3S8FB

1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
166
structure length
166
Chain Sequence
DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYTLATHTAGVIPAGKLERVDPTTVRQEGPWADPAQAVVQTGPNQYTVYVLAFAFGYQPNPIEVPQGAEIVFKITSPDVIHGFHVEGTNINVEVLPGEVSTVRYTFKRPGEYRIICNQYCGLGHQNMFGTIVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title High resolution structure of the ba3 cytochrome c oxidase from Thermus thermophilus in a lipidic environment.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 48
structure length 166
sequence length 166
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2011-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF09125 COX2-transmemb Cytochrome C oxidase subunit II, transmembrane
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3s8fB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3s8fB02
2WJKA 1H2SA 2VT4A 4X1HA 2BP8B 2GSMB 2HXAA 3T45A 3G5WA 4GPOA 1NIAA 1AP9A 1A65A 1J9TA 1W6LA 3FU7A 3PBLA 3D12B 4BUOA 4ZK8A 4P5SA 1J5DA 1OE1A 4A2EA 3CAPA 2HZHA 2BW5A 5H2HA 4GP8B 1F56A 1ZV2A 1KG8A 3EHBB 3EH5B 1M9WA 2PPDA 4BV0A 2XX1A 2PEDA 2F93A 5G54A 2XX0A 1MG2C 2FQFA 4N6HA 1VGOA 2EI4A 2EIMB 2PCYA 1KMEA 2DY2A 1HZXA 3CDZB 4HCFA 3X2QB 1AS7A 2Z73A 1P8HA 3QAPA 3NP3A 2MRYA 2IWEA 1HFUA 2VW7A 3S3CB 4KLYA 2HX7A 4MBSA 3UAEA 3CVBA 3DKHA 3AM6A 2YAFA 1JV7A 2W88A 3BVDB 3H56A 4M4RB 2HPYA 2YCXA 1NDTA 1JZFA 2BZCA 1JXFA 4UG2A 2I7OA 3NJHA 5I6MA 4LDOA 2AT9A 3HASA 4G71B 1DZ0A 3HB3B 4Q8BA 1AR1B 5TGZA 1SFDA 3OM3B 4XXJA 4TL3A 5H2OA 4YSUA 1NPNA 3ZEVA 3RFMA 5B3SB 1AZBA 1SF3A 1MDAA 1F50A 3CZUB 4PXKA 5I26A 3WG7B 2HLEB 3FYEB 4F2FA 4E9VA 2BZ7A 4QI1A 1TEFA 4JQ6A 2DYSB 4KO7A 2VM4A 1JZIA 3T6WA 4E9WA 3AG2B 1OCOB 3L45A 5J7AA 1E5YA 3VI0A 3SBRA 1JOIA 2CBPA 5AFAA 2EINB 1NTDA 4MFHA 4BEYA 2QDWA 3NP4A 2Q5BA 3C9LA 2XVBA 3T6XA 1GW0A 3DIVA 2J5WA 2AVFA 1X9RA 5B6YA 2FQDA 2Y02A 2J56A 5E9NA 2I7SA 2OJ1A 5IY5B 4BDVB 2NRDA 5ANHA 1NWOA 2AANA 2IWFA 1PLBA 4HYXA 3ODUA 5FJGA 1AANA 2VN3A 1JZJA 4NAJA 3DTUB 3QBLA 3KW8A 5B1JA 1KGYE 1ETJA 1ID2A 4M3HA 1AQ8A 4KO6A 2CJ3A 1FFTB 5B34A 4P5RA 3NSCA 1E5ZA 1BQKA 3QDCA 4OV0A 1MG3C 4JHUA 4DPBX 3PDSA 1GS7A 2ZWNA 1ZIBA 3PAUA 1GYCA 3WNJA 2QT6A 2RACA 1FBKA 4BWUA 2GC4C 3AG1B 5I6OA 2BW4A 1NIBA 3GXUB 3WKQA 2YAQA 4DP4X 4GP5B 3FQ1A 1M57B 5H2NA 3FQ2A 5LDUA 2VSMB 2VM3A 1DYZA 2R4SA 2PP9A 1ET8A 1BAWA 4BVNA 2XUWA 3MBVA 2B08A 1WS8A 3OE8A 1A8ZA 2BWDA 1S54A 2FQGA 4AI7A 4N8UA 3UTYA 1JVLA 4L35A 1BYPA 2IDFA 3QJRB 1C8RA 5JJNA 1GY1A 4IB4A 1NIEA 1V55B 5I6PA 5PCYA 3WI9A 5I5IA 1J5CA 5H2KA 3AYNA 4YSPA 5B7FA 1IW6A 1Q5JA 2YARA 3IEAA 2BRDA 3HARA 2RH1A 2JXMA 4YSSA 2YCWA 2IH8A 1GS6X 4XTOA 5B7MA 1O0AA 3X1GA 2CALA 3VVKA 3QJUB 1OV8A 3SBQA 2P80D 4CSZA 4DP8X 4DP6X 3EF4A 1S52A 1LN6A 4XT1A 2JAGA 3FSZA 4E9SA 5EHFA 4YSOA 2YXVA 3PLYA 3PPSA 3PQRA 4EJ4A 1RZPA 2ZOOA 3FQYA 3HAOA 4FAAB 1P8UA 2UXFA 3N55A 1SDDB 4JR8A 1B3IA 1NINA 3X1BA 1AIZA 2AZAA 1ASPA 5AZUA 3H4HA 4N4WA 2E86A 1GR7A 2IWKA 5D4HA 1OOWA 2BHFA 3SBPA 2GIMA 3NJJA 2CAKA 3CODA 4GY4A 4KNSA 1KDIA 1J9RA 1F4ZA 3TBCA 3V2YA 3NJFA 2CCWA 2YQBA 4UHRA 3OQRA 4JKVA 1RCYA 8PAZA 5B1BB 1N68A 2YDOA 2GBAA 4E9YA 3UTXA 4YSDA 4MD2A 3NYAA 3REYA 1X9UA 4GBRA 1P8IA 3OD3A 3ABMB 3PAVA 5DYSA 5G2DA 1PMYA 3NJGA 5I5JA 1S8LA 1AG6A 4DP7X 2XU9A 3OMNB 1PNDA 4G72B 2N0MA 4GRVA 3EH3B 1ZIAA 1CC3A 1NICA 1CUOA 1W6WA 4YVNA 3N2JA 1DZEA 3RYMA 3HANA 4UAHA 4BXSV 4KO5A 2OV0A 4PAZA 2IDQA 4EA3A 1PF3A 5G2AA 4E9QA 1KCWA 2IH9A 1PZBA 4RH4A 3NJMA 2DYRB 4K9JA 4CSPA 4BWBA 1ZPUA 5B6WA 1AS6A 2LNLA 5AX0A 1GU8A 2R7EA 2X87A 2NTUA 3BQVA 3NT0A 4JHVA 4DJHA 2YAHA 5B0WA 3NS0A 3MBWB 2XLLA 5DHHA 4NERA 3X3BA 5AHYA 5A45A 1E0PA 3QBKA 1L9PA 4G7SB 4FBZA 1JZGA 1IW9A 2YCYA 5A44A 4GP4B 1AZUA 4G7RB 1JV6A 3VGAA 4YSAA 4GXFA 3AYMA 4BWWA 2Y04A 1E30A 1QNIA 2OCCB 5DHGA 5H2LA 2I20A 1QHQA 2BP8A 4KOCA 2FWLB 3OE6A 2BP0B 3TA4D 1BM1A 4G7QB 5B1KA 1L0MA 3GDCA 3OAXA 3UABA 1R2NA 2WSDA 1BQ5A 1V10A 3FPYA 3AW5A 4WW3A 4HALA 2QPEB 4AX3A 1PAZA 3VW7A 1NIDA 3IBOA 4YSQA 1FWXA 1ZDSA 2HX9A 3AG4B 3RZEA 3UTWA 1ADWA 3TBBA 1PZAA 2JFCA 3CDZA 2H47C 3NJNA 3NJLA 3WIAA 4DP0X 1XB6A 1BRRA 1PLAA 2DV6A 5BR2A 1ILSA 3X1NA 4PCYA 1A4CA 4X4KA 2KS9A 5C1MA 2J4YA 5ETZA 3TU6A 2XXGA 3FSWA 3UZCA 3T6VA 4YSEA 3UAAA 1QLEB 2I1XA 2Y69B 4A67A 1PXRA 4TXVB 3EMLA 1NIFA 4X31A 3ZDWA 2IDUA 4L0PB 3ZPRA 1GZMA 5FC9A 3OE0A 5F7AA 3C9MA 2FT8A 3JTBA 1PXSA 2UXGA 2X88A 5B7EA 3FSAA 4DP2X 2Y01A 3EH4B 9PCYA 5I6KA 5G53A 4J4QA 4Q89A 2QPDB 2NTWA 1JXDA 1L9TA 2H5UA 1PCSA 2XYBA 1A3ZA 1JERA 5TK2A 1E12A 4MQSA 3OMAB 1OE3A 1M56B 2Y00A 1Q5IA 4HAKA 4A2GA 2B3IA 2PCFA 1NZRA 4WAVA 3NY9A 1ZDQA 3ZBMA 2GC7C 4ENZA 2XWZA 4QLWA 3QAKA 3X1FA 1IC0A 3VG9A 1AACA 3ASNB 4F2EA 2ZZLA 1WS7A 3X1EA 1AZCA 2M3GA 4HHWA 3S8GB 7PCYA 1EZLA 2YAEA 2FNWA 3PWHA 3ABGA 1TN5A 2DWTA 2ZXWB 4X32A 1PY0A 5A7EA 3JT2A 3PXLA 1AOZA 4DP5X 2WJLA 3IE9A 1F88A 1SHWA 2VMJA 4DAJA 4G70B 1XMEB 2P80A 3FYIB 4HZ1A 4DPCX 6PCYA 3UZAA 3UONA 4GYCA 4MQTA 4AMIA 2I85A 4YSTA 5AX1A 1IXFA 3WKPA 2UXTA 1UAZA 5AWZA 3QJTB 1J9SA 1IBYA 4BDVA 7PAZA 5LWEA 4KOBA 2TSAA 1L9OA 3A7KA 4HHGA 1VLXA 1IUZA 4FPDA 2FJSA 3NJIA 2R4RA 3UTVA 2I21A 4BEZA 5D4IA 1BRXA 1QKPA 4AMJA 3U25A 1AS8A 