1M3JA 1SF5A 5F3HA 4A7TA 2EH8L 2ED9A 5KS9A 2F53A 3GXNA 4XH2A 4G8FA 5ANMA 4X7TB 5EOQL 2C9VA 4FQQB 5T1DH 3HPJA 4MX7B 2NTWA 5A8EA 1CXIA 2BSBA 5C07D 4YPJA 3UYPB 3HI1B 3VFWB 4JFPA 3VM5A 3BIAX 4JKMA 4NGHH 2PN5A 4MA8H 4ZOBA 1JFQH 4OKVA 5EZOH 2Z7WA 1SJHA 3VM7A 3N5AA 3U9UA 1NKOA 1ID5I 4X4ZA 35C8L 1U91B 3KM2A 3UADA 3HAEG 3JV4B 4M3KB 4ZMAT 1JF1A 1LE9A 1J0KA 2OULB 1EEZB 3QDJE 2B1AH 5JYMA 3NAAH 3X3FL 4W4OC 2PP8A 1ZLVH 3VTMA 3ZBMA 1GY2A 1BA9A 2FEEL 2IH1B 3ESVF 3MLVH 4JVPA 3S2AA 5J89A 3IETA 4JG0L 3U46A 1R2NA 3J07A 1E0OB 3CSYA 3B3BA 5K39B 4NRYA 1MF2H 1M7DB 3O2VL 4GW4A 3HA0A 4Z5RB 4XPGH 4M6NL 1CFQA 5FK9A 2CM5A 1PIFA 5C7XL 3I6GB 1T3FB 1OPGH 4G5AA 1UOKA 4K3DH 5HHNA 3MPCA 4XC3H 2AS5M 2TRYA 4FGMA 3TN0D 1OWWA 4QPEA 5DS8B 1KTKE 3LS5H 1URZA 4PD4K 4F80A 5DFWH 2UWEB 4P5KA 2G9HB 3A4AA 2Q86B 4E9SA 3EO1A 5BNXD 2VJ8A 4QXVA 5IEKB 4NRZA 3OBAA 3NCCB 2A0LC 1JGDB 5E6YA 2H6PA 3N85H 4C56B 3V10A 4Q9QH 1E4JA 1PU0A 3STLB 4EUPH 4UOZA 4D7BA 1DQLH 3KL3A 5DMYA 2CO3A 1AGFB 1L9SA 1J0ZA 4K71C 4JMXA 4ZS7L 5AALA 1QW8A 1PPIA 2Y5TB 4NIKB 2YWZA 4L23A 4PJFE 4RMVA 3U79A 2GYSA 3NJFA 4MDIA 1QPXA 1R3KA 5FHAL 4BM7A 2IH3A 3TL5A 2EH8H 3TXAA 1O6SB 4PSPA 1KCUL 3E1F1 1RU9H 5EOQH 3DBSA 3RWDA 5I5IA 2GT9A 5CLXA 3F01A 5IOKA 1XO8A 4WY7H 5D6CA 4HT1L 1A4JB 4POYA 1FZMB 4NAQA 2WAHA 1EIBA 1FN4B 4JHWL 3HG5A 5DUBB 1LO2L 2WOBA 2Y6SD 4JFXA 1A6TA 2NNCA 2CIIB 1U3JA 2O4EA 5FB8A 35C8H 4X0KA 4YEEA 2ZWZA 3ARGD 4OFYD 4FULA 1KCRL 4NFBA 1YRKA 3DO7B 5L4FA 3UAJC 4TLTA 4YDJA 3TOPA 4ZYKA 3D69A 3O8XC 4TRPH 3O41A 1K8DB 2VE6A 1MCOL 3LKRB 3ZDZF 2EYTB 5LJYH 3R1GL 1SRDA 2WPGA 1M7XA 5DI8A 3WUWB 4FA6A 3W5MA 4JN1H 3QWRD 4OQ1A 1IC5H 3DX9A 4XN8A 4NZJA 3O2VH 3G5VA 3REYA 3MCYA 1QAWA 3MHZA 5CEXB 4IDLA 2A4ZA 4RAUB 1MI5D 4GP8B 4M6NH 2MH4A 3SDAD 5C7XH 4MQTA 1OW0C 1VERA 2IANB 3FH5A 2A74C 3GSQB 4XAWL 8FABA 5DJ6B 5DZVA 2JXMB 1RULL 1F4XL 4MNQB 4NP4L 4Y9BA 4KZCA 1ECZA 1C9SA 1XGYL 5J9PA 4KO7A 4K3JH 2IPUK 1LO5B 4DGVL 5J11C 3MLTB 1NCJA 4MYPA 3OR7B 5HY9A 4J3OH 1NICA 1PG7X 5E23A 1WF5A 2DDQH 4AGMA 4OZIE 3VFOA 3RFMA 4HX1A 3T1FA 1GZPA 5FGCB 1I8LA 1YN7B 4H25A 3RDTA 5EC2B 1R84A 1DJSA 3VG0H 4TUJA 2FR4B 3IDYC 1GH7A 4ZS7H 3V4VB 1HEJC 2CO6A 3L7FB 5EEWA 4BWWA 3IGKA 3T65B 2XG4B 1DUZB 4RFEB 3EYOA 1MCFA 1BD2D 4Z7AA 5IMMA 1ORSA 3FT0A 3H7LA 5I18L 5C08E 2P8MB 1BCIA 3LVEA 1OAUL 5ALBL 3RKDC 4GY4A 3VHZA 4JFTA 2ADYA 3NIDE 4HT1H 1FJ1A 3QDCA 1AQMA 4UT9A 2HJLA 2WLHA 5DMIL 3CUPA 4BK5C 4Z95L 1HU8A 4L8BA 2GSIB 3HHRB 5AW7B 1U8IB 3OXSA 4ZTEA 3O8XB 4ZQTA 4MAUL 1GZQA 4UZSA 1DQML 1I7UB 1UA6L 3CFNA 1CIUA 2JKNA 1OE1A 1KCRH 4FG6D 4MXVF 2NY2D 3OKEA 2AZAA 3CBJB 1W9XA 2IH8A 3MRRA 3L4UA 1F4ZA 1BLIA 1PEWA 4NENA 3TF4A 3AWEA 3Q5YA 3W38A 4FC3E 1NBVH 1NCHA 3MXWL 4GRLD 3SDYH 2MKLC 1U8QA 4OLXL 3K6SA 1U9KA 3R1GH 3VFSB 3EGXA 1OQOA 2ZKWA 5D4JA 2A74B 3MJGX 5IVXE 2PWHA 4LFHD 4LP8A 3UBXI 4KMTL 3LKOB 1B6UA 2Y07L 5FW8A 1HHKA 3BWSA 3GHEH 3NFNB 3RPKA 5CEZE 2H9GB 2DYSB 1TKWA 4UOW0 4D0CA 2DH3A 4LLUA 1D5BB 1XD1A 4NP4H 1RULH 1F4XH 1J48A 4FCHA 3SYAA 1S7VB 1PMYA 5J11B 2EVFA 4N68A 4QRPD 2DQEL 1J8HA 4A66A 4O2FA 1NFDB 4HKXB 2RCSL 4F7TB 4NAJA 3EBHA 4DGVH 5AUMB 2O26U 3FRUA 4LCWB 1Z0MA 2FB4L 2ZSVB 3IDYB 2RQEA 4N20A 4XWGL 4JFDA 2PWEA 1WAPA 4TOYL 3AWFA 2H3KA 3TBSA 3T3MB 2CUAA 3HC0B 3LQZB 4XO4A 5CP7A 2DI8A 3HIZA 4P2YA 1S7WA 3GQFA 2J4YA 3FPXA 1NKRA 4D94A 4X6CE 5C0CD 2PTTA 4Z76B 3QUXA 3OAUL 3T0ED 4WI7A 4E41E 4ZFOL 4WJ5B 2WXGA 4KO5A 4ODSL 4L37B 4GW1A 5I18H 2KZBA 4MXWL 4ADJA 1OAUH 4QXWA 5D1XC 3WJLC 4GI6A 4JLRB 4YUEH 1S78D 1A4KA 2H8PB 4JZJA 2J1YA 5A2FA 1WBXA 2X6AA 1FG9C 3OZKA 1ETZA 1L0QA 1IE4A 3ARVA 3QPQD 4FFWD 4PJDB 3SQBA 3TA3B 2E27L 4FL4C 1HHIA 3IRPX 3L95A 4GSQA 1KY6A 5DMIH 5F21B 5GSRA 4Z18A 4LEXL 4OCNC 3A21A 2CU9A 1DQMH 3D50A 4BEYA 2ZIYA 2IBGA 4LHUB 1Q5JA 4LLYA 3WIHL 3QRFM 3HVDA 4HIIB 3FUHA 3Q1SL 2D03H 4Z7NE 2NYZA 4ORGB 3OC5A 4P2OD 1U8KA 4OLXH 5FGBC 2JK5B 3IRCA 1BQKA 1WAAE 3VYOA 2RGSA 3FONA 4Y9GA 1TZIA 4JBSA 4KMTH 2A6IB 2VXQA 3HASA 4PAZA 1J18A 1JZ4A 4TSAH 3HHMA 3CVHH 3GIZL 4MD0A 3RTQD 2AQSA 1HWGB 3GBMH 3BVUA 2L7UA 4UM9A 4F33A 3V7MA 1A7QL 2LW3A 5GGUB 4YR6B 