3S8MA

The crystal structure of fabv
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
390
structure length
390
Chain Sequence
CTTTHPLGCERNVLEQIAATRARGVRNDGPKKVLVIGASSGYGLASRITAAFGFGADTLGVFFEKPGTASKAGTAGWYNSAAFDKHAKAAGLYSKSINGDAFSDAARAQVIELIKTEMGGQVDLVVYSLASPVRKLPGSGEVKRSALKPIGQTYTATAIDTNKDTIIQASIEPASAQEIEDTITVMGGQDWELWIDALEGAGVLADGARSVAFSYIGTEITWPIYWHGALGKAKVDLDRTAQRLNARLAKHGGGANVAVLKSVVTQASAAIPVMPLYISMVYKIMKEKGLHEGTIEQLDRLFRERLYRQDGQPAEVDEQNRLRLDDWELRDDVQDACKALWPQVTTENLFELTDYAGYKHEFLKLFGFGRTDVDYDADVATDVAFDCIEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determination of the Crystal Structure and Active Residues of FabV, the Enoyl-ACP Reductase from Xanthomonas oryzae.
pubmed doi rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Oxidoreductase
molecule keywords Enoyl-ACP Reductase
total genus 141
structure length 390
sequence length 390
ec nomenclature ec 1.3.1.44: Trans-2-enoyl-CoA reductase (NAD(+)).
pdb deposition date 2011-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07055 Eno-Rase_FAD_bd Enoyl reductase FAD binding domain
A PF12241 Enoyl_reductase Trans-2-enoyl-CoA reductase catalytic region
A PF12242 Eno-Rase_NADH_b NAD(P)H binding domain of trans-2-enoyl-CoA reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3s8mA00
3RC7A 2B37A 1CDOA 5A9RA 4BIIA 4K6FA 3PP8A 4J43A 3WFIA 5JFOA 1UZLA 4ND3A 3PK0A 1PZEA 1XIVA 3A06A 4Z9XA 3IDSA 1UZMA 5CG2A 2C5AA 1LUAA 1NPYA 4BO9A 2G1UA 2LDXA 3QVOA 2XXBA 2A92A 4GQAA 4EEXA 1GTMA 3H65A 3PJDA 3PWKA 1LDEA 1GV0A 2AA3A 4RPJA 1A4UA 1LSSA 4J91A 1ZK4A 2PWZA 1GYPA 4PLWA 3KLMX 4ND5A 3BMNB 4B3IA 3HDHA 3AI2A 1FDVA 3LC2O 4XGIA 1GUYA 4EDFA 1ZFNA 2V7PA 3RKRA 4ZU3A 5CEFA 1U3WA 3OEWA 3E5MA 1C1DA 4PLYA 5CEJA 1EE9A 2B83A 3MJ4A 3ZN2A 2PFGA 1EQ2A 1XWFA 1LJ8A 1NFQA 3SLKA 1XR3A 1SNYA 4O63O 3RBVA 2E49A 2RAFA 1DLIA 2C59A 2JD2A 4WE3A 1M66A 1JKJA 1O6ZA 4HWKA 4RPHA 4AJHA 4PZCA 1VE9A 4PG4A 1PQWA 4BQPA 3TF5A 1Y5RA 3F5SA 3COSA 1SCUA 2EP5A 3UHAA 1PJCA 4CMAA 4CM8B 2RH8A 4KOAA 1K6JA 2CSUA 2FHSA 3STHA 3Q3CA 3RROA 3NT4A 4E30A 3KUXA 2O2YA 3G1TA 5DT9A 1I33A 1CJCA 3IUSA 4IDBA 1A71A 5KJCA 4Y8VA 2ZKLA 1Y8QA 4NBTA 3U4HA 5I7VA 2CF5A 2IXAA 3FRJA 1HWYA 3F4BA 4OSPA 1M6HA 1JA9A 3L9WA 2OXIA 5CP8A 3DC2A 2Z5LA 4IIVA 3QQPA 5IJZA 1N7GA 5AOVA 3WIEA 1TXGA 2AQKA 2JHFA 5KJ1A 3I1JA 3DZKA 3GDGA 5BSFA 3G17A 3TJRA 5AVOA 5CDUA 3EAGA 3GZNB 3BMOB 3JD1A 1IUKA 3PLNA 3QSGA 2RHRA 3TZHA 3PRJA 1P31A 4FFRA 4MVJG 2O3QA 5JC8A 4XIJA 3QVTA 1PGQA 3HSKA 1KVSA 5IN5A 4S3MA 3K9QO 5JSFA 1BVRA 4GGPA 1JVSA 2UV8A 1VSVA 1IHYA 2P4QA 1L1FA 5B4TA 2GUGA 2GN9A 2E48A 4FJ2A 3GFGA 4P38A 5G0TA 1NFFA 2I6TA 5COAA 4Z0PA 3IP3A 4U0JA 2VNAA 4BKOA 2BFOA 1T2FA 3EC7A 3T4EA 4IS2A 4WECA 3W6UA 3KM0A 2Y1CA 1NQTA 4M8SA 1X13A 2EF1A 1A9ZA 4PRKA 2ET6A 1JKFA 1X7DA 4JX8A 1X0XA 1DJNA 1AXEA 3PGJA 3A28A 2Q2VA 5T8KC 2DFDA 1U3TA 3ADPA 3NTQA 3WQQA 1VC2A 2JAPA 1KVQA 2PD4A 3D3WA 1ONNA 1EZ4A 1Q0HA 2EEZA 2ZATA 4RQTA 2JD1A 3RIHA 4RZHA 3IKTA 1VLLA 2PY6A 3SXPA 2V6GA 4K1LA 4LMRA 4NQZA 3QIVA 3VDRA 1SMKA 2G5CA 2IEDA 4DUPA 5HRUA 3RSHA 4BNUA 1LI4A 1DSSG 1ISHA 2OUIA 2BMAA 5IZ4A 4XJTA 3FSRA 1QORA 3U4DA 2OOSA 3JD2A 3I3OA 4FC7A 4RQUA 3DEYX 4HFJA 4E2WA 5ER6A 2P9CA 2VHZA 2X7HA 4OO3A 1G1AA 1WLYA 3PVZA 1T2EA 4TZKA 2DTDA 3GQVA 1DDOA 1N92A 3FPLA 2O7QA 5EJ2A 4YACA 1I5RA 4KP7A 4MVJD 4CM4B 4J1QA 4M86A 3CINA 1JW9B 1N1EA 3L4BC 2OP1A 3NDIA 1VKNA 2X9GA 4NDNE 1Z6ZA 1YRLA 3QY9A 3M1LA 4RORA 1DC6A 3DAFA 4J90A 3JQ7A 1J6UA 1YB1A 4HNHA 1KC3A 2PD3A 1E1LA 2NTJA 3FTPA 4ID9A 4TSKA 2DLDA 4OSOA 1I2CA 5KWEA 2O4UX 3VPSA 4E21A 1NYTA 3GR6A 3LLSA 4A03A 5ER9A 5KVVA 5A05A 3WXBA 3PDUA 1C0LA 4HX5A 4BNWA 2ZTVA 5CFZA 1BXZA 1H9BA 4PLFA 4KMSA 5ITWA 4JCOA 1DO8A 3QV1A 5G0UA 2QX7A 3K5PA 3JD4A 3JQ9A 3DZBA 3ANMA 4MVJH 1LTHR 3QVXA 3ROQA 4PIVA 5GY7A 3RUIA 4LVUA 2NADA 4LRSB 4RCVA 2PH5A 1H5QA 2O4CA 3JQGB 4PG6A 4DIBA 4GSKA 1Y8RA 4E33A 4D79A 3WGQA 4D3SA 1VL8A 1V6AA 1HZZA 2I67A 4UUNA 3GT0A 1G6KA 3JQDA 2XPCA 4FQ8A 4YXFA 5BNTA 3HHPA 4MIYA 4OKIA 2V65A 3QE3A 1GPDG 2WSBA 2X0RA 3CMMA 4F46A 4WASA 3A1NA 5JCJD 4FC6A 4DA9A 1DXYA 2CFCA 3D64A 3OIDA 3T4XA 3H9EO 5A06A 2AQ8A 2NU6A 3WMWA 3DHYA 5BNIA 4R9SA 5TLSA 4CMHA 1RPNA 4GL4A 5DBFA 4CMEA 3DXFA 1YBAA 3BZUA 3P2YA 4N5LA 3GN1A 4XYBA 3PXXA 2EGGA 3H4VA 2J3JA 1N7HA 2D8AA 2O3SA 3KZVA 4OXYA 3M2PA 3WJAA 7MDHA 3TOXA 2DUUA 2TMDA 1T1RA 2BHLA 4N54A 1YONA 5A5EA 4EITA 1U7TA 6ADHA 3I9OA 2JCXA 3LZ6A 2ZTMA 4IMPA 3GAZA 1B16A 4CLRA 1Y5MA 3OJEA 2B0JA 2GO1A 3JCZA 4BO8A 3W8EA 2G76A 5THQA 4A5OA 4G81A 2TMGA 1M75A 1T24A 2ZB3A 4OOEA 5JLAA 3JQ9C 3LC7O 1P1RA 3ZWAA 1K3TA 5JDIC 4E5PA 2HK7A 1WDKA 4B4OA 1YKFA 4Z9FA 3TSCA 2YJZA 5H81A 1EVZA 1AXGA 4CM6A 2VUTA 4AJLA 1LC3A 4AVYA 1GEGA 3B1JA 5DP2A 1LU9A 3OETA 2H9IA 5BSGA 5C3MA 2GYYA 1DIHA 1Z45A 1SBYA 4WLUA 5H83A 5IXYA 3DZJA 5JAZA 3WGHA 2EKLA 4J7CA 3TNLA 2CVQA 2Y1GA 3GVHA 4N7RA 1I3LA 1A7AA 1ZK3A 1KVRA 5IZCC 1WPQA 3DBVO 3WIDA 4E2ZA 1MFZA 2GPTA 3G79A 5HBRA 1GQQA 3RU9A 4CJXA 1JWAB 5CDTA 2Q1SA 