1W8EA 3CVDA 4A66A 3QBGA 1OF0A 2YAOA 4EF3A 1CYWA 4DP9X 5G28A 3AZUA 1URIA 3WQJA 1J9QA 3ZPQA 5H2PA 3ABLB 3DDLA 3S8FB 2XV2A 3FPXA 2KSAA 1SHXA 3NSYA 5AZDA 2WO3B 3OMIB 4KNUA 4AZUA 5JJEA 2MTAA 3P0GA 4EIYA 1JZHA 1BXUA 4QKTA 1AZRA 3TASA 5PAZA 3NSFA 1L9HA 4A68A 2ZFEA 2PP8A 4Y9HA 2KSYA 4DP1X 1XB3A 3GYRA 1MGYA 5ITEA 4BWTA 2PPCA 5B6VA 1H68A 3WNIA 1XJIA 2PPFA 2GHZA 4AKQA 3SQRA 1KYAA 2AZUA 2H3XC 4HYJA 4IARA 3FU8A 5JJJA 3ZIYA 2FT7A 2PP7A 1X0K1 1QKOA 1A4AA 1BQRA 1L9QA 1XB8A 3HAPA 2HX8A 2Q9OA 1R84A 2GI0A 1AZNA 1PLCA 3CG8A 5B6XA 3QJQB 3QQXA 3T71A 1S8JA 3T9WA 1ILUA 3UG9A 1TEGA 1NPJA 1BXAA 1X0SA 1FBBA 1M0LA 5H2MA 1MZYA 2XV0A 2XV3A 4HWLA 4DPAX 2GB2A 3KJ6A 3V9EA 1C8SA 1X0I1 4YSRA 4JKNA 4WKXA 6PAZA 1S53A 2Z55A 4BK5C 1RZQA 3ABKB 2PLTA 4K5YA 2W8CA 2WO2B 4IAQA 3PXOA 1SDDA 3ABWA 2YAMA 4UANA 1UCQA 1JGJA 2UX6A 1ASQA 1EHKB 1C3WA 3COCA 4GYBA 3UADA 3S3DB 1RKRA 4NB7A 2IAAC 3ZX1A 4AKPA 1GY2A 4NC3A 1A4BA 5F8UA 1E65A 3QBIA 1PZCA 2PPEA 3HEIB 1SNRA 3UACA 2QDVA 2F95A 1L9RA 1TN0A 4L6RA 1CWQA 1KCBA 1KGBA 1OCZB 5TK4A 1M0MA 3QJSB 4PXFA 2EIKB 1IKOP 1ASOA 3T6ZA 5A8EA 4XTLA 4KNFA 5B35A 2JAFA 4W9ZA 2I35A 4UF7C 1MZZA 4KO9A 1S51A 2PPAA 3C75A 5AHZA 3ERXA 1L9SA 4YSCA 5F7BA 2ZONA 1ET5A 1GUEA 5ITCA 1VJMA 5I5MA 2G87A 3HAQA 2FTAA 3S3BB 1M0KA 1WA0X 2TSBA 2YAPA 2X72A 1WAEA 1FA4A 3FU9A 2Y03A 4HIPA 5H2IA 2BWIA 3PCYA 1KBWA 4HCGA 4A4MA 4N4YB 2VSKB 4HCIA 1PY6A 2EIJB 3QJVB 1GS8A 4KNTA 4E9XA 1OE2A 1OCCB 1T5KA 5I28A 1AT9A 3VHZA 2AFNA 2ZIYA 4MD1A 1KDJA 4A2HA 4E9RA 1UATA 3FSVA 5B6ZA 3FU7B 3V2WA 1GSKA 2FT6A 2J57A 1AG0A 3ASOB 2BP0A 5I6NA 3KW7A 3NYKA 4A2FA 3D4SA 1HAUA 3NSDA 1AAJA 3QPKA 2KSBA 2YDVA 5BR5A 3OE9A 4E9TA 4DKLA 2VW6A 3NJKA 2A3TA 1HAWA 3MX0B 4AKOA 1I53A 4LDLA 4YVUA 5G36A 2HRGA 1WA1X 2UX7A 3NY8A 5B1JC 1JFPA 1KG9A 1BRDA 2DWSA 3FT0A 2IDTA 5D4JA 2IDSA 1IBZA 1JXGA 3PAZA 1SFHA 1CYXA 4QRYA 3H4FA 2J55A 3AG3B 4BXVA 1BXVA 2UXVA 4XTNA 2HRHA 2LLNA 4QIDA 2XXFA 4YL4A 3IN2A 3SN6R 1BEXA 4XT3A 5H2JA 1BYOA 1JZEA 2YCZA 1JVOA 1SJMA 1E67A 1TKWA 5AKRA 1R1CA 1QM8A 1PNCA 1CURA 1U19A 5KKHA 2BO0A 1QHJA 1SF5A 2EILB 2JKWA 2R7EB 1NWPA 4A2DA 1KBVA 1OCRB 5EN0A 1TU2A 5G2CA 2YXWA 1N70A 3UGEA 4F7KA 3X3CA 3NSBA 4WTQA 2VW4A 1WA2X 4LDEA 1XIOA 2L6XA 5B2NA 1KV7A 2Y1AA 2FQEA 3IN0A 5I6LA 1V54B 4FA7B 3CVCA 3DQBA 3FS9A 3AY2A 3V9CA 2CUAA 1YLBB 1ET7A 5B1AB 4W1TA
chains in the Genus database with same CATH superfamily
3K6DA 4M6ML 3AFLA 2KL6A 3WUWA 4M9PA 1TCMA 1L0PA 1TTRA 3DVIA 4OUUA 3D12B 4E5XG 1WTGT 1P1ZB 1MCDA 1BZQK 5K9JL 1AY1L 4GP8B 2BNQE 1F56A 4O58H 5F3BB 2OXGA 4OZIE 2A74A 3DPDA 1YY8B 2HT3D 3T3MF 4MD4A 5DK0B 3UBGA 3WXWL 3CN3A 4HS3B 4KK6D 2WJ5A 3ZSSA 5E95B 2FQFA 3D87B 1HJBC 4K8RD 4WI6A 2VLLA 3BP7B 4PW3A 3LD8C 3WEXA 4L48A 2VDOL 5C0RL 5JW4M 4BKTC 2HT4C 2Z7UA 3BP6B 3BT2H 2AEPL 4UQIM 3TWCH 4Z7QB 4MBSA 1LNUB 4CMMB 2EAEA 4F27A 3O6FC 2AJUL 1UQSB 2G5BA 3PY9A 3UG3A 1PIFA 5D1XD 5GRVL 3AREA 3G7TA 1XGYL 3AM6A 4M6OH 2V0AA 4KFMA 4G9FA 4QY8B 4JO8A 3Q06A 1P7QD 3A6OA 4AL8L 6FABH 3EDFA 4CN4A 2HYMA 4P46B 4ELKB 1KJVA 2DQJL 1B0IA 4WFHE 2CLRA 3VM7A 2EDJA 1DCEA 2PWEA 1E28B 2ZKYA 1UB6B 3WO3B 2YD6A 1P6AB 3FYEB 4JO4L 4U1NA 3TLRA 3F12A 5F89B 1A7BA 2B0SH 3DV6B 4HZLA 3EBHA 2VR7A 2X53A 3WY2A 3L45A 1JRHI 5J13B 3DSFL 3LIZL 3FB7B 4PJ8D 5E5MA 3VUAA 1RJLA 3ILDA 4WV1B 2X6BA 3G04B 3M8OL 3QDME 4LDCA 4XZUB 5FEBA 4Q6KA 3GUTA 4PWFA 1F8TL 4B97A 1ZTXE 3E2HC 3QQDB 4ZQTA 5C8JA 3WE6B 4M5YL 2Y02A 1XX9C 4A7GF 1FE8L 2OJ1A 3I85A 1GZPB 2HG0A 2VZTA 5I0DA 5IY5B 1U2YA 4XHJC 1RZGA 4C8XA 2C9PA 1I31A 2O6DA 5GJTH 4MS8C 2EDTA 3H1ZA 1U3JA 2D4FA 2DQIH 4XNUH 3QCUH 4MMZB 4P5TD 1ZWIB 5AVYB 3BAKA 4HXBH 4MVBC 4P2RB 1DQIA 4HIEA 3QDCA 1OF2A 1USQA 4JHUA 4G9DA 3QUXC 4DPBX 4ADIA 2EUVA 2V5YA 3IMUA 1LMIA 3MOBH 5G5DA 4PIRF 1GTFA 3H9YA 1M05A 3VH8G 4ALAH 1MCWM 1E6OH 3BKYL 1H6FA 4M4PA 1Z5HA 3AROA 1CICB 5IQ7H 1BP3B 4KXDA 1U3NA 3P2TA 4J3WA 2MKWA 4LL4A 1MWAA 4EZKA 4PRPA 2H9GA 5FF6A 4BCZA 2R69L 4OT1H 3S34H 5ANMB 4Z7UA 4L35A 1CIDA 2A7BA 1A5FH 4MAYC 3UAJD 1KSRA 5AQ0A 1C8RA 1MW1A 3REVB 3R1GL 1S8DB 3JWNH 2H2SD 5LO7A 3AYNA 3DOSB 2JXMA 3QZOA 4FXGB 1EEYA 1GS6X 4JFZH 4P5MB 3T0XA 4YDKH 3MLUH 2OQJB 2NDGA 5T5FH 2BOCB 4WEBH 2DWXA 4KI5C 2JAGA 3TGXA 12E8H 3LKSA 2NXYC 1DN2A 2XWJA 3MNZB 4EJ4A 4JPKL 4AEIL 4IBVA 2N7AA 2KKQA 1AMYA 2X9XA 3VXNB 1C08B 2FX7H 5EF3A 2J1KA 2CRMA 4JKMA 4FQXB 4P2QA 1ASPA 3WCYA 4M8UA 4HZAA 5HDWA 5HHQA 2Z35A 1OL0A 4XTRD 1A14L 3O2DH 3PWVA 4GY4A 3FOLA 1BZOA 2ITCB 3GMNB 4FTVD 2X3AA 4YSDA 3PF2A 1T89C 4HWBH 4FFWC 2JWYA 4HUVA 2ZJSL 3SGJA 3BC9A 4ANVA 4TSBH 5E8PA 5AD0B 2N0MA 1A3RL 5T33L 3EH3B 4OZGE 1H3UA 2AQTA 3N2JA 2Q7YB 2BSDA 2FX8L 1IC1A 4U31A 3TM6A 3BXNB 4IGBD 1VCBC 2OV0A 5CKGA 4ZXBA 3APFA 3EGSA 4E9QA 2J8UB 1RK1A 4TQEL 1NCAH 2GJRA 4NNXB 5BRZB 2LHAA 2VJ8A 1LE9A 2MCPL 2IH3A 1ZPUA 3WMSA 1WHPA 5HVFB 5G2NA 4KXZI 4F5CA 2Z4TA 4O4YL 2ZUXA 1KC5L 4M43H 1E9PA 3F7RA 3N42B 4KK5D 4ZMTA 4YBQD 3KLAB 1E9QB 3E9UA 5C0AE 3WLBA 2OYMA 2DI8A 3ARVA 2QL1A 2GSGA 1G7PB 4PGZA 1MCHA 4U4IA 4PLKD 4LLUA 1W72A 2EVGA 4P9HL 2DQGH 3FAWA 5IHUH 4Y1AD 4JPWH 4N0UE 2WSDA 1SGKA 4F8OA 4ZSOA 3DJRA 4FQIL 1IJNA 2X4RA 4MNGB 1FNEA 1OQXA 3NRPA 1PYWB 1SZNA 3TURA 1FZJB 2L7QA 3C8HA 2L04A 1T0NA 