3S8JA

Crystal structure of a papaya latex serine protease inhibitor (ppi) at 2.6a resolution
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
182
structure length
182
Chain Sequence
APKPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDNGEPIIFSAIKNVKDNIVRESVDLNVKFNITINCNETTAWKVDRFPGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTNDAKEFVFIKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The plasticity of the beta-Trefoil fold constitutes an evolutionary platform for protease inhibition
pubmed doi rcsb
molecule keywords Latex serine proteinase inhibitor
molecule tags Hydrolase inhibitor
total genus 32
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3s8jA00
4QD2B 4I7IA 3CA1A 1ISVA 3VT2A 4KC3A 2NYYA 4JP0A 2ESUA 2D7RA 3QYDA 3O5WB 4KBBA 3HMYA 3OBTA 3IM7A 4Q9GA 1QQKA 3NBEA 1JLXA 3LLPA 2J3PA 1PC8B 2VXRA 3O4BA 1RY7A 3T8SA 1W3GA 4LO1C 3O49A 5BVPI 3P53A 4LO8B 4D0ZA 4P0KA 4EFQA 1IILA 1BFFA 4I4PA 2FFUA 3LTQA 1E0OA 1BFBA 4IQPA 3WA1A 2KI4A 2BEAA 1BLDA 1DIWA 1XG6A 2VUAA 4JKQA 5BQUC 3RSJA 1I1EA 3NBNA 1AVAC 3AKGA 4IYBA 4IY8A 1FQ9A 3WMVA 1TWMA 2FDBM 1CVSA 1UPSA 1BFCA 3NBCA 4I1BA 1WBAA 3RMXA 3OJMA 3FJKA 3AJ6A 1DFCA 4LO0C 1PWAA 3O4AA 3WO4A 4A7YA 4LO7C 2YUGA 3S8KA 3VEQA 3R4SA 1ILR1 1JLYA 4IHZA 3WINA 1G9AA 2DREA 2FO1A 4ISQA 3D7WB 1TFMB 2X2TA 2XOAA 2DRYA 4R6UB 3BA4A 1TP0A 3IAGC 3R4UA 3PHZA 1IOBA 4I96A 3WMUA 1K5VA 3BADA 4G9NA 5FZYA 1V6VA 1FMMS 5EC5A 2M49A 4LO7B 4ISRA 1DFQA 4AN7B 3AZVA 4GAFA 2GZBA 5DZUA 2DRZA 2X2SA 3VSZA 4EB2B 3ZC9A 4I4OA 4Q91A 1JY0A 2Y9WC 3UJ4A 4ZFUB 1RG8A 3N7KA 4GP0A 3Q7XA 3N7MA 4IZXA 2WRYA 4USPA 5DVHA 3V0BA 2HWAA 2F2FC 5F8WA 1EV2A 3AH4A 4LO3C 4X3AA 6I1BA 1AF9A 3PUBA 4GOVA 4OUJA 4YOLA 1AVUA 3FUOA 1IRPA 3BB2A 1CE7B 1DJSB 2F8XC 1XZZA 3ZC8A 3F1RA 3I29B 3BAVA 2RQ9A 3V0BB 1HWMB 3O4CA 3FGMA 1G9CA 3FJ8A 3JUTA 4X38A 1ISYA 1S0BA 3S8JA 1K5UA 4QALA 2KLLA 1IRAX 4PC4A 21BIA 4G1RA 3A07A 4XFUA 3ZX7A 3UDAA 2AAIB 3FJ9A 3H6SE 1D0HA 3HSMA 2D22A 2FFVA 3FJCA 5FNWA 3JRRA 3HOMA 2RG9B 3ZXGA 3RMYA 1F31A 5BXPA 4XFSA 4J2SA 1EPWA 4KEIA 4EFRA 2AQZA 2D43A 4KEJA 4LO1A 3CRHA 3OJVA 1SR4C 3FJFA 4I3NA 4JAWA 1FN0A 1T4QA 4P0LA 3HN1A 1TIEA 3KMVA 2IHOA 4J2YA 1NUNA 1R8NA 3VT0A 3CA0A 3I2XA 3CA5A 3CQAA 4DEPA 4I2SA 2NP0A 4J2KA 3UD7A 1FMZA 4IZEA 3P6IA 5EG6C 5D63A 1JT7A 3HBWA 5BP5C 5BQUA 3BRFA 4JPZA 1L2HA 1YBIA 1IT0A 1S0CA 3AKFA 3A22A 1PUMB 4I37A 4ZBVB 3H6QA 4L4HA 4I8MA 1G9BA 5F8YA 5E24E 3B9UA 3Q7YA 1BFGA 4Q9PA 5D61A 5BXTA 5I1BA 3BRDA 4FVVA 4I4XA 4LO0A 2NTDA 3W9TA 1PUUB 5BXRA 3PG0A 1S0FA 3N0KA 1IJTA 2QYIB 4LO2C 1JT5A 3RTIB 1ONKB 3AJ5A 1AVWB 1Z4SA 4I0YA 1Z0HA 2ERMA 3AZWA 4JKXB 1DZDA 2HWMA 3BAQA 3CA4A 3BTAA 4I4RA 3V79C 3E8LC 1TTUA 3UD8A 4G6JA 5DUYA 1ISWA 2IWTB 2L5XA 1I1BA 5JLVA 3O4OA 1WD3A 1BA7A 4QO3A 2ET2A 1HIBA 4I4QA 2HW9A 4HR6C 3TC2A 4GP3A 4J23B 1EYLA 4ZLBB 4DCKC 3Q7WA 1SZ6B 2Y9GA 3FUQA 2VU9A 2P39A 1Q1UA 2Q3NB 4IY9A 1DZCA 2F2FA 1FWUA 1NZKA 1R8OA 1W3FA 4LO3A 3UJ0A 2Z48A 2D20A 1Q04A 3K1XA 3WO2A 4H04A 4HA2A 3VUOA 1G9DA 4I4YA 3FJJA 1DQOA 2VXTI 1ISXA 2NZ9A 4P6AA 4D8HA 1JTCA 2GO2A 4A7KA 1HCDA 4OWKA 5B2HA 2BFHA 1G82A 2AFGA 1WD4A 2KI6B 8I1BA 1XYFA 5BXSA 2R9KB 1ISZA 2E4MC 3CU1B 4Z8SB 4KEKA 1DQGA 3FJAA 1AVXB 3BA5A 4ZA3B 1BLAA 3POKA 1WBCA 3ILAA 1VCLA 4QC4A 3HALA 4OEEA 3ZXDA 1HWOB 3PMEA 4I4UA 3BX1C 4CJMA 2Z49A 1SR4A 3MPPG 2VSEA 2BEBA 2FGFA 1V6WA 4ZFYB 1V6UA 4WBCA 3A21A 4HJJA 4GOYA 1JT4A 1Q03A 3CRGA 2UUSA 3BA7A 3IIRA 4II0A 4A7ZA 4QKSA 3P6JA 1OQLB 1TWEA 3BAHA 2RSTA 4J2XA 5BP5A 5JMCA 3UD9A 4I4VA 4OWJA 3OJ2A 2D23A 4I6IA 3O3QA 1T9FA 4ZFWB 1HWNB 2KH2A 4ZKTB 5EHAA 2MC2A 1HWPB 3RTJB 1YTOA 1Z2VA 3OGFA 4EEEB 3AKIA 3V0AA 3FJEA 4OEGA 2VLCA 2D1ZA 4P0JA 5HPZA 4OW4A 3N7JA 2HZ9A 3O4DA 1FWVA 1QXMA 2D44A 3F62B 1ABRB 1RMLA 3CA3A 4TLPA 2VSAA 4LO2A 5DSSB 1ITBA 3EF2A 3FJIA 4X39A 1W3AA 1II4A 1S0LA 2QN4A 1QQLA 4I1EA 3CAHA 1FGAA 4EFPA 5FZZA 3NBDA 2D7IA 3BAOA 3NJ5A 4F34A 4ZGRB 