4C7JA 4E13A 3LT0A 3WOHA 1HYHA 4YAEA 3HE3A 3ROMA 3ICCA 4DMLA 1B0AA 1O5IA 1QYXA 4XX0A 4AL4A 3MJSA 1K6XA 3KXDA 1HDZA 3WDSA 2NVBA 2I99A 1LSOA 2GN4A 1DAPA 2DKNA 4JBIA 1PL8A 4YAIA 1LX6A 4ALLA 3V1TC 1DRWA 3PWSA 2I76A 1E3JA 2EGHA 3MTGA 4I5EA 2Q1TA 2WTBA 2YDXA 5DN9A 2G82A 5T67A 1P44A 3TFOA 1HSOA 2OL4A 1Y81A 1W4ZA 4MVJE 2O3RA 5G0WA 3PIIA 1Q7CA 3VZPA 5JMWA 2LDBA 3JQFC 3CE6A 1M67A 3RUAA 4R1UA 1HE4A 5DP1A 4H16A 1E77A 3VZQA 2PKQP 1AN9A 1VSUA 4WLVA 4LRTB 1GUFA 4JJFA 1BWSA 1R12A 3WGIA 3ASVA 4PRLA 1N8KA 4BNJA 1MC4A 4YBZA 1YQDA 1O94A 1YWGO 2C82A 1PJ3A 1N9GB 1UXJA 4G5HA 3GLQA 4IDEA 4R5HA 4D7AA 5KNLA 1YDWA 1YVEI 3L4SO 3ZU4A 4BNXA 3HG7A 2QYTA 1ZSVA 3GGOA 3INGA 1ISIA 2BKAA 2QRJA 3ETDA 3FN4A 4PLPA 2HLPA 4J6FA 1LA2A 1A5ZA 1OAAA 9LDTA 1IULA 2GGSA 2YHIA 1T4BA 1RM5A 2VWGA 1VL6A 1U2GA 1Z73A 4GGOA 4E4YA 8LDHA 4FOSA 5FI5A 4NK5A 4Q3AA 4BO0A 4YJFA 4NU5A 4KQWA 2X1HA 4ZA2A 3NT5A 1BGVA 1UXGA 1IHXA 1LRJA 1DLJA 3RFVA 2EV9A 2PKQO 2VWPA 4DGSA 3E9MA 1GQ2A 3GEGA 4AICA 2PZJA 4IGEA 5EERA 2WJPA 3AY7A 3DZGA 1E3EA 3Q9NA 3OBBA 1O8CA 4R54A 2C7VA 2R2GA 1NAIA 4RF5A 4RDIA 3UUWA 4CMGA 1KY5A 3FI9A 3RKUA 4ZICA 5DULA 4NI5A 1QLJA 5THKA 5JO0A 1KVUA 1A9YA 3GNSA 2AW5A 3OA0A 2B4TO 3WYEA 1FXSA 5GZ6A 2AEMA 3HQ4O 4BNHA 2Q1UA 4E12A 1YO6A 3F1KA 4MP8A 4YDRA 5BT9A 3ULKA 4OIMA 1R4NB 3TRIA 3INRA 4NFHA 4R1NA 1P1JA 3KSUA 1LDBA 1WW8A 3KHUA 4JP2A 4Y6PA 1NHWA 4UEJA 4BMNA 4Z6KA 5I9NA 5DBGA 1ZXLA 2GN8A 2O48X 4WCFB 2A94A 2CF6A 5J23A 4N18A 2GR9A 3VPGA 4II2A 4J9UE 3BTSA 2Z95A 1BRMA 2NACA 3JD3A 2X86A 4NNJA 3AU8A 2AMFA 4L0QA 2NLOA 1E1KA 4WPGA 4R68A 4BNMA 4MP6A 3FNGA 4EUFA 3RAJA 2UYYA 4WEQA 1C3VA 5EL0A 5I8ZA 3IIEA 4BNNA 1EFKA 4QO7A 3RUCA 1BW9A 2PZLA 1ADBA 4ROSA 3P19A 4DVJA 4XCVA 3NDRA 2VRCA 1K0UA 4WK6A 1C0IA 3CPSA 3ZHYA 5U1PA 4B4WA 4OGWA 4J1NA 4R3WA 4HP8A 1B8PA 3NRCA 1FDTA 1HKUA 4I8XA 4ZQBA 3IP1A 2VT3A 4BV9A 1ZK2A 1E7QA 4AJNA 1X1TA 4NBRA 2BI7A 2IZZA 2B69A 1KETA 4Q3EA 1EK5A 2W90A 1OBFO 1EBFA 4CV2A 2O3UA 4OQYA 4MVJI 1QP8A 4TRJA 1IL0A 3FR7A 2GNAA 1SB9A 3PJEA 4YT2A 3JYNA 4XB1A 1P77A 4BO2A 5JAIA 4Q39A 5KTKA 3E5RA 3R3SA 2DTXA 3ZV3A 1AHHA 5F1OA 3U9LA 1CEQA 4RF3A 2OORA 2CVOA 4IDGA 3K8ZA 5JAMA 5ILGA 5EESA 4MJLA 3X2EA 3ZCXA 3C1OA 4CQMD 4MP3A 2J3HA 4UVGA 3WGGA 4CLDA 3H2SA 4LGVA 3FHLA 3AFMA 3PDJA 4EZBA 1WMBA 3DBRB 4BO1A 4JBHA 5LDGA 3QWAA 1YS4A 5TF4A 4JIGA 4DL9A 1BDBA 1Z74A 3D4PA 1MUUA 2YQ4A 1XKQA 3NTRA 1LDGA 1IE3A 3SX2A 3O38A 4ZQEA 4FW8A 3FWZA 1HE2A 3WB9A 2AG8A 1L7DA 1HDOA 3BMQA 2NTVA 3KYCA 3S1LA 4E31A 4L4XA 1UUFA 4IBOA 1WXDA 5A04A 4LCEA 4CQLA 2AE1A 3RUDA 1ISFA 5COQA 4AJIA 2HMWA 4IQGA 2EHDA 1XGKA 2VZ0A 1P0FA 3GVIA 1I0ZA 5DCWA 3JQBC 5FI3A 3RUFA 3W8DA 5B4VA 2H6EA 3I52A 5ENVA 1Y8QB 5JC1A 1XQ6A 2DVMA 4Y67A 3OF2A 3JQAA 4BQRA 5KVCA 4NG5A 3K73O 3Q1LA 1PS8A 2PNFA 4F6CA 3FBGA 5DCYA 1UDBA 2ZTLA 1F8GA 3G49A 3RJ5A 2I65A 1QLHA 1D8AA 3H5AA 3E6AA 5CHEA 4CLXA 2BH9A 3H9UA 4I9HA 3DTTA 3UW3A 1RKXA 5EMHA 4DPKA 3PFFA 1VJ0A 5TIIA 4J1TA 4BGIA 3IOYA 4HUJA 4AJPA 2EJVA 2VUUA 3VPFA 1LLUA 2X0IA 1TT5B 3IC5A 3OQ1A 4NJMA 3RWBA 3D1LA 4MPDA 4PCVA 2CY0A 2ZYDA 1E7MA 4BKRA 2Q49A 3WICA 2HU2A 3LU1A 1BXGA 3WLFA 2FSVA 3ABIA 3KBOA 1DC4A 3ENNA 4CV1A 3MZ0A 4E0BA 3DFZA 5L40A 4KUHA 4CLRB 4NZ9A 2BFPA 1WP4A 4ALMA 1H6AA 2IE0A 2YV2A 3W8FA 4R5MA 4CR6A 5L7YA 2D2IA 3VKVA 2HAEA 4BNTA 4DRYA 1HDYA 1YGYA 4FOOA 5CDSA 1JVBA 4PVCA 1R0SA 1QSGA 2FWMX 3GK3A 3IJPA 1OZAA 4HADA 5A03A 1E3WA 4CMIA 2AEJA 1K89A 2BFMA 4YJDA 5CPBA 4YAJA 5CAEA 3B1KA 3GEMA 1KIFA 4IM7A 1EQUA 1GD1O 4GLOA 2NQTA 4J4BA 3EVNA 4JLWA 1DFIA 1DIGA 4TVOA 4MIOA 4OXNA 2XF8A 1U1IA 1Y1PA 1I3KA 2J6IA 1A7KA 2WEKA 4L8VA 5F21A 5TJ9A 1MC5A 5EPOA 3QJ5A 1NASA 5DNAA 5IDQA 4CL8A 3CMCO 3ONFA 1BHSA 4DYDA 1KC1A 1N1GA 4NBWA 1C1XB 3RVDA 1YJQA 1NR7A 2YHUA 3DDNA 4K28A 1TT7A 2HRBA 2VHWA 4I1IA 4YT5A 5G4KB 4P4GA 5L95A 2ZJ0A 5JPIA 3L6EA 4DQVA 2RHCA 3BMCB 3WYCA 4ALIA 2DBZA 1P45A 2NU8A 3ZDFA 1HLPA 1J0XO 2GCGA 4H15A 4OMUA 3ONEA 4B4VA 2GN6A 1LRKA 4FFPA 4GPD1 4FIZA 1WMAA 4YR9A 4CM4A 2X0JA 1ZK1A 2X9VA 3L6OO 3QVWA 2OBNA 3UN1A 3KTDA 1PJBA 1PL7A 4XZ3A 4TRNA 2JAHA 4C4OA 1U8XX 4BO5A 3Q0EA 3WGZA 1ML3A 3C1TA 2BF7A 1MFPA 3PYLA 4EEZA 1P3DA 4IJUA 2VWHA 3JQ7B 2ZQZA 3H2ZA 4NH4A 5B4UA 3OJLA 1UP4A 4YEDA 2DU8A 3TZQA 4FR5A 4YJGA 4B79A 1UH5A 1ULSA 3GMDA 2CDAA 4I9NA 2BGLA 4CUKA 2PZKA 3K92A 3QRWA 3R1IA 1JLLA 1DB3A 1NP3A 3H9GA 2IZ1A 3WTBA 4ZHSA 1N9GA 2VOEA 4I08A 4IIUA 3DAPA 4H7PA 4RVFA 1VKOA 3A4VA 1D3AA 5LC1A 4Z0TA 3JQAD 3HDYA 3OH8A 3ZU3A 1H6CA 2D5AA 3RFXA 4FPXA 2W4QA 3FTNA 3WBFA 4QFCA 3WWYA 4PN3A 4XRGA 4M89A 1EE2A 3DL2A 5JCXA 1MXFA 2CMDA 3AUTA 4IPTA 4GLLA 1BXKA 4K6CA 1OC4A 3I5MA 2Y1DA 3V1UA 3SBOA 2UDPA 1X1EA 3AK4A 1I01A 4J0FA 1PZHA 3PIDA 4LN1A 1U5CA 3BYZA 3JQ6A 4XB2A 3W1VA 1PGOA 4MVJP 2YV1A 3D4OA 3NJ4A 4EBFA 2B5WA 2RIRA 4GBJA 4A26A 3UCXA 2NM0A 4JNKA 5K0ZA 1XQ1A 1E6EA 1I10A 2HDHA 2WYVA 2PGDA 4INAA 3W4KA 2JFFA 4ZRMA 4GMFA 3RJ9A 2RH4A 2Z1MA 4J0EA 4TWRA 4W7IA 3NYWA 3UKOA 4DMMA 4E5YA 1R4MA 4J2OA 4MKXA 4R3NA 2E37A 3I9LA 2FRDA 2IDZA 4IXTA 4D41A 3H3FA 3G3EA 1P74A 