5F2FA 3MUZ1 1XB3A 1CFMA 1NCCL 2K7PA 2K8QA 4DVRH 1AO7E 1BSIA 1PZ2A 4D8PB 2KS0A 4IBUA 2BC4A 3V2AR 5EUKA 3UDWA 3KPRE 5BMFH 3EGSB 5DFVD 1MFAL 2RCSH 5L9DL 4RRPM 3KGUA 3II3A 5FWQA 1OAYH 4QY8A 3QR0A 1XVSA 1DEEA 2FB4H 2BSRA 1T6WA 3K2IA 4MNHB 4QRTA 4LCCC 4XWGH 1ZS8A 4PQXA 3RWHB 4L1HA 4EIBA 1MLBA 2DJUA 1OZTG 5DHVA 2GJ6B 1PY4A 3VSTA 5I6NA 2PKDA 4TN9A 3V2YA 4N4WA 2R15A 1JGUL 2OCCB 2Z64C 5D1XB 3QVAA 2LE9A 4EXKA 3OAUH 4IRSD 1WBZB 4YZFF 2QGBA 2MOVA 1F4WL 1T6BX 3TBVA 4C55A 4MXWH 2VMCA 2H2SC 2KZKA 3RWIA 4N6RB 2WTRB 5B6ZA 4P46C 3I50L 3B7UX 2I07A 1MUJA 4HIHB 3VFRB 4RGMC 3CPLB 2E27H 2W0PA 3KPLA 3TPUA 1CFSB 2YC1B 2LAGB 3I9GL 1O9VA 5C07A 4JUTA 4LEXH 5D7HA 2P80A 3L3DA 5GS2H 5EBLA 5HBBA 2JJWA 2W88A 4PJ5B 2FBJL 4U0RB 3US1A 2Q7YB 3AACA 3Q1SH 4L3EB 2B5IC 4F58H 4ZMXA 4WU7A 1NCWL 3IMBA 3FUNA 2CLVA 3G6JA 5C0JB 4XXDA 4I2XB 4C4UA 3FT2A 5FFLA 4J8RA 5BZXA 2CIKA 4YDVA 4M9OA 2X05A 15C8L 2GB2A 3ZKNC 4WTZG 3TNNB 4QJ4B 2Y1YA 1TZOA 3UJTL 5IBUG 2HFFA 3VB9A 4UIMB 2P5ED 5AX0A 1UFGA 1W91A 1KXQA 4ZDHA 4G83A 4N8VB 2KPWA 3LRMA 4UT6A 3WTVA 1HQRA 5JIDA 4WO4C 1N12A 4RGND 2Y04A 4KJQC 1CU4L 2BY0A 4AGOA 5I1LB 5I82A 5IFJB 2VLJD 3MJ6A 1GPOH 4LCCB 1MELA 4HK3J 4WI2A 2X1OA 1LK3H 1KT2B 1J0JA 1MCPL 3TN0A 5L9DH 2HJFA 3QK0A 4W81A 1RP9A 3PDOB 2FUQA 4L3AA 2I9TB 4KK8C 3G9AB 1OARH 4UQAA 3THML 3BRDA 3POCA 4M43L 1HI6A 1HIMH 3Q5TA 5BR2A 1JGUH 3C6LB 2P28B 1MRCL 2YOCA 4O02L 3ZTNL 4P46B 4FZ8L 1ZANL 2NQ3A 2YEQA 4ZJ9A 1INEL 1F4WH 1H3UA 4U1LB 3GTNA 5D72H 5ISZA 4PTTB 1RXLA 3Q3GB 4UTBH 2QGEA 1PXRA 2X2HA 4Y16D 2VDLL 5ENWA 3U1SL 5FO7B 1BZQK 3LH2L 3CZGA 1WQVT 1JVLA 5EUOB 3FH7A 3G04B 3GB7B 1LK2B 4JFFB 3X3CA 4RGOL 1JYVA 1DQVA 3L9RA 4AV0A 1KACB 1KLFB 5DZPA 2VT4A 1CBJA 1ETB1 4KHTH 3CCHA 2PYEB 1WWBX 3HZMB 4X5WB 2FBJH 4JANA 5D2NA 2O6CA 1SPDA 3TWYA 1VACA 1ULVA 1SVCP 4HS6A 5I1CH 2Q7NA 3BQUC 4M4PA 1G7PB 4X5PA 3ARGA 1YEFL 3IFOA 4AYFA 1NCWH 3CLFL 5TQ2H 3LD8C 5IUCA 4PVNA 2H32B 3MBED 1NCNA 1UM5L 4Y5VA 1AFVL 3AY2A 1HSAB 1HFUA 3NFPB 2WW8A 1FV1B 4PGCB 15C8H 3FCUB 4ZO8A 2ICCA 3CH1A 4GXUM 4PG9A 2B1OA 4OAWB 3QWRA 4NXSA 1OXYA 3BDXA 4XOCA 2GJRA 5DQDL 1TITA 2H5UA 3FFCE 3PL6C 2YKKA 4H26B 4HZLA 4MJIE 4ZMLA 1A64A 1A02N 3BZ4B 1MI5A 3SDAA 2C3XA 4LCIH 3ABLB 1CU4H 1LMKA 4YAQB 3MV9D 3D3VE 3KJ6A 4NLHA 1JGLH 3SJVD 2XV3A 3FJTA 5C3LD 1MCPH 3L3OC 3OXRB 3FB8B 4LDLB 4XODA 3UTTE 1A2YA 2DV6A 4QTFA 3O3EB 3TEZA 4JHAL 4AZ8A 3WE6A 3QC6X 4D7PA 1CICB 3S4SB 5F7LB 5F1NA 3QJTB 1UWYA 3V6OE 3IDXL 4ZD3L 1XMWA 2OXGA 4G70B 3NQKA 2P8LB 4GXVL 4O02H 3ZO0A 4FZ8H 1ZANH 2BP5M 1IJ9A 3CBRA 4WCYH 2XSKA 1N6VA 3E3QC 2O5XL 2ZONA 3K6OA 2Z3FA 1INEH 2YGVA 5DMGD 4YHML 1HNFA 5HGHB 4AM0Q 4YSAA 1R5IB 2VDLH 4W9HC 3QJFB 4QIRA 5EBMB 2Y7QA 1M53A 1BD2A 3LH2H 2K9UA 2DIAA 3ZTDC 4DVBB 3LNIA 3BUIA 3MJ9A 4RAVB 4NO5A 2K3HA 1OAQL 4RGOH 5ESAB 4KDTC 1BVOA 3UTPE 4Z78A 1JNJA 2E4FA 3ISWA 1QLEB 4PGBB 2IFFH 3BQUB 3CK0L 1U8CA 5JHMA 1Q9WA 3FT4A 4BFJA 2A9ML 5L4JA 3LD8B 4LF3B 4N1EA 3K8MA 3B9VA 4LDCA 2GKIA 2OMTA 3V0WH 1FNAA 4PJXE 1DDHB 4OW6A 3ZEVA 3EJRA 5FX3A 4QKTA 1U30A 3AQDA 2JB5L 3AW5A 1YEFH 5T3XL 4EUPG 1UWFA 3CLFH 4J27A 1MZZA 3NIFE 5CFAA 1UM5H 2BRQA 4C56D 1D5IL 4U1HA 1NWPA 3D34A 3PL6B 3GPEA 2P46B 1AC6A 4GRLA 4BWUA 4F20A 1JHKL 4GAFB 3H6AA 1DVFC 4OD2A 2J20A 4G7QB 2VH5L 2ZP9A 4AC4A 3IN2A 3L3OB 2XWEA 3CU1A 4NIYE 4L8SB 4QOKB 4N8UA 3NPSB 4LBAA 1T0PB 3QZWB 1E4XH 3HG2A 3SBPA 1SFDA 3KCWA 4QAWA 2ZCZA 1TZHA 2OTPA 4F3FA 1YJDC 2O5YL 3C5ZB 4QRPA 4P48A 2YGPA 1ZEAL 5JOPE 3BH9A 2X1WL 4JHAH 2XN1A 4AIXA 4X80L 4MNGA 2GJJA 4AENB 2XV6B 2FJFB 1EO5A 1RLBA 3LKSA 2X7LA 1RK0A 1VFAA 3N42B 4QRUA 3PP3H 1M57B 1CDYA 2M1KA 3MRGB 3ZKQD 2G2PA 3IDXH 4ZD3H 3PIQA 1ZXQA 3GSRB 3K6DA 2UWEF 4PJ8B 3V7AG 1TTGA 4XP6L 4GXVH 3WN5C 5HYJE 2XN9B 4C83B 3ZO9A 4M93C 2O5XH 1E12A 5C0CA 1NBYB 4JM4H 3T0EA 4MJ5A 2OSLA 5E94A 1MCKA 3L4VA 2IOOA 2YAHA 4L8CB 2NZIA 1IGTA 4AQ1C 4MD2A 5DEJA 1R3JA 1A4BA 1OAQH 1A6AA 4ZOCA 5AVRB 4LSDA 1F8TL 2A9AA 2DQMA 1JG9A 2YPKB 1JI2A 2HA1A 5HYEA 3CK0H 5JXAL 1LEIB 4MKTA 1SLUA 4JJ5B 3IBEA 1T5KA 4KDVA 3G7TA 1FYHB 2Z6FA 4CU7A 1KBPA 2D9CA 3BN3B 4NLAA 2XZQL 5T3XH 5C2BL 