3AKHA 3V0AB 1AFCA 4AN6A 1AXMA 2P23A 5FNXA 1M16A 4QBVA 2KKIA 1RZOB 4G9MA 4L4IA 4DENA 4QKRA 1FV2A 4OEFA 4JRAA 3FJBA 3AH2A 3VT1A 3CRIA 1S0DA 3WINC 2NVHA 3IM5A 3FJHA 2MLLB 4EKXB 5F90A 1EVTA 4G6MA 4IONA 5BOWA 41BIA 1YF8B 4Z9WB 1YYNA 3OBRA 3AH1A 3BAGA 3VWCA 1HKNA 1M2TB 1V6XA 2K8RA 3SNVA 1GGPB 2ZR1B 3A23A 1PZZA 1KNMA 2I1BA 2K4AB 1A8DA 4OWLA 3FFZA 3WO3A 1S0GA 3H6RA 3I2AA 2MIBA 1IHKA 1HCEA 1S0EA 1BARA 3IM6A 1XHBA 3VSFA 3OGGA 2Q9XA 1BASA 2AXMA 1P63A 4H9WA 2DS0A 4XFTA 4D0TA 1TOOA 4ZOTA 3O44A 3MALA 5F8SA 2E4MA 2Y9FA 4QD2C 4ENDA 1FV3A 1JQZA 3QR5A 5G00A 4XKIA 2NM1A 4FGFA 9ILBA 2K43A 4QBCA 3BRGC 1N4KA 2LIQA 3H6RB 3N7LA 4X37A 1YXWA 2WBCA 2LIEA 3BAUA 1J0SA 7I1BA 4F83A 5D62A 2D24A 2Y9XE 3FJDA 1DLLA 2ZQOA 1JT3A 4JQ0A 1MD6A 5FZUA 4GAIA 4I4SA 5GAQA 1MC9A 3CA6A 4USOA 2ZQNA 3C9ZA 31BIA
chains in the Genus database with same CATH superfamily
4QD2B 4I7IA 3CA1A 1ISVA 3VT2A 2NS2A 4KC3A 2NYYA 4JP0A 2ESUA 2D7RA 3QYDA 3O5WB 4KBBA 3HMYA 3OBTA 4UY4A 3IM7A 4Q9GA 1QQKA 3NBEA 1JLXA 3LLPA 2J3PA 1PC8B 2VXRA 3O4BA 1RY7A 3T8SA 1W3GA 4LO1C 3O49A 5BVPI 3P53A 4LO8B 4D0ZA 4P0KA 4EFQA 1IILA 1BFFA 4I4PA 2FFUA 3LTQA 1E0OA 1BFBA 4IQPA 3WA1A 2KI4A 2BEAA 1BLDA 1DIWA 1XG6A 2VUAA 4JKQA 5BQUC 3RSJA 1I1EA 3NBNA 1AVAC 3AKGA 4IYBA 4IY8A 1FQ9A 3WMVA 1TWMA 2FDBM 1CVSA 1UPSA 1BFCA 3NBCA 4I1BA 1WBAA 3RMXA 3OJMA 3FJKA 3AJ6A 1DFCA 4LO0C 1PWAA 3O4AA 3WO4A 4A7YA 4LO7C 2YUGA 3S8KA 3VEQA 3R4SA 1ILR1 1JLYA 4IHZA 3WINA 1G9AA 2DREA 2FO1A 4ISQA 3D7WB 1TFMB 2X2TA 2XOAA 2DRYA 4R6UB 3BA4A 1TP0A 3IAGC 3R4UA 3PHZA 1IOBA 4I96A 3WMUA 1K5VA 3BADA 4G9NA 5FZYA 1V6VA 1FMMS 5EC5A 2M49A 4LO7B 4ISRA 1DFQA 4AN7B 3AZVA 4GAFA 2GZBA 5DZUA 2DRZA 2X2SA 3VSZA 4EB2B 3ZC9A 4I4OA 4Q91A 1JY0A 2Y9WC 3UJ4A 4ZFUB 1RG8A 3N7KA 4GP0A 3Q7XA 4MZGB 3N7MA 4IZXA 2WRYA 4USPA 5DVHA 3V0BA 2HWAA 2F2FC 5F8WA 1EV2A 3AH4A 4LO3C 4X3AA 6I1BA 1AF9A 3PUBA 4GOVA 4OUJA 4YOLA 1AVUA 3FUOA 1IRPA 3BB2A 1CE7B 1DJSB 2F8XC 1XZZA 3ZC8A 3F1RA 3I29B 3BAVA 2RQ9A 3V0BB 1HWMB 3O4CA 3FGMA 1G9CA 3FJ8A 3JUTA 4X38A 1ISYA 1S0BA 3S8JA 1K5UA 4QALA 2KLLA 1IRAX 4PC4A 21BIA 4G1RA 3A07A 4XFUA 3ZX7A 3UDAA 2AAIB 3FJ9A 3H6SE 1D0HA 3HSMA 2D22A 2FFVA 3FJCA 5FNWA 3JRRA 3HOMA 2RG9B 3ZXGA 3RMYA 1F31A 5BXPA 4XFSA 4J2SA 1EPWA 4KEIA 4EFRA 2AQZA 2D43A 4KEJA 4LO1A 3CRHA 3OJVA 1SR4C 3FJFA 4I3NA 4JAWA 1FN0A 1T4QA 4P0LA 3HN1A 1TIEA 3KMVA 2IHOA 4J2YA 1NUNA 1R8NA 3VT0A 3CA0A 3I2XA 3CA5A 3CQAA 4DEPA 4I2SA 2NP0A 4J2KA 4MZHA 3UD7A 1FMZA 4IZEA 3P6IA 5EG6C 5D63A 1JT7A 3HBWA 5BP5C 5BQUA 3BRFA 4JPZA 1L2HA 1YBIA 1IT0A 1S0CA 3AKFA 3A22A 1PUMB 4I37A 4ZBVB 3H6QA 4L4HA 4I8MA 1G9BA 5F8YA 5E24E 3B9UA 3Q7YA 1BFGA 4Q9PA 5D61A 5BXTA 5I1BA 3BRDA 4FVVA 4I4XA 4LO0A 2NTDA 3W9TA 1PUUB 5BXRA 3PG0A 1S0FA 3N0KA 1IJTA 2QYIB 4LO2C 1JT5A 3RTIB 1ONKB 3AJ5A 1AVWB 1Z4SA 4I0YA 1Z0HA 2ERMA 3AZWA 4JKXB 1DZDA 2HWMA 3BAQA 3CA4A 3BTAA 4I4RA 3V79C 3E8LC 1TTUA 3UD8A 4G6JA 5DUYA 1ISWA 2IWTB 2L5XA 1I1BA 5JLVA 3O4OA 1WD3A 1BA7A 4QO3A 2ET2A 1HIBA 4I4QA 2HW9A 4HR6C 3TC2A 4GP3A 4J23B 1EYLA 4ZLBB 4DCKC 3Q7WA 1SZ6B 2Y9GA 3FUQA 2VU9A 2P39A 1Q1UA 2Q3NB 4IY9A 1DZCA 2F2FA 1FWUA 1NZKA 1R8OA 1W3FA 4LO3A 3UJ0A 2Z48A 2D20A 1Q04A 3K1XA 3WO2A 4H04A 4HA2A 3VUOA 1G9DA 4I4YA 3FJJA 1DQOA 2VXTI 1ISXA 2NZ9A 4P6AA 4D8HA 1JTCA 4H75A 2GO2A 4A7KA 1HCDA 4OWKA 5B2HA 2BFHA 1G82A 2AFGA 1WD4A 2KI6B 8I1BA 1XYFA 5BXSA 2R9KB 1ISZA 2E4MC 3CU1B 4Z8SB 4KEKA 1DQGA 3FJAA 1AVXB 3BA5A 4ZA3B 1BLAA 3POKA 1WBCA 3ILAA 1VCLA 4QC4A 3HALA 4OEEA 3ZXDA 1HWOB 3PMEA 4I4UA 3BX1C 4CJMA 2Z49A 1SR4A 3MPPG 2VSEA 2BEBA 2FGFA 1V6WA 4ZFYB 1V6UA 4WBCA 3A21A 4HJJA 4GOYA 1JT4A 1Q03A 3CRGA 2UUSA 3BA7A 3IIRA 4II0A 4A7ZA 4QKSA 3P6JA 1OQLB 1TWEA 3BAHA 2RSTA 4J2XA 5BP5A 5JMCA 3UD9A 4I4VA 4OWJA 3OJ2A 2D23A 4I6IA 3O3QA 1T9FA 4ZFWB 1HWNB 2KH2A 4ZKTB 5EHAA 2MC2A 1HWPB 3RTJB 1YTOA 1Z2VA 3OGFA 4EEEB 3AKIA 3V0AA 3FJEA 4OEGA 2VLCA 2D1ZA 4P0JA 5HPZA 4OW4A 3N7JA 2HZ9A 3O4DA 1FWVA 1QXMA 