5IFLA 3FD8A 4UVIA 4D3DA 3PWZA 1YH3A 2ZB4A 4BOYA 4GX0A 1E7WA 4ITUA 3RQSA 3ST7A 1VJTA 5JO9A 5L7WA 4IJWA 5HWSA 4R69A 2R00C 5GZ1A 4A0SA 3VH4A 1DHTA 1IY8A 2IEBA 4DLLA 3NV9A 1PJLA 4XYGA 4ZVVA 9LDBA 4YJHB 4CPDA 1DHRA 4IINA 4EJMA 3E03A 3I23A 4YRDA 5L45A 1T1SA 4KTTE 2ZQYA 2XAAA 3GGPA 1R0KA 3KYDA 3VVCA 1B7GO 4P4LA 4BKPA 4RJTA 5I7SA 5IDWA 1H93A 3ZV6A 3LSYA 3S8MA 4R1TA 2Z1NA 1XELA 5EIOA 4IXWA 3SJUA 3U0BA 2DFVA 4IUYA 1PSDA 1XYGA 4Y6SA 2HKIA 4O59O 1NX6A 3DBLB 1P0CA 5TT0A 1ZUD1 3RUEA 3WNVA 1FJHA 1AGNA 1EVJA 2ILTA 1LQUA 3KSDO 4FGSA 1ZSNA 3GNTA 1HRDA 2AG5A 1YBMA 2YV3A 2EG9A 3WNQA 1B3BA 4A27A 3F4LA 4UAGA 1OMOA 1HSZA 3DR3A 1ADGA 2FR1A 3H3JA 3PTZA 1BVUA 4I5FA 5I7EA 3PZBA 1CF2O 2FR8A 3RC1A 3ORFA 4J4HA 4MDHA 3HN7A 2O23A 2HRZA 4RPGA 3EMKA 3HZZA 1MG5A 2QG4A 5ICSA 4S1VA 5T5QA 2HMSA 2VWQA 3ITDA 4WKGA 4FFOA 3BA1A 1ZSYA 1L7EA 3GPIA 1I36A 1YXMA 2Y1OA 3R3JA 3GGGA 1ZXBA 5DCUA 2QW8A 3JQ8B 4LSMA 2CD9A 4CM9A 4OH1A 1SC6A 3AW9A 4Z0HO 4JBGA 1DEHA 2POQX 2Q99A 1DJQA 1ONPA 3EHEA 3JQCA 1ZZEA 3GRKA 4RL6A 4P22A 3S2EA 3DZHA 1NR1A 2WE8A 4WCDA 4NFYA 2NUAA 1Q7GA 2V6FA 2DC1A 3PHGA 1GZ4A 1KYQA 3E9QA 1CQJA 3NGXA 4NJOA 4BHTA 3NT2A 4AJJA 1RM4A 8ADHA 2PH3A 3F3SA 5KJEA 1E3IA 1NWHA 1Q1NA 2WD7A 1GCOA 2CDCA 3EW7A 1HETA 1IZ0A 5F5LA 4GH5A 2YY7A 4MO2A 2FSSA 4QO8A 4ZQHA 3BTOA 3ZH2A 4J9VA 1ULUA 4QSMA 4KWHA 2PGJA 5DDIP 2F00A 4NPCA 1PGNA 2W98A 2Q50A 3KYBA 1LDYA 4IQ0A 4EGFA 3C7AA 3OIFA 2YFHA 2VYNA 2Y66A 1H0KA 2VT2A 1IPEA 3X2FA 4Z9YA 3ZNNA 2PTGA 1D1SA 3ZWYA 3IL2A 3H6KA 1JAYA 3L6DA 1X15A 4FCCA 4L75A 3M2TA 4BNZA 3O03A 3CH6A 3BAZA 5HS6A 2QZZA 3LK7A 4CV3A 3MOGA 1U2DA 5TRTA 2GZ2A 3FCOA 3OSUA 2C29D 3KEOA 3KSZO 1Z75A 1MX3A 5A1TA 5T8KA 1WNTA 1HYEA 4QQRA 4ILKA 3ZHZA 1I3NA 4YVFA 4WEOA 4HXYA 3PHHA 3ZW8A 2BGMA 1C0PA 1AHIA 3H5NA 1UP6A 4BO6A 3EZYA 2Q45A 2Q4BA 3UF0A 3HFGA 1PX0A 3SVTA 1QYWA 1PEDA 5JMPA 4PLCA 1T2AA 4XR9A 3GUYA 4JN6B 4GVXA 5AXDA 3KETA 3JYLA 4CUZA 3EYWA 3QVSA 4U6QA 1X7HA 4BNIA 3AFNA 3BHMA 1ADFA 1H9AA 3ROPA 2QRLA 1XCBA 3FNEA 2I66A 4IJVA 4IS3A 4K26A 1KEPA 4AFNA 2E4AA 4YT4A 2IRWA 1K6IA 1R4NA 1Q0LA 3H5RA 4HFRA 3WLEA 3QW2A 1A27A 2D5CA 3BTVA 1QV6A 2Q4EA 4CMIB 5IN4A 2HUNA 2G17A 1QYVA 4XQCA 4Z3DA 1DIAA 1TVEA 4BB5A 3ZWBA 3TN7A 3UCFA 2HK8A 1SOVA 3OICA 2OGUA 1K2WA 3RC2A 4CMCA 1EMDA 1BTOA 1YL7A 4TZTA 3FNHA 1HL3A 1XA0A 4FD3A 4PG5A 4UREA 4DLAA 4Y9DA 2VYVA 3PLRA 4WJZA 3I9NA 1PR9A 3EVTA 3IAHA 1HDRA 2H1SA 2UUOA 2YFQA 3NKLA 5KIAA 3LF2A 3L0DA 1PTJA 3NUGA 4ND2A 1C14A 1EFLA 3OMLA 3LT4A 4L9RA 4Q3CA 4UEKA 3LDHA 5JNLA 1UP7A 1AE1A 2E82A 1YOVA 4N5MA 4QXMA 3HN2A 4AJ4A 5A3VA 4EI2A 1H94A 5FFFA 1NQ5A 3I9KA 4TKLA 4CLHA 1HDXA 3BMOA 2C20A 2CDBA 4RVSA 4XYMA 4L4RA 3R6DA 3RBXA 3QLJA 4D0RA 3BMNA 4JGBA 3BXXA 4UUPA 1E6WA 4XGNA 4B7XA 2H63A 3ITKA 5T6BA 2Y93A 2GLXA 4WLNA 4WOJA 4A10A 3PFWO 3JQEA 2SCUA 2VCYA 2UUPA 3WWZA 4CM5A 4RLHA 4ZJUA 5KVSA 1YBVA 3ZHXA 2BD0A 1GFSA 4BB6A 1YB5A 1NQOA 4FS3A 5L4LA 4QX6A 2J5QA 3CKYA 3ADOA 4BGUA 5KKCA 2WYUA 2Y1EA 4PZDA 3IMFA 2UVDA 4WUVA 3INTA 5COBA 1QKIA 2A4KA 3AM4A 2VYND 3GPDG 1B8UA 4PG8A 1F12A 4RO0A 3EUWA 3VAZA 3V2GA 2IYPA 1HE5A 4MIEA 3KO8A 1X14A 5B12A 5TT1A 4E2XA 1FMCA 5HTOA 2GSDA 3PJFA 3LF1A 3O26A 4XQEA 1NWCA 1NVGA 1E7SA 1I32A 3UICA 4PGFA 3W4JA 1ZEJA 2DBRA 2PKRA 5CPFA 3D5TA 3WR5A 5F3RA 1WDLA 2P91A 4B3HA 3W6ZA 5JCJA 1RM0A 4J2HA 1B8VA 4DLBA 2FZWA 2D59A 5K9ZA 1HYGA 3GVPA 3SJ7A 4CQMB 4FFLA 5TSDA 1P1HA 1T4DA 2GZ1A 4RVDA 4HNGA 3WGYA 1LNQA 1W8DA 2X23A 3ANLA 4Q9NA 3AM5A 4CQLB 4YQZA 3K30A 1IB6A 4W9NA 5EN4A 1LXCA 2GZ3A 3PYMA 3WMXA 4D42A 4DC1A 3N7UA 3UH1A 1IZ9A 1N5DA 3JYPA 3UOGA 3CTMA 3OP4A 3PYXA 4IDCA 1JTVA 3WS7A 4AJEA 3VHRA 5GMOA 3GAFA 2EWMA 3UVEA 3BHIA 1ZNQO 2NVUA 3CUKA 4TQGA 4B8ZA 2EP7A 5JDCA 3HNPA 2I3GA 4B3JA 5C7OO 3I4FA 2Q3EA 1ZBQA 4IQ8A 4DC0A 2JCVA 4QEDA 2BRUA 4XA8A 5BSHA 3HB4X 2OP0A 2OMEA 1XG5A 1NAHA 1A72A 3F47A 3NAQA 1I3MA 2GDZA 3KV3O 5IAAA 5L51A 4TKMA 4NJMB 3CZRA 5DF1A 3CEAA 4CMBA 3PQDA 3GVCA 3I4CA 1EDZA 1UZNA 4R41A 3T7CA 3K2EA 4AJKA 4BV8A 1ISJA 4Y6RA 2WYWA 4JK3A 1J4AA 4D46A 1SPXA 1YQGA 5C5IA 4E2YA 2JCYA 3IS3A 1XDWA 3OFSA 3VPHA 1HXHA 5BSEA 4O5OA 1DIRA 1GYRA 1W6UA 2X9NA 1DFGA 1PR3A 5AXCA 5MGBA 2ZJ1A 2X58A 2Y68A 3O8QA 1GPJA 3MWEB 1LC0A 2ZYAA 3ON5A 4LISA 1NNUA 1O95A 2V6MA 4A7PA 1SEVA 1EVYA 2PZMA 4KUEA 5JYEA 1BDMA 4EUEA 4NBUA 4ZGWA 3LYLA 3UFXA 2BI8A 4K9DA 4BNVA 4FJ1A 4CV0A 2J8ZA 1HTBA 3IJRA 1H2HA 1JAXA 2B36A 3NX4A 4G2NA 4BNFA 3VOSA 2HJSA 1C1XA 1P1KA 2FPPA 5JDCC 1NPTO 5F1PA 5GZ3A 1LQTA 4PZEA 5KOIA 3QHAA 1PWXA 2Q2QA 1CWUA 3DHNA 2Y0CA 3GRPA 2OO5A 4M49A 4GKBA 1DOHA 1B26A 4JROA 4U7WA 2FR0A 4YYZA 3WX0A 5I9LA 5IF3A 1E7RA 2NQ8A 3OIGA 1BG6A 2QRKA 4F3YA 5IXSA 4QT0A 1RYDA 3RD5A 3FBTA 5L4NA 4XDYA 3ZWOA 1UXIA 1DRUA 3GHHA 1ENPA 3F5QA 2X0NA 2DBVO 1TI7A 1DRVA 2I9PA 4H3VA 1U3VA 2VTDA 3C8MA 3ETGA 2WD8A 3AWDA 4DQUA 5G2OA 3JD0A 4GMGA 3OEYA 5K6AA 3ENKA 3U62A 1QV7A 3Q2IA 1MB4A 3SLGA 3JQBA 3T7EA 4W99A 3E1KA 2A9FA 4M54A 3TOZA 3VTFA 3JQGA 2BGKA 2WDZA 2X5JO 3O9ZA 3ZWCA 1GDHA 2AQIA 4NIMA 1E92A 1WZIA 3LT1A 4HKTA 4RPKA 