3VFRB 3PIQA 3Q1SH 5E7BA 2C34A 5C0DA 1D5BB 2QVIA 1JDCA 5FOJA 2DV6A 4WCYH 3WFZA 4X8GA 43CAA 1JIBA 2GY5A 3QXDB 2J4YA 4JZJC 4U3CA 2BH0A 2DW5A 4Y5XC 3MROB 4JFDA 1I8KB 2NNAB 3RB5A 1GA2A 3FT9A 1UWGH 3FQNA 4H8HA 4DT2A 3TP4A 1GHFL 1NGZA 3AB0B 4K8RH 2PYEE 3ILQD 1C12A 2HKHH 4J23A 4UT7L 2AJSH 4H1LA 5I6KA 2IH1B 4LDEB 3VYPA 4PG9B 4U1SA 1L9TA 1PFCA 2XYBA 3UTPE 2C4FU 2J7LA 2WVSA 2ZP0T 4AUJA 4CA4A 1LO5B 4NO3B 5DJYB 1RZIB 1K72A 2EADA 5BRQA 3WUWB 2CNYA 2XZAL 2XVKA 2ZP8A 3MUJA 2YOAA 4CKQA 3SKJL 4OUUB 3O45A 4HJ0D 2LAAA 4G59C 4HHWA 3N1GC 2V5RA 1I8MA 1ZTMA 2OXGB 4PBDA 5EN3A 4Z7QF 4J3SA 3VXPA 4MD4B 4LEBA 3E8VA 1E42A 5FV2A 3ZT5A 4QXGH 3WEXB 3JWNE 2E7MA 1WAAF 4LSQL 4L29A 2V7HA 4DZ8A 2MSPA 2D9QB 3H53A 4JHZA 1IXFA 1GXEA 3DLQR 5JZ7D 2QSTA 3LS4L 4K94H 1NGWA 3CFNA 3Q6FA 4FFZA 5I1GL 3AREB 3INUH 4XNYH 1Q94B 5E2JA 3OWRA 1LYQA 1DBAH 4G9FB 1J8HA 3GI9H 1HQ4A 1J9CT 3I6GB 4A66A 4YHYC 4FLSA 1BVNP 1LMKA 4UT6L 3AGVA 2GI7A 2P45B 4APQD 1KJVB 1U8PA 3F58H 1MHPH 3MBEC 1J9QA 3TO4B 1JGLL 3PAYA 4Y9GA 1KGCD 2DL9A 3S8FB 3B2VL 3FPXA 2J3SA 3BKMH 3K6IA 1ETB1 3CFEA 3EYFA 4U1NB 4S11A 1BLIA 4ODHL 5MHSE 3F12B 3BD3A 4GLRH 4JDVA 5ALCH 1G1KA 4HZLB 4NDMB 1ED3A 4QKXB 1EMTH 1TTFA 4EXKA 4OSUL 4KUZL 2WYZA 5E5MB 1E2WA 1RJLB 1BVOA 3HS8A 4JRYA 1FRGL 5I8KH 2BM3A 2QVMA 3GUTB 4HYJA 4IARA 3ULVF 3ECBA 4JE4B 4X4MA 3QJQB 1CGSL 4RETB 3L4ZA 4WLCA 4H44C 5AYTA 1MQ8A 4AXWA 4Y4HC 4HVBA 1B6DA 2BXYA 1BXAA 5DEGA 5B1CA 3LRKA 1RZGB 2UZPA 1SOQA 3KLSA 4MGXA 2DQEL 1IKFH 3MCKA 3L3OA 1FUNA 2W0FA 3OAZH 2IQAA 2WO2B 2I25N 5FO7A 4K3HA 1KBBA 4OKDA 4G9DB 4LRIC 1E4XL 4OI7A 1H3VA 2Y72A 4LCWD 4XMPL 2IAAC 4AKPA 4EI6A 3BZ4B 5G5DB 3FDWA 4A1RA 2NW2A 3OR7A 1U8KA 3GO1H 3HEIB 3MRGA 3W0WA 5HJ3A 2DB8A 2MQGA 1T04A 3QFJA 1W72L 3CCHA 3EOTL 2QKIA 3VG0L 3QJSB 1O75A 3I9GL 4H1LG 1IKOP 3DUUA 1WITA 1XL6A 1MWAB 5DEZA 4PRPB 3LDBC 1UENA 2H9GB 5FF6B 4ERSL 1S78C 4UF7C 1IGCH 3LEXA 1S51A 1Q0XL 1TMQA 4Z7UB 2G2RA 3HAEA 4FNTA 1AFVH 5AAWC 5J1TC 2Q0ZX 2FJUB 5IWLC 3R4DA 2IO5A 1I3VA 2FTAA 4YGAB 2YAPA 4FJYA 1PEZA 4MB1A 4PRHD 2FWSA 2JXMB 1D3CA 2V8LA 2CK0H 3SBWA 5H2IA 3GEFA 3H9ZA 3LEYL 2O6FA 4HCGA 1CE6A 2VSKB 3ARXA 4BSWA 4M7KL 3OGOE 1TZ8A 2XWJB 4F8TA 4EN3C 3VD7A 1N5YH 4JL1A 3QO0A 4PVBA 2JJVA 4L3EA 4JG9A 5D1XE 3V4VL 5I1CH 4GT0A 2CDGA 3QORA 1P6WA 2VAAA 4ZFZA 5JDSA 4X80L 4TTDD 2AJZA 3PWVB 4FZEH 1G1OA 5JXED 4E9TA 4XOEA 3HW7A 3ZDXF 1H3TA 3WTXA 2J8UF 5FGRA 1MFEL 2F54B 4HUVB 2X1QA 5D4JA 5E8PB 4ZX5A 2NX5D 2V9TA 1CDJA 2DRUA 1UA6L 3ULUD 4DN3L 4KRPC 5C70A 3H4FA 2X9ZA 5GGQH 2BIQA 3P77A 3PHAA 5EBLB 4ZXBB 4PV1C 4XE0A 3EGSB 2VC2H 5E8DH 5BNXD 1RK1B 1PIGA 2IH3B 1N64L 2E4TA 2A6KA 2AK1L 3U9UA 3Q0HA 3NSBA 3WNMA 1E9PB 4UIMA 2AAAA 4M56A 3MRQA 4JN1L 3TEYA 1QABA 3AY2A 5IBUB 2CUAA 3LNHA 3AY4A 3WLBB 1ET7A 3I3BA 2YRZA 1H2SA 5FFGA 2GSGB 4ISVB 2DKSA 2HXAA 5E56A 3G5WA 3BLKA 4JGUA 1CLVA 1HINL 4LLUB 4RGMC 1W72B 5D1ZA 1UVQA 4XN1A 3ZUCA 2J12B 2VOTA 3QYMA 1ECZA 4UNIA 1KG8A 2UZYA 3NRFA 2X4RB 4R7DA 3PREA 3UO1L 3FRUA 4ODVH 1ML0A 3GBDA 5JW3H 4I2XB 1T0NB 2W9EH 4KKLC 3KGUA 4PRIB 1DP0A 3T4YA 3VGHA 1KMEA 5C0DB 3WELA 2Y2TA 2W95A 1NBCA 2Q2EB 4UINL 5DYFA 4BQBA 5F44A 43CAB 1BJ1J 2HLFD 2OMWA 3S3CB 2EEAA 4JFDB 4NC0B 2IQ9H 2EO9A 1NGQH 3QR1A 3HLKA 4K5LA 3RX8A 3FQNB 3CZLA 1PL3A 2F74B 3CVBA 4LLYB 4DUWA 1DO6A 5E99L 2NYZA 1C12B 3GUFA 4FNPA 3EFFA 5DVMA 1JZ4A 5HD8C 4AV0A 3V5DA 4U1SB 3HAEG 2E74C 3T09A 1FO0L 1G6VK 3LSOA 3RGVA 4AQAA 4QWWD 4PJEA 3C5XA 1FVDA 1UM6H 4EI5C 5G4NA 4L3CA 3GSUB 3U82B 3V4LA 5IVXA 4KZEH 3ARFD 4PJXE 3WG7B 2HRLA 5IHBA 2C9XA 4IKNA 4NS0A 1I8MB 3B2UD 2Y1ZA 2AJ3A 1QEWA 3T65A 1OHQA 3OAZK 4FTVE 5SX5K 3NP4A 3UH8A 4J3TA 3SCMA 4L29B 1TZGH 5DZJA 2V7HB 4DZ8B 3IYLW 4RFNB 3V52L 4GMTL 5KVEH 3ZE1F 2IIJA 3IDYB 1CL7L 4RGOH 1NKGA 1UA7A 1BM3H 1H3XA 5B8CA 5IB2A 1OOAA 1NGWB 1T0MB 3Q6FB 2OZ4A 5C0BA 3GJFH 4UNTA 1NGPH 1F41A 1KGYE 2C4FT 2HT2D 4ADJA 1HQ4B 1FL3A 4LASH 4NZJA 2XCMC 4PWHA 1CXFA 5DC0A 1BQKA 4NQDB 4P4KA 2R15A 5KVDH 1F58H 2VH5L 3WKMH 2X0UA 2L7JA 2VXSH 1BVNT 3ASWA 4FQLL 5GGUB 2NW3B 2WINA 3CFEB 3EYFB 4GP5B 2HH0L 1M7IA 1ZV5A 5I19L 1XSKA 4ONGH 2NCMA 4I4WB 5M7QA 3KJ4B 3W82A 3S3SA 4QRUA 1ED3B 4HIXH 2DPKA 1B90A 3KVPA 5C0AA 4PV8A 4WUUB 3VFSB 2ORBL 5BS0A 3GZOA 4P46C 4JRYB 4Y1AE 1FFPA 4KHXL 3BPOB 1XEUA 2AQRA 3ECBB 1GY1A 4IIZA 4KTEH 5FO8A 3RLSA 4G3YL 5E4OA 4AUUA 4AXWB 4MA1B 5FHAL 2IALA 3V5HA 1IEBA 1J0KA 4ONOA 4HJTA 3RIFF 1DN0A 3L3OB 5J13C 1MY5A 4DGYH 5HGHB 2W0FB 1ZLSH 3FQYA 3SGEH 4Z7NE 2UXFA 5FO7B 2KZWA 4WV1C 3NCXA 1PAMA 1ZHKB 1ZTXL 1HILA 3DECA 4FHBD 3S36H 1D5IH 1FH2A 1R3JA 4GW1B 4O9HL 1DQMH 4EI6B 2GK0A 1ADQH 3VFNA 1OOWA 2MQ0A 2NW2B 3OR7B 1KDIA 2RBLA 3MRGB 1NH6A 3W0WB 3TBCA 4OCNC 5HJ3B 1T04B 1EJOH 3CCHB 3QFJB 4I18B 5CEYA 4XWOD 2EXWD 3UTXA 1GJWA 3DUUB 3O9WD 1IGML 3ABMB 1QSEA 4EQ2A 2ZXEB 3PWUA 1TF4A 3NJGA 4MMZC 5E4AA 4DP7X 4P3WA 3UBFA 5I71B 4HULB 1JHLH 4JRXA 5FPIA 2ZCZA 2ICWJ 3LEXB 4YVNA 2G2RB 3TVMD 5G2AA 5B21A 1HJCA 4LEEA 3ARDD 1BQHA 3VXSA 3MCLL 1EWHA 1E40A 4MCZA 4B9KC 5AX0A 3UTQA 1CICC 3BLBA 2PO6A 4QHMA 1CE6B 3L2MA 5B0WA 2YRLA 4DHLA 4BSWB 3ULUH 1DSWA 2XLLA 1UD5A 2DQFA 1EHLH 4DQAA 2PXYB 4MZIA 2MMXA 3CFJA 2DH2A 3IDXL 3OGCB 4KVNL 1AZUA 3JSSA 1O6SA 2ICWI 5FCUH 4GXFA 