2D44A 3F62B 1ABRB 1RMLA 3CA3A 4TLPA 2VSAA 4LO2A 5DSSB 1ITBA 3EF2A 3FJIA 4X39A 1W3AA 1II4A 1S0LA 2QN4A 1QQLA 4I1EA 3CAHA 1FGAA 4EFPA 5FZZA 3NBDA 2D7IA 3BAOA 3NJ5A 4F34A 4ZGRB 3AKHA 3V0AB 1AFCA 4AN6A 1AXMA 2P23A 5FNXA 1M16A 4QBVA 2KKIA 1RZOB 4G9MA 4L4IA 4DENA 4QKRA 1FV2A 4OEFA 4JRAA 3FJBA 3AH2A 3VT1A 3CRIA 1S0DA 3WINC 2NVHA 3IM5A 3FJHA 2MLLB 4EKXB 5F90A 1EVTA 4G6MA 4IONA 5BOWA 41BIA 1YF8B 4Z9WB 1YYNA 3OBRA 3AH1A 3BAGA 3VWCA 1HKNA 1M2TB 1V6XA 2K8RA 3SNVA 1GGPB 2ZR1B 3A23A 1PZZA 1KNMA 2I1BA 2K4AB 1A8DA 4OWLA 3FFZA 3WO3A 1S0GA 3H6RA 3I2AA 2MIBA 1IHKA 1HCEA 1S0EA 1BARA 3IM6A 4MZFB 1XHBA 3VSFA 3OGGA 2Q9XA 1BASA 2AXMA 1P63A 4H9WA 2DS0A 4XFTA 4D0TA 1TOOA 4ZOTA 3O44A 3MALA 5F8SA 2E4MA 2Y9FA 4QD2C 4ENDA 1FV3A 1JQZA 3QR5A 5G00A 4XKIA 2NM1A 4FGFA 9ILBA 2K43A 4QBCA 3BRGC 1N4KA 2LIQA 3H6RB 3N7LA 4X37A 1YXWA 2WBCA 2LIEA 3BAUA 1J0SA 7I1BA 4F83A 5D62A 2D24A 2Y9XE 3FJDA 1DLLA 2ZQOA 1JT3A 4JQ0A 1MD6A 5FZUA 4GAIA 4I4SA 5GAQA 1MC9A 3CA6A 4USOA 2ZQNA 3C9ZA 31BIA
chains in the Genus database with same CATH topology
4QD2B 4I7IA 3CA1A 1ISVA 3VT2A 2NS2A 4KC3A 2NYYA 4JP0A 2ESUA 2D7RA 3QYDA 3O5WB 4KBBA 3HMYA 3OBTA 4UY4A 3IM7A 4Q9GA 1QQKA 3NBEA 1JLXA 3LLPA 2J3PA 1PC8B 2VXRA 3O4BA 1RY7A 3T8SA 1W3GA 4LO1C 3O49A 5BVPI 3P53A 4LO8B 4D0ZA 4P0KA 4EFQA 1IILA 1BFFA 4I4PA 2FFUA 3LTQA 1E0OA 1BFBA 4IQPA 3WA1A 2KI4A 2BEAA 1BLDA 1DIWA 1XG6A 2VUAA 4JKQA 5BQUC 3RSJA 1I1EA 3NBNA 1AVAC 3AKGA 4IYBA 4IY8A 1FQ9A 3WMVA 1TWMA 2FDBM 1CVSA 1UPSA 1BFCA 3NBCA 4I1BA 1WBAA 3RMXA 3OJMA 3FJKA 3AJ6A 1DFCA 4LO0C 1PWAA 3O4AA 3WO4A 4A7YA 4LO7C 2YUGA 3S8KA 3VEQA 3R4SA 1ILR1 1JLYA 4IHZA 3WINA 1G9AA 2DREA 2FO1A 4ISQA 3D7WB 1TFMB 2X2TA 2XOAA 2DRYA 4R6UB 3BA4A 1TP0A 3IAGC 3R4UA 3PHZA 1IOBA 4I96A 3WMUA 1K5VA 3BADA 4G9NA 5FZYA 1V6VA 1FMMS 5EC5A 2M49A 4LO7B 4ISRA 1DFQA 4AN7B 3AZVA 4GAFA 2GZBA 5DZUA 2DRZA 2X2SA 3VSZA 4EB2B 3ZC9A 4I4OA 4Q91A 1JY0A 2Y9WC 3UJ4A 4ZFUB 1RG8A 3N7KA 4GP0A 3Q7XA 4MZGB 3N7MA 4IZXA 2WRYA 4USPA 5DVHA 3V0BA 2HWAA 2F2FC 5F8WA 1EV2A 3AH4A 4LO3C 4X3AA 6I1BA 1AF9A 3PUBA 4GOVA 4OUJA 4YOLA 1AVUA 3FUOA 1IRPA 3BB2A 1CE7B 1DJSB 2F8XC 1XZZA 3ZC8A 3F1RA 3I29B 3BAVA 2RQ9A 3V0BB 1HWMB 3O4CA 3FGMA 1G9CA 3FJ8A 3JUTA 4X38A 1ISYA 1S0BA 3S8JA 1K5UA 4QALA 2KLLA 1IRAX 4PC4A 21BIA 4G1RA 3A07A 4XFUA 3ZX7A 3UDAA 2AAIB 3FJ9A 3H6SE 1D0HA 3HSMA 2D22A 2FFVA 3FJCA 5FNWA 3JRRA 3HOMA 2RG9B 3ZXGA 3RMYA 1F31A 5BXPA 4XFSA 4J2SA 1EPWA 4KEIA 4EFRA 2AQZA 2D43A 4KEJA 4LO1A 3CRHA 3OJVA 1SR4C 3FJFA 4I3NA 4JAWA 1FN0A 1T4QA 4P0LA 3HN1A 1TIEA 3KMVA 2IHOA 4J2YA 1NUNA 1R8NA 3VT0A 3CA0A 3I2XA 3CA5A 3CQAA 4DEPA 4I2SA 2NP0A 4J2KA 4MZHA 3UD7A 1FMZA 4IZEA 3P6IA 5EG6C 5D63A 1JT7A 3HBWA 5BP5C 5BQUA 3BRFA 4JPZA 1L2HA 1YBIA 1IT0A 1S0CA 3AKFA 3A22A 1PUMB 4I37A 4ZBVB 3H6QA 4L4HA 4I8MA 1G9BA 5F8YA 5E24E 3B9UA 3Q7YA 1BFGA 4Q9PA 5D61A 5BXTA 5I1BA 3BRDA 4FVVA 4I4XA 4LO0A 2NTDA 3W9TA 1PUUB 5BXRA 3PG0A 1S0FA 3N0KA 1IJTA 2QYIB 4LO2C 1JT5A 3RTIB 1ONKB 3AJ5A 1AVWB 1Z4SA 4I0YA 1Z0HA 2ERMA 3AZWA 4JKXB 1DZDA 2HWMA 3BAQA 3CA4A 3BTAA 4I4RA 3V79C 3E8LC 1TTUA 3UD8A 4G6JA 5DUYA 1ISWA 2IWTB 2L5XA 1I1BA 5JLVA 3O4OA 1WD3A 1BA7A 4QO3A 2ET2A 1HIBA 4I4QA 2HW9A 4HR6C 3TC2A 4GP3A 4J23B 1EYLA 4ZLBB 4DCKC 3Q7WA 1SZ6B 2Y9GA 3FUQA 2VU9A 2P39A 1Q1UA 2Q3NB 4IY9A 1DZCA 2F2FA 1FWUA 1NZKA 1R8OA 1W3FA 4LO3A 3UJ0A 2Z48A 2D20A 1Q04A 3K1XA 3WO2A 4H04A 4HA2A 3VUOA 1G9DA 4I4YA 3FJJA 1DQOA 2VXTI 1ISXA 2NZ9A 4P6AA 4D8HA 1JTCA 4H75A 2GO2A 4A7KA 1HCDA 4OWKA 5B2HA 2BFHA 1G82A 2AFGA 1WD4A 2KI6B 8I1BA 1XYFA 5BXSA 2R9KB 1ISZA 2E4MC 3CU1B 4Z8SB 4KEKA 1DQGA 3FJAA 1AVXB 3BA5A 4ZA3B 1BLAA 3POKA 1WBCA 3ILAA 1VCLA 4QC4A 3HALA 4OEEA 3ZXDA 1HWOB 3PMEA 4I4UA 3BX1C 4CJMA 2Z49A 1SR4A 3MPPG 2VSEA 2BEBA 2FGFA 1V6WA 4ZFYB 1V6UA 4WBCA 3A21A 4HJJA 4GOYA 1JT4A 1Q03A 3CRGA 2UUSA 3BA7A 3IIRA 4II0A 4A7ZA 4QKSA 3P6JA 1OQLB 1TWEA 3BAHA 2RSTA 4J2XA 5BP5A 5JMCA 3UD9A 4I4VA 4OWJA 3OJ2A 2D23A 