5ACMA 1XF2A 5D93B 4M56A 3OMZA 1F88A 3PWNA 12E8L 1NPJA 1DVFB 5A6IA 1FVDB 4HC1A 1D5IH 1ES0A 3FN3A 1CDUA 4JQVA 1NGWB 1AQDB 4P2OA 1IBFA 2CBTA 4NB7A 1JHKH 2YRPA 4WWID 1T7WA 5TGBA 2H47C 4JRLA 4GW5B 4GSRA 1DFBH 1SMAA 3EOTL 4HWUA 4QTHA 3ZHNA 4JO8A 3K5SA 4HV8B 3ZTJH 3AJ7A 2ENPA 4C58B 3BUYA 1NUFA 4WFHE 1KIUA 2OL3A 3H85A 2ZUTA 3RTQA 1ZGLB 5DEGA 2P9RA 3IDJB 1J1PH 3KLAA 3ZRSA 2KKQA 5A7BA 2LABA 4OZ4A 3EOBB 3APNA 2C7UA 3RZCA 3D39E 1FFNB 3TM6A 2I85A 2BIHA 4YNYA 3TBYA 2O5YH 2PO6D 1ZEAH 4JG1H 5A16B 1EAQA 4UYQA 4OQTA 1KDJA 3AREB 3MCLL 1SY6L 1QKOA 4X80H 3W39A 3UAJD 4L9LA 3WN5B 5K59F 3KNBB 1Z9NA 3ECVA 3FT9A 2KDGA 4M93B 2EIBA 3T71A 1VGKA 1JGIA 3RWFA 1VFUA 3BRGC 2ZF8A 1DLFH 4Y4KB 2N0MA 1PW3A 4N2FA 4LRNL 4XP6H 4PY8J 4ZFZA 2XZAH 1J11A 4JO5A 1MPAH 3CSGA 2LU3A 2XXGA 3GRWA 1GAFL 4IRSA 2E6QA 2Y69B 1Q94B 3BZ5A 1ZT4A 4LEOA 5EU6E 4BDVB 4DP0X 2APFA 2EDMA 6FABL 3N6YA 1F8TH 2IV9A 5I8KL 1CR9L 1RZKL 2Z65C 4RDBA 4FN0A 5HDBE 5JXAH 1PD1A 4HIXL 4NZRL 4UT9H 4KNUA 4M1GH 4MMZB 3SOTA 2K6ZA 2NY1C 4G59C 4X5XB 4FTVD 1OKEA 1OTSD 4FJZA 4HYXA 4A2MA 1DBML 4B96A 3QEHA 3KWWB 2X4NB 3EDFA 2OK0L 2XZQH 4HAGA 2M83A 4XP4L 4X6EB 3FT3A 2MOQA 3S36L 3LN4B 1SUHA 3BHBB 4W6WB 1CVSC 4OF3A 3QWOA 2H26A 3SN6R 3S5ZA 1G6RB 3ZX1A 3WO3B 1XT5A 1EERB 3WKYA 3EOTH 3RKDD 5B38B 5I16B 2C7FA 3T8XB 3DIDA 3GMNA 5HHVL 2VXQL 4CGUB 3HBQA 2F15A 2P5EA 2XT1B 4F27A 1HSBA 4FS0A 4EO5A 3FK3A 4XVTH 4QHNA 3P9LB 1UB5A 3NSJA 1Q90A 4DKFL 1FAKT 1I9RL 4FQJL 2VLJA 3G5WA 3FYIB 4DP4X 1G6VK 4X6DE 3QI9B 4B9YA 3IJSA 2C5DC 1JDDA 4XTLA 3TLRA 3PCYA 2FJGA 2VM4A 5GJSL 2QQQA 5FECB 3JYCA 5KYYB 4WU5A 2QR0B 2Q20A 4LRNH 3C9LA 3W9EA 5CF3A 5CN3A 4ECNA 2YMOA 5EHFA 3QDGE 4L0ZA 3SD5A 1KTDB 1L0YA 4IOIB 4OGYL 2KSYA 5CJQH 4N25A 4AT6A 2EACA 4E9TA 4W9IC 4A7VA 3V0VB 5GGRA 4EDWL 4KJPC 4CJ0A 3MRNA 2DRUA 2PCPA 5GGQL 2BIMA 4Y16A 4FXKA 4AKQA 2NY1B 2ADFL 1REIA 5LAXA 5IGXL 6FABH 3NIGE 3K2KA 4TMPA 3P9WB 5I8KH 4RNRB 1CR9H 1RZKH 1JE6A 2YSTA 3GI9L 5EO1B 1KG0A 5DD3H 4NZRH 3GGWB 2IOIA 1TJGL 3X13A 5JMOC 2D31B 2D7MA 2K70A 3HS0A 5DYOA 1Z32X 1MWOA 1DBMH 1EUTA 3P0YL 3QFDB 2VNCA 3V7AE 2YAMA 5KEZA 4XP4H 1FBIH 3FCTA 5HYSG 5CBAA 2J8HA 2QADB 1UUNA 3W0WE 2KMWA 5E00B 1N59B 4PYGA 5ETUA 1AHWC 4LDOA 1ET8A 2NX5E 1VENA 2ENYA 2HFGL 1OE3A 3MBEA 3OLGA 4TVSa 3MMEB 4CW1B 3AC0A 1PKQB 3H9SB 1NOAA 5EU7C 1CXFA 5GGVL 1BW8A 2GAZA 3MJWA 3WDJA 5EEYA 2OQJA 1W2KT 4EVNB 5E4AA 5HHVH 4PJBB 5FKPB 1FGNH 2HVJB 3RJDA 1SHWA 4DZBB 5FEBA 1T2QH 1UWEH 2FWSA 2W94A 1LM8V 3LX9A 3QEQD 4UT6L 4DKFH 1N0XL 1I9RH 4X7TA 1J1XL 3MV9A 4PRPD 1CCZA 4MCNA 3SJVA 2XY2A 3EYFA 4XWOC 3UYPA 1XH1A 1ROWA 1CUOA 1PFCA 4JKWA 3BUPA 5GJSH 2Z92B 3W81A 1FFTB 1IM3D 1N70A 4DH2A 2DQTL 4B9GA 3B3IA 1U91A 4B7IA 5DHVH 3MVSA 4XNYH 2CDFA 4X2UA 4HD9A 2CXKA 1DUYB 2H0JA 4GQQA 1EAPB 4OGYH 3IT8D 4MDRA 5FA3B 2FX9L 1J88A 4D8OA 4BBWA 1QATA 5L6YH 1YMME 4JS7A 4KXZI 4EDWH 1L0PA 3TVMC 4OV0A 3DTDA 3F5WB 1YO4A 4O4YL 5GGQH 1WFJA 4M00A 2ADFH 5IGXH 5K39A 1JZ5A 3K6IA 1DBAL 1SF3A 3CFIC 5TDPB 4Z5RA 1BX2B 3ATBA 5EU3B 2D3NA 4F9LA 5CWSA 4ODBD 3BT0A 1T3FA 1TJGH 3VXRB 4BGDA 1J1OH 5E2UL 4WI0A 3P0YH 5DJ8A 1AHWB 4FLOA 2VN5A 1SOSA 2W9DH 2X4PA 2C9AA 3NZSA 2Y3NA 3QXWA 3MRMB 5GS0C 2UWEA 1KIRA 2G9HA 3UPRA 2Q86A 3QJQB 3RIAK 2VL5B 3GLEA 1M71B 2IEPA 3T8VA 1PNDA 3FQUB 1A7BA 4IMLB 3A24A 3QZBA 4C56A 3GMQB 1R0AH 2XV0A 5GGVH 3UZEA 2F8XC 4R7LA 4F5CE 5E51A 1AGFA 1M2VA 3VACA 3C5JA 2G2RB 2XQ0A 2Y5TA 1HXYA 2YGQA 1CF8L 5JORB 3VRLF 1XGUB 1IUZA 4NKIL 2VABB 2PW1B 1O6SA 4UT6H 4CADB 1N0XH 1EHNA 5K1VA 5EIVA 5JO5A 2Z7UA 1J1XH 3MRBA 1P53A 4WHTB 3V6BR 1T20B 4YDKL 3WJMB 5D1ZI 4N2HA 3KJ6L 4HWZB 3GM0A 4OGXL 1E30A 4CRPA 1ZWIB 2DWSA 5DLMH 3GS0A 2ADGB 4PPTA 1NMAL 3LPWA 1YY9C 5D1QD 2EE3A 3A67L 2D4FA 1SVBA 4W4OA 5E70A 1FQ9C 2DQTH 5F9WC 3MRPB 1RL1A 2HTKC 4XNZC 5C86A 3D2TA 4NO2B 4JMNA 1KPVA 1BYOA 2C9UA 3ES6B 2BSED 4XMLL 3TVMB 3WENA 4Z7OB 3QIUB 1TSRA 4P4KC 3LKNB 3RWEA 2FX9H 3ETBJ 4NSKB 5IJDC 2E9IA 1CE6B 4L4VB 4LSPL 3V0GA 5LDSA 4ZUTB 1F3RB 2KSBA 5DUMH 1NM4A 3LKRA 5IK3A 4HU8A 1QP1A 4O4YH 4WO4D 5BO0D 1U21A 3TO2A 1XAKA 1QO3A 4KJQD 3WUWA 4CBPA 3IGAA 4IB4A 1WTLA 