4I5GA 4NFSA 3U49A 1ZCJA 1DFHA 3TL2A 5A5FA 2PD6A 3NTOA 3DB2A 4I9UA 4KDEA 1CYDA 5CDYA 3S2IA 1ORRA 1E5LA 3B70A 4M55A 2OZPA 3TL3A 4X54A 4CL3A 1ZVMA 3AJRA 4CMKA 6LDHA 1PQUA 2VHVA 2W2LD 3TZKA 4G65A 4PG7A 3VPXA 1VL0A 2HMUA 1GR0A 1KEUA 1VJ1A 3DAGA 3E48A 3IUPA 3DBHA 4FBGA 2GF2A 1DC5A 4KTVE 4CM3A 4GKVA 1ID1A 1QYDA 3JSAA 3NDJA 4TRMA 3S2FA 3ZU5A 3N58A 5A9TA 1JDJA 4Y98A 3P7MA 1P1IA 2IODA 3HFSA 1GUZA 2NU7A 2PGLA 5KKAA 4ND4A 2B4QA 2X5KO 3TZCA 3MJCA 2EKQA 5KCZA 3VZSA 4XRRA 2DUWA 3MOIA 4YTEA 3M6IA 1EBUA 4CLOB 4ALNA 3AI1A 3ZV5A 5K6AC 1PZFA 2AHRA 5I7FA 1O9BA 4B7UA 3V2HA 3WGTA 4FGWA 1ZJYA 4O0LA 3A14A 1PL6A 4PLHA 4GAEA 4ZN6A 3GMSA 1U7HA 2YQ5A 1LDMA 3EZLA 5FYDA 3L07A 2IXBA 4YWJA 2VRBA 2YUTA 2P2SA 2P68A 1UDCA 5JAQA 2J3KA 2FY8A 1VRWA 1FDUA 1XLTA 4M1QA 1MV8A 2EERA 1MLDA 3JYOA 1LLCA 1T26A 2YHIB 3HWRA 4P8RA 2Q2WA 1YB4A 3RI3A 1UXKA 5DBIA 3OJFA 1WAMA 1BSVA 4CLEA 1PGJA 3GH3A 1V8BA 4YJFB 1CRWG 1E5QA 3EK2A 1UJMA 3F9IA 1GAEO 1OOEA 3GZ4A 1YOVB 4MINA 1E1MA 3ROKA 4DBZA 2VHXA 2JKVA 3WQRA 4BGEA 3N74A 3LLVA 3IKVA 1KS9A 4LW8A 2W2KB 4QFDA 1Y7TA 1ZH8A 5FF9A 4OKNA 5FEUA 4XD2A 5ADHA 1ZIDA 4PLGA 5TC4A 4RF2A 3E9NA 5HA5A 4BS9A 4ONEA 5TQVA 1UAGA 3D5QA 1Q7BA 1Q2XA 4HFMA 1V3TA 1ZW1A 3VDQA 1GZ6A 2FOIA 2VOJA 5A9SA 3MCVA 3JQ8A 2WM3A 4KQXA 4UVHA 4IJKA 2OBYA 3NJ8A 1QRRA 3AUAA 1J49A 2PR2A 4BNGA 2HK9A 3VH1A 2C0CA 3OM9A 4Q3BA 3PPIA 4J7UA 4WLOA 1HF3A 3KRTA 5ITVA 1S7CA 4UEOA 1T25A 2HCTA 4GWGA 3U5TA 4D3FA 3DFUA 2OFPA 4CM9D 1V9LA 1V3UA 1EUDA 1GADO 2CNBA 3EY4A 1SZJG 3EGOA 1WWKA 4XKJA 3E8XA 2RCYA 2B4RO 1ISMA 3ZWPA 2VHYA 4YA6A 5KJ6A 3VVBA 3DONA 5ES3A 5JE8A 2DPGA 1R6DA 3WTCA 2WD7B 4IMRA 1DIBA 1ZMOA 1I8TA 3QWBA 3D0OA 3TDKA 3I83A 4YRAA 4BO3A 1HDCA 3GNQA 2FN7A 1PS0A 1SAYA 2JHGA 3E18A 4YQYA 3KVOA 4AJ1A 4B7CA 5EQFA 3PZRA 1FF9A 4XJSA 3VZRA 3H8VA 4UUOA 4D43A 2C07A 4WGGA 1LSUA 1M2WA 4DIOA 1DPGA 3U3XA 1U9JA 2IZ0A 2J5RA 5AQ1A 4OYRA 3A9WA 4BGVA 1H6DA 1GZ3A 3P2OA 3VH3A 3P5SA 1OI7A 3OECA 2X22A 4FFNA 3DMTA 4YCAA 5LDHA 2R00A 2VYVD 1U4SA 4J3FA 4QUKA 3D7LA 2HMTA 4XEHA 4GVLA 5U4QA 1N2SA 3TPCA 1RWBA 3DOJA 2RBEA 2XXJA 4FN4A 3G1UA 1R66A 3C1AA 3VC7A 3DTYA 4BKUA 1KVTA 2NVUB 4JJIA 2WE7A 3ZWMA 2JJYA 1EUCA 2EKPA 3BTUA 3TFQA 3ZW9A 1JKIA 2A35A 2P5UA 4WLFA 4W4TA 2F1KA 5MDHA 2VRCD 1PU2A 1J5PA 4B4UA 1E3WB 2PA3A 3L4BA 2I3AA 3I6QA 2O50A 1HDGO 1DC3A 4IY1A 4CM8A 3QWIA 2BFAA 1PGPA 4UULA 1YE3A 4U8GA 3SC6A 3CIFA 3K31A 3HDJA 2R6JA 4R9RA 3ZI0A 5LCXA 3RUHA 4JXKA 3GC6A 5F5NA 3C24A 5KVQA 2BELA 4FFMA 5C7LO 3FF4A 1LRLA 3KOUA 3GOHA 3ZV4A 2P9GA 3DBRA 1GY8A 1QMGA 4LMPA 1EUZA 3MTJA 4W7HA 3UAGA 1AUPA 1U28A 4A73A 1NVTA 3GG9A 2AE2A 5BQFA 3MJTA 1XEAA 3U09A 1VPDA 2QHXA 4NR0A 1YQXA 5G4KA 3O8QB 3F46A 3C3XA 5C7IO 1SB8A 2Y1FA 1Y6JA 3KYCB 1MG0A 3BMCA 3JQFA 4JQCA 3ICPA 1XU7A 1NXQA 4IDAA 2FPIA 3UCEA 2PK3A 2HMVA 4GX2A 2HO5A 3MWDB 3JYQA 4DQXA 4N5NA 4YRBA 4QTZA 1TA4A 4OQZA 2DBQA 2NSDA 3L9XA 4XIYA 3W4IA 4J1SA 3NGLA 4U0KA 1KERA 4U6SA 3JQAB 4XYEA 5EINA 2O2SA 4GSLA 4TMFA 1ZKMA 1GCUA 5TNXA 3G0OA 3RASA 4HY3A 3HDQA 4TRRA 1F0YA 1ENZA 2NV6A 1E6UA 4XYLA 2V6BA 4OAQA 1TB4A 5DZSA 4RGBA 2WMDA 2ZCUA 4TVBA 5JXWA 3B1FA 4BVAA 2DQ4A 1F17A 1C0KA 3RFTA 4YAGA 3Q11A 3HB5X 4KDFA 4C7KA 5A3JA 3JV7A 3HJAA 4PFJA 1BXGB 3QWFA 3RBZA 1V35A 3OHSX 3ZNPA 2DM6A 1GYQA 3SEFA 4L4SA 3RC9A 4BL5A 3ANNA 3PI7A 3IQDB 2BLLA 4GX1A 4BMVA 1QG6A 1JQBA 1R16A 4XGKA 3UXYA 1LLDA 1NTOA 2Y05A 3PHJA 2QYSA 2ZB7A 4PLZA 4YPOA 1HE3A 5H82A 2IYOA 5L3ZA 1IPFA 4OHUA 1O89A 2B35A 2QIOA 3AUSA 5ENDA 4YB8A 1ONOA 5CEEA 1LSJA 4B8WA 1JWBB 4ALJA 1LDNA 4RVGA 4ND1A 5JDIA 3I9MA 3ZZNA 5JYDA 3ZNQA 4U5QA 4RLSA 4L74A 1R4MB 2CUKA 3F6YA 1G0OA 1UDAA 3WG9A 3GDOA 1JN0A 1B14A 1OC2A 3GHYA 4CQMA 1VM6A 3DO5A 1GQYA 1U4OA 4XQ9A 5A4DA 3AU9A 1Z7BA 1V0JA 1Y9EA 1YJ8A 3GF4A 4J4TA 3GY0A 3GEDA 3MJVA 3FR8A 4PLVA 4ZD6A 4Q3NA 1TT5A 4EUHA 4D45A 3Q6IA 4J16A 3V8BA 3B6ZA 1TEHA 2O3JA 4JJGA 2X8LA 3DZIA 1K5HA 1KY4A 1PIWA 3KB6A 4D0SA 2HJRA 3DOCA 2JFHA 5ICMA 3VKUA 1C1DB 3PHLA 1GEEA 4I5DA 5L4SA 3TWOA 4NHEA 4NU6A 2HQ1A 2CVZA 1P9LA 4MVJF 1FDSA 3R0IA 5FWNA 1MGOA 3Q9UA 4A2CA 3GA0A 1YDEA 2J3IA 4KUGA 4CLOA 1NBOA 3HADA 3GDFA 5JBIA 2P5YA 1EK6A 2JL1A 2YDYA 4DIFA 3WQSB 2B5VA 1ZJZA 2EJWA 1PJQA 3BHJA 2VN8A 4PVDA 1Y8RB 2E6UX 3BIOA 1PJSA 2C2XA 1DBVO 4JP3A 4MVJM 5DOZA 3SC4A 4BNLA 4YT8A 1LEHA 1B15A 2DTEA 5ILOA 3CXRA 5TX7A 1PQPA 4QECA 4WOKA 3V5NA 1ZO8A 1ZK0A 3KEQA 2C5EA 4M87A 4WLEA 5IDXA 2GD1O 1LLQA 3ETEA 2ZCVA 1U3UA 1I24A 1D7OA 1S6YA 1HT0A 4GI2A 3VH2A 1BMDA 3AOGA 3GFBA 1IOLA 4E5MA 4LSWA 3OQ6A 3ZGYA 5I9MA 4CUJA 3PQEA 5G4LA 1R37A 4IGFA 5T64A 4HBGA 3AOEA 5TS3A 1PJTA 1ENYA 5JS6A 4MKRA 3BMQB 3H7AA 1CERA 3GZNA 2NTNA 3OJ0A 1P33A 4IDDA 2JFGA 2W8ZA 3K6JA 4KWIA 1YL6A 2EIHA 5L7TA 3F1LA 1KEWA 2H5LA 7ADHA 3TZ6A 2AXQA 1V3VA 1Z7EA 1ENOA 2C54A 4BNYA 4UUMA 2W2KA 3PQFA 1E3SA 2X6TA 4EJ6A 1GU7A 1R0LA 1KOLA 1FK8A 1QR6A 1KEVA 2JD0A 4E5NA 4DREA 5L9AA 4BO7A 4RF4A 3ZHBA 3DOOA 3ZWWA 5AYVA 3LVFO 1SOWA 1GV1A 3B20A 4II3A 4MOWA 4R51A 1ARZA 1U5AA 3GN2A 4W82A 4CM1A 2D0IA 4ALKA 5A9SB 5L53A 4L76A 4FDAA 