4I6IA 3O3QA 1T9FA 4ZFWB 1HWNB 2KH2A 4ZKTB 5EHAA 2MC2A 1HWPB 3RTJB 1YTOA 1Z2VA 3OGFA 4EEEB 3AKIA 3V0AA 3FJEA 4OEGA 2VLCA 2D1ZA 4P0JA 5HPZA 4OW4A 3N7JA 2HZ9A 3O4DA 1FWVA 1QXMA 2D44A 3F62B 1ABRB 1RMLA 3CA3A 4TLPA 2VSAA 4LO2A 5DSSB 1ITBA 3EF2A 3FJIA 4X39A 1W3AA 1II4A 1S0LA 2QN4A 1QQLA 4I1EA 3CAHA 1FGAA 4EFPA 5FZZA 3NBDA 2D7IA 3BAOA 3NJ5A 4F34A 4ZGRB 3AKHA 3V0AB 1AFCA 4AN6A 1AXMA 2P23A 5FNXA 1M16A 4QBVA 2KKIA 1RZOB 4G9MA 4L4IA 4DENA 4QKRA 1FV2A 4OEFA 4JRAA 3FJBA 3AH2A 3VT1A 3CRIA 1S0DA 3WINC 2NVHA 3IM5A 3FJHA 2MLLB 4EKXB 5F90A 1EVTA 4G6MA 4IONA 5BOWA 41BIA 1YF8B 4Z9WB 1YYNA 3OBRA 3AH1A 3BAGA 3VWCA 1HKNA 1M2TB 1V6XA 2K8RA 3SNVA 1GGPB 2ZR1B 3A23A 1PZZA 1KNMA 2I1BA 2K4AB 1A8DA 4OWLA 3FFZA 3WO3A 1S0GA 3H6RA 3I2AA 2MIBA 1IHKA 1HCEA 1S0EA 1BARA 3IM6A 4MZFB 1XHBA 3VSFA 3OGGA 2Q9XA 1BASA 2AXMA 1P63A 4H9WA 2DS0A 4XFTA 4D0TA 1TOOA 4ZOTA 3O44A 3MALA 5F8SA 2E4MA 2Y9FA 4QD2C 4ENDA 1FV3A 1JQZA 3QR5A 5G00A 4XKIA 2NM1A 4FGFA 9ILBA 2K43A 4QBCA 3BRGC 1N4KA 2LIQA 3H6RB 3N7LA 4X37A 1YXWA 2WBCA 2LIEA 3BAUA 1J0SA 7I1BA 4F83A 5D62A 2D24A 2Y9XE 3FJDA 1DLLA 2ZQOA 1JT3A 4JQ0A 1MD6A 5FZUA 4GAIA 4I4SA 5GAQA 1MC9A 3CA6A 4USOA 2ZQNA 3C9ZA 31BIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QD2 B;  4I7I A;  3CA1 A;  1ISV A;  3VT2 A;  4KC3 A;  2NYY A;  4JP0 A;  2ESU A;  2D7R A;  3QYD A;  3O5W B;  4KBB A;  3HMY A;  3OBT A;  3IM7 A;  4Q9G A;  1QQK A;  3NBE A;  1JLX A;  3LLP A;  2J3P A;  1PC8 B;  2VXR A;  3O4B A;  1RY7 A;  3T8S A;  1W3G A;  4LO1 C;  3O49 A;  5BVP I;  3P53 A;  4LO8 B;  4D0Z A;  4P0K A;  4EFQ A;  1IIL A;  1BFF A;  4I4P A;  2FFU A;  3LTQ A;  1E0O A;  1BFB A;  4IQP A;  3WA1 A;  2KI4 A;  2BEA A;  1BLD A;  1DIW A;  1XG6 A;  2VUA A;  4JKQ A;  5BQU C;  3RSJ A;  1I1E A;  3NBN A;  1AVA C;  3AKG A;  4IYB A;  4IY8 A;  1FQ9 A;  3WMV A;  1TWM A;  2FDB M;  1CVS A;  1UPS A;  1BFC A;  3NBC A;  4I1B A;  1WBA A;  3RMX A;  3OJM A;  3FJK A;  3AJ6 A;  1DFC A;  4LO0 C;  1PWA A;  3O4A A;  3WO4 A;  4A7Y A;  4LO7 C;  2YUG A;  3S8K A;  3VEQ A;  3R4S A;  1ILR 1;  1JLY A;  4IHZ A;  3WIN A;  1G9A A;  2DRE A;  2FO1 A;  4ISQ A;  3D7W B;  1TFM B;  2X2T A;  2XOA A;  2DRY A;  4R6U B;  3BA4 A;  1TP0 A;  3IAG C;  3R4U A;  3PHZ A;  1IOB A;  4I96 A;  3WMU A;  1K5V A;  3BAD A;  4G9N A;  5FZY A;  1V6V A;  1FMM S;  5EC5 A;  2M49 A;  4LO7 B;  4ISR A;  1DFQ A;  4AN7 B;  3AZV A;  4GAF A;  2GZB A;  5DZU A;  2DRZ A;  2X2S A;  3VSZ A;  4EB2 B;  3ZC9 A;  4I4O A;  4Q91 A;  1JY0 A;  2Y9W C;  3UJ4 A;  4ZFU B;  1RG8 A;  3N7K A;  4GP0 A;  3Q7X A;  3N7M A;  4IZX A;  2WRY A;  4USP A;  5DVH A;  3V0B A;  2HWA A;  2F2F C;  5F8W A;  1EV2 A;  3AH4 A;  4LO3 C;  4X3A A;  6I1B A;  1AF9 A;  3PUB A;  4GOV A;  4OUJ A;  4YOL A;  1AVU A;  3FUO A;  1IRP A;  3BB2 A;  1CE7 B;  1DJS B;  2F8X C;  1XZZ A;  3ZC8 A;  3F1R A;  3I29 B;  3BAV A;  2RQ9 A;  3V0B B;  1HWM B;  3O4C A;  3FGM A;  1G9C A;  3FJ8 A;  3JUT A;  4X38 A;  1ISY A;  1S0B A;  3S8J A;  1K5U A;  4QAL A;  2KLL A;  1IRA X;  4PC4 A;  21BI A;  4G1R A;  3A07 A;  4XFU A;  3ZX7 A;  3UDA A;  2AAI B;  3FJ9 A;  3H6S E;  1D0H A;  3HSM A;  2D22 A;  2FFV A;  3FJC A;  5FNW A;  3JRR A;  3HOM A;  2RG9 B;  3ZXG A;  3RMY A;  1F31 A;  5BXP A;  4XFS A;  4J2S A;  1EPW A;  4KEI A;  4EFR A;  2AQZ A;  2D43 A;  4KEJ A;  4LO1 A;  3CRH A;  3OJV A;  1SR4 C;  3FJF A;  4I3N A;  4JAW A;  1FN0 A;  1T4Q A;  4P0L A;  3HN1 A;  1TIE A;  3KMV A;  2IHO A;  4J2Y A;  1NUN A;  1R8N A;  3VT0 A;  3CA0 A;  3I2X A;  3CA5 A;  3CQA A;  4DEP A;  4I2S A;  2NP0 A;  4J2K A;  3UD7 A;  1FMZ A;  4IZE A;  3P6I A;  5EG6 C;  5D63 A;  1JT7 A;  3HBW A;  5BP5 C;  5BQU A;  3BRF A;  4JPZ A;  1L2H A;  1YBI A;  1IT0 A;  1S0C A;  3AKF A;  3A22 A;  1PUM B;  4I37 A;  4ZBV B;  3H6Q A;  4L4H A;  4I8M A;  1G9B A;  5F8Y A;  5E24 E;  3B9U A;  3Q7Y A;  1BFG A;  4Q9P A;  5D61 A;  5BXT A;  5I1B A;  3BRD A;  4FVV A;  