2AZUA 2PETA 4JKVA 4TQPA 5EDXA 5AOZA 1IMHC 5CEXA 1A9BA 3CDZB 2FJHA 1E6JL 5EV7A 3MJ9L 4RAUA 1OGSA 2XFGB 4F57L 5SX4I 3GSQA 1P6FA 4ELMF 1CK0L 1WIUA 4JZNB 4NBXB 4EI6B 4KK8D 4H8WC 2JXMA 1CLZH 1OSZB 1W0VA 3L1GA 4MNQA 5EUOF 5LXVA 2EUVA 1FRGL 3UBXG 5I1AB 3P4MB 1CDGA 1NLDL 1MFUA 3WAJA 3EO0A 5DHDA 7FABH 4QDGA 3WTUA 3CZLA 4GLRI 3CWGA 4R4NC 5F6HI 2DLEA 3QDJB 2NLJA 3S5LG 3NCXA 3TPKA 2OMVB 4MAYC 5E9DE 3MLTA 4ALAC 3F7VB 3E2HB 3CLWA 3I6SA 1BBJA 3MGAA 5D8JL 1ACYH 2V2TB 1EZSA 3MACL 4P9HC 5T5NF 3EHBB 3D06A 5HYFA 3TT3L 2W1NA 3CZKA 4GQ9H 3L7FA 1GC1C 2Y72A 3MRIA 4OLUH 3C2AL 2BY1A 3X3BA 1D5ZB 1XCTB 2F6AA 3MCG1 3ILQC 4NKIH 1T66C 3VXOB 2VR6A 3U2SB 5C9JB 3IU4L 4EQ2A 2DM3A 3GM8A 4CC1A 4ONGL 2N7BA 3HE6B 3UZCA 1YQVL 1UVQB 1GXEA 2A3TA 3I75B 3KJ6H 4OGXH 3EO9L 3O6ML 3OKYA 5F9WB 4ZNCD 4XNZB 2QZQA 3C5SB 2PO6A 3RHWF 1NMAH 2BRRH 9CGTA 1RZJH 2AEOA 2YK1L 3UAJA 5CLYA 1T80A 1NIBA 1CI5A 2IQ9L 1ZE3C 4FPDA 3L17A 1I7UA 1UZ8B 4PJGA 3S36X 4XMLH 4PJHE 3D0VB 4I9WE 2YDVA 5BXFB 1SBBA 5EB9A 1PGRB 1D5MA 4MMYA 3QZPA 4KOBA 4F2ME 4LSPH 2IAAC 2VDPB 3RL2A 1AJ7L 1AY1L 4R96A 3W11D 4PJFB 3ARPA 5I75C 5J7CC 2DLFL 3QXVA 2OMYB 3IJEA 1MFBL 2YAOA 8CGTA 3VFSA 3MV7E 3I2CL 1OW0A 3KDMA 2ZOWA 5JQ6L 3MA7A 3ZZSA 3LKOA 1URIA 3L1OL 1NEZA 1Q9LA 1Q9KA 3TFBA 1UB6A 3E8UL 1E6JH 5DQJA 3MJ9H 1MCCA 2ZOLB 1CK0H 1O9WA 2LR4A 2ZNWA 2K9FB 4ZMNA 1S7VA 4KXCA 3RILA 4MAYB 3SKOA 4G7RB 1NLDH 4FTVA 1I1YA 2OZNA 5B6WA 5KBKA 1S2EA 5B4MD 1TEFA 1KCLA 1LO4H 1R47A 3B5HA 3BO8B 3LNEA 2BWQA 5F3BA 2C3WA 2R4RL 3V0EA 3PFQA 2GK2A 3AXIA 4EN2A 5JPNB 1MHEA 3H8NA 4HC1L 3JV6B 3LQZA 3QXTA 1FVEB 2YXVA 3EYSH 1BVZA 3B1TA 3SHSA 4PV1C 2WQAA 3TT3H 3DC0A 1WVZA 2R2BB 4Z76A 3KBHE 4CDGC 1A1MB 3C2AH 1L7IL 4JFSA 3GINA 2EZ0C 4WTQA 5G2NA 3VD2A 4L37A 2YSSB 2UXGA 4YSDA 2OL3L 4LKCB 2R1YB 3KAAA 1CF1A 2DYRB 2QPFA 4JNXA 1YQVH 4BK5A 4OIAA 2H8PA 1TXKA 3IYLW 5I66A 4JPSA 1XR8B 3EO9H 3O6MH 5LBSL 1N18A 1CFVL 3FO1A 2CH8A 2UZYB 3IDUA 2EE6A 3VXME 2JJUA 3CMOL 5A3ID 4PREB 3D4YA 3NJHA 2YK1H 3BKYL 3QS2A 4N1CA 3ZTCC 4Y2DC 1E9QA 2IQ9H 4OZIB 5I75B 2C3HA 3QHZL 2VR7A 2GTZB 5FUCE 3QNYB 3SDXF 2N1KA 3BX7C 3B7RL 3N42F 1AJ7H 1AY1H 3UTWA 2KS9A 3VFUB 5I8CA 5JNYA 3ZTJG 2DLFH 2XWCA 2N56A 1MFBH 4FI8A 2X9ZA 2JK5A 3GRWL 2E5EA 5C08B 2JI3A 4QT5B 3T2QA 3ARBC 3FTXA 2CRIA 1NWOA 2CHZA 5EZPA 3NIDB 5AW4B 4G82A 3QIWC 1V3KA 5GGUA 3GLZA 3RQ3A 1K8IB 1S7TB 2HZHA 4OY9A 4S0HA 1G1YA 1NC2D 5IVOA 2YCXA 5LN4A 1T5WB 4D8PA 2ZAGA 1XX9C 2GFBB 3WFDL 4ZXBC 4IBVA 1UG9A 4WENB 1SN2A 4OH2A 2AEIT 3CFCH 2OMUA 4KXZH 1KIQB 4WSJA 2XRAL 4I1NB 4AYSA 1CGWA 1BM1A 1MRDH 4I0CC 4EPSA 4M62H 2EIKB 1NGPL 2IDCA 3GYRA 1KB9J 1HJBC 3H9HB 3FQXB 3MC0A 4HC1H 1Y1DA 4ILDA 1ND0B 2NZ1A 2O6EA 1BZ7A 4V2BA 5IVXB 5I17B 4ELKA 2G5BB 4Z0BL 3WJLA 2CUMA 4U4BA 4Y1SA 1XH2A 4P06A 1L7IH 5SX5H 3A6OA 4L1TA 3UEZA 2OL3H 1AQKL 4AV4A 1ZVYA 1HT6A 5DJ0B 4Y2DB 3CHOA 3NDZE 1ZIBA 4KKQA 3BJLA 1CFVH 2HSIA 1UGNA 4N3TA 4PRPA 3L3JB 2HAZA 1I3GL 3BVTA 3CMOH 3IJ8A 4I7ZC 2XQBL 1X6NA 4FFVC 4OQTH 1YMHA 3BKYH 4GKNB 4FQLL 1ADQA 3FHEA 2KUTA 3JT0A 5AW5B 1LWHA 2GITB 2P5PA 2VERN 3QJUB 5FGBA 1IM3A 3QHZH 3ETSA 4FERA 2ZUSA 2YXWA 1I3RB 2Q8AL 2JQMA 3QQ9C 4X6CB 4LCUA 4BZYA 1SJEA 3ARBB 2F53E 2YD0A 3FT1A 4OD1L 5ANME 4X4XB 4E41B 3COCA 5IVZA 5LAPA 3ZY7A 2KPNA 4A1RA 1U8HA 3GD1C 3P40A 2X6BA 1V10A 3GRWH 3QAZC 3QIWB 4CMHC 4XNDA 5K1NA 2DWDB 1NDMB 2EVJA 4DGUA 5HHXH 3WCYA 1EGJA 3VG9C 4PRDA 5EMYA 2AANA 5E8PB 2YUZA 4ZXBB 5ANHA 4LL4A 4M6ML 3RKPA 2GQHA 3SKJL 1ZHNB 4N8VA 4DTGL 1TG8A 3BEVA 2QHLA 5IFJA 1A47A 1L9PA 1L0XA 3CFTA 1BWMA 1X5YA 1ACXA 2JVUA 1KB3A 4X8GA 1MIEH 2XRAH 4U1JA 1ECYA 4M5SA 2APVA 4Z7NB 4ZAKD 3SE3C 3VRIA 1NGPH 4FFYL 4R4BB 3B6SB 4TYUA 3KPMB 1U3ZA 3PAVA 2GW5A 4AUYA 4G3YL 1I3VA 3CD4A 6PCYA 3DVGA 5I1JL 3DX4A 4Z0BH 4OCXL 1E4WL 2X4UB 4KUCD 1NBQA 1VJSA 1ZVNA 4H0LC 5T3ZD 4PP2B 5EZJB 4KK5C 2IQAB 1XCQB 4U1LA 3E6HB 4PTTA 4AGQA 1AQKH 2XN2A 3VGAA 4LSRH 4ELMA 1UENA 5C1MA 2NY1D 1AO7B 5FO7A 4JFYA 2FWOB 2WO4A 5EUOA 2L4OA 1WAEA 3KPRB 4K9EL 5LNDA 1LK2A 2QKSA 1FNSL 1AD0B 1ZA6A 2CMRL 1I3GH 2ZCLL 1OP4A 4BINA 3B2UD 3T0DA 4R90L 4PBWD 4AH2A 3MJ7B 1MREH 1JCVA 