3PJGA 2NU9A 2FPGA 2NVWA 2O7SA 2VTEA 4YJGB 4DWVA 1PWZA 3DZFA 4OXKA 3C7DB 5U9CA 3GVXA 4HFNA 3RCBA 3L77A 1MXHA 4IDFA 1VI2A 3CSDA 4NK4A 4Z3KA 3D3WB 3KYDB 5G0SA 3GG2A 5B1YA 1OFGA 5TJHA 2I5PO 3ZWVA 3M1AA 1F14A 4OJNA 3D3EA 3RU7A 1SEPA 1RYEA 3S2GA 1JU9A 3FWNA 1T2CA 4GWKA 4RPLA 4AJOA 4W9NC 1TLTA 3DBLA 2X4GA 1WZEA 2P4HX 3PGXA 4LK3A 5IDYA 3D4NA 3WSVA 3AUUA 4R1SA 4YAKA 3AOEC 1Z82A 1XHLA 2Y67A 4OM8A 4RZIA 3OJOA 4EJ0A 3FPCA 4LVCA 2XOXA 3QWHA 4WNCA 3DHEA 1XU9A 1ADCA 2GASA 2CZCA 4DPLA 4P4NA 4O6VA 3O4RA 5KJFA 5HS4A 4FB5A 4RDHA 3WGOA 2Y99A 2NNLD 4RV9A 4UVDA 1E1NA 3KLPX 2ZTUA 1NVMB 5CG1A 5TGDA 1H6BA 3UGKA 2OHXA 4O1MA 1SO8A 4IZIA 1W73A 3FNFA 3AI3A 3CZMA 4F6LA 3I9JA 3NEPX 2HSDA 1O0SA 4CMJA 1I2ZA 3S55A 3WYBA 3U4IA 4DXHA 4Q3DA 3HUDA 4BMSA 4E6PA 4CMEC 1DAOA 1CETA 4PLTA 2EXXA 1XSEA 3H9QA 4NBVA 2J5KA 1QYCA 2QZ9A 3K2BA 4FSHA 1PJ4A 1HLDA 1FDWA 1RM3A 3OQBA 1PJ2A 3DBHB 2UAGA 1I2BA 4YJHA 5JW6A 5BR7A 2Y0EA 2NWQA 1MP0A 2YW9A 1R15A 1P1FA 4CR7A 5JY1A 1ISGA 3VTZA 3AY6A 4RVUA 4E5KA 1ZEMA 2ZIZA 2WWRA 2GRAA 2EW8A 2PLAA 4WCFC 4BKQA 1HZJA 5F1KA 4UVEA 3OA2A 2FP4A 4URFA 1NQAO 2GERA 4DYVA 3AM3A 1E3LA 3ZWXA 3DWFA 1CQIA 2AQHA 4XQGA 1PS9A 1Q0QA 2D3TA 1UR5A 3LT2A 4R01A 4FJ0A 1YL5A 3ASUA 4GX5A 4E3ZA 1WVGA 3Q2KA 1GL3A 5BNFA 2DT5A 1NPDA 2O3TA 4XR4A 3QP9A 2YZ7A 1E0DA 4R16A 1F06A 4OL9A 2DPHA 4XDZA 5B37A 3WBBA 5AXBA 1RJWA 1PZGA 2X5OA 4WNIA 3PEFA 4CR8A 2VZ8A 4J49A 1IYZA 3LC1O 4EW6A 3QA9A 3PHIA 1LBEA 2AEFA 1KBZA 4ESOA 1X7GA 2P9EA 1EEHA 2FZEA 3DQPA 3DMTC 4ZQGA 1X0VA 1CIVA 3JTMA 3EDMA 3K96A 4BNKA 1MA0A 4XWYA 1T2DA 4HV4A 2C7GA 4MKZA 3LQFA 4CODB 5IZCA 2VNSA 3C7CB 1QXSA 2ZK7A 3WFJA 3WJ7A 1NFRA 5DOVA 4D44A 1G0NA 3AY3A 4KZPA 1HEUA 2VQ3A 3ZU2A 4ZQFA 2DAPA 2ZB8A 4E32A 5G0VA 2VUSA 3V2UA 1M76A 2D1YA 2W2LA 3H9JA 2Q1WA 5C37A 5IG2A 2EW2A 1H2BA 5EQDA 2PV7A 1WDMA 3ZNOA 3TQHA 4EYEA 4LCJA 2QQ5A 4TROA 3WSWA 1UAYA 4AJ2A 3MJEA 5A02A 2C2YA 1NM5A 4WCFA 1NHGA 1D1TA 1D4FA 1U8FO 4W6ZA 1A4IA 5I8WA 1EVIA 1I30A 5HM8A 3GUCA 4J7XA 3DMYA 1ZMTA 3C85A 4ZRNA 1B2LA 4RVHA 5AXAA 3E82A 2ZYGA 4OOFA 4DTIA 4IZHA 1EDOA 1Y9AA 4DPMA 1W0CA 4BO4A 3ZWNA 4CM7A 2G0TA 2FMUA 4AG3A 4L73A 1B3RA 1BW9B 4MVJA 5JY6A 4NMHA 4R4JA 1M6WA 4BUCA 3U4CA 5CDGA 2Y0DA 4DBVO 2D4AA 5T57A 1UXHA 2Q46A 3MEQA 3V1YA 1F8FA 2YYYA 2VZ9A 3ONDA 1E7YA 4F45A 3I6IA
chains in the Genus database with same CATH superfamily
4XDGA 3RC7A 1CDOA 3WE7A 4BIIA 3NALA 1TJPB 3PP8A 5GAJA 3ZDYB 1LW6E 2YWRA 1OWNA 4ND3A 4I50F 4F6RA 3Q8LA 2XUHA 3AV3A 1ZLYA 1JMYA 3NRJA 2Q0QA 4U9HS 3QXHA 2C5AA 4GEKA 4WOBA 2IBTA 1ULTA 3IV9A 4KCGA 1GPKA 2LDXA 5AVKA 3GXOA 4GQAA 4MNTA 3S99A 4ECEA 3H65A 3F2IA 3AUJB 3KJGA 3N70A 1Y6GA 4N40A 1OTHA 1Q77A 1TZKA 1A4UA 4XJXA 1LSSA 3I04M 3O7WA 4DY4A 1ZK4A 1IFXA 1NXWA 1O94D 5C8VA 1GYPA 1GAXA 4ND5A 4B3IA 1ZM2A 5CXSA 2AYZA 4CTOA 3V7NA 4X20A 2B3DA 4YAOA 1QCDA 2PO7A 3LC2O 1SY7A 1ZFNA 3WGNA 2V7PA 4OP1A 5AD1A 5HOQA 4B46A 3G5TA 3ZE0B 3IIIA 3SHVA 1IZYA 2C8VA 1C0EA 4Q3LA 1UJ6A 3LCCA 4KLAA 3DF7A 1RADA 3DR5A 1Z4PX 1NFQA 5HTKA 3SLKA 3LQKA 2R97A 4D5GA 1PG5A 5IUKC 1C4XA 2QR3A 3I0NA 5CGZA 4UTOA 3PLAE 3LKBA 4U2GA 1A5BB 1M66A 1JKJA 1O6ZA 4HWKA 4I4NA 1I1HA 4RELA 4RPHA 2XBLA 1A8UA 3PEYA 4KW7A 4PG4A 3GJXC 3GJZA 4RZQA 1PQWA 3ZHRA 3WC4A 3LRTA 3F5SA 2C42A 4JYZA 3COSA 1JNYA 1SCUA 2EP5A 2W9XA 1L4UA 2YCLA 2ZIAA 3UHAA 1W0KA 3DULA 3UJDA 1H8HA 1GGFA 2RH8A 3WGVA 3OU2A 1TRHA 3NAMA 2QVBA 1CEYA 4P35A 3STHA 2ZWPA 2O2YA 4V38A 2GKGA 2ZIGA 5DT9A 2CXOA 2PLWA 2NO0A 4AMGA 5KJCA 4EF4A 1C7RA 2HIGA 2Z43A 1F2DA 3DMGA 4M0LA 4Q7MB 3U4HA 2NO6A 3FSGD 3FRJA 2QGNA 3G23A 4MRVA 4OSPA 3IEUA 3RT7A 1JA9A 1YMQA 2HA6A 3DC2A 4NV0A 3SN6A 3SR0A 1RZUA 3N8IA 3QQPA 1IXZA 1T1JA 3IQFA 1RWXA 1X7XB 3HCPA 2F8MA 1UKYA 4OHVA 3R7LA 5C8DA 2XAUA 3IAUA 2C5SA 4B9AA 2XEXA 9LDTA 5KAPA 1HC7A 2MTBA 3GZNB 3QSGA 3I2IA 3JD1A 1NMZA 1NX9A 3TZHA 3FPFA 4FFRA 4MVJG 5IH7A 5JC8A 3REFA 1RSZA 4ZT5A 2BMWA 2ZRLA 1IBLB 4BLPA 3FYHA 2VDVE 3VJKA 4DJTA 2PBZA 3FF1A 2AYXA 3W5VA 1GARA 1UFQA 2UV8A 3NU1A 2AV6A 5E4TA 1IVYA 1VSVA 1JAIA 4P32A 3IMKA 5BWNA 1J0CA 1XMXA 2OVFA 2QN3A 1OH7A 2Y2UA 3KKNA 1BA3A 1Y82A 5TVKA 5KTSA 4KV7A 2I7XA 3NDPA 5E1OA 2I6TA 1OVGA 3IP3A 3GELA 4BKOA 3EC7A 5EKSA 3REOA 2PUGA 1EP9A 2FAXA 1QH9A 1XLUA 1WSWA 2PYIA 3VVMA 5DM4A 4Z7OB 1CNFA 1NQTA 1U6JA 1X13A 1LPBB 2C4TA 4YJ2B 4CXMA 1R0RE 3HA2A 4H6WA 1JDUA 1TW2A 3ZHQA 2C5LA 4O8ZA 2IYFA 2F3TA 1TMYA 1X7DA 4H1TA 4JX8A 3SGLA 2MSWA 3O91A 1L9KA 1E9BA 1AXEA 1VHTA 2A86A 3H1FA 4KXXA 5FI1B 2Q2VA 1J70A 2HU5A 2V58A 2DFDA 2Z5VA 2ZJ7A 2J9FB 5D7BA 1CJUC 3WQQA 5FL7D 1VC2A 3G0CA 3MJRA 4KB5A 2ZJ3A 3BQMB 4E08A 4ER3A 3UJNA 3HZOA 1N2BA 2A5YB 2PD4A 3D3WA 5ECYA 1SUBA 5IJ0B 3I6ZA 2WQ7A 4MLZA 1RCFA 2FSFA 2WM9B 2Z57A 1OB2A 4C6HA 2PUAA 2FN9A 1P1BA 3H5IA 2V6GA 3CJRA 1UJ5A 4K1LA 1TCUA 4LMRA 4NQZA 5J4YA 3DLBA 1SMKA 2G5CA 2IEDA 3GDHA 3VGPA 3RSHA 5JYBA 1OB5A 4U9IS 3WMEA 4XOUA 2BBSA 2CNLA 4RE5A 2QP9X 3TLXA 5JU6A 4XJTA 1JLRA 1R6VA 3PDHA 4L9AA 1ZIYA 3FSRA 5K05A 1G3QA 1QORA 3PT5A 2OOSA 3DWEX 3BL8A 1KKMA 4NATA 2FSPA 3OCJA 4UBIA 