4I4X A;  4LO0 A;  2NTD A;  3W9T A;  1PUU B;  5BXR A;  3PG0 A;  1S0F A;  3N0K A;  1IJT A;  2QYI B;  4LO2 C;  1JT5 A;  3RTI B;  1ONK B;  3AJ5 A;  1AVW B;  1Z4S A;  4I0Y A;  1Z0H A;  2ERM A;  3AZW A;  4JKX B;  1DZD A;  2HWM A;  3BAQ A;  3CA4 A;  3BTA A;  4I4R A;  3V79 C;  3E8L C;  1TTU A;  3UD8 A;  4G6J A;  5DUY A;  1ISW A;  2IWT B;  2L5X A;  1I1B A;  5JLV A;  3O4O A;  1WD3 A;  1BA7 A;  4QO3 A;  2ET2 A;  1HIB A;  4I4Q A;  2HW9 A;  4HR6 C;  3TC2 A;  4GP3 A;  4J23 B;  1EYL A;  4ZLB B;  4DCK C;  3Q7W A;  1SZ6 B;  2Y9G A;  3FUQ A;  2VU9 A;  2P39 A;  1Q1U A;  2Q3N B;  4IY9 A;  1DZC A;  2F2F A;  1FWU A;  1NZK A;  1R8O A;  1W3F A;  4LO3 A;  3UJ0 A;  2Z48 A;  2D20 A;  1Q04 A;  3K1X A;  3WO2 A;  4H04 A;  4HA2 A;  3VUO A;  1G9D A;  4I4Y A;  3FJJ A;  1DQO A;  2VXT I;  1ISX A;  2NZ9 A;  4P6A A;  4D8H A;  1JTC A;  2GO2 A;  4A7K A;  1HCD A;  4OWK A;  5B2H A;  2BFH A;  1G82 A;  2AFG A;  1WD4 A;  2KI6 B;  8I1B A;  1XYF A;  5BXS A;  2R9K B;  1ISZ A;  2E4M C;  3CU1 B;  4Z8S B;  4KEK A;  1DQG A;  3FJA A;  1AVX B;  3BA5 A;  4ZA3 B;  1BLA A;  3POK A;  1WBC A;  3ILA A;  1VCL A;  4QC4 A;  3HAL A;  4OEE A;  3ZXD A;  1HWO B;  3PME A;  4I4U A;  3BX1 C;  4CJM A;  2Z49 A;  1SR4 A;  3MPP G;  2VSE A;  2BEB A;  2FGF A;  1V6W A;  4ZFY B;  1V6U A;  4WBC A;  3A21 A;  4HJJ A;  4GOY A;  1JT4 A;  1Q03 A;  3CRG A;  2UUS A;  3BA7 A;  3IIR A;  4II0 A;  4A7Z A;  4QKS A;  3P6J A;  1OQL B;  1TWE A;  3BAH A;  2RST A;  4J2X A;  5BP5 A;  5JMC A;  3UD9 A;  4I4V A;  4OWJ A;  3OJ2 A;  2D23 A;  4I6I A;  3O3Q A;  1T9F A;  4ZFW B;  1HWN B;  2KH2 A;  4ZKT B;  5EHA A;  2MC2 A;  1HWP B;  3RTJ B;  1YTO A;  1Z2V A;  3OGF A;  4EEE B;  3AKI A;  3V0A A;  3FJE A;  4OEG A;  2VLC A;  2D1Z A;  4P0J A;  5HPZ A;  4OW4 A;  3N7J A;  2HZ9 A;  3O4D A;  1FWV A;  1QXM A;  2D44 A;  3F62 B;  1ABR B;  1RML A;  3CA3 A;  4TLP A;  2VSA A;  4LO2 A;  5DSS B;  1ITB A;  3EF2 A;  3FJI A;  4X39 A;  1W3A A;  1II4 A;  1S0L A;  2QN4 A;  1QQL A;  4I1E A;  3CAH A;  1FGA A;  4EFP A;  5FZZ A;  3NBD A;  2D7I A;  3BAO A;  3NJ5 A;  4F34 A;  4ZGR B;  3AKH A;  3V0A B;  1AFC A;  4AN6 A;  1AXM A;  2P23 A;  5FNX A;  1M16 A;  4QBV A;  2KKI A;  1RZO B;  4G9M A;  4L4I A;  4DEN A;  4QKR A;  1FV2 A;  4OEF A;  4JRA A;  3FJB A;  3AH2 A;  3VT1 A;  3CRI A;  1S0D A;  3WIN C;  2NVH A;  3IM5 A;  3FJH A;  2MLL B;  4EKX B;  5F90 A;  1EVT A;  4G6M A;  4ION A;  5BOW A;  41BI A;  1YF8 B;  4Z9W B;  1YYN A;  3OBR A;  3AH1 A;  3BAG A;  3VWC A;  1HKN A;  1M2T B;  1V6X A;  2K8R A;  3SNV A;  1GGP B;  2ZR1 B;  3A23 A;  1PZZ A;  1KNM A;  2I1B A;  2K4A B;  1A8D A;  4OWL A;  3FFZ A;  3WO3 A;  1S0G A;  3H6R A;  3I2A A;  2MIB A;  1IHK A;  1HCE A;  1S0E A;  1BAR A;  3IM6 A;  1XHB A;  3VSF A;  3OGG A;  2Q9X A;  1BAS A;  2AXM A;  1P63 A;  4H9W A;  2DS0 A;  4XFT A;  4D0T A;  1TOO A;  4ZOT A;  3O44 A;  3MAL A;  5F8S A;  2E4M A;  2Y9F A;  4QD2 C;  4END A;  1FV3 A;  1JQZ A;  3QR5 A;  5G00 A;  4XKI A;  2NM1 A;  4FGF A;  9ILB A;  2K43 A;  4QBC A;  3BRG C;  1N4K A;  2LIQ A;  3H6R B;  3N7L A;  4X37 A;  1YXW A;  2WBC A;  2LIE A;  3BAU A;  1J0S A;  7I1B A;  4F83 A;  5D62 A;  2D24 A;  2Y9X E;  3FJD A;  1DLL A;  2ZQO A;  1JT3 A;  4JQ0 A;  1MD6 A;  5FZU A;  4GAI A;  4I4S A;  5GAQ A;  1MC9 A;  3CA6 A;  4USO A;  2ZQN A;  3C9Z A;  31BI A; 
#chains in the Genus database with same CATH topology