4L3EB 5CJXA 3N40P 1NUFA 2VDKL 2I20A 3KEHA 2R2EA 3RUGA 3PABA 2VAAB 4AOFA 4ZFZB 2ITEA 4B0MB 4NP4H 2QPSA 2AJZB 2HA1A 3OHXB 4XMLH 3GDCA 3SOTA 4AE0A 2OM5A 2QGEA 4FXGC 5DC9B 4NO0A 1FYTA 4DVRH 1KGCE 4JB9H 5IMLB 5J6HA 3NFPB 2YC1B 3O2DA 3I6KA 4P49A 1JF5A 2JFCA 1S7UA 3VQ2C 4NRXB 4DZBA 3LKOA 3NEXA 4FQXC 4K07A 5KVEE 1FI8C 1DZBA 4O58L 2WNKA 4Y19A 1F02I 2WXMA 2XZZA 5FLVA 2QHRH 4X31A 3RY6C 1HI6A 2XIDA 2A6KB 5FHBH 3U9UB 5B7EA 1RERA 2AQ3A 2E47A 2GAZA 4PJBA 4XPFH 3TIDB 4J4QA 4JX0A 1JGIA 4UIMB 1JXDA 5KVDE 3MRQB 3EYOB 5FECA 3BT2L 4KXBA 3TWCL 1ZY9A 1Y7VA 2L7UA 5LBSA 4OKVA 3QIBD 3RVXC 4MASA 3FCUB 4ELDA 1HE8A 1KXVC 1N8OE 1NFAA 4J12A 1DTUA 1UVQB 2E9BA 2PKDA 6FABL 4F9PA 1KNOB 4LCWE 4L1TA 3GJFK 2CHDA 3FRUB 3WYRA 4NAQA 1QWUA 3GIZL 2VMJA 2VWEE 3LH9A 4PIBA 3X3FH 3U83A 4AK1A 3MLXH 4PJFE 2Y23A 1Y07A 1GGIH 2HN7A 2OMWB 3IDMB 3N43F 1ZRUA 3IMWA 2B0SL 4LPTA 1KGUA 4RMRA 2WO4A 5AOLA 4ZMYA 4Z7WA 1RJZA 3HG2A 2EE3A 3ZTEA 3EFFB 3EH1A 5IF0A 3VX1A 1KY7A 3FTGA 1EIBA 3V5DB 3DHUA 3SDDA 4LB8A 4PRHE 1SDYA 2NUTB 2XQBH 1CYWA 2VDKB 4AK2A 1ORQB 3LSOB 3IB4A 5H8DA 3RGVB 3ZKMC 4AQAB 4PJEB 1FVDB 4JZOA 2BSEA 1BQHG 1OTUC 3IMSA 4L9DA 4DEPB 4BUHA 2MTAA 2XBZA 5IVXB 2YEZA 2VE6A 4OW6A 1JZHA 3PJNA 3TZVA 5BMFH 5GJTL 4ABWA 4XNUL 2DQIL 2CUMA 2F1BA 3QCUL 2F68X 2G3MA 2MQ3A 1L9HA 4FQ2H 4JFWA 3AB0C 4HXBL 4X8XA 3IS0X 4BRVA 3GYRA 3NACH 2XWTA 1GL4B 3E9TA 4KKQA 4N1CA 5D1XA 1U8HA 3B2MA 2E6PA 1QEWB 4BV1A 4XMTA 1A4JA 3MOBL 5HHOD 3T65B 4PQXA 1F6AA 4TUOA 5E2VH 2H3XC 2J72A 4ALAL 4D8OA 1E6OL 2DM2A 2KS0A 3W9EA 3BUBA 4KMTH 3RPKA 3SCMB 4L9LA 4GFTB 5GGSY 3CG8A 3IJSB 1BIHA 5IQ7L 4BZ1H 2OTPA 1A6UH 2NX5E 4G6MH 5IB2B 3LVTA 5B8CB 4HT1H 3ULUE 3N0AA 5L0QB 4CSTA 2CDFA 5T3ZD 5C0BB 4OT1L 2VB5A 2BNRD 3E1F1 2WWKO 3S34L 4OZGB 2A74C 2Z55A 1C5DA 3IFLH 1A5FL 1RZJC 1BEYH 1FL3B 1D5RA 4ANXA 1LO0H 1VGEH 4L4TD 1BBJA 5I82A 4UOQA 2RD0A 4P4KB 4UTCA 2I32A 3L5WA 2EEDA 2WQAA 4JFZL 2X1PA 3VI3E 2V3FA 3DO7A 3LZLA 4YDKL 1IVLA 3CFMA 3MLUL 1E65A 1PW3A 1XSOA 3MV7A 3QS3A 5T5FL 2JQAA 2WINB 1L9RA 3BISA 2R8SH 12E8L 1M7IB 5AVQB 3AREC 1U2CA 2OJZH 1OT2A 1P69B 2KLTA 5I1DA 2FX7L 5EBWA 3GWJA 5DZAA 1J18A 5C0AB 2CM5A 3NEEA 4POZC 3SYCA 4BFEA 2ADYA 2EYSA 3BSHA 5C6PB 4LSRH 3O2DL 1IBFA 2PPAA 1HL5A 3P0VH 3EGXA 4Y16D 4BZ2H 2XTSA 3DX4A 4GH7B 4ZFOA 5FO8B 1J7VR 1NAMH 1JGUH 4N0UB 1VEPA 2G87A 4HWBL 2NSQA 2VLRA 3PWNA 3FU9A 3V5HB 1U8MA 1IEBB 4OFIA 5AVSB 1TZHA 4KXZH 2WWMD 3QUGA 4KNTA 1DN0B 2G9HA 5AOIA 5D5ME 3V8CA 4OF6A 1XO8A 4TSAH 3VDCA 1HILB 4TOYL 1JTPA 1NCAL 3A3YB 1PGRB 2J57A 1R3JB 2GK0B 3KG5A 3OTTA 5ICXA 3VFNB 2NY5H 4H40A 2A9MH 3Q13A 2DBLH 3QPKA 4HUCA 3REWB 4M43L 2W0PA 5CEYB 4G11A 5EUOF 1QFOA 2IFFH 1WA1X 4JHBA 2EYTA 2H1PH 2IOIA 4JFXA 3UG4A 1QSEB 3PWUB 4EIUA 4YDNA 1HOCA 1IILE 4ZOEA 2Z3FA 4JRXB 2HG5A 4PJXA 1BA9A 4N20A 3IAGC 1KYDA 2E8YA 2DQGL 3FFCA 4HUUA 5JIMA 5IHUL 3QULB 2HRHA 1NCJA 4JPWL 4AGPA 4QIDA 4EOWH 4W6YB 2YSSB 4GIAA 4JK0D 4LLVA 3QIWD 3VXSB 1R1CA 3KLHD 1PNCA 3LJ3A 3MCYA 4P06A 3Q2NA 3UTQB 1IE4A 4H0HB 2PO6B 2K8QA 4QHMB 3Q1SL 4F7KA 4HG4K 2DQFB 1Q9KA 1M1XA 4XCCH 4WCYL 3HI5H 1MVYA 3CFJB 4PU2A 4ODUA 2DTSA 1O6SB 4Z7VE 5IG7A 5KYNA 3MMEA 3QO1B 3PL6D 4WWKD 1UWGL 4N28A 1AE6H 1NPUA 2R2EB 3T45A 3PABB 3RUGB 4YHNA 3M1BB 4K8RL 4LKCA 2ZOTA 4Y5VA 2HKHL 4N26A 3GXFA 4ZK8A 1J5DA 2AJSL 2R9HD 1YZZA 4NO0B 1FYTB 3CFTA 4PJDA 2PPDA 3AXLB 5ETUA 5J6HB 1GC1H 5E6ID 1E5BA 3I6KB 1RIHH 1WFUA 5CLZA 4N6HA 1S7UB 4NHCH 4IRZA 4DZBB 4J2XA 1Z6JT 4HWZA 3AACA 5H37A 2QADB 2D4DA 2MRYA 4Z3IA 4NUPA 4Y19B 3P30H 4PGEA 3EUDA 1HI6B 1JV7A 2K6WA 5I24A 1JZFA 4QXGL 5C9JA 2GAZB 4PJBB 4DVBA 3H42H 1V7MH 3SGJC 1AR1B 2SODB 1M3JA 4NCC1 5K39A 4OKVB 4X6CE 1YEJH 1U30A 2WBWB 2ARWA 2XSKA 4PJ7E 2G0LA 1KYOK 2JKLA 1SVBA 4K94L 4ZXBC 4M6AA 3WS3A 3W39A 3INUL 4XNYL 2KZKA 1T22B 1DBAL 2HVJA 1A6ZA 2Y0SA 5AVUB 3GI9L 4K23H 3D09A 3QZWA 4FLHA 3CBJB 4FHKA 5HSFA 3OJ2C 3F58L 1IFHH 1MHPL 1MF2H 4Z18A 3BKML 3OKKA 2WLZA 2DWEA 4YHPA 5F93C 1ZJBA 3QAZB 4WI9A 3K0YA 3SHSA 3Q8AA 1NFDE 9CGTA 4A2LA 4BINA 2Q5BA 2FQDA 2HN7B 1WFJA 5ALCL 2W60A 4D0CA 1AO7A 5C7XL 1EMTL 2AANA 2K0RA 3KCWA 3MQIA 4PJEF 3FONA 3CIQA 5TDOA 4XN7A 4Z7WB 1RJZB 5IVXF 1HKFA 3HS0A 2FBRA 5I8KL 1TTCA 3GINA 3GLDA 1QX1A 4M3HA 4R83A 5IF0B 4S1QH 3FTGB 3SDDB 1V3KA 1WIPA 4BFFA 1MG3C 2XWBA 3KE0A 4M93B 4KKCD 3PAUA 4XOCA 1D7DA 5CJQH 2WNWA 3U79A 5GRUH 5T3ZH 2BFGA 2E56A 1INDH 5I6OA 3B8YA 2YEZB 1IKFL 4B27A 4DP4X 1N10A 1BF5A 1CO1A 1RHFA 4YFEA 5I74B 1A22B 2XWTB 3SKUD 5D1XB 1U8HB 3AWGA 3BEWB 4LSTH 4BQCA 1A8ZA 2FQGA 5I0XA 2DIEA 1F6AB 3QIUA 4K2UH 4TUOB 1OAXH 4XAKD 5KBLA 3GO1L 3GPEA 3IGLA 1V55B 3DI2B 4L9LB 4U1KA 2YARA 2GKIA 4CKVX 3RPBA 3LV3A 1NGXA 4KX9A 4OB5H 3MXVH 3QJUB 5FYJD 5F1KC 1IGCL 2B7DT 1F86A 4AQZA 5JR1H 1OWRM 1C5DB 3PPSA 3O3EA 2OAAA 4R90H 1AFVL 1U8IA 2ITFA 2ZD0A 7CGTA 5H37G 1JF6A 4MQXD 1BBJB 3EDJA 2P47B 4YDZA 4MA7H 2IOMA 4E9LA 3L5WB 3H4HA 4ZNEE 2CK0L 3DO7B 1CI5A 3QEGH 2IAMD 4OF7A 3MV7B 3IDYC 4LHQB 5C08A 4F9LA 3S5LA 2X4TA 4E9YA 1N5YL 5GSVA 5IM7B 3GHEH 4JQVA 5EBWB 3L1GA 4PJ5A 4YBHA 2ATAA 5I5JA 5I1CL 2GIXA 1KXTA 1JZ5A 1EJFA 2EYSB 1CC3A 2WQRA 1CUOA 4N9OB 2D0GA 5F1IA 1KBGH 3EGXB 4FZEL 4ZFOB 2I69A 4H0GA 2IH9A 1ID5I 1DVFD 3NJMA 3QZWG 1MNNA 5ELIA 