5IJAA 4ESEA 4E2WA 3QTBA 1HZZC 1Q74A 2GCPA 2P9CA 1G4UR 1YR7A 1WLYA 4TZKA 1J8YF 1IZ7A 1HKHA 3O8OB 1RJEA 3DOIA 4X8LA 3GQVA 4K05A 2F1OA 3B36A 3O2SB 1A98A 2BGTA 2HSZA 1M5UA 1W36B 1B8NA 1NMQA 2O7QA 2C4HA 3DCNA 3V32A 1I5RA 5INTA 3BL5A 1C81A 4KP7A 3D7MA 3FCAA 3MVEA 4MVJD 4O2BA 4M86A 3CINA 5AJUA 5EOVA 3VPAA 1N1EA 3QPCA 2WWXA 2G4LA 3L4BC 2H2DA 3KWFA 2XB6A 3R0XA 4JOSA 1NVVQ 1WW2A 3CNEA 1U3GA 4H6VA 4R7GA 1GCIA 4G85A 1II8B 3JQ7A 1H0RA 1J6UA 1RYYA 1KC3A 2PD3A 3DL4A 2ZM5A 3FTPA 2WYHA 4GFDA 4L2IB 1CUDA 4MVCA 5ICFA 2SECE 1I2CA 3MCTA 2Z98A 5DYTA 5KWEA 4S1WA 4ZPJA 3VPSA 3NYIA 2NZUG 4DLWA 4JL8A 3V8QA 3AL2A 4ZXPA 4H7JA 6Q21A 3FVQA 16PKA 2PSJA 4GQBA 3W6PA 5KTNA 5LIPA 2XF2A 2HL6A 1VMEA 4KYIB 4DCPA 1KGDA 4F06A 4BNWA 3AXSA 1L8XA 3MD9A 4OX9B 1WCYA 2YXDA 2R79A 1UAAA 3EH2A 4PLFA 2ZUWA 4KMSA 4WNYA 2NO1A 4X5OA 4RXUA 3QLVA 2H54A 2OO7A 5AK4A 3AHFA 3QV1A 2LCIA 1OAKA 2YJ3A 5FQOA 4MVJH 4R8SA 1KAMA 1LTHR 1VDZA 2HDWA 3M5WA 1E5TA 4UZEA 4YYEA 5CLFA 1DRJA 1EEXB 5LLSA 1Z08A 4PCAA 1CR6A 1AY0A 3RUIA 4UM8B 3QUSA 4KJZA 2CJXA 4LRSB 2I9KA 5ECWA 1XD8A 4DTCA 1B8OA 4C5BA 1Y6FA 4LC9A 4ZYZA 3O73A 4RY0A 5BOSB 2I67A 1XVLA 5E7QA 1XAHA 3G68A 2OLKA 3AERB 4K0RA 2YOGA 4H0NA 5DM2A 1E2JA 5B3JA 3T4PA 4DWOA 2GM4A 3SAJA 4O4JF 4RTRA 3DHVA 4EGQA 1GPDG 1JBKA 4JEMA 5JCJD 1CUBA 2PZAA 2D1FA 1ZG3A 4MQLA 5IAOA 2FEOA 5DBHX 3T4XA 2GA9A 1YZGA 4OUDB 1TCBA 2AQ8A 3HBAA 3SP1A 1PV1A 4LJRA 1D2HA 2PBFA 1UC4B 3DHYA 4JZYA 1P7PA 3ZH9B 4GL4A 3W2GA 3ZOKA 3CVUA 1RYNA 2HSJA 1ZN2A 3OIWA 4FSXA 5CT8A 1ZJ5A 1PUXA 2EGGA 1D4AA 3DW3X 3H4VA 3PXXA 5AJHA 3L49A 4CW7A 4KC0A 1E60A 1WXIA 2O3SA 3KZVA 1XXHE 2WAYA 3HY4A 1F0NA 4Y30A 4C3OB 3WJAA 1EE1A 5GGXA 1WZUA 1JFFB 4TLBA 4ZOAA 4UUQA 1YQUA 3KZ1E 4JYPA 4EITA 1QQ7A 3OLWA 1OZGA 4FT4A 2ISCA 1OYWA 3ED1A 3LZ6A 1YNOA 1HOXA 2J4CA 4IMPA 3K0HA 3WGLA 3GAZA 2QE7D 1B16A 1YCDA 3TYXA 4CKYA 3OTHA 2W6JD 4DFDA 2HCJB 3WXMA 3AHIA 2B0JA 3BJEA 3PTLA 5DISB 4F1KA 3W8EA 4F4UA 5BRJA 4U7DA 2G76A 4X8MA 2OBLA 4G81A 1SXGA 1GKYA 2PQ0A 4UC0A 3RS5A 1JDVA 5ALQA 1CW2B 3ZGNA 4NMWA 4EPWA 4EGAA 4S0XA 2E4XA 1P1RA 1K7SN 1E9VA 1MPTA 3KVNA 4E07A 3NIDB 4E5PA 5KSOA 3H05A 4YMLA 1CS0B 4Z9FA 2Y1XA 3S2ZA 5JNWA 2YJZA 4DUZB 2QSZA 2OK8A 1J8DA 1T5TA 2GK7A 2V9ZA 3L1VA 3O83A 1MTZA 2JLSA 4C06A 1WQ1R 2V8OA 4MICA 4AVYA 5F23A 3ZKWA 1G2PA 5C3MA 2VRWA 1SBYA 2P3OA 1OR8A 5IXYA 1BQ4A 2Q9UA 4PCUA 3H1TA 4L8YA 2XCTB 4KWTA 4AZ0A 1QCYA 4D96A 2GJAA 3N5CA 3TNLA 3HMQA 4XUGB 1KFKB 4N7RA 2HM7A 5IZCC 3EIFA 4QBIA 4HCJA 3G82C 3VUFA 5JQGB 5KNDH 4LHSA 4KU4A 1T9CA 2BTQB 5HBRA 1YRAA 1UKCA 1B23P 2G6TA 3W5HA 2JIQA 2WW8A 3VV3A 1EINA 1XEXA 2BISA 2O2CA 3BWCA 3NXKA 4YREA 5DBFA 5DH9A 5DN6D 5LOVF 1E2NA 3EVZA 4HLCA 3N2GA 1KNXA 1B0AA 1XK7A 2ZJ6A 3CKMA 3G02A 3G5AA 3G9QA 4H31A 4RKWA 1HDZA 4KPFC 1TTPB 1M7GA 2NVBA 3V6LA 2E3JA 1JJVA 2QV0A 1XWIA 4NBSA 1JR3E 3RSQA 3B85A 1R50A 2DKNA 3U31A 5NULA 1TADA 4PYLA 3UJ8A 1Y8ZA 4W5NA 1ZISA 2Q9BA 2ZWOA 4BFSA 3UFXB 3PWSA 2I76A 2P4EA 4D9KA 4I5EA 1E2FA 4FW9A 1GTZA 1JX6A 5FP0A 4UMDA 1DBPA 2FG5A 4IYJA 1DAIA 5CBPB 2WMNB 4KPEC 1W4ZA 4MVJE 2O3RA 5G0WA 1Q7CA 2XA9A 1N2JA 1I0LA 4L3WA 2P0YA 4V02A 3CS3A 1CRQA 3H0KA 5DSTA 4ZVTA 1E77A 1WUKS 1NSYA 1CRPA 2OXRA 4A9AA 2HWYA 2Y6VA 1EWKA 2ZIFA 5LQSA 5EMNA 5LDDC 2DMRA 4JJFA 1R12A 4MRRA 3MINA 4REQB 2ZYUX 4WBNF 1EWQA 3T9FA 3ODGA 4A0GA 1AUVA 3IRUA 2WJZB 1NF2A 1J00A 5DNDA 4BFCA 2EJBA 5BWMA 3RAFC 3A4MA 1FPQA 1UXJA 4O1HA 1OVMA 3GLQA 1GIAA 1UK8A 5KNLA 1YDWA 2FP4B 2IE8A 1G20B 1NULA 3LTEA 2ORED 3VSEA 3D4BA 2LWIA 1AUQA 2YZKA 4LK2A 1IBKB 1N1MA 1LPOA 1JHXA 3VU3A 2FPWA 3DOHA 3FN4A 4ZV9A 3Q3HA 4PLPA 2HLPA 3RHSA 2X7XA 4DV3B 1PV2A 5C52B 1IULA 1F3LA 5EWLA 1G5RA 5TB5A 5IFKA 2UVQA 1RM5A 4GBGA 1VL6A 1XMIA 1U2GA 1OXKB 1XF1A 4RL4A 3SHTA 2HNKA 4MTCA 5FI5A 4NK5A 4H18A 4QJ3A 3EWAA 4BO0A 2R3SA 1PTKA 1OGIA 4DF3A 1ACJA 5KDLA 1P0IA 4WY2A 2A5DA 1WETA 4XE5A 2EFJA 1O9GA 1K7FB 2EG5A 1BGVA 1UXGA 3NT5A 3RFVA 1DLJA 2WHXA 2PKQO 3W7VA 4LWZA 4DGSA 4YJ3A 1H3FA 1GQ2A 3N86A 4UBNA 1OH8A 2H52A 4IGEA 3BZBA 4BPBA 3AY7A 3DZGA 2H4FA 3W5IA 4BTEA 3BE5A 3Q9NA 1C7FA 5TPWB 4MDEA 4QDZA 1N1DA 1DEXA 4R54A 2VF7A 3VPDA 2R4QA 1Z29A 2GVNA 4P7BA 5F64A 1KBQA 5JBQA 3LL7A 4MCJA 1KY5A 1XX6A 4BQSA 1L3IA 3RKUA 3THXA 4CG0A 3LV8A 5D01A 3WO1A 1A9YA 2AW5A 4X63A 1QLWA 1AT1A 1BJRE 1CBUA 2UYQA 4MVYA 3UMBA 3ZZMA 5CFMA 2B8NA 2WKRA 3I34X 2D7CA 3C7TA 4A2WA 1YO6A 3F1KA 3QUCA 4BNHA 5BT9A 6NULA 1L7PA 5IT5A 4O02B 4FBMA 3Q7TA 4OIMA 1UM8A 1DC7A 5T3UA 4F71A 3KL4A 2HF2A 3CUYA 3EEFA 2ZPAA 4TLCA 1WW8A 3F7NA 3KHUA 2J33A 4G4JA 3ZV7A 3MBOA 4Y6PA 1NHWA 4DT1A 4DG5A 3U7QB 5DNVA 3SX4A 1CUFA 4BMNA 1U2PA 4Z6KA 5I9NA 3OIVA 3OEED 4D82A 4TTJA 4LYHA 2J59A 3M4YA 2O48X 4Q4CA 2JJ1A 1GFZA 2YMMA 2WI8A 3MUOA 1RPJA 3N8DA 4YJFB 3PKZA 2DERA 5C80A 4WI1A 4F1WA 3THRA 3VYRB 3AU8A 2HNAA 2AMFA 2NLOA 1Q20A 5ALNA 5JTTA 4FUTA 3SDBA 3DPSA 1KDTA 5AK3A 5ITSA 1S02A 4MP6A 2QOEA 3CLTC 1Z33A 3A3YA 2P6OA 1TLFA 3FA2A 5B7NA 1RXSA 1F38A 2H59A 2JDIA 3ZVRA 3OZCA 5I8ZA 5ALPA 4BNNA 3HB0A 3SFVA 1DAFA 1Q3HA 3LBIA 3MWGA 1T9HA 5LD2C 