 4QD2 B;  4I7I A;  3CA1 A;  1ISV A;  3VT2 A;  2NS2 A;  4KC3 A;  2NYY A;  4JP0 A;  2ESU A;  2D7R A;  3QYD A;  3O5W B;  4KBB A;  3HMY A;  3OBT A;  4UY4 A;  3IM7 A;  4Q9G A;  1QQK A;  3NBE A;  1JLX A;  3LLP A;  2J3P A;  1PC8 B;  2VXR A;  3O4B A;  1RY7 A;  3T8S A;  1W3G A;  4LO1 C;  3O49 A;  5BVP I;  3P53 A;  4LO8 B;  4D0Z A;  4P0K A;  4EFQ A;  1IIL A;  1BFF A;  4I4P A;  2FFU A;  3LTQ A;  1E0O A;  1BFB A;  4IQP A;  3WA1 A;  2KI4 A;  2BEA A;  1BLD A;  1DIW A;  1XG6 A;  2VUA A;  4JKQ A;  5BQU C;  3RSJ A;  1I1E A;  3NBN A;  1AVA C;  3AKG A;  4IYB A;  4IY8 A;  1FQ9 A;  3WMV A;  1TWM A;  2FDB M;  1CVS A;  1UPS A;  1BFC A;  3NBC A;  4I1B A;  1WBA A;  3RMX A;  3OJM A;  3FJK A;  3AJ6 A;  1DFC A;  4LO0 C;  1PWA A;  3O4A A;  3WO4 A;  4A7Y A;  4LO7 C;  2YUG A;  3S8K A;  3VEQ A;  3R4S A;  1ILR 1;  1JLY A;  4IHZ A;  3WIN A;  1G9A A;  2DRE A;  2FO1 A;  4ISQ A;  3D7W B;  1TFM B;  2X2T A;  2XOA A;  2DRY A;  4R6U B;  3BA4 A;  1TP0 A;  3IAG C;  3R4U A;  3PHZ A;  1IOB A;  4I96 A;  3WMU A;  1K5V A;  3BAD A;  4G9N A;  5FZY A;  1V6V A;  1FMM S;  5EC5 A;  2M49 A;  4LO7 B;  4ISR A;  1DFQ A;  4AN7 B;  3AZV A;  4GAF A;  2GZB A;  5DZU A;  2DRZ A;  2X2S A;  3VSZ A;  4EB2 B;  3ZC9 A;  4I4O A;  4Q91 A;  1JY0 A;  2Y9W C;  3UJ4 A;  4ZFU B;  1RG8 A;  3N7K A;  4GP0 A;  3Q7X A;  4MZG B;  3N7M A;  4IZX A;  2WRY A;  4USP A;  5DVH A;  3V0B A;  2HWA A;  2F2F C;  5F8W A;  1EV2 A;  3AH4 A;  4LO3 C;  4X3A A;  6I1B A;  1AF9 A;  3PUB A;  4GOV A;  4OUJ A;  4YOL A;  1AVU A;  3FUO A;  1IRP A;  3BB2 A;  1CE7 B;  1DJS B;  2F8X C;  1XZZ A;  3ZC8 A;  3F1R A;  3I29 B;  3BAV A;  2RQ9 A;  3V0B B;  1HWM B;  3O4C A;  3FGM A;  1G9C A;  3FJ8 A;  3JUT A;  4X38 A;  1ISY A;  1S0B A;  3S8J A;  1K5U A;  4QAL A;  2KLL A;  1IRA X;  4PC4 A;  21BI A;  4G1R A;  3A07 A;  4XFU A;  3ZX7 A;  3UDA A;  2AAI B;  3FJ9 A;  3H6S E;  1D0H A;  3HSM A;  2D22 A;  2FFV A;  3FJC A;  5FNW A;  3JRR A;  3HOM A;  2RG9 B;  3ZXG A;  3RMY A;  1F31 A;  5BXP A;  4XFS A;  4J2S A;  1EPW A;  4KEI A;  4EFR A;  2AQZ A;  2D43 A;  4KEJ A;  4LO1 A;  3CRH A;  3OJV A;  1SR4 C;  3FJF A;  4I3N A;  4JAW A;  1FN0 A;  1T4Q A;  4P0L A;  3HN1 A;  1TIE A;  3KMV A;  2IHO A;  4J2Y A;  1NUN A;  1R8N A;  3VT0 A;  3CA0 A;  3I2X A;  3CA5 A;  3CQA A;  4DEP A;  4I2S A;  2NP0 A;  4J2K A;  4MZH A;  3UD7 A;  1FMZ A;  4IZE A;  3P6I A;  5EG6 C;  5D63 A;  1JT7 A;  3HBW A;  5BP5 C;  5BQU A;  3BRF A;  4JPZ A;  1L2H A;  1YBI A;  1IT0 A;  1S0C A;  3AKF A;  3A22 A;  1PUM B;  4I37 A;  4ZBV B;  3H6Q A;  4L4H A;  4I8M A;  1G9B A;  5F8Y A;  5E24 E;  3B9U A;  3Q7Y A;  1BFG A;  4Q9P A;  5D61 A;  5BXT A;  5I1B A;  3BRD A;  4FVV A;  4I4X A;  4LO0 A;  2NTD A;  3W9T A;  1PUU B;  5BXR A;  3PG0 A;  1S0F A;  3N0K A;  1IJT A;  2QYI B;  4LO2 C;  1JT5 A;  3RTI B;  1ONK B;  3AJ5 A;  1AVW B;  1Z4S A;  4I0Y A;  1Z0H A;  2ERM A;  3AZW A;  4JKX B;  1DZD A;  2HWM A;  3BAQ A;  3CA4 A;  3BTA A;  4I4R A;  3V79 C;  3E8L C;  1TTU A;  3UD8 A;  4G6J A;  5DUY A;  1ISW A;  2IWT B;  2L5X A;  1I1B A;  5JLV A;  3O4O A;  1WD3 A;  1BA7 A;  4QO3 A;  2ET2 A;  1HIB A;  4I4Q A;  2HW9 A;  4HR6 C;  3TC2 A;  4GP3 A;  4J23 B;  1EYL A;  4ZLB B;  4DCK C;  3Q7W A;  1SZ6 B;  2Y9G A;  3FUQ A;  2VU9 A;  2P39 A;  1Q1U A;  2Q3N B;  4IY9 A;  1DZC A;  2F2F A;  1FWU A;  1NZK A;  1R8O A;  1W3F A;  4LO3 A;  3UJ0 A;  2Z48 A;  2D20 A;  1Q04 A;  3K1X A;  3WO2 A;  4H04 A;  4HA2 A;  3VUO A;  1G9D A;  4I4Y A;  3FJJ A;  1DQO A;  2VXT I;  1ISX A;  2NZ9 A;  4P6A A;  4D8H A;  1JTC A;  4H75 A;  2GO2 A;  4A7K A;  1HCD A;  4OWK A;  5B2H A;  2BFH A;  1G82 A;  2AFG A;  1WD4 A;  2KI6 B;  8I1B A;  1XYF A;  5BXS A;  2R9K B;  1ISZ A;  2E4M C;  3CU1 B;  4Z8S B;  4KEK A;  1DQG A;  3FJA A;  1AVX B;  3BA5 A;  4ZA3 B;  1BLA A;  3POK A;  1WBC A;  3ILA A;  1VCL A;  4QC4 A;  3HAL A;  4OEE A;  3ZXD A;  1HWO B;  3PME A;  4I4U A;  3BX1 C;  4CJM A;  2Z49 A;  1SR4 A;  3MPP G;  2VSE A;  2BEB A;  2FGF A;  1V6W A;  4ZFY B;  1V6U A;  4WBC A;  3A21 A;  4HJJ A;  4GOY A;  1JT4 A;  1Q03 A;  3CRG A;  2UUS A;  3BA7 A;  3IIR A;  4II0 A;  4A7Z A;  4QKS A;  3P6J A;  1OQL B;  1TWE A;  3BAH A;  2RST A;  4J2X A;  5BP5 A;  5JMC A;  3UD9 A;  4I4V A;  4OWJ A;  3OJ2 A;  2D23 A;  4I6I A;  3O3Q A;  1T9F A;  4ZFW B;  1HWN B;  2KH2 A;  4ZKT B;  5EHA A;  2MC2 A;  1HWP B;  3RTJ B;  1YTO A;  1Z2V A;  3OGF A;  4EEE B;  3AKI