3KPPB 1A21A 5D1QA 1QSFE 2K4AA 1X5JA 1HQ4B 1S9YB 4LSUL 4CMHB 2Q8AH 3DYMA 2TSBA 1IQDA 3AXLB 1E5YA 1IEBA 2BSEA 4IRJB 4K5PA 1AG6A 2YKLL 1MWAB 2VSDA 3UTZA 1QHPA 2PMZA 5F6IC 3VSUA 4JDZB 1W0YT 4MZ3A 3V6FB 4R7VA 1WDAA 1OOWA 3Q2WA 4JHBA 3WIFA 1WHOA 2OX5A 4WO4A 1SDYA 2QHRH 7TAAA 1P4IL 1DEDA 2CR6A 2EEDA 2JTYA 3ME0B 5DD1L 3VD0A 5T3XE 2W60A 4M6MH 4QO1B 5IMKB 3SKJH 5AWZA 4DTGH 2RHEA 5D6DA 3UC0L 3V4UH 1SXZA 2IGLA 3CFBB 2VDMB 2X4TB 1GYAA 4IEFB 4YAQA 4KTDH 3IXAA 1RHHB 2PLTA 4LQFL 3OKNA 6CGTA 4HWLA 4J3SA 3OE6A 4KK9D 3EFOB 3DX0A 2B4CC 4JM2C 5I8EA 3WS3B 3ECQA 3LN5B 3SN6N 4AGNA 3UERA 2MSPA 4IGBD 2L6XA 4KJYB 3QUKB 5I0VA 3FOLB 4KJPD 4G3YH 5AOKA 4ZZKA 1RK1B 4J3TA 1CTMA 3L4XA 4OCXH 4GPOA 1BBDL 4F9PA 4PBVC 4X5LA 1ED3B 3ZE0E 5CZKA 4Z7VE 4YHYC 1RV6X 1JHLH 1T6VN 4JQXC 1R5IA 4EI0A 5FOBA 3QJFA 4ZW6A 3CDFA 4YSRA 3TWCH 1OTUD 4YXLH 5J1SC 4MA7H 5BV7H 2CLZB 4DVBA 4NQTA 5F88B 1A7PL 4RAVA 4YFLF 2JAGA 3WY2A 5HHOD 2HVKA 3FB6A 2X6VA 2WXOA 4FABH 2J1WA 2D2OA 1J10A 4Y1AD 1P1ZB 3QXAA 1EEUA 2BNRE 2BPBA 4U6VL 1XXDC 4IU2A 4LF3A 2FQFA 4FQIH 5BZWA 1K5NB 4LCYB 3UPAA 1E2WA 5C6TL 4PJ9C 4BQ6A 4HHGA 4CKQA 4GO6B 4Z3HA 1H3TA 4ZQKB 2YFNA 5FF6A 4ZTPL 5A45A 1P1VA 2W9EL 5G2AA 1P69B 4JPQA 2R0KH 5EPMA 5E5UB 3INOA 4XNMA 3IAPA 3RIAF 3V6OC 4XCYA 4K94C 2WUCL 2BNUA 2NNAB 1F00I 1GUEA 3B8SA 3LTVA 1P4IH 1OP9A 2EYRB 4PEEA 4OSUL 4O51A 2OP4L 5DC2A 2DQGL 4JO4L 2OR9L 3U6RA 3FHAA 3I84A 5B1CA 3L3OA 4XWOD 3LNHA 4QOKA 3UC0H 1QEWA 2VSMB 5ABAA 4JM2B 5E7FA 1I7TB 3A3YB 4Y5XA 2JJTC 2Z8VC 4GEJA 1HEZA 3T4YB 3D25B 1T1XA 4LQFH 3U0WL 2A73A 3VU2A 2WXIA 3KPTA 3GJEB 3H55A 2FJFA 2WBJB 4WWKC 3SDXA 3VE0A 5E1AB 4HUWB 1MCRA 4KMLB 1F11A 1ASOA 2V17L 2EC8A 3SZ6A 3J7HA 4YHYB 4JZOA 3GSRA 3N1GC 1OSYA 2P7TA 4F2FA 1H8LA 3LZOA 1BBDH 5K9QG 1UJ3C 4AKOA 4HS3B 1TMCB 5DVOA 4DP9X 5JW4R 2Z35A 1SMDA 3BP7B 3BEWB 3FFCB 1NBYA 2WQSA 1J8HE 3IJHA 3EFDL 4MJIB 3V4VL 2FK9A 3M7OA 3OL2A 4KDTA 3OQ3B 4NWTH 1Q9OB 4RIRA 1KTJA 4YBQC 4IW4C 1IT9L 3D3VB 1D6VL 4RZCA 1X9UA 4TSBL 4JFDE 3PGFL 2DMKA 2VR5A 4ZMYA 2R0ZH 1KTBA 5TQ0H 3EYVB 4F24A 3RY6C 3FOMA 4PJ9B 3ML8A 3UTTB 1FNEA 5J12B 5E8EA 1J0YA 1J0HA 1EJ8A 3ALPA 4U6VH 4JJ5A 1I7RB 1VEOA 4QGYA 3NSYA 2WYTA 1QWUA 2NW3A 4D9QE 4UTCA 4HK3N 1JTTA 2IADA 1MAJA 3K81A 4ZUSA 4XCEA 4ZTPH 3HW7A 5DHMC 4PVLA 2VMDA 1JERA 1AMXA 1N8ZB 3CFJA 2H0PA 2MQ3A 4HZ1A 3C60D 3PNRB 3ZQ9A 4Z7OF 5DJXA 1WRFA 4GW5A 1WZMA 1CFNB 2ZYIA 5EC1B 4ENZA 2OP4H 4PFEA 2DQGH 2ICEC 3BGMB 2OR9H 4HV8A 4ICXA 4JO4H 4QRRD 4XT3A 4ANWA 2KL6A 4N85A 2KQNA 2R1XB 3VFVA 4BQ8A 1WPCA 4LP5A 4LLVA 3NBNA 5AW6B 2KZ1B 4KV5E 3IMRA 1YY9D 4OLYH 5KOVC 4O58L 4BJLA 4GS7B 3N9GL 4WWKB 3NESA 4PJXB 3UCQA 3U0WH 2F8VA 1NC2A 4XOBA 3FFDB 2HTKD 2X12A 2K45A 4TPRL 4BE5A 3HBZA 5A16A 3H3KA 1IU1A 3RZWA 1TZGH 1UACL 3F04A 4P4KD 3NIFB 1ZHLA 5E7BA 2J1XA 2VSKB 1F58L 2F93A 2OI9C 2WM0A 5JMRA 3PY9A 2V17H 4AQAA 1HN1A 3MBWB 4QLWA 2YPVA 2D73A 3QGVA 1HILB 1JRHL 3BH8B 4PTUA 1IVLA 2WQ8A 1T1YB 2ARJA 3UC2A 1E42A 1S7QA 4Y2OB 1QACA 1LWJA 4NZFA 4AQ1A 5FDWB 2EUXA 1VFMA 3EFDH 1M3IA 5GS3A 2EDKA 3QJZA 3FU6A 1Q94A 4XP9L 4N2BA 1IT9H 1D6VH 2I60H 4TSBH 4BDVA 5FYKD 3PGFH 3KPOA 3TCXA 4YK4C 2IDSA 3FU0A 3NSDA 1L7TH 4R4ND 3WUZA 2VAAB 5H37A 4U7SA 1GOHA 1YDPB 1IL1B 2OYKA 5GRYA 1DANT 2NY6C 1LMIA 1ZSHA 4XVOA 3CX2A 3EJYC 2GTQA 4H2CA 3V5HB 3KWWA 1GU8A 3FTVA 5IBUB 4ICWA 5HYJB 2AW2A 2FTAA 2DJSA 2OR8A 4MCYB 1N3NA 1SZNA 3QUZB 2Z4QB 2CRMA 2QSQA 1FF5A 3DSFH 3QH3A 4ISVB 3WMQA 1KB5A 1PIGA 2GSGA 4ZOAA 1G6RA 1UT9A 1X7QB 4LFHG 4NKOB 4U2ZA 1T66D 3WEOA 4KQ0A 1C5BL 5D55A 5HHMD 5B38A 5SV3A 5TE4H 5A43C 2JCCA 1ZPLA 5I16A 3QG6B 3T8XA 4BFIB 4OJYA 1KN4L 3JBG7 2E7BA 4BV0A 4OJDH 4O58H 2QPSA 1KJ3L 3O11A 5DURB 4LT7A 2OI9B 3G6JE 1ACZA 1MHHA 2WYHA 2EIZB 4TPRH 5CJXC 3HRZC 4H8QA 1UACH 4YLBA 3D4CA 4QGTA 3BT2L 4J5VA 5DRZB 4LVEA 1WC7A 4ZAKA 3LPGA 1G5AA 2WSPA 3VCLB 5T1JA 5FECA 1KXQE 1LJMA 5KYYA 1MJUH 1QLRB 2QR0A 2D8KA 1DDTA 5EOCL 2GBVA 2ORBH 3FQTA 3H3PL 3L7EB 3P0GB 3G6DL 3Q2CA 3NCMA 4IOIA 4XP1L 3OD3A 3SE8L 3EH4B 1YCSA 1A9VA 3SYCA 3ZKMC 5F7EL 3V0VA 4GRWH 4XP9H 1F41A 5DF0A 3ISYA 1W0WB 3NUKA 2YLHA 4X50A 3D39B 5J8OA 