1G7JB 3PWNB 3DETD 3IMTA 3N3EA 4YOKA 1U8MB 1SDAB 1NBYA 1TZHB 4PRDA 3KJ4C 4AIXA 1X4XA 4XN8A 1XSIA 1A7PH 4FXLA 2G9HB 3LPGA 5A2CA 1UJ3A 5E7FA 5GGQL 4FFYA 3VGAA 3QPXH 4I0PD 4NHUA 2ZNWA 2VC2L 2VMDA 4X5XA 5E8DL 2N1KA 2A9NH 4MRCA 2Q7AA 3LKRA 4LP4A 1S5HA 1ACZA 3BPOC 1B9ZA 3TA4D 3JWOC 1NEPA 5ICXB 1JZ8A 4XMXA 4KROB 4UWQB 5ACZA 4MA1C 4S0TD 1TNMA 4H7VA 3S98A 4LKXA 1QUPA 3E0GA 4WW3A 4NUJA 3ARGA 1HXYA 2EYTB 4JFXB 3JWDC 3L3OC 3O0RH 4Y88A 3QDHA 1C5BH 1PG7W 1XR8A 2XXCB 2A0LC 4DPRA 2H47C 3NJNA 1ZGLM 4PJXB 5BOZG 4KX7A 1E2VA 1KB5H 4FQPA 1IIIA 2WYTA 1U8QA 1XGTA 4F91B 4LLVB 5HHOE 5KOMC 1IKNA 1J10A 1ORSA 2OSLA 4ODVL 4H2AA 5JW3L 1X5MA 1X5JA 3RUGF 3PQYA 2W9EL 4XC3H 1KEMH 1UOVA 4F80A 9PCYA 3FUKA 3L9YA 4FTVB 1Q9KB 1M1XB 2QPDB 4A39A 2H5UA 4WGWB 4XI5C 3TBTA 5I71C 1JERA 1J1OH 1A6VH 4ODUB 4XPAH 5IG7B 1HE7A 2IQ9L 3ILEA 3MMEB 1NGQL 5T3ZE 2BNRE 1FL5A 2XWZA 1BJ1H 2EDBA 5KUMA 3ECQA 3D34A 3EJRA 4YHNB 3VG9A 4LKCB 4Y5VB 2X7LA 2Z0UA 4IGBB 3CGTA 4L4TE 3SSGA 5DCCA 1AZCA 1FG9C 5L2JA 3SBWC 4WY7L 2YAEA 4OBSA 2B4CC 1OTTD 3N85H 4PJDB 5GJSH 3EBGA 1JZ2A 4Z3GA 1PY0A 2BIOA 3PXLA 2PXYC 3JUZA 5JOFA 3VI3A 3DX2A 5KTEH 3TV3H 4KZEL 2NY3B 4WJKB 5DURD 4DAJA 4ZFFA 4HWZB 5EZIH 3PUUA 3ZHKA 2AV1A 4K5PA 3IJ9A 4KFZC 3VXUA 4PJBF 4AMIA 3QORC 1QD0A 1UZ6E 2P8MA 4XVTH 4LRNH 1YMMD 3MRJA 3WNKA 5F1OB 3OHXC 3OX8A 1NOLA 1L9OA 4HHGA 5CGMA 5KS9E 4YXHH 1ACCA 2YLHA 4XGZB 3WLWD 4X5LA 4Y1AB 4DVBB 5JIPA 4JMXA 1UADC 1TZGL 4HKXA 1PBYA 1M6UA 1A1OA 3G5XA 1R75A 4ZBJA 4X7CC 5K39B 4RGOL 2J4WH 2OMBA 4GQPH 4I8DA 3ZZSA 1BM3L 3G5VA 4BBWA 1J05A 3IJHA 5I1HH 4EIYA 3GBLA 5E2UH 3W39B 3B9VA 1OGAA 2HVJB 1NGPL 2CO3A 3U0TB 3D69A 4LASL 3QZWB 2WAQA 2NR6D 3RGHA 4O5LH 3QDJD 2DJUA 3P9LA 4P23D 5BZXA 5LNEA 3ZE2F 4ZMWA 1HTYA 3H3PH 2CMRH 5KVDL 2K9FB 1F58L 4Y2NA 3WKML 2VXSL 3OKKB 2BOBA 3SQRA 4Z7WF 2DWEB 4YHPB 2H45A 3AY4C 4ZJ9A 4A7UA 3HVNA 2DEWX 4UMGA 4UQ9A 3KYKH 3NABH 1ZT1A 5J57B 3QXVA 5M95B 4IQHA 3SDAA 4ONGL 1ILUA 3RWIA 4MNHA 4B9PA 4D0CB 1Y6KR 1AO7B 4HIXL 2DN7A 4H8VA 1MZYA 2OMUA 2QMKA 3LS5L 4KKAD 3FONB 4HWLA 2Z64C 5I2IA 3GSRA 4R8WH 3HMXH 1TYJA 3D33A 4GBXD 3BYTA 1DQLH 4D9LH 2R2HA 1YAZA 2WXKA 4M1GH 2BS9A 1SDDA 4KTEL 4D7PA 4LCYA 1WFMA 2V6HA 2EXYD 1IGFH 1UKQA 3TJHC 3KDMA 4S1RH 5FYJH 3EGDA 3ELAT 3UGUA 1H8OA 2QELA 1ANUA 4DGYL 1ZLSL 2LQRA 3M1OA 4FQHA 4AGLA 2O6CA 3QE5A 2JV6A 3S36L 1D5IL 1T1WA 2CK2A 4KK9C 5HI5D 5LWYH 1DQML 2EABA 1ADQL 2XZQH 3T0DA 1I9IH 3QIUB 5BZZA 3RGVC 4HPYL 3U6XS 4F15B 2A4CA 1AP2A 2GJ6D 3GDBA 3MRBA 3C5SB 4IK6A 4OCSH 1L5GA 1EJOL 4L4VD 4DEPC 2V17H 3LRMA 4OD1H 1OB1A 4JFQB 3MRKA 4CADA 1EAPA 2X72A 2XWEA 3BFWA 3LV3B 1NGXB 4HIPA 4MCNA 1N3NA 4Y9EA 4L8CB 1UT1A 5EF0A 4HCIA 1JHLL 3TPUA 5AW6B 5IFJA 3MYJA 3RBSA 4K4KA 1I7RA 1I75A 2C9QA 3TEUA 3O3EB 4CL7A 5I28A 3B56A 1U8IB 1KTDA 1X4YA 4WSGA 4YIQA 4BZ1A 4I3RH 4NT6B 2OYKA 5L2KD 4MD1A 1TQTA 1BCIA 1XGRB 1RK7A 1UZGA 5TE7H 3ASOB 5D2LA 3SCMC 4ZUSA 5F7UA 1DJXA 1WBXA 3U6XA 1HNGA 2FCBA 3ULUL 1UWXK 1MFDL 1EHLL 5B8CC 4AKOA 1HAWA 3S5LB 5L0QC 2K7PA 1R5WB 4PTUA 4LDLA 3MXWH 2X1XR 5EU6D 5FCUL 1GTNA 4JPVH 5KG9A 4PJ5B 3CDGA 3SE4C 3VQLA 1QSFD 5EFIA 1JGEA 2AXJA 1KXTB 1TZOA 4UYQA 3MZGB 4KGLA 4QRYA 4P4KC 4NP4L 5F1IB 4U1GC 3WIFA 4MLSA 4HU2A 1FNGA 4XMLL 4FCHA 4RISH 4PCTA 1MCQA 3U6RA 3VMPA 5E0FA 2XXFA 3IN2A 3DURA 1OW0A 1IAOA 1XVSA 4DVRL 3OB0K 2BHZA 1JVOA 3L7FB 4LCWB 5JHLH 4JB9L 4ACPA 1I1AA 4HCRA 4PRDB 2W94A 1V5JA 2L6XA 2DAVA 2TRYA 2EO7A 3MLSH 3S36X 1UJ3B 3CVCA 1YLBB 1F42A 3VGAB 2HAZA 1G9HA 2DEXX 3FBQA 2AKRA 2H3KA 3LKRB 1S5HB 2VT4A 4Z3EA 2QHRL 1I1YA 4GPOA 1HDMA 4R97B 5DA4A 3KYOA 2AMUA 5INCA 5ACZB 5ADPL 4XPFL 2BW5A 4KJPD 4LKXB 1XCTA 3MZTA 3FT2A 3EYQD 5AAMA 1GRWA 4XB3A 4NUJB 3ARGB 1HXYB 4D0DA 2XOTA 1G6RA 2WM0A 2F93A 3WBDA 4RMBA 1S7QA 4D9QD 1XR8B 5IQNA 2PCYA 1XH3B 1U3HA 4S0SD 5H94A 1E3ZA 4YZFF 3VM5A 2OJEA 1N5AA 4CVUA 3FAXA 3ESUF 1RU9H 1ORSB 1JRHL 4QXTA 2OSLB 4XAKE 5DJ6B 4JO3H 1K6QH 2W65A 1DFXA 1U42A 4NBYB 1GYAA 3GGWA 2JCCE 2AT9A 3QDAA 3Q5TA 3X3FL 1WZKA 2A73A 3MLXL 5C0RH 4ALAC 4ZRGA 1GGIL 4QTFA 1SMDA 3VO0A 2OW6A 4PJDF 2EEBA 2E5EA 2NX5B 4I89A 5FYJE 1AGFA 1FL5B 4B50A 2A83B 1M1SA 1F50A 1EBAA 3VG9B 4GRLA 4JUSA 4J1UA 4V2BA 2X7LB 1RIVH 4BE5A 1TEFA 1QLEH 4Z77B 1ETZA 4IJ3B 4CMHB 5KYUB 1HC1A 2PO6C 1FGVH 4M7JH 2XQBL 5A2LH 1XXDC 3IETB 3HHSA 3MGAA 5JOFB 3PV6A 3VI3B 2KMWA 5CINH 1Z5YD 5CJXC 3TA3D 2RGSA 5BMFL 5SWSA 2AV1B 5C86A 5E70A 3RDTA 4FQ2L 2P48B 5EZJB 3UERA 4TN9A 3QIBA 1GYUA 2I7SA 3NACL 3MRJB 1G0XA 2NRDA 3IWVA 1D7BA 3OX8B 1S9VB 2XFXB 3NAAH 1Q0YH 5IKCA 5J6GA 3A47A 2Z1PA 5D4QA 4QO1A 2WZ5A 3V7MA 5E2VL 1U95A 4R5TA 5HVWA 5FAAA 2WXIA 2F5AH 1IEHA 2WMPB 3Q9QA 4KMTL 5I0VA 1KJ2H 4HKXB 4M4RA 2YO3A 1A1OB 3G5XB 4YFLI 5AYQA 2BMKB 4J8RA 4BZ1L 3RI5F 2YJQA 2OSWA 4YR6A 1A6UL 3R7QA 2QADC 4G6ML 1YPZA 1R24A 2ZOKA 4HT1L 1J05B 2GC4C 3IJHB 1QOKA 5DMYA 2F53D 4JKWA 2YRPA 3G3LA 1OGAB 3IFLL 3T2PA 3D69B 3EFDH 5F9OH 1BEYL 3SE6A 1LO0L 5D5MB 2FX9H 4TRPH 5J1AA 1Z0NA 2WLJA 1MELA 4JFYA 2ESVD 4JKKA 3HLAA 1AR1C 2H41A 2BOBB 3ZO0A 4XBGA 3KMDA 3QJRB 3K8MA 1SLXA 5B3JF 3G6AB 1OD7A 2AMGA 4PP1C 4QOKD 2CBMA 4Z95H 2VUOA 4B60A 3SDAB 4BK4A 3RWIB 2BRDA 4MNHB 3FQ4A 2RH1A 1P4UA 2B5IC 4C59B 3ARFB 2OMUB 2Y5EA 4XZ4A 4DP8X 