A;  3V0A A;  3FJE A;  4OEG A;  2VLC A;  2D1Z A;  4P0J A;  5HPZ A;  4OW4 A;  3N7J A;  2HZ9 A;  3O4D A;  1FWV A;  1QXM A;  2D44 A;  3F62 B;  1ABR B;  1RML A;  3CA3 A;  4TLP A;  2VSA A;  4LO2 A;  5DSS B;  1ITB A;  3EF2 A;  3FJI A;  4X39 A;  1W3A A;  1II4 A;  1S0L A;  2QN4 A;  1QQL A;  4I1E A;  3CAH A;  1FGA A;  4EFP A;  5FZZ A;  3NBD A;  2D7I A;  3BAO A;  3NJ5 A;  4F34 A;  4ZGR B;  3AKH A;  3V0A B;  1AFC A;  4AN6 A;  1AXM A;  2P23 A;  5FNX A;  1M16 A;  4QBV A;  2KKI A;  1RZO B;  4G9M A;  4L4I A;  4DEN A;  4QKR A;  1FV2 A;  4OEF A;  4JRA A;  3FJB A;  3AH2 A;  3VT1 A;  3CRI A;  1S0D A;  3WIN C;  2NVH A;  3IM5 A;  3FJH A;  2MLL B;  4EKX B;  5F90 A;  1EVT A;  4G6M A;  4ION A;  5BOW A;  41BI A;  1YF8 B;  4Z9W B;  1YYN A;  3OBR A;  3AH1 A;  3BAG A;  3VWC A;  1HKN A;  1M2T B;  1V6X A;  2K8R A;  3SNV A;  1GGP B;  2ZR1 B;  3A23 A;  1PZZ A;  1KNM A;  2I1B A;  2K4A B;  1A8D A;  4OWL A;  3FFZ A;  3WO3 A;  1S0G A;  3H6R A;  3I2A A;  2MIB A;  1IHK A;  1HCE A;  1S0E A;  1BAR A;  3IM6 A;  4MZF B;  1XHB A;  3VSF A;  3OGG A;  2Q9X A;  1BAS A;  2AXM A;  1P63 A;  4H9W A;  2DS0 A;  4XFT A;  4D0T A;  1TOO A;  4ZOT A;  3O44 A;  3MAL A;  5F8S A;  2E4M A;  2Y9F A;  4QD2 C;  4END A;  1FV3 A;  1JQZ A;  3QR5 A;  5G00 A;  4XKI A;  2NM1 A;  4FGF A;  9ILB A;  2K43 A;  4QBC A;  3BRG C;  1N4K A;  2LIQ A;  3H6R B;  3N7L A;  4X37 A;  1YXW A;  2WBC A;  2LIE A;  3BAU A;  1J0S A;  7I1B A;  4F83 A;  5D62 A;  2D24 A;  2Y9X E;  3FJD A;  1DLL A;  2ZQO A;  1JT3 A;  4JQ0 A;  1MD6 A;  5FZU A;  4GAI A;  4I4S A;  5GAQ A;  1MC9 A;  3CA6 A;  4USO A;  2ZQN A;  3C9Z A;  31BI A; 
#chains in the Genus database with same CATH homology
 4QD2 B;  4I7I A;  3CA1 A;  1ISV A;  3VT2 A;  2NS2 A;  4KC3 A;  2NYY A;  4JP0 A;  2ESU A;  2D7R A;  3QYD A;  3O5W B;  4KBB A;  3HMY A;  3OBT A;  4UY4 A;  3IM7 A;  4Q9G A;  1QQK A;  3NBE A;  1JLX A;  3LLP A;  2J3P A;  1PC8 B;  2VXR A;  3O4B A;  1RY7 A;  3T8S A;  1W3G A;  4LO1 C;  3O49 A;  5BVP I;  3P53 A;  4LO8 B;  4D0Z A;  4P0K A;  4EFQ A;  1IIL A;  1BFF A;  4I4P A;  2FFU A;  3LTQ A;  1E0O A;  1BFB A;  4IQP A;  3WA1 A;  2KI4 A;  2BEA A;  1BLD A;  1DIW A;  1XG6 A;  2VUA A;  4JKQ A;  5BQU C;  3RSJ A;  1I1E A;  3NBN A;  1AVA C;  3AKG A;  4IYB A;  4IY8 A;  1FQ9 A;  3WMV A;  1TWM A;  2FDB M;  1CVS A;  1UPS A;  1BFC A;  3NBC A;  4I1B A;  1WBA A;  3RMX A;  3OJM A;  3FJK A;  3AJ6 A;  1DFC A;  4LO0 C;  1PWA A;  3O4A A;  3WO4 A;  4A7Y A;  4LO7 C;  2YUG A;  3S8K A;  3VEQ A;  3R4S A;  1ILR 1;  1JLY A;  4IHZ A;  3WIN A;  1G9A A;  2DRE A;  2FO1 A;  4ISQ A;  3D7W B;  1TFM B;  2X2T A;  2XOA A;  2DRY A;  4R6U B;  3BA4 A;  1TP0 A;  3IAG C;  3R4U A;  3PHZ A;  1IOB A;  4I96 A;  3WMU A;  1K5V A;  3BAD A;  4G9N A;  5FZY A;  1V6V A;  1FMM S;  5EC5 A;  2M49 A;  4LO7 B;  4ISR A;  1DFQ A;  4AN7 B;  3AZV A;  4GAF A;  2GZB A;  5DZU A;  2DRZ A;  2X2S A;  3VSZ A;  4EB2 B;  3ZC9 A;  4I4O A;  4Q91 A;  1JY0 A;  2Y9W C;  3UJ4 A;  4ZFU B;  1RG8 A;  3N7K A;  4GP0 A;  3Q7X A;  4MZG B;  3N7M A;  4IZX A;  2WRY A;  4USP A;  5DVH A;  3V0B A;  2HWA A;  2F2F C;  5F8W A;  1EV2 A;  3AH4 A;  4LO3 C;  4X3A A;  6I1B A;  1AF9 A;  3PUB A;  4GOV A;  4OUJ A;  4YOL A;  1AVU A;  3FUO A;  1IRP A;  3BB2 A;  1CE7 B;  1DJS B;  2F8X C;  1XZZ A;  3ZC8 A;  3F1R A;  3I29 B;  3BAV A;  2RQ9 A;  3V0B B;  1HWM B;  3O4C A;  3FGM A;  1G9C A;  3FJ8 A;  3JUT A;  4X38 A;  1ISY A;  1S0B A;  3S8J A;  1K5U A;  4QAL A;  2KLL A;  1IRA X;  4PC4 A;  21BI A;  4G1R A;  3A07 A;  4XFU A;  3ZX7 A;  3UDA A;  2AAI B;  3FJ9 A;  3H6S E;  1D0H A;  3HSM A;  2D22 A;  2FFV A;  3FJC A;  5FNW A;  3JRR A;  3HOM A;  2RG9 B;  3ZXG A;  3RMY A;  1F31 A;  5BXP A;  4XFS A;  4J2S A;  1EPW A;  4KEI A;  4EFR A;  2AQZ A;  2D43 A;  4KEJ A;  4LO1 A;  3CRH A;  3OJV A;  1SR4 C;  3FJF A;  4I3N A;  4JAW A;  1FN0 A;  1T4Q A;  4P0L A;  3HN1 A;  1TIE