4MJ6B 2EADA 3HMXH 4ZTOL 2YD4A 3G3LA 5F1OB 4GEIA 3ZDZE 1KPRB 1OANA 2XWJA 1F3JA 4ETQB 2QQLH 1QBLL 3VQ1C 2VQ1B 4M48L 3SE4C 1ADQL 1HYRC 3NMEA 1UASA 3T4AA 5A6LA 5BOPA 2G3NA 5SWQB 4MCZB 2W0FB 3MRKB 1XR9B 3HNVL 4N9GB 3PHQB 4GAGL 1H3PH 3NRQA 1XGZA 1JIBA 3VVKA 5E00A 4AOFA 1N59A 3JTBA 1KCSL 3CFMA 4OZIF 2JLPA 5IM7B 2FZ3A 1GJUA 3GNML 1N68A 3ULVD 4X7EC 2AGJL 2R2EA 3H9SA 1NAKL 4QXTA 3UX9B 4X6FA 4J23A 5EU6B 5AVYB 4XNUL 1DSFL 4DKDC 3OJDB 2HVJA 3Q6FB 5I6XB 1EJ6A 3MRLB 5HDBB 1PJWA 1OM3L 3HRZB 4A39A 1S9WA 1NAMB 2HJKB 5DK3A 4NQVA 2EC9T 3R7RA 4Z7IA 5KZCB 1FA4A 3LKPB 2AHIA 1WEJL 1JWUA 3RJQB 3DV6B 3OLEA 3QRGL 4FHKA 5I6PA 4ZMQA 2QL1A 1W8NA 4HQQH 4P4RA 4AXWA 1UUSA 2WSKA 1O7VA 4HWNA 1AC0A 1BZ9A 1TVHB 3CFKB 1NKGA 3DX8B 5IEHB 5LNGA 2HXAA 5EO9B 5HGDA 5C70A 1A3ZA 1PDKB 4B3VA 3QR1A 1XGTB 4IGBA 1HOEA 1MI5E 4OCMC 1J7VR 1VIWA 4HG4J 4NQDD 4ZW7A 4E41D 4MS6A 2QPDB 2WKGA 2D3JA 5KBDA 1CDHA 3SE8H 3A6BH 3QIWD 4LLQB 1UYWL 5F7EH 3NTCL 3V0DA 5IVXF 3F5WA 2BJML 5I2IB 3RU8L 3ZYIA 4MA1C 2XFXB 4PCTA 1EDYA 5EIIG 4GI8A 3RPBA 3ALXA 5CP3A 1K2DB 1SYVB 4ZXBD 4EUPB 1EFXD 3TIEB 3UAFA 1AI1L 3I74A 2LGNA 3PGCA 4X6DB 4ZTOH 1L9RA 3O3BA 3LQAC 5TDPA 5HHOA 5SV4A 4FG4A 4U1NA 2ZKXA 4XRCA 1QBLH 2FEDD 3B9DA 4Y1AA 2BSDA 4WWPA 1CGTA 1ADQH 5F7HA 1N0LB 3VW3L 3O4LD 3IMWA 4UAOC 5FHBL 2BSCA 3HNVH 4Y9CA 1TPXC 1BD2E 4WI3A 5IROC 4LSTH 2BZDA 3QDGB 4PLOB 2IPTL 1C8QA 3ASNB 2G9KA 3IDMA 4GIOA 1LWRA 1G7QA 2VC2B 1M71A 1KCSH 4TULL 1F4AA 4MDJB 5LLIC 3FQUA 4TVPD 2NY3D 4QI1A 4GUCA 5TK2A 2B20A 2AGJH 1MFVA 4RVBA 3ML9A 4XNUH 2ZP8A 3NIGB 1EGJH 4HH8A 1F50A 2G2RA 3ZT7A 4BD4A 5CCHE 6TAAA 1ZSDB 3A47A 5DVNA 1UGKA 1OM3H 3S9DB 1CIDA 1FPTL 3QQDA 1NBZB 2PW1A 4XNXL 1HH9B 2ROXA 5JIKA 1RZ7L 2HRGA 3SKNA 2DQIH 1WEJH 3KPRD 4WHTA 5FA4B 3QRGH 1XL6A 4OR1A 2X4SB 3CVIL 4M5TA 2H0FA 2W95A 2ADGA 3W0WB 1LQBC 1P6AB 2FJUB 2NX5B 3PV6B 3BWZA 3K71B 2XLLA 1E8YA 1CXEA 1MCSA 4GUPB 2JKRM 4NO2A 1AT9A 3ES6A 3TVMA 3FCBA 4HJJL 2X44D 1LEGB 1QEXA 3DI2B 5I5JA 4MA1B 1MNUL 1AP9A 1XGRB 3LKNA 2AC0A 3VO0A 4NBYB 2HMIC 3REVA 1UYWH 1WAAF 4QRPE 3NTCH 1IBBA 3MI6A 1NCBL 1CFTB 4S1SL 4TUKL 4Y7MA 2E7DA 1MW2A 1IQWL 4MNGE 4XZ4A 2Q3ZA 1SXAA 4AVHA 2ADJB 1LE5A 4ZBJA 1RJLA 4JCMA 1FHGA 3PJSB 4RLDA 4N0YL 1AOHA 1QQDB 1TPXB 4UINH 1KLGA 4NUMA 3WD5H 3DK0A 3QXDA 1OSZA 1S5IH 3U4BL 5C0CE 3VW3H 4BH8B 3P4MA 5GGTH 2E9WA 5FHBH 5KJRL 2MTPA 3TO4C 3VI3F 3WNKA 2IPTH 2X9YA 5DT1H 1JPFA 1MQKH 4N2MA 4CVZB 4KK5D 1OD7A 5C92A 5J13C 3G5XA 1PKOA 2QVMA 3QEUB 1WUZA 3C60A 1DQJA 4P3WA 2PTUA 2ZPKL 1MQ8A 3CDGB 3EUDA 2Z4TA 3IS0X 2P49B 3ZHFA 3KHQA 4QRRA 1E65A 1JWMA 1F0LA 3C6SA 3QYCA 5DYFA 3IE9A 1FPTH 5M7QA 1YG9A 4Y7OC 5CGYC 3MGTA 4XNXH 5E8OB 2HG5A 1RZ7H 3O9WD 5C0EB 3ATEA 1J5DA 1YNKL 3KLHC 1NJ9B 1W72A 1RCYA 2H4EA 1UCBH 5DXWA 1BM7A 1T89C 1EVTC 3CVIH 4JEGB 4YZFE 4KKCC 1MXGA 4L1LA 3VMPA 3FTGB 3HMWL 3C5SA 5LGHH 1S5HA 3UXFA 3N43B 1JSYA 3WIIL 1JHTA 1E28B 1UKQA 4G9DB 4LOEA 4P4KA 5IJKC 3NCBB 4XTNA 3WMPA 5TPWL 4H5SB 5GRWA 3VX0A 3BZFB 1B2WL 2L7JA 1MNUH 5L2JA 3RVWD 2ZF9A 4JDEB 1SGKA 2IG2L 1ZJAA 4N2KA 3GZOA 2BLFA 4ZPTB 1O75A 4AK2A 5EG6C 1MHCA 3UZVB 3C12A 4IARA 1BF2A 3DKHA 1G7HB 1C08B 1NCBH 2OMYA 2FO4B 4FMKA 4FLQA 4S1SH 4ZPVA 4F15B 1IQWH 1RAMA 1JNLH 3GSOB 4PWKA 1H68A 3GZQA 2O1AA 2J5LB 2WV3A 2O6PA 2ZWLT 4OFPA 1FG2B 4N0YH 3DGGA 3NGBC 5I76B 5KSAB 3TO4B 2IF7A 4EZJA 2J72A 3MOQA 4BZ2A 4BCXA 4PS4H 4Y0GA 3U4BH 1AS6A 4AM0A 1D7CA 3PYCA 3V9CA 5KJRH 1CE1L 2XI9A 3EADA 2CDEA 1OF2B 1F4YL 2R1WB 4YFLI 1ZGLM 4ACPA 1SHMA 4N0CD 3PABA 4JPVL 2NUPA 3SIKA 1MXDA 1OGTB 3BO8A 1WGVA 5AKSA 3WFEL 4DUXA 1V8HA 3WU1A 5CZRA 1IAMA 2D7NA 4H20H 4KH2A 1FVEA 5TE7H 3UTSD 1SN5A 3DUSB 5IR1B 3BPCA 1AKJB 1GOGA 3AS0A 4A4MA 2AV1A 2I9LB 5GRZA 3MV8D 3KCPB 1ET7A 5MEOB 3SDDB 3N1PC 3R18A 4CU8A 4GYBA 3U4KA 1RUQL 5A6MA 3KWVA 2PF6A 1YJDL 2OKMA 3B9KC 1KELH 2DQCL 2RMNA 4IU3A 4CVXA 3VU1A 2X6UA 1EZVY 2XIBA 4PJ9D 4UDUA 3HI5L 2CR0A 3ESNA 4U1IA 4X6BB 1ZJBA 1NUGA 1IGYB 1MZYA 3UJIH 4JM2F 4CA4A 4MQSB 3AT8A 3CVHB 3QG7H 3GMOB 4HSAC 4HYTB 5E9DB 3VGDA 4F7MA 1S8DB 3B56A 4G1EB 1CXLA 4Y8DC 3U82B 3WS6C 1UQSB 1LTXA 2DS4A 4HWEL 1JV2B 