5I2IB 4Z7NF 1DDHA 4DP6X 5T1LD 4F9PC 1LN6A 1NQBA 5IEHA 4LSRL 5C07D 3ATDA 3EF7A 3LRGA 3P0VL 4KDWA 3PQRA 3ATAA 5DS8B 4JMNA 4BZ2L 2R2HB 3VGGA 1EZSA 3BUPA 3LZFH 1SDDB 1IMHC 1NAML 2IGFH 5HI4D 1AI1L 1JGUL 1DEEA 1T6BX 3TFKC 3QAZC 5HPOA 3KLDA 3OJDA 5K9QI 3AQZA 1X5GA 2X4OA 3CSPA 2C9SA 3KDMB 2PR9A 2GIMA 2C9RA 4GUOA 3EGDB 5IMOA 1CXKA 1OP5H 3BKCH 4N0YH 4P2CG 1VEOA 3V6BR 2GHWB 4OJAA 3RNKA 3R4RA 4JCWA 4FQHB 4TSAL 4Z7VB 5LG6A 3IGAA 3LXAA 4Q56A 3BMVA 5SWZA 1HL4A 3SEPA 2Q20A 3SDDC 1G6RL 1PS3A 3FB8A 3KWVA 4JZNA 2NY5L 5HHMD 4KK6C 4MKMA 2A9ML 4KKBD 4M93C 2DBLL 1LP9A 1AP2B 3MRBB 5HGDA 1Z9OA 1L5GB 1U3ZA 3CWGA 4EA3A 2W80C 2FLMA 3B2XA 3HG3A 1VHPA 1OB1B 4KRLB 3TZVC 3CH8A 2IFFL 3MRKB 3MRPB 2H1PL 1EAPB 2VR6A 4CADB 1PJ9A 2AF2A 1N3NB 1JI1A 4TTGA 1ZHBB 1ZSDA 2BIPA 3ETBF 3KHOA 4UU9B 5I74C 3TPUB 5IFJB 3MYJB 4Y1SA 1CJYA 5D1XC 2NZ9D 4KBPA 2A99A 1B4JL 4WUKH 4YIQB 1CTMA 1YMME 3ZE2E 4N2KA 2X1OA 4EOWL 5KZCD 1GZHA 4EN2A 2OPCA 1PCXA 5CBEB 5H2LA 5D2LB 4L9LC 1U58A 4BIKA 1WBXB 5EIQA 5FX3A 3D3VD 3GSXA 4XCCL 3A67H 3HI5L 5B4MC 4G8GA 4PTUB 3OLDA 5KG9B 4GXUN 5DJDA 5AG8A 1FNHA 4LOFA 5EFIB 5T1KA 1J8KA 2LLGA 1JGEB 1AE6L 3QZPA 2YPLA 1KCLA 4FF9A 2VMFA 4RZKA 5D7LA 3WIFB 3QDJE 3GSNA 4K94C 3U6RB 3TU6A 2VO5A 3PGCA 3H6JA 3DURB 2EIZA 2VDQH 4Z7OF 1PXRA 4TXVB 5HHNA 4HC1H 4OF0A 5IVZA 3N50A 1GC1L 2LTQB 1QI3A 1RIHL 1HWGB 2XTJC 1XL4A 3BQUD 4NHCL 5DU7A 2WY3B 4QEGA 3O3UN 1ZLVK 3GQFA 1G9MH 3OMAB 2Q8AL 1OE3A 5G4OA 2Y00A 4PJAE 3UJIL 1Q5IA 5C0CD 3O81A 3A22A 3S8WA 1U3YA 5FCSH 2AKRB 4U0RB 3KYNA 1RQ5A 4PG2A 2ZUUA 1I1YB 2WANA 1HDMB 1WUZA 1AACA 2PCPA 3KYOB 1A7QL 4JDZA 5INCB 3E8UH 3S8GB 3H42L 1V7ML 4NOBA 1YHPA 2V2XA 4D0DB 1CVRA 3S4SA 1G6RB 2BSRB 1EHNA 1YEJL 1EK3A 4LBEA 5E8EA 3O3BB 4PHXA 4N85A 1MLBA 3UEQA 1U3HB 4JHAH 1W91A 2YA1A 4IRJD 3B9EA 5H94B 4M02A 4Q6YA 4K23L 4LFHG 5B38G 1KFAH 1LJMA 2XN1A 4WEUD 3D2UD 2GYSA 2BVOA 5FGBA 2OJEB 1N5AB 2VDPH 4KROC 1RULH 2C5DC 1IFHL 3AXHA 4QXTB 4ZOCA 4DKDC 1IUZA 1MF2L 3P2DA 4ZS6D 1VFOA 4BKLA 3MV9D 2XN9D 5CZVH 4CRPA 2XACC 2GJ6E 2W65B 4F8PA 5EORH 1JNHA 3V0DA 2QV4A 3TOPA 4L4VE 3GGWB 2ITDA 1W8EA 3H85A 1G7MA 2NY6D 4EF3A 3ZDZE 3BUIA 2Y2WA 2NUPA 3HFFA 1KCKA 1C5CH 2XT1B 3QQ4A 4QRQA 3CH1A 1KN2H 1AGFB 2B15A 1I1CA 2YGOA 4H26A 3BGAA 2H3NA 5GS3A 1YC8A 4RFOH 4GRLB 1AZRA 2MOGA 4J1UB 5L2KE 5K9OB 1ETZB 3DARA 3VMOA 4S1QL 3TS8A 4DGVH 1R3KA 1OQOA 3VWJD 3P54A 1XJIA 3HHSB 3FZUC 2Z65C 3PV6B 3I9IA 1B6UA 5CJQL 5I73B 5IHWA 5T3ZL 3F7LA 1INDL 3C5JA 5BUGA 2X09A 1BD2A 1N6VA 1X0K1 5IQLA 5SWSB 4KAQH 5EU6E 3WY1A 4ZMVA 4KQ4H 3HNVH 4N2NA 4IDLA 1QSFE 4GRWB 3QIBB 4HH9A 2L3BA 4WWPA 3NG5A 4Y5VC 4P07A 4IGBC 1PDKB 1MRFH 3HN5A 3ENEA 1OP5K 5J6GB 3IJEA 4LSTL 5CHNA 4RAHA 3V9EA 4GXUM 4QO1B 4XXWA 4K2UL 1OAXL 1ITCA 1RZQA 1U95B 2HP4A 2HTLD 4Z5RA 2YXMA 4FFTA 3Q8EA 5C97A 2NY3C 2P9RA 3QH3A 4G42B 4J8RB 3U1SH 1C3WA 3QPQC 2CLVA 3BVXA 1J8RA 2DIBA 3GB7A 3LIUA 4QHNA 4YLQT 5EOCJ 2MJWA 3UADA 3B8SA 4OB5L 3T0EA 2ZOKB 5DRWA 4LPYA 4ODXA 4FRWA 4AV4A 3KLKA 4FTDA 4FFVD 1DQTA 1MLCA 4PBXA 5JR1L 4R90L 5C0IB 2EIKB 5J1AB 3HR6A 2WXFA 4MA7L 4JFYB 4XTLA 3HLAB 2I35A 3D39A 1MVUA 4L8DB 2DEYX 4KO9A 1FNAA 1JD9A 4FNQA 3KVQA 4XBGB 3QEGL 3U9PH 1Y6NR 4OM0H 4YEFA 4XCNB 4R0LA 1QAWA 4FYRA 3EZ8A 2D3NA 3MHZA 1TT6A 2NY0D 4D9QE 3GHEL 4O02A 1WAEA 2BWIA 1DDHB 4ZX4A 4I88A 5IEHB 3BP4A 1A7RH 4DKAA 1DLHA 3F7YA 3IMVA 2CWRA 5FLUA 1DEEB 4E9RA 1BJMA 4MHHG 3V2WA 1DBMH 5I6NA 3MNVA 5I66A 3O0LA 1CD8A 5CN3A 3D4SA 3NSDA 4B9ZA 5IMOB 3VVWA 4ZDHB 5D7IA 2CHWA 4W9HC 2CBQA 4OLVL 1FPTH 1QUNA 3WJMA 3RNKB 3HHMA 2HRGA 1A9BA 3NH7L 3CPLA 3POHA 3QPXL 4AYEC 2A9NL 3B9KA 3IGAB 5SWZB 1TZAA 1EHXA 5MI0B 1NLBH 4JZNB 5J9PA 2PYFA 3HRZA 5DO8A 4R4BA 1BGXH 2J55A 1LP9B 4JKLA 1WFNA 5FO9A 1A2YA 4KJWC 4XPTH 4D2NA 1SJXA 2HJFA 5H2JA 1BYOA 1DE4B 2ZTBA 3B6SB 3O0RL 1C5BL 4HFUH 1ONQA 5D2LF 5DTFA 5EN0A 5BW7A 3PP3H 2OA9A 5JZ7C 3X3CA 1ZSDB 5EOTB 2HTKD 5DJYA 2Y1AA 5TDPB 5IROD 5I6LA 2NY2B 4OLWH 5FO2A 5C0FA 1IBGH 1KB5L 5C0EB 4J3OD 3IWUA 3QIUC 5E23A 4F15C 4AYBA 1MFNA 4IOIB 1U58B 5FOBB 5EEXA 1SYSA 3M07A 4P5SA 4ORZC 1KEML 4UNVA 3Q2LA 1MAKA 4PWIA 1TO5A 3GSXB 2UYLA 3KGRA 5F21B 3B83A 2JKXA 4G8GB 3EOBA 1J1OL 1M9WA 1A6VL 2X1WL 4XPAL 2LLLA 4ZMPA 5KN5A 3VJ6A 2PEDA 5DJDB 3SKOB 2F53E 4J3UA 5T1KB 2YPLB 4HCFA 5HHPA 2X2YA 3AJ7A 2DY2A 3X2QB 2YJLA 1P8HA 2DMKA 5D7LB 2WQWA 3QUYD 2WAHA 3PGCB 5F3HA 3K6OA 2HX7A 4J2QA 2ESVE 1K4CA 2EIZB 3N85L 5ICZB 5GJSL 1ACYH 5HHNB 4OGZA 5IVZB 4L1DA 4NZUH 4OQTH 1CLYH 2WQXA 4F9LC 4RDQG 2HPYA 5KTEL 3TV3L 4NIKB 4AMXA 1JXFA 1ZHNA 1CB4A 2DDQH 2ZWLT 4JQVC 4QOKE 1KIQB 3RY4A 5BJTA 3W2DH 5B22A 5HGAA 2XFGB 5DEFA 2VQUA 4XVTL 4LRNL 3GSVA 2ENYA 2VXQH 3KYNB 5CSZA 3EG9B 3KPRD 5C07E 5LGJA 2VQ1B 4YXHL 3ARPA 3TN0A 2BZ7A 2PCPB 4JDZB 3VDAA 5A3ID 2Z6FA 4FERA 4E9WA 3QIWB 2BIIA 5GRJH 1I9EA 2V2XB 5J7AA 1CDGA 2VDLB 3S4SB 3OKEB 2J4WL 5I1AA 1UJ3C 4LBEB 3IDGB 3W11C 4X6DE 5E8EB 2VM9A 3VGAC 5I1HL 1PZUB 2L0DA 1MLBB 3SYAA 4MNQD 3PDDA 3T6XA 3VD0A 3GXNA 4PH8A 3FH7A 1RURH 3GF8A 3KGSA 1G4MA 4O5LL 2YD0A 2N59A 3PL6B 1A7NH 2BVOB 4R97C 5GGVY 3H3PL 2CMRL 4ZW7A 3U1QA 3ODUA 1UXLA 1MI5A 5HHME 5FGCE 4RESB 4BKLB 3KW8A 4FYTA 1JNHB 3ARGC 4GNKB 1ETJA 4PJHF 2ITDB 2VUKA 4IHBA 3KYKL 1G7MB 