A;  3KMV A;  2IHO A;  4J2Y A;  1NUN A;  1R8N A;  3VT0 A;  3CA0 A;  3I2X A;  3CA5 A;  3CQA A;  4DEP A;  4I2S A;  2NP0 A;  4J2K A;  4MZH A;  3UD7 A;  1FMZ A;  4IZE A;  3P6I A;  5EG6 C;  5D63 A;  1JT7 A;  3HBW A;  5BP5 C;  5BQU A;  3BRF A;  4JPZ A;  1L2H A;  1YBI A;  1IT0 A;  1S0C A;  3AKF A;  3A22 A;  1PUM B;  4I37 A;  4ZBV B;  3H6Q A;  4L4H A;  4I8M A;  1G9B A;  5F8Y A;  5E24 E;  3B9U A;  3Q7Y A;  1BFG A;  4Q9P A;  5D61 A;  5BXT A;  5I1B A;  3BRD A;  4FVV A;  4I4X A;  4LO0 A;  2NTD A;  3W9T A;  1PUU B;  5BXR A;  3PG0 A;  1S0F A;  3N0K A;  1IJT A;  2QYI B;  4LO2 C;  1JT5 A;  3RTI B;  1ONK B;  3AJ5 A;  1AVW B;  1Z4S A;  4I0Y A;  1Z0H A;  2ERM A;  3AZW A;  4JKX B;  1DZD A;  2HWM A;  3BAQ A;  3CA4 A;  3BTA A;  4I4R A;  3V79 C;  3E8L C;  1TTU A;  3UD8 A;  4G6J A;  5DUY A;  1ISW A;  2IWT B;  2L5X A;  1I1B A;  5JLV A;  3O4O A;  1WD3 A;  1BA7 A;  4QO3 A;  2ET2 A;  1HIB A;  4I4Q A;  2HW9 A;  4HR6 C;  3TC2 A;  4GP3 A;  4J23 B;  1EYL A;  4ZLB B;  4DCK C;  3Q7W A;  1SZ6 B;  2Y9G A;  3FUQ A;  2VU9 A;  2P39 A;  1Q1U A;  2Q3N B;  4IY9 A;  1DZC A;  2F2F A;  1FWU A;  1NZK A;  1R8O A;  1W3F A;  4LO3 A;  3UJ0 A;  2Z48 A;  2D20 A;  1Q04 A;  3K1X A;  3WO2 A;  4H04 A;  4HA2 A;  3VUO A;  1G9D A;  4I4Y A;  3FJJ A;  1DQO A;  2VXT I;  1ISX A;  2NZ9 A;  4P6A A;  4D8H A;  1JTC A;  4H75 A;  2GO2 A;  4A7K A;  1HCD A;  4OWK A;  5B2H A;  2BFH A;  1G82 A;  2AFG A;  1WD4 A;  2KI6 B;  8I1B A;  1XYF A;  5BXS A;  2R9K B;  1ISZ A;  2E4M C;  3CU1 B;  4Z8S B;  4KEK A;  1DQG A;  3FJA A;  1AVX B;  3BA5 A;  4ZA3 B;  1BLA A;  3POK A;  1WBC A;  3ILA A;  1VCL A;  4QC4 A;  3HAL A;  4OEE A;  3ZXD A;  1HWO B;  3PME A;  4I4U A;  3BX1 C;  4CJM A;  2Z49 A;  1SR4 A;  3MPP G;  2VSE A;  2BEB A;  2FGF A;  1V6W A;  4ZFY B;  1V6U A;  4WBC A;  3A21 A;  4HJJ A;  4GOY A;  1JT4 A;  1Q03 A;  3CRG A;  2UUS A;  3BA7 A;  3IIR A;  4II0 A;  4A7Z A;  4QKS A;  3P6J A;  1OQL B;  1TWE A;  3BAH A;  2RST A;  4J2X A;  5BP5 A;  5JMC A;  3UD9 A;  4I4V A;  4OWJ A;  3OJ2 A;  2D23 A;  4I6I A;  3O3Q A;  1T9F A;  4ZFW B;  1HWN B;  2KH2 A;  4ZKT B;  5EHA A;  2MC2 A;  1HWP B;  3RTJ B;  1YTO A;  1Z2V A;  3OGF A;  4EEE B;  3AKI A;  3V0A A;  3FJE A;  4OEG A;  2VLC A;  2D1Z A;  4P0J A;  5HPZ A;  4OW4 A;  3N7J A;  2HZ9 A;  3O4D A;  1FWV A;  1QXM A;  2D44 A;  3F62 B;  1ABR B;  1RML A;  3CA3 A;  4TLP A;  2VSA A;  4LO2 A;  5DSS B;  1ITB A;  3EF2 A;  3FJI A;  4X39 A;  1W3A A;  1II4 A;  1S0L A;  2QN4 A;  1QQL A;  4I1E A;  3CAH A;  1FGA A;  4EFP A;  5FZZ A;  3NBD A;  2D7I A;  3BAO A;  3NJ5 A;  4F34 A;  4ZGR B;  3AKH A;  3V0A B;  1AFC A;  4AN6 A;  1AXM A;  2P23 A;  5FNX A;  1M16 A;  4QBV A;  2KKI A;  1RZO B;  4G9M A;  4L4I A;  4DEN A;  4QKR A;  1FV2 A;  4OEF A;  4JRA A;  3FJB A;  3AH2 A;  3VT1 A;  3CRI A;  1S0D A;  3WIN C;  2NVH A;  3IM5 A;  3FJH A;  2MLL B;  4EKX B;  5F90 A;  1EVT A;  4G6M A;  4ION A;  5BOW A;  41BI A;  1YF8 B;  4Z9W B;  1YYN A;  3OBR A;  3AH1 A;  3BAG A;  3VWC A;  1HKN A;  1M2T B;  1V6X A;  2K8R A;  3SNV A;  1GGP B;  2ZR1 B;  3A23 A;  1PZZ A;  1KNM A;  2I1B A;  2K4A B;  1A8D A;  4OWL A;  3FFZ A;  3WO3 A;  1S0G A;  3H6R A;  3I2A A;  2MIB A;  1IHK A;  1HCE A;  1S0E A;  1BAR A;  3IM6 A;  4MZF B;  1XHB A;  3VSF A;  3OGG A;  2Q9X A;  1BAS A;  2AXM A;  1P63 A;  4H9W A;  2DS0 A;  4XFT A;  4D0T A;  1TOO A;  4ZOT A;  3O44 A;  3MAL A;  5F8S A;  2E4M A;  2Y9F A;  4QD2 C;  4END A;  1FV3 A;  1JQZ A;  3QR5 A;  5G00 A;  4XKI A;  2NM1 A;  4FGF A;  9ILB A;  2K43 A;  4QBC A;  3BRG C;  1N4K A;  2LIQ A;  3H6R B;  3N7L A;  4X37 A;  1YXW A;  2WBC A;  2LIE A;  3BAU A;  1J0S A;  7I1B A;  4F83 A;  5D62 A;  2D24 A;  2Y9X E;  3FJD A;  1DLL A;  2ZQO A;  1JT3 A;  4JQ0 A;  1MD6 A;  5FZU A;  4GAI A;  4I4S A;  5GAQ A;  1MC9 A;  3CA6 A;  4USO A;  2ZQN A;  3C9Z A;  31BI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...