2YRLA 2DQFB 4EIYA 5H2KA 5TPWH 4PJIF 3X11B 4P5SA 4IJTA 3FAWA 5KVMC 2YPVL 1JK9A 3VXQB 1CLYL 1H8OA 2WGNB 3FB7B 3K2MC 2IG2H 1AH1A 3HC2A 4RGNE 2VLJE 5LWYL 3L9EA 4HLZH 2J8OA 4GKSB 1D7BA 3NGBB 5FC9A 4JKLA 2ZE0A 3M86A 5K9OA 2VLMD 3P4LA 1XF5B 4A55A 1I8IA 2EDLA 2R39A 3F8UB 4B5EA 3IKCB 5ACZB 5HYSB 3KJ4C 3CVDA 2CUIA 2ICES 2E6PA 4JPWL 1TVDA 1WA0X 2IWGA 1BEYH 4GKZB 1PAMA 5DHGA 3RY5A 3E9UA 3L6FA 1RZPA 4UB0L 4NC3A 1QSVA 4H44C 1T5WA 1CE1H 3MX0A 2ED6A 1ZVSA 4Q2ZA 2SEBB 5SWSE 1F4YH 2DLGA 3APCA 4HIEB 4P0DA 4D0BA 4PJHB 4W6XB 4ERSH 3DX1A 4E0RB 1ZD6A 4JPVH 1KIQA 2BFGA 4PRAB 1XIWD 1M0KA 2ZAIA 4I88A 5F7NC 4BCZA 2NYYC 3IMTA 3NN8B 4F2MB 3D5OF 4H8HA 4JDTL 3NFSL 4NT6A 4JB9L 2DTML 2Q7AA 5DHHA 2MFNA 4PJEF 1BQHB 1KEML 1ND0A 1KB5L 3MV7B 5FUCC 1CXKA 1G6RL 4YBQD 1HESA 1T04B 1FL3B 2G5BA 2CK0L 1CJYA 3ECBB 5EFIB 3COOA 1Q8MA 5J6GA 1OQXA 3HAPA 4BKLB 3FHQA 4F91B 3WXVL 1Z5LB 3K0WA 3MOBL 5CO1A 5DJ0A 3HAEA 4Y2DA 3HI5H 5EOTA 2P48B 5E99L 4TQEL 3HE7B 4LK4A 4E5XA 1VCBC 4XHQA 1KGYE 5I1DA 4GKNA 3DJZA 4K7PL 1H3XA 4OGQC 4PJXF 4QHKJ 4ZODA 1JZ2A 1B4TA 2HKFH 4HWEH 3HN3A 3MNZB 5CMAA 5LBGA 3GJFK 1XL4A 1SJVA 5HYJD 2YPVH 2EXWC 1CLYH 5G5DA 4YHLL 3DJ9A 4YH6A 4W68A 4BFOA 5DZLA 2A1WL 5FO8B 5AB0A 4NQDA 1HWWA 5JW4N 3WFHB 5LWYH 3MV9E 2XCMC 3E38A 1NGZA 4E41A 2EXYC 5C0FA 4H13C 3KJ4B 1NEZG 3SJVE 4U1KB 5DJYA 3W5NA 3QIWA 2AXGB 3EF7A 5BQ7B 3EW3B 3P73A 4YXKL 4XT1C 1M7IA 1KYOK 2JKLA 4LPCA 4V11A 4DPBX 5C0NC 4X1HA 3I9IA 2AJUL 4ZXBA 1EFXA 1A14L 1ILUA 5DTFA 3BPOC 4X9FA 2XWXA 3VXMB 3VUAA 1ZHNA 4CMMA 3E6FB 5T1KB 2BHUA 5H37H 2IBBA 5I30L 5AW2B 4DAJA 3VSVA 4HPYL 4UB0H 1MLCB 2NY4D 1P84J 2WD0A 5DC9B 1QD0A 4G7YL 4APXB 4YX2H 2JF1A 4JAMA 3VGEA 5GRUH 4N0UE 4NYLB 3NCWA 3O4LA 4BSJA 4TTDC 2EVIA 3ZPRA 3U9PH 3NFSH 1HH6B 3HUJF 4IIZA 2DTMH 3KPMA 4FA8A 1U2CA 1KB5H 2A7BA 1G6RH 2OXHB 2NXYC 4JR9L 4KFMA 4M5YL 4N87A 2CQVA 5CD5C 4Y88A 2FO1A 4NKMB 2CK0H 1IGCL 3PV7A 2X4UA 3CXDL 1FZOA 4J12A 4WFHD 4L4TD 1PLBA 4PP2A 3AM8A 4IDJH 4EKJA 3NG5A 1HZKA 2EUZA 2IBZY 2YOAA 3WXVH 5FWRA 3LMJH 2J56A 4XHJC 4PUBL 3OSKA 2EP6A 3NYKA 2NY6D 2Z8RA 1H15B 4LNRB 3T8MA 4EDXA 2R0WL 3EJYD 5E99H 3TBCA 4C56E 3KPRA 1AD0A 5KBLA 1NIFA 4P2QE 2NT1A 5HJDA 3VI3A 1EAOA 5JW4Q 2YD5A 5DRXA 2ZICA 3RGVC 4PGDB 4UI2A 3RLSA 1C5CL 1HINL 3VW7A 2PP7A 1YYLL 1UWGH 2F5AH 1HQ4A 4UOQA 4P2AA 4IKJA 2A1WH 1HVXA 2RFXB 2QMKA 1B3IA 3VG9A 4KMQA 3GS4A 4Z7WA 3UZQB 4TXVB 5KYWA 1CD1B 3DPBB 4GOSA 4XPAL 3VRJA 1VADA 2BP8B 5T3ZH 3BPOB 3BKML 2WMPB 3Q1EA 1ZT1B 3UBXB 3GIVA 3UO8B 4Y9EA 3VWKC 3ZQXA 2GJPA 3RDJA 4X4YA 1AKPA 1EH9A 2WLKA 3ME0A 2RALA 2AJUH 3JTSA 3QFGA 1A14H 3QC5X 4GI9A 3S5LB 1IGJB 2RD0A 4O02B 4QO1A 2IWKA 3V8OA 3QORD 2C1PA 2AJZA 2VN6A 5I30H 2C34A 1A5FH 5E5MA 4IEFA 4ZFFB 3SE3A 2XX0A 2ZOUA 2YJLA 4G7YH 2AMUA 3PXLA 2VDLB 1OHZA 1G9MC 5F3HB 1S9KC 1JVKA 4LRIA 1M9WA 1BOYA 4RAHA 2NXYB 1GVIA 2VUOA 4S2SB 5TF1L 1G7MA 5LQBL 2BCMA 2F53B 4XH2B 4G8FB 5ANMB 2ZX9A 3HPJB 2V2XB 3GSNA 1I1AC 2ARWA 3KWXA 4W9CC 4JO1H 1DANU 3ZKMD 3DIFA 4KJYA 1IIIA 5IHHA 1OB0A 3K8KA 4JR9H 4M5YH 3SGDI 2H1LM 1RK1A 2IIJA 4JFPB 1M9SA 4GAYB 3GHBH 4OKVB 4HYJA 5K59E 3G6AB 4WW3A 1NDGB 3RI5K 3U9UB 1ED3A 3DRTA 2ZYHA 3CDYA 1LE9B 2EO9A 2H6UA 3GK8L 5IJVB 2AERT 4PUBH 3EH3B 1T2XA 1NCIA 4FQCL 5TE6L 1CPUA 3O9WA 2ZUWA 1XHHA 2VMEA 2F74B 4FQ2L 4UZUA 3TBTA 1M2OA 2D7PA 3IETB 4KK6D 2YD6A 4LPVA 4YIQB 4L29A 2V33A 3U46B 4B6ZA 4KJWC 3RWJA 1P1ZA 3CFUA 3DX7A 4WI8A 3ZK0A 4X7SH 4NRYB 3DHUA 1C5CH 4GW4B 4M9PA 5LNEA 1K5NA 1YYLH 2V9TA 2XKNA 5A1AA 1CFQB 5FK9B 4DPRA 4JE4B 2UUDH 4O2CA 5HHNB 4HBCL 3VJ6A 3AG4B 4ZQKA 4APQC 4OFVA 1UHVA 1OIOA 3FO2B 4AE0A 3R0MA 3QXUA 3CNKA 3LHPL 2V4LA 4N24A 2KC0A 3DBXB 4JPKL 4XPAH 1F1GA 5GHWL 3TC9A 3BKMH 4P5KB 2VLKD 4OUOA 5HD8D 3NP3A 4PG2C 1J87A 2P26A 1X5FA 1U33A 4NRZB 5L0QB 2UY6B 1DN2A 2H6PB 2N0KA 3ZHDA 4XXWA 5CP3H 1AXTH 1DL7L 3KXFD 4PJGE 5B35A 2X1XR 2R7EA 3TBWA 2ADIA 2EEFA 4JM2A 2Y01A 4U3CA 1I7TA 2ZFEA 5GS0L 5C0DA 1QSFB 4X6DF 1NUDA 3T4YA 4NNYB 5DZNA 3MRCA 1I8LC 4ONHA 2WQWA 3FTZA 3W0WD 4PJIA 5LQBH 1INDL 3WE1A 1T03H 1QI5A 1LXMA 4KZ0A 1GS8A 4HAFA 1CG9B 2WWNA 4KU1A 3PWLB 4JQXA 1A6TB 1EBPA 