1TQSA 3C12A 2JIXA 3NABL 3NSCA 5CXPA 4OV0A 3VXRA 1DBBH 2CBOA 4EZLA 1GS7A 2FUQA 4XRCA 1GOFA 1GYCA 3T0AA 4QRQB 3QQ4B 3QS2A 3CH1B 5FYKU 3VFWA 4N2BA 2JMRA 3AG1B 4H26B 5EH1A 4IKJA 4R8WL 3BW9A 3HMXL 5L4FA 3MJ8A 3V95A 3FU3A 1IKNC 1DQLL 4D9LL 4WK2B 5EBMA 4M1GL 3EXJA 1PKQA 1R3KB 2R4SA 1W9XA 3OLGA 4GRWF 4PB9H 1PFOA 3AT9A 4AIOA 1Z9SB 5LGYA 1IGFL 4P9MH 3D3VE 1QBAA 4AI7A 4GKNA 4IRSD 3UTYA 4S1RL 5FYJL 3UTZA 1FBIH 2BVEA 2FJFB 3E38A 1TJHH 2MFNA 5KJ4A 5CD5C 4UTBA 4DGWC 1VDGA 3CQFA 3ULUC 4ABVA 1BLNB 4HH9B 3VG9C 5E5UB 1JNLH 2MNWA 3MRMA 1O0AA 4L4JA 3VSQA 1KIPA 3B5TA 4IJ3C 3IJEB 4QRPA 2QKSA 5CHNB 4CMHC 1YPZF 3FSZA 2WWOA 4E9SA 1I9IL 5GGVH 3UG5A 2ZOOA 3IKCA 4Z5RB 2IANA 3BZEA 4OCSL 3N55A 5CJ5A 2C7FA 2D7TH 3TWYA 1TVBA 2V17L 4GG8A 3P3SA 4OD1L 3QH3B 2YSTA 2CLVB 3GB7B 4N86A 4QHNB 2V33A 1QRNA 3MJ9H 3T0EB 1EXUA 5DRWB 4O2FB 4MMYB 5DUPH 5C0CE 1MLCB 1A21A 2VIRA 5DC4B 1FP5A 4I3RL 3NYAA 4YAQB 2C3VA 4PJAA 4ENED 2H8PA 2F1EA 2JNZA 5DYSA 1L0YA 3EJPA 3LYRA 3MUHL 4HEME 4KK8C 5TE7L 2XU9A 3OMNB 1MVUB 4GRVA 4GBXA 4FG6C 1P6FA 4M00A 4XBEH 3O3AB 2H32A 4BXSV 4BHUI 4PAZA 5AL0A 4R0LB 1PF3A 4V1DA 3KPLA 2YUXA 3MXWL 2IXQA 3SGKA 4QRRD 3TH3T 1MUJB 4O02B 4JPVL 1AQKH 2GITA 2VUYA 4U1LA 4IBWA 2WKLA 3VXOA 3ZYJA 3KM2A 4ZO7A 3NCBB 2EE9A 2HFEA 3BP4B 2Y3NA 1RZKC 2IPUG 4FBZA 1DLHB 3EAKA 1IW9A 4RISL 4NRYA 4E41D 3F7YB 4YDLB 4TULH 3OKDB 4PW9A 3AYMA 4YHLH 1XZ0A 5SV3A 3MV9E 2XN9E 1QNIA 3I6LD 5JHLL 4WI8A 2GK2A 4XODA 3R0MA 5I66B 3PE9A 3P3UA 3SDAC 4HPHA 1MQKH 2BSSA 5D7IB 2FDBP 3C09C 4XC1L 3VSUA 1LP9F 2ZSWA 3MLSL 3P3YA 4FLRA 1V10A 1A66A 1J1XH 1A6PA 1QUNB 4FJZA 3WJMB 3HJ0A 4J3OH 4JY6A 3VWKD 1A9BB 4QHPA 3ZRCC 3CPLB 1XFPA 3WHXA 4KUCD 3FQWA 4PGBA 2AITA 2YWYA 1AZVA 3B9KB 3F04A 3QZNA 3CVHA 1I9JL 4KJQD 4QTIH 4EJ1C 4ES9A 3O6KH 1JTTA 3N9GH 5J9PB 2PYFB 3HRZB 1ILSA 4R4BB 3WIHH 5FO9B 2CKNA 1A2YB 5J3HD 3UZCA 2IFGA 2V5MA 4WO4A 1JYXA 3G6JA 2YEQA 4J4PA 3ZDWA 4DF9A 3P4LA 1ONQB 3HMWH 4LSDA 2R0KH 4OR1A 5DTFB 3SZ6A 4NUMA 2NTWA 4HIHA 3RZCA 1X7QB 2YD5A 5BV7H 5C0FB 1EVUA 2Q3ZA 2UWEE 5L8LB 4XPBH 3RKDD 4ENZA 1HHIA 5E1GA 1RU9L 1JPFA 4JO3L 3V7AE 2YA0A 1K6QL 3D9AH 3GRWH 1IQDA 1DBKH 3X1EA 3V6OE 2Q3AA 5F7KC 2UYLB 1DVFB 3ZQ9A 4HUNB 4JPSA 3MRFA 2UY7B 5DFWH 2DWTA 1OP9A 2VLKA 1N19A 3L3DA 4CGTA 2P5WA 4APXA 5KN5B 3VJ6B 2GPZA 5CS7A 4C55A 3K3QA 5I0ZA 3ARBA 5E8NA 2XN0A 3MDJA 1G94A 3NIFF 1RIVL 2JJWA 3QJZA 1QLEL 4I0PB 5FKAB 3TO2A 4BFOA 1JDAA 1LGVA 3X13A 3VI4E 5AX1A 4D8PA 1VGKA 1K4CB 4M7JL 1FGVL 3RWCA 4BDVA 1J9SA 7PAZA 1GOGA 2P49B 1FJ1B 3A7KA 3K4ZA 5GGRY 3AC0A 4R84A 4L8BA 3UTVA 1ZVHA 5CP3H 3ZXAC 5MENA 4J28A 3VGDA 1ZHNB 5CINL 3RB7A 2BX5A 3WHE0 1PPIA 5BJTB 5HGAB 5F96H 3BLPX 2YAOA 4DP9X 5DEFB 1UA3A 3X17A 3DRQB 3GSVB 3BWAB 3LB6D 4GKLA 2CQVA 3JYCA 4DGIH 3MA7A 3PNRB 3PWPA 3OMIB 4KJYA 5CSZB 3NAAL 5GRYA 1SYVA 1NJ9A 5LGJB 2EVFA 4GW5A 4H20H 1OW0C 3CFUA 2KPNA 1A64A 4ZUWB 1OGSA 3TN0B 5EU7E 3V4PH 4JEGB 4WJ5A 2DMGA 4NZDA 2F5AL 3HOGA 2LTQC 5DQDH 1U8LB 2VISA 1KJ2L 4WENB 3ZZQA 2CR6A 1N26A 2NY7H 5C2BH 1H68A 2EXWC 1XGUA 3S3JA 5I1AB 1WV7T 2OTUB 3IU3A 3GSWA 4WAFA 2ADJA 2JELL 5DO2C 3PG2A 4HJJH 4U0RC 2WIMA 3WJLA 5CLTA 3EFDL 4H8WH 2VLJD 1AYRA 4TSCH 1JE6A 4AEEA 4TRPL 1BMWA 1MCNA 4LESA 1TEGA 2IG2H 4XVSH 2P28B 1MI5B 4Y4KD 2GB2A 4XO9A 3I6SA 5AAMC 4IBZA 4LSPH 8FABA 1HZHH 4XP1H 5DHDA 2AXWA 2ZAHA 1E8ZA 3PXOA 1XF3A 2JIXB 5KYWA 1BG9A 1M53A 4Z95L 1YEHH 3VXRB 1UCQA 2DI9A 4W9JC 3M1CA 5LKNA 3UJTH 1U3HC 3F84A 2PN5A 5GS0D 5DURB 3VFWB 4KKPA 4G8AC 1UGKA 3B2DC 3ZKQD 1K5WA 3MJ8B 2YMOA 1FFOA 4PBWD 5CP7A 4NQTA 1NSNH 5EBMB 5JORA 2ZE0A 3HN3A 3LZFL 3APDA 1TETL 1PKQB 2IGFL 3L4UA 1B4TA 1JPST 2WXLA 1TENA 4ACTA 3C08H 1ZE3H 4GKNB 1F4AA 3EJZD 3LN9A 1JNJA 1SLUA 4OZHA 3BKCL 1XV8A 3D6GA 1CN4A 2VZOA 5CJOH 4F33A 4ZMLA 1IC7H 1UURA 4GRLC 4HBQA 4YGVB 3MRMB 1Y1DA 4GSDL 1F6FB 1KIPB 3WENA 5F0PB 3FTYA 1KBWA 4ZQKA 4MYPA 4L1SA 3MGTA 4GINA 2FYYA 3OZLA 3B3IA 4TLUA 4CVWA 3C5ZD 2E9JA 2IANB 3BZEB 4BM7A 5I73C 4C4KT 4GXVH 1TVBB 4GG8B 3FSVA 3I75A 4RDQF 4PJ9A 1QRNB 4GW4A 3RDTC 2DLHA 4HJGA 4U1JA 3CFCH 3QIBC 1IE5A 1XCQA 1E8YA 1KJ2B 1T5WA 1G9NH 2W59A 4HUWB 4WUKL 2VIRB 3AXIA 4YVUA 2WJ7A 3A21A 3GT6A 4BCYA 2UX7A 2V9UA 4PJAB 3KPRE 3UCRA 1JFPA 3FT0A 1GH7A 1PQZA 5AB1A 2CRZA 5T1LA 4DOHE 3H7BA 4GBXB 3MR9A 4PJHE 3I50H 2H32B 3FN0H 4YLCA 3QI9D 3ATFA 2CCLA 1D9KA 3A67L 3MLTA 4V1DB 2AGJH 2IXQB 3BWUF 1TSRA 2GITB 4A2DA 5JO5A 3LZPA 2QV2A 3ATEA 3T2QA 2EIEA 4MNQE 2XDHA 3K72A 2Y1VA 3GMPA 4V11A 5CMAA 3CQQA 2HFEB 4TVPD 5B2NA 1T0OA 4Q6IA 4NRYB 3TBVA 3CZGA 3GLAA 5I17A 2VXVH 1XZ0B 1NEZA 2VDQL 4FOMA 3C87A 3KBEA 4HC1L 5L6YL 1JS4A 2Y7SA 1IZKA 1LDPH 3MPCA 5AVWB 3S35L 3GD1C 2BSSB 2RR3A 5CBEA 2ZSWB 3D07A 1S6NA 2PTTA 4G6AD 5IT2H 2BOLA 3FCBA 5EEVA 4JY6B 4X8JA 2ZKHL 2AXGA 2XYCA 2OSXA 4PGBB 2WBXA 4MXWH 4BUGA 4HMEA 1HZXA 1F00I 5BO1L 2XWRA 3DJSA 3NP3A 1ZLWH 1PEWA 4B53A 5J7CC 5KSAA 3FTUA 3E8UL 3A4DA 3FT3B 4LHUA 2ZXAA 5DUML 2FATH 3QCVH 5I15H 3UAEA 4WO4B 4FZ8H 3NIDE 3FFOA 3V0JA 4JM4H 2Y9RT 3K80A 2NZ1A 2OR9H 1WWCA 2KPWA 3PJSA 4FNLH 1SXBA 4JFFA 1TJIH 4LXFA 2L7EA 1HHHA 3DYOA 4UG2A 3VGEA 3SJVD 4K15A 1PD0A 4HIHB 4R2GD 2VQTA 4JHAL 1WAPA 4JO1H 1NC2A 1E50A 1IM3D 2OFQA 2YD4A 3H9SD 1KFAL 3POCA 5MI0C 5H2OA 