2CWDA 4BWGA 2CW5A 2PZLA 2C3MA 2H5JA 3E3OA 3IUJA 2IYNA 4R8KA 2CL6X 4NCBA 5BURA 3CPSA 3ANXA 4DZRA 3IVRA 3MELA 3WWDA 2ORVA 4KE8A 1XPJA 3U16A 1OU0A 5LQAA 1UBRS 2MWMA 5CB6A 1HKUA 3FCCA 3UAWA 2AJTA 2W6ZA 3OUUA 2ODAA 1EIZA 5FNVA 3OZEA 4L3VA 1E7QA 5EHXA 4JI5B 4AJNA 1H42A 4R8VA 4YJ3F 5LXTA 1XZEA 4Q21A 3BWMA 1MJNA 1EK5A 5AVVA 3KC2A 4F97A 3RRMA 2E4UA 1EBFA 4QQNA 5CH3A 5HSGA 1ECFA 2CXNA 2BZSA 3H87A 4QUGA 3U1VA 1Y89A 1CUIA 4CIVA 5L3QB 4N65A 1TA9A 4L5IA 4BMDA 3EXIB 4YT2A 1SUIA 2W6MA 2WP8J 2FFHA 2WWTA 4Q39A 4TXLA 2H85A 5EXPA 4BO2A 5I4CA 5IABA 5JAIA 3L82B 4CIYA 1AHHA 5F1OA 3U9LA 2AN5A 1RI5A 4G0MA 3L7LA 2NO5A 2P90A 2QG9A 2CBZA 2NUAB 3K8ZA 2GXAA 4QXQA 3ZCXA 2QTLA 5ELMA 4ME6A 1CHNA 1TD1A 4UVGA 3TH5A 1G291 3GLIE 1FS4A 4HNUA 1T35A 3IOEA 3FHLA 3F97A 5B6PA 3KEMA 4N76A 1XJQA 3K53A 2G25A 5F2KA 2D0DA 3B7GA 4QU5A 3WRVA 4D9HA 4H6XA 5LDGA 1GZUA 2IYTA 4BQNA 1D4OA 3ROFA 5C1OA 5TXGA 3DE6X 1ODIA 2OHIA 5C8YF 3L1JA 2FUCA 3D4PA 3QBDA 3NTVA 5K3SA 2YQ4A 1GRRA 3FE2A 3BEOA 1A8IA 4JLJA 4A5SA 1XAJA 1YVUA 3FYCA 1OFIA 4R84A 1L4LA 1G6Q1 2QAJA 3PE4A 4MSUA 4QYSA 4V0RA 3VI4B 4RKQA 3JAWA 3K4HA 4BX3A 1NLZA 1VRCA 1WXDA 2H29A 5A04A 2HNBA 4LCEA 3TBFA 3KVVA 3WLHA 2EARA 3W5AA 5AKZA 2JLXA 4V2UA 4NEHB 1PG2A 4AO6A 4UBMA 2ZSBA 5DCWA 3TRFA 5JSZA 1V8DA 3I52A 4Y7CA 4RTSA 2I4NA 5CFNA 4N49A 3OF2A 3CZPA 1M74A 5AESA 3QVGB 1MBZA 2F7SA 1E2KA 1J25A 1PS8A 1TM1E 1M34E 4GRIA 1LPNA 3FBGA 4HGYA 5DCYA 3ACBA 2VK8A 2PN1A 1RFLA 3EHDA 3KZXA 3Q72A 1JECA 4INPA 4Y9TA 2PL1A 2VTBB 2QSUA 1DDIA 4B6QA 1JT9A 2M1ZA 3PSAA 4DCCA 2APJA 1II9A 3OUTA 3OD1A 4CLXA 1USWA 3MMPA 4IH4A 2NU9B 2UUAB 4YQEA 3VAAA 3PFFA 1VJ0A 3B9QA 4DPKA 4J1TA 4BGIA 5TIIA 2C88A 1AKWA 2BMVA 2VUUA 5LOVB 4QVIA 2X0IA 1SURA 1TT5B 4TSRA 3SQNA 1R1DA 1YULA 4O4IB 3NTXA 1VL1A 3RWBA 3W2TA 5LP6F 3QENA 2CFRA 1V47A 3CB4A 1NUHA 4MULA 1FUIA 4G84A 3KPWA 1UFKA 2Q49A 4FNGA 2RE8A 2FDXA 5E0OA 4H7KA 1U11A 5KI6A 1JG4A 5B7PA 3ILXA 1WTCA 4HGNA 1Z88A 3KBOA 1LWOA 2PJUA 1IONA 2V4UA 4MLPA 1MO3A 3R8CA 4JVLA 4Q37A 3WKAA 5L40A 3G89A 1IUOA 2D06A 1ZR4A 2BFPA 4EJFA 1D9ZA 2A6PA 1XTRA 4L78A 3N05A 3QLUA 4K87A 6REQA 1YGYA 2AMJA 5FLEX 2FWMX 3AWIA 5CNKA 3GK3A 4QLOA 4EY5A 1Z4JA 2IKQA 4JJEA 3ELBA 2XCSB 1OZAA 2CMGA 4HADA 3M9LA 3SQMA 4EHKA 1G3IA 3CISA 4JQZA 5IC4A 2AEJA 3T61A 4YJDA 3WL4A 4JELA 1TJ4A 2PRKA 4KQ2A 2CLLB 3B1KA 4YAJA 4JJ6A 1CUSA 3ODPA 1SELA 2HT6A 2IPXA 3GNLA 4IM7A 3ZD6A 4JLWA 1OGJA 4J4BA 1UDRA 2Q1XA 2O2DA 1DFIA 1P7CA 4TVOA 2B30A 2IGTA 1XAGA 1I3KA 2J6IA 2VHQA 1GZSA 3MXTA 5F21A 2NN3C 2VPQA 4IV8A 4AQYB 5TJ9A 1LF0A 4TMYA 1IIBA 1TPZA 2XYQA 2VK4A 2W42A 1K4MA 1TCAA 2VQDA 1SM4A 2XUIA 3DMDA 3OCZA 4FYJA 3T6KA 5IDQA 3K70C 4AYWA 2GMWA 3NHFA 3ONFA 1BHSA 1JS1X 1WB5A 3SIXA 3E7WA 3PC6A 4DYDA 8ABPA 4AKEA 3F6SA 1ZGGA 4NBWA 4OFZA 4XH9B 4X91A 2TMYA 4LDQA 4QLBA 5C8ZA 4L95C 4D57A 1C9DB 1UC9A 4P98A 1P2BA 3DDNA 3EGCA 3RT1A 5BN1A 3MCAA 5DBEX 3W5SA 4MYCA 4B32A 5L95A 1QIIA 1L0BA 3FI0A 4FONA 5KNCD 1JHUA 3CLSD 3DTNA 4AZSA 5LQJA 3IAM1 3PNQA 2OV1A 5ERXA 3JQRA 3GLKA 1ACLA 2JIDA 1X8XA 3O5AA 4ALIA 4DQVA 2ZR7A 1IN7A 3IE1A 3VYTB 1BAPA 2FPIB 4K9NA 4MLDA 3HJTA 4RANA 5FNVF 4I1PA 1RYMA 1K8RA 4D2IA 1JDBB 2R5NA 5EC8A 1TECE 4GECA 2QRPA 3U3DA 4H15A 3EIHA 3LX6A 3BIWA 3ONEA 4NXMB 2GN6A 4MHTA 4FFPA 5E3IA 4YR9A 1EFTA 3A25A 2WLTA 2GBFA 3UKDA 1O8BA 2H00A 2X9VA 3THOA 1KFBB 1PL7A 1ORTA 1CQPA 2GB4A 3GLVA 2P9HA 4HWPA 1KAGA 4QUJA 4TRNA 4C4OA 4CF3A 3BERA 3CH5A 1GG8A 2WSLA 3C1TA 4DSUA 4Q12A 4PYRA 4HRVA 5FLXA 1P3DA 3EQ9A 4IJUA 5DMXA 1NXPA 3JQ7B 4BMYA 3UB3A 3RYIA 3OOWA 5HHTA 3R75A 4DCJA 2BRUC 5KZMB 2WTXA 4FR0A 4FR5A 3TZQA 5IN4A 2LP4Y 3PU6A 3QVJA 1CZUA 3L7KA 5JR3A 1ZUWA 2GAOA 2BGLA 2I2XB 4KYUA 5AJWA 2UXCB 4W6QA 4B84A 3K92A 3QRWA 5FAXA 4D4HA 2WPDA 3R1IA 1YTUA 3I72A 1DKNA 3KT3A 1JLLA 4EZIA 2GSWA 1EWVA 2CLMB 1DB3A 3UC5A 3RNOA 3OE5A 5B2FA 4AS1A 4JB3A 1RBZA 1S01A 1XJWA 2N46A 3NEJA 3B6JA 3DAPA 4H7PA 1T8SA 3TUIC 4DMRA 4Z0TA 3OWXA 4EG7A 1H6CA 1I9GA 3ZUGA 1B6SA 3W7BA 2D5AA 1C7IA 3RFXA 4ZMSA 3FTNA 3FUUA 1Z5GA 3EF0A 5AKIA 4CEIB 1EE2A 2WFZA 3W5BA 1MXFA 1T6YA 4TYWA 1NW3A 2CL0X 4RH1A 4ZRDA 4DCTA 3ZU6A 2P6RA 2ZS8A 3HKCB 2Y1DA 1RHKA 6AT1A 3VU9A 2DOKA 2FZ4A 1X1EA 4DG9A 4HAVA 2PMFA 3MAAC 1I4WA 1MB3A 1TM4E 5FUVA 3S2UA 5LMCA 4MGIR 4C2BA 1FZTA 2FZLA 1W49A 2B5WA 3AX6A 3C6BA 4YRZA 4GBJA 4CEHB 3FLBA 2WHRA 4B6RA 3HBJA 2KM1A 2NM0A 5SYAA 3TINA 2H06A 1SXJC 1XO1A 2PGDA 2ZR0A 4AIIA 4TTVA 3A8TA 2FGJA 3RJ9A 2RH4A 4J0EA 2V4MA 4TWRA 4W7IA 4DMMA 4E5YA 3EEQA 1R4MA 1ZD4A 4M88A 2ERCA 2P9JA 3QF4B 4MKXA 4PYNA 5KTPA 3T9CA 3I9LA 4HATA 4QDTA 5CVVA 4RSGA 4D41A 3H3FA 1T2NA 3G3EA 1P74A 4MUYA 1HNNA 2D2VA 3HA3A 3O1LA 4N0QA 5FTLA 4P4UA 1E4VA 2NG1A 3PWZA 1KO7A 4K9MA 3HXLA 4JUIA 4ITUA 4Q1AA 3RQSA 3L8DA 4H7IA 4F72A 5LQKA 1QIKA 3C3EA 2YMQA 4FYWA 4JFAA 5JO9A 4C7MA 5GZ1A 3WLQA 4BLTA 3CLRD 2HMAA 1SUEA 4DLLA 1F7VA 4QDJA 2CJFA 5JXGA 4ZVVA 1WUIS 2XYVA 3WZLA 5AVRA 1DHRA 3A11A 4OPMA 4WIAA 1V8OA 4IINA 1A5AB 3O8DA 1NMXA 1BMQA 1MQAA 1MT3A 1C3XA 1T1SA 3BDIA 2GAJA 4KTTE 3GGPA 1M0SA 3JASA 3KYDA 