4HOZA 2LT9A 5E2WH 4BH7A 4FTVE 4Q14A 4X0KB 3ZL2A 1I9IL 3BP7A 3MV8A 4ZOEA 1R24B 2E6JA 1OE2A 2UX6A 4YDJB 1XD0A 4ZYKB 4FQCH 2PPEA 3D69B 3NIGF 3D3VA 5A2IH 1EHKB 3O41B 1Q38A 4FQ2H 4FKHA 4CN1A 1VAHA 4PJ9A 1JD9A 5DI8B 5IROD 4PSRA 1BVNT 3HJEA 3DX9B 3FO0L 3ZPQA 1KN2H 4AMXA 3G5VB 4DEWA 1K3IA 2EC9U 2VM3A 4RISL 2I25N 4GRWE 4GT0A 1EXGA 4MQTB 4ABUA 3NACH 8FABB 1H6EA 1KBBA 4PJEA 1J5IA 3PU7A 1B0GA 2LVCA 3C8DA 4E42A 5JOFB 1BXVA 3H9YA 2ZXCA 3GKWL 5IW1A 3ZE0B 1YEHL 4JPKH 4N2OA 4Z7VB 1KENH 5J9PB 2VDPL 5GHWH 5IF0B 1Z6JT 4DGYH 4XN4A 1RPQA 4U05A 4RBPH 1BRRA 1CFNA 2A99A 5CKGA 3FSAA 5EC1A 5CSGA 2JJTA 1T21A 1IBDA 3ECWA 5HY9B 2KDYA 1NEPA 3VFOB 3T1FB 1GZPB 2R1XA 4AL8H 2XTJE 3RDTB 3TYFA 3BI9X 2I5YL 3BQVA 3GXPA 4TUJB 3W82A 3K4ZA 2BNRB 1FNLA 2CO6B 1TFHA 3SPCA 2ROYA 4BZ2L 4PJXA 3K91A 4UQ9A 2IFGA 1JGEA 3EYOB 1JMXA 2FNWA 3LXAA 3ELAT 1ORSB 2MKWA 3BAJA 4ALAL 4B3EA 3DO3A 2YN3A 4K7PX 1INDH 2WVUA 3CFQA 3WI9A 4CILA 1XIWA 3QUMH 1UJ3A 4ADGA 5AG8A 2ZSWB 4P9HL 3MJ8A 1ZV5A 1KTCA 5ESVA 4L3CB 2HJLB 1HILA 1GC1L 5A40E 5BW7A 3CUPB 3OHMB 1T1YA 1KIPA 2Y7MA 4L8BB 1KGIA 2F58L 3OKKA 4JZJC 4Y2OA 3LZFL 1G7LA 4M8QA 2WNGA 4NNPL 3RY6A 3OKEB 3MRRB 3CBKB 4B5ZA 3GDCA 5KVFL 3OKOA 3SYOA 4NENB 3VH8A 2ZXWB 1LYQA 2YAQA 3K6SB 2F8IA 1W72H 5DYSA 2YWYA 1KMGA 2K0RA 3ZYOA 1HL9A 2WB7A 3FO0H 4NHUA 5H2OA 3F7YA 5F71A 1HHKB 1D9KC 5KJ4A 1TKWB 3HUJA 4QR7A 4WTZA 3FZUC 4D0CB 4LLUB 4Z23A 3N43F 5CCKL 5LUMA 5HYJA 2AJ3A 1RURL 2A9NL 3DLQR 1E2ZA 4P59L 4YEFA 3CIAA 3OLDA 2VMJA 3QEQE 4LLWA 3GKWH 4HGWA 2EDHA 1ZLSH 1YEHH 2ICEA 1J8HB 3FB5A 2K8MA 4ISVA 4O2FB 3ZLQC 2WXPA 4PRPE 4NKOA 4BK8A 3SY0B 1AKJD 1JZ3A 2LHAA 2A4CA 2WXMA 2VM9A 3EGDA 3KLHD 3E1ZA 4JFDB 3C5XA 3UDWC 1I9JL 5EWIL 4F8PA 1AGEB 3D87B 1KSRA 1MRFL 4KKCD 4I85A 5FYKH 1S7WB 2I5YH 2APWA 5L2KD 3CQQA 4TV3A 1T7XA 4DKAA 1B0WA 1P8HA 3OPZL 3HNTL 4AQEA 4BZ2H 4HH9A 1VFBB 3P0VL 4OFIA 4OCYL 2YD3A 4XN7A 2B39A 4GW1B 1KV7A 2EIZA 5DJCA 3HCVA 2W0KA 4ALAH 1IAKA 4KOCA 1BJMA 1TJMA 2Y7OA 4HPOL 1DYZA 5E24E 3QAQA 1A4KB 3MUUA 4JZJB 4AEFA 1WBXB 1P5VA 3VI4F 1NIEA 1ETZB 2UY7B 2IMMA 1CWVA 3OJ2C 5D71L 3VCLA 2QTEA 4OCSL 3WJJC 3KPSE 4C4KT 1GC1H 2A4EA 1EBAA 5GSRB 2F58H 2G0LA 4W9GC 2WXFA 3LZFH 2B15A 3ARDC 3QPKA 4LVHB 4ZMOA 3P0GA 5I24A 5F7MC 5FCSH 2ZT9C 3KLQA 4E9XA 4LLYB 4NNPH 3ZYZA 4L4TA 2ZUUA 5I19L 1X5ZA 5CEZL 3OHXC 4NZUH 2JELH 4DO4A 1YC7A 3VNZA 5KVFH 4NWUL 2EQDA 2PABA 1RPUA 3E7JA 1U8KB 2J21A 1D9KB 2AEWA 4LPTA 3FONB 3V5DA 1ZE3H 1CBVH 4JY5L 3SGDH 2DQHL 5K93A 5FJGA 4UQDA 3ZT5A 4EZLA 1ZPUA 5AYQA 5L7XL 3VA6A 3BLBA 3SD2A 1A1NB 4G8GD 5KVDH 4F33B 1FBBA 1TJXA 1F90H 1ZOXA 4MCZA 5CCKH 3MRKA 4N9GA 1RURH 2A9NH 3LH8A 4ELME 4P59H 3W3BA 2PCYA 1A1OA 5AHYA 4FMVA 3MV7D 3Q8FA 1EXHA 2Q9OA 4HUVB 3B9KD 4OLEA 1DEEB 4E9YA 2BSRB 4PU2A 3CN0A 5DLLA 1PSKL 4N28A 1ZS8B 3QCTL 1S7RA 4A2FA 5EWIH 2JIXD 5D1QE 4V1DD 1LILA 3PWPD 4PJAF 5DHVB 4DEPC 4KNFA 3IPFA 3KVPA 1YAIA 3F64A 4QD2E 5CJXA 7PCYA 4I5BA 3FQNA 3HRZA 1U8JA 4XI5D 3ZHLA 1JK8B 1NAMA 3HNTH 4ZUWA 2X6CA 1NMCB 3LKPA 4OCYH 2EVHA 3NP4A 2Q8BL 3TBVB 4U1GC 4PWJA 2CHNA 2XPGB 2B2XL 4YBLB 3RWIB 1PLCA 4HPOH 1HS6A 5DUPL 2ZZUT 1OCWL 5I23A 3ARUA 5F7AA 5IEHA 2DBLL 2I07B 4NZDA 5EO9A 5D71H 5CGMA 4OCSH 3KPLB 3TPUB 1XGTA 2V37A 3OHXB 5IB1A 4H0HB 1WH0A 3LZNA 1EUUA 4TVPL 3L3DB 3MLUL 2J3SA 4JJOA 2PWGA 1LD9B 3ULVH 2Y5EA 1ID2A 3UP1A 2F7PA 2XA8H 3N91A 1EO8L 2V7NB 4BQCA 1E5CA 3DWTA 4NWUH 4WU7B 1KEGL 5H37G 4XX5A 4P49A 2CLVB 3G6JB 4XXDB 1SYVA 4EUPA 4J8RB 3TIEA 4MZIA 3HAEH 2CIKB 1PJ9A 4GQZA 2E7HA 4YDVB 2BW5A 3ARGC 5T1KD 2C1OA 2DQHH 4XTOA 1X44A 1IXFA 2DQDL 2NYYD 2HFFB 3FU8A 4HXAL 4RFOL 2OZ4A 5L7XH 4Y5VC 2LAAA 3ZR5A 5J6HA 1PZAA 1N5YH 2F68X 2WGXA 4N26A 4WHCA 3B7TA 5F1IA 3IMVA 4XNBA 4PN6A 3TN0B 2AQ1A 2HJFB 2B3IA 4DEPB 1MWAL 1MCJA 1PSKH 3GXDA 1YECL 3QCTH 5AZEL 3S2CA 3Q2VA 3WKNA 4OBRA 1OEZW 3CFDB 1HI6B 3GEWB 4ANVA 4YSPA 1RZJC 4U1GB 4X99A 3ZDZB 4XXJA 1E8ZA 1Q4NX 3KXFA 2XYCA 4FP8L 4P5RA 3BKJL 1KGXA 3VYNA 1COBA 5B21A 1BEXA 4IIQC 5C0IA 5E1HB 2D0GA 4L1SA 2Z1PA 3WFCL 5FA4A 4CJ1A 1X9QA 1U8MA 1KCVL 2B2XH 3SGKA 2EXWD 3GEFA 4QXGL 3ZYJA 3RAJL 1Z9PA 5DUPH 2EIEA 3W0WA