2VDPL 1NPNA 2Z4QA 4QHUA 4R26H 1RULL 1HHIB 3CFBB 2ARJA 2UV3A 2Y2YA 1U0QA 5IHLB 1JPFB 4B96A 4PXKA 2W91A 1BFTA 3QQ3A 5EORL 1IQDB 4TQIA 2ZUVA 3KPTA 1FFNB 4OGYH 3IM1A 1HCFX 3DHJA 1P2CA 5T1MA 1OCOB 1HEZA 2VLKB 3L3DB 4GAAA 2KQNA 3T1WA 4APXB 1C5CL 1EDYA 1QLFA 4DO4A 1KENH 1L9MA 4HUMB 3ZTCC 2NY2C 1KN2L 4BSJA 4ELME 5E2TH 2VZUA 3ARBB 4WHDA 1WG3A 2VYRE 5E8NB 1MPAL 2HJLA 4RFOL 3ALWA 4WGVB 3TO2B 2VZSA 1XIWA 4RA3A 1CQYA 1SEBA 1T1YA 3ULSA 4D8PB 5JOEA 4DGVL 3US1A 5CUSH 1LHZA 3QEUA 3II2A 3RWCB 4BDVB 3S35X 5J5EA 1IT9H 3LKNA 3RVWC 1DJHA 4YXKH 4L8BB 3MA9H 4UQCA 1UGNA 5JDJA 5MENB 1A1MA 3OXSB 2V3DA 3P11H 5F7EH 4UTAA 1KTRL 4KAQL 3SQOH 4QRRE 1TZIB 2V9RA 2VDQB 2WWMC 4KQ4L 3HNVL 4YC2B 1UHVA 2DQDL 4JQIH 3MA7B 1MRFL 2UVEA 3PWPB 4KJYB 3UDWA 1SYVB 1NJ9B 3HB3D 4GW5B 4E41E 2NY1D 4XXCA 3GXUB 3H8NA 1SRDA 3A4EA 1FC1A 2YKLH 3ZDYF 5IEKA 4WJ5B 3WEMA 3ZR6A 4ZX6A 4I77H 2F7OA 2GSIB 2VISB 3I6LE 4G43A 4U05A 4Y2DD 5HDBF 1IEAA 5DHYB 2ERJB 3P40A 2E59A 4BVNA 5KVFH 1WS8A 1NEZG 5GS0H 1XGUB 1CFBA 2P5PA 3E80A 4C4UA 1NL0H 3IU3B 3TONA 3GSWB 1RPQA 5DI8A 4E42A 4YDJA 5EOCH 3UIYA 4BA0A 4AMKH 4PG2C 4CNIA 2YLKA 5C0NC 2ATPA 4WEEA 4YNYA 4G5AA 5HYJA 4X0NA 4TNFA 3SBQA 2ZNXA 1S52A 3QARA 4HF5H 4NN7B 1YUKB 2YPKB 3QIWC 3U9PL 1MRCH 3QUMH 4OM0L 1JMZA 4C56D 4N6QA 4Q2ZA 4I0CC 1A4KA 4X98A 1XGZA 2PWGA 4X83A 4MJIA 3FO9A 1JV5A 1QHOA 5EIIG 5CD3B 1X5HA 5FGSA 4LSVH 3KHQA 5FGBC 3BKJH 1LM8V 3PL6C 3QFGA 1E3XA 2AHIA 1QI5A 4P3CH 5D7JA 5DZNA 1A7RL 1U4EA 5CP7B 1YC7A 2X6AA 2XZCH 3STBA 4KV5E 1DFBH 1FZOA 4AJVA 1S8LA 3WL9A 4MMXA 3EFOA 4ATWA 1DBML 1U92B 4LLQA 2OL3A 1RXLA 4JY4A 1FNSH 3RYMA 1HT6A 2ZAGA 3EO9L 4OZHB 3LPOA 4FDWA 1FC2D 1XXFC 1FPTL 1RD6A 5D1QD 4F33B 3NCMA 5MEOB 4OUOA 3HE7A 2R56H 2F53B 5TH2A 4ZQKB 4XNBA 5F6HJ 1C8QA 3NS0A 3KPNA 4P04A 5DHHA 1NLBL 3MGTB 1COBA 3A24A 2FYYB 5TQ0H 3B3IB 1BGXL 2ZCHH 1JZDC 3GK8H 3IGKA 3VRLE 4HAFA 3HUJA 4XPTL 1BIIA 4WI0A 3VI4A 2ESVB 5JHDA 1UFGA 4UV7H 5MP6H 1WWAX 2XC8A 3WNLA 3QUZD 3OE6A 1OPGH 4PJ9B 5B1KA 4HFUL 4GW4B 1ZLWK 4HJGB 4U1JB 2A77H 4GT7A 1I7UA 1JWSA 4TVPH 1E0OB 4HLEA 1BQ5A 1T5WB 1DO5A 4M9OA 4CVXA 1CCZA 4OLWL 4HALA 4WEMB 1IBGL 2OR8A 4EI0A 1CFQA 4AX3A 4GAGH 3VW7A 3O11A 3CXDH 4YSQA 1FWXA 1PQZB 1TTBA 1THCA 2BC4B 5T1LB 2CJSA 1SOSA 3MR9B 3DPBA 1WWWX 4DKEH 2IGLA 3KH4A 5C1MA 3MJ6A 2VT0A 3T0EC 5HDOA 2ADIA 1D9KB 3MLTB 1LD9B 2VR5A 4RX4D 5LN4A 1FN4A 4DCQA 4HQQH 3SN6N 5DZLA 3O4LD 2VR9A 5F70A 5JO5B 3OE0A 4RAVA 1CGYA 1M3IA 3VQ1C 5CCHE 4DP2X 3K72B 1LO4H 3EH4B 3GMPB 5CMAB 2VLJE 4I0KA 3NA9H 3DX1A 4MJ6B 5TK2A 4WHTA 3U0PA 3PU7A 3TBVB 1Z66A 5I17B 1NEZB 2B3IA 3FB6A 3FN3A 2PCFA 1KCRH 1ACYL 2GC7C 3RP1A 4IOSD 2D9CA 4NZUL 1RP9A 4R0LC 3QAKA 1QFWI 3OKYA 1CLYL 4OQTL 5HHMB 5FGCB 4BSVA 2DDQL 4KVPA 1V7NH 1XF4A 4WK4B 3W2DL 5KJRH 2PTTB 5KVFE 3NCJL 3FKUS 3BIBX 3SB3A 1DVSA 2YR3A 2EEXA 2AXGB 3V6ZA 5J12C 2VJXA 3UAFA 2VXQL 2YEVB 2XPYA 2J25A 3G6JF 1VACA 4YDLC 5C92A 4N24A 1OAJA 3TH2T 3ZU8A 3BWUC 4HZ1A 4ZI8A 5KSAB 1N0LA 1UEMA 1GCFA 5KZCB 5L4MA 3MBEA 4YX2H 4LHUB 5CR8A 4WW2A 1F1GA 1T7ZA 1UM5H 1IAMA 1UAZA 5GRJL 4KOBA 2TSAA 5E8OB 3APNA 1RP8A 2X40A 4XCYA 3PJSB 4JFFB 5CFHA 3D3VB 2ZF8A 3ZRSA 5EDXA 2BK8A 2RA1A 3US9A 4Y4FA 4PJIE 3B9KC 1OF0A 1RURL 1NC2B 3CSYB 4TQPA 3FFDA 2ZYRA 4A7TA 1A7NL 3HRZC 4Z3FA 3F8UB 2QFPA 1JV2B 4MQXC 4AZUA 4LVHB 5GRVK 1WT5C 4KNQA 1PVHA 4UDUA 3OKMA 3HC3H 5IQMA 4HK0A 3QQ3B 3LHAA 2DKMA 4HV8A 3NSFA 3LNDA 1S3RA 4IYKA 5BW7C 5T1MB 3VYOA 1SY6H 1HEZB 1DBBL 4JFEA 1BZ8A 4HUXA 3VXMA 3P9MA 1QLFB 4KVCH 4MDRA 1OP4A 4CU7A 2PPFA 3BQUB 2GHZA 4EZMA 1VAHA 4ZPVB 2PP7A 2QGBA 2HJLB 1BAGA 5F9WB 2OL3L 2HX8A 3UC0H 3BGFC 3FH8A 1XIWB 1S8JA 3VSTA 1SEBB 3SY0A 1T1YB 3AAZA 2DLTA 4FS0A 3ULSB 4AYFB 3T5WA 1BFVH 2J1WA 3QEUB 4PB9L 3TV8A 3UYRH 1D2PA 3WGVB 2A2QT 3VU2A 1JAEA 3CHXA 5AVVB 4P9ML 1DVFC 4NFBA 4X4YA 4WKXA 1A1MB 2EVHA 4LEXH 5DSCA 3DETC 1DVUA 1FBIL 2ID5A 1XT5A 4JM2A 1DQQB 1E8XA 1TJHL 3MNWA 4WSJA 4MYWB 1MRDL 1YY9C 2R29H 2ZYIA 2EDLA 2GABA 2F8OA 1Z7JA 1WZ1H 1JNLL 2HCZX 3MUUA 3V0VA 2WZPD 3KNBA 4TVPE 3UACA 2PCXA 5AAWA 2QDVA 1QFWM 4L6RA 3L81A 5GGVL 4KPHH 5IEKB 3AU1A 5EEYA 3MRDA 3RDJA 1DCLA 3Q1EA 3GSOA 2D7TL 3RWFA 2IVFC 2B2XH 1IEAB 1LE5B 4X99A 4XN4A 3BSGA 5CCGE 3MJ9L 2PF6A 2XVLA 3PV7A 3EJYD 1YNTA 4PPTA 5DI8B 4E42B 5DHVA 5DUPL 1WC7A 4UQ2A 4YDJB 5F7BA 1B0RB 2BVYA 1GIGH 4XMZA 5FA4A 3QISA 2EDKA 1W15A 3MACH 5HDRA 2ATPB 5FS5A 2AS5M 3TN0C 4YNYB 5HYJB 4X5RA 4S2SA 3AQDA 5IZ7A 3BAIA 5HHQB 1P1VA 3BI9X 1OE2A 2R51A 1T20A 4XBEL 3B3BA 3K74B 3WFCH 3ETSA 4F7EA 2EZ0C 2NMSA 1J12A 4KI1A 2MIZA 1T6VN 3FO9B 4LVNB 3GSQB 5HJDA 1AQKL 2JE8A 3AITA 3SJVE 1NFKA 5KSUA 3ULAB 2Q76A 3QGVA 5D7JB 3OE9A 2CSPA 3H9SE 2VW6A 3BO8A 4ORGA 2JKRM 4OZHF 3MLZH 5G36A 1GOHA 2RMNA 4TULL 2UWEB 4FLQA 3KJ6H 3AS3A 1FZOB 5HDLA 3WL9B 1J1PH 2IDTA 3EFOB 4LLQB 1SFHA 4YHIB 2OL3B 2FEJA 2Y5QA 5ISZD 4GJTB 4N1HB 1YEGH 4XNQB 1MQKL 3KZ8A 3WJJA 4NWTH 1L7TH 4ZW6A 1S2EA 3CAFA 1KB9J 1J1XL 1OLZA 3DDFA 5AKRA 3VCLA 3HE7B 4OF8A 4UM9D 3V5KA 5DJ0A 3WN6A 5TH2B 1N70A 4QTIL 1E3FA 3QDGA 3KPNB 2F58L 3OAYH 3O6KL 1GYWA 2XKNA 3N9GL 1NAKL 3DXAD 3IN0A 1JGDA 1A1NB 5TFSH 1MCRA 4ZO6A 3WIHL 3MN8A 2BDNH 4MZ3A 3WLWC 1VERA 5HDBE 2FO1A 1XTLA 3DOIA 3HUJB 3ZLQC 5E0QA 4WI0B