3JVIA 3VVCA 2FGKA 2IYYA 1APBA 3LIIA 4QVKA 1MAVA 2CCGA 2J0SA 2J3QA 4PRZA 4MW0A 2D7JA 1VMDA 4KAXA 3K4QA 2DFVA 4JITA 1CV2A 5IX8A 1IK4A 1EFCA 4NZMA 2DQZA 1U2GC 3OKAA 4PSVA 4XSHA 3PIRA 4Y6SA 4QGGA 1NX6A 4DZTA 1CE8A 4HAUA 2PS1A 3HYCA 4UHFA 3T0FA 2V54A 3WNVA 1FJHA 1RFGE 5EZYB 3X1JA 1QB7A 1VA5A 3QXSA 1LQUA 1MN6A 1SVMA 2VPWA 3S4YA 1HRDA 1V7ZA 1VZ2A 1YBMA 4HC4A 1FQKA 2EG9A 2YV3A 3EXFB 1E64A 4MQEA 3DFFA 1B3BA 1TZJA 2WFLA 3A9SA 1U90A 3BWXA 3JWEA 1OMOA 2I8AA 3DR3A 3PTZA 2ZYVX 3FKQA 4GOJA 1BVUA 1HEIA 1KDVA 4BATA 1PX2A 3KTAA 1JDZA 1RMYA 3PEVA 3PNBA 3HN7A 5HCIA 1NJGA 1UANA 1DPFA 2B0CA 4NOMA 3B78A 2O23A 3L7YA 3SZOA 2LKCA 4RPGA 3Q3IA 1VG0B 3HZZA 1KP3A 1L5WA 2CDNA 2A78A 2P9QA 4YHBA 2I7VA 4MEBA 5T5QA 3R4VA 3E35A 3ITDA 4IRXA 1XKTA 2BCJQ 1M1ZA 2J7KA 2Z2YA 3SE0A 4EUSA 1ZSYA 3EC1A 1DQRA 1R2QA 4Q6WA 2OESA 1ZXBA 3GGGA 4YALA 2VPTA 2XODA 2CD9A 3BIJA 3H1GA 4OH1A 1SC6A 3PRKE 3AW9A 1XZLA 1U3CA 4WXMA 3VMFA 4CM9A 1R7RA 4JBGA 3N2GB 1QP0A 3SI7A 2G9VA 5GJVC 5BV8A 2POQX 3PXBA 2BP7A 5F73A 2VDWA 1OYYA 4KL8S 3GRKA 1UODA 3AEKA 4K81B 4NNOA 5ECDA 3RRXA 4AUNA 2GQ0A 3K35A 4DBLC 5HIAA 3DLHA 1W5TA 3D43A 5I3ZA 4Q9HA 2LIPA 3UMGA 1BKDR 1DBIA 1SVLA 3L4JA 4MQ5A 4NJOA 3NGXA 5H5JA 4S2UA 2HHAA 2WF7A 3UYLA 4PN7A 3M5CA 4MYRA 4WZAE 5KJEA 1NWHA 2X5NA 1ZI6A 3PQ5A 4P0PB 1YGPA 4LRYA 3EW7A 2I87A 3G8CA 3KBBA 5K3FA 2ZIVB 1MHTA 4TM7A 1IZ0A 4MWTA 1QHHB 1XHFA 4TUYB 3UH0A 2C4NA 2YY7A 5M34A 5BMVA 4PO1A 1GGJA 2CLIB 2GZSA 4MV3A 4QO8A 3AUFA 4RSHA 4UBOA 1X80A 3G59A 2I2DA 3OJCA 2QRUA 2PGJA 5DDIP 3BXOA 5GQSA 1QUFA 5K0EA 2O0KA 2RK4A 4EKDA 3UJ3X 1JB1A 3KYBA 4IQ0A 4LSGA 3C7AA 1W4RA 4ZDWA 4B3SB 3OIFA 3H2HA 4RDCA 2VCEA 5IKOA 2PVPA 5KYXB 5C31A 1JNXX 1Q0UA 4HQ6A 4UJ3A 3TM5A 4PPGA 3VTKA 4IVNA 4AN4A 3IEKA 4BVLA 3QYJA 4BJ5A 1A50B 3IUNA 3D6JA 3VZDA 4B17A 5JJIA 2V4ZA 4Q9IA 2OB2A 5FOTA 3N8GA 3LK7A 3MOGA 1FVOA 4B6SA 2Y2VA 1KXZA 1C9MA 3MWKA 2C29D 1ILWA 4RMJA 1EP1B 1Z75A 5HVNA 1QJCA 3OTOB 4B44A 5B6JA 2DLNA 5T8KA 3SR4A 2XQKA 3QUTA 1ZM4A 3KQTA 4ILKA 1I3NA 4J29A 4ZZIA 5T4HA 4BNDA 3DG9A 3PPVA 1G3UA 5K1ZA 2CXUA 4DEYA 1HX7A 2PUHA 1I0IA 1X7YA 2GBPA 2ZUBA 1Z2DA 2ZZKA 3LPDA 2G77B 2OQVA 3MB8A 1J23A 3DDZX 3H1BA 2PS9A 4FDLA 4F96A 4EO7A 5CYFA 2QRGA 4X93A 3HFGA 1T5OA 3A2LA 1A04A 1CLEA 2XNHA 1PEDA 2ZUTA 4B2LA 2ZS7A 2AFIB 3FOAA 4PNHA 2FWJA 3GRUA 1P7YA 2C61A 4BRSA 1GJRA 2A9RA 3PENA 3JYLA 2EKDA 3KETA 3LY9A 5I3CA 4Z1OA 3YASA 2W6JA 4RJLA 2EGUA 2C5HA 4HQLA 4BNIA 3AKZA 4L5AA 1RLUA 1SOAA 3HABA 3UWPA 4C6RA 4I99A 2FPLA 1M73E 2RD2A 3ROPA 5LZ2A 2EJCA 4P83A 4IJVA 1VYTA 5LBIA 1I3CA 1V5EA 3WHPA 3SMQA 1KEPA 1P9OA 3OY7A 5DYGA 2WIBA 1Q0LA 3H5RA 5LA6F 4IFEA 2W8BA 3QW2A 4PWYA 4ZVSA 3INYA 1RI1A 1RQRA 4Z7NB 2D5CA 4EZEA 2R1VB 3OZWA 5IK2D 2E2WA 1Y6QA 2CHGA 1CUYA 1NYRA 2HUNA 4RKEA 3TLGA 3QBJA 3U7QA 2GCEA 1L8AA 2JKZA 2VJOA 1DIAA 1TVEA 2W0MA 3HEBA 4U7JA 4UEQA 4BB5A 4DDMA 3Q40A 5IT4A 5F9FA 2HK8A 3HSYA 1ZBDA 1OFVA 3EQZA 4M8KA 3HDTA 4UNIA 2IU0A 1I2MA 1ZN7A 1XL1A 3OICA 5CNIA 3SZ3A 2C1ZA 4RD6A 2F8TA 1CQIB 4X1KB 1M2NA 1CK4A 1YL7A 2ZSUA 3F0TA 3FNHA 3JRNA 3P27A 4QJIA 3V8EA 3WO0A 2VYVA 1YT5A 3FVWA 2WTUA 3SQOA 4ZYLA 1FFDA 1AZTA 1PR9A 4ZDIA 1AGPA 1DAHA 4JBWA 1D6SA 5KIAA 2VS1A 3F5DA 3FJYA 4GPBA 4ND2A 1CQXA 1DL5A 4I8DA 2QM3A 4QREA 4C0KA 4HS4A 2V7TA 1IDOA 3MLAA 5M3BA 1UBHS 1USUA 2J0UA 5GJWC 3HN2A 1WOYA 1ZNZA 2QX6A 4WMLA 1NQ5A 4I6JA 4Y2RA 4YRLA 4IWNA 3P9QA 4TKLA 5FFFA 4XYMA 4L4RA 3CUWA 5WRFA 3QLJA 4F4FA 1NKTA 2HGSA 1NVXQ 4U4AA 3TQOA 3TEJA 3BCSA 1E6WA 4RV5A 1TJNA 4XGNA 1GN9A 2H63A 3ITKA 2W5UA 4DSOA 2GLXA 2R5FA 4WLNA 4C0SA 5DT2A 2UZ4A 4I8IA 4MR8B 2QRHA 1N2HA 1CNMA 3RAPR 1D8TA 3BWBA 2X14A 1TAGA 2YNMA 1LQ2A 2UUPA 1D09A 1TA0A 4DJAA 2O9JA 4ZJUA 3ZHXA 5ALKA 2QD3A 5DK6A 2LPMA 3QLUC 2VJPA 3M4XA 2O05A 1ZAYA 1GFSA 1MEOA 2HD4A 4BIMA 2CNWD 1VGVA 4FS3A 5L4LA 1ZGBA 2J5QA 5FJJA 4PS1A 1N4AA 3F3MA 5IAEA 1G60A 3IMFA 2UVDA 4XVQA 2GPYA 3CCBA 2PKEA 3OCCA 2RSLA 3AM4A 2VYND 1IN4A 1JQDA 1AKNA 4OAPA 2I3BA 1LS1A 2UYOA 1XXLA 4RO0A 2WT9A 3V2GA 1HE5A 4TT3A 4DVGA 4BUZA 4ABYA 4CIBA 1FMCA 1QIJA 4PQYA 5JCPA 2B5OA 2W2QA 4PC1A 4JEIA 5JNSA 3DO6A 5BV7A 3ND5A 1C9YA 1DINA 1NWCA 1E7SA 4K9KA 3EXAA 2HYIC 4PGFA 2R11A 2DBRA 2PKRA 4M2LA 2HLHA 5IJ0A 4AY6A 4B3HA 4DA6A 2EW1A 2G40A 1EA7A 1PFVA 5JCJA 1F8XA 2ID7A 5JZSA 3CUEF 5JS7A 2ZP1A 5K20A 3EH1A 3SJ7A 5KPJA 2OD9A 3N1UA 4UDXX 5E6UA 3TQTA 1U28C 3AT1A 3K4PA 3D8TA 4TPKA 1X1BA 4QPJC 2CYBA 5TDHA 4XUCA 3RVOA 4DCUA 5JAOA 3HGMA 1DBRA 4KH1A 3PPXA 4IG9A 2X23A 4IVPA 4ZO4A 5CT9A 3V7YA 2C97A 5FFNA 3PQCA 3LQQA 1PKXA 1LFDB 4ROTA 2PUTA 1GNSA 4W9NA 4OHPA 1LXCA 5F7OA 3C14C 2GZ3A 2ZBQA 1V7CA 4F2PA 3PYMA 4D42A 1G59A 4ZCIA 1CYEA 1KYXA 1U0JA 3N7UA 1IZ9A 3RO7A 3ZHOA 3QKRB 1JHPA 1LBSA 4O2BB 3TZLA 1EXVA 2RAVA 1G7SA 2JKYA 4IDCA 1X86B 3OFVA 3RF7A 2BUBA 4AO8A 1L9XA 3GAFA 2KLBA 3BHIA 1ZNQO 2NVUA 5DYNA 5FAKA 3H2IA 2PMEA 5TQJA 1SN7A 1ZDMA 3VNAA 4BZZA 2G36A 1UBMS 4EHDA 1D2GA 3GWGA 3NEYA 1ZBQA 1II8A 3F78A 2WVAA 4YJ2A 1IZ8A 1K88A 2JCVA 2BRUA 4XA8A 1AF7A 1Q11A 2H4JA 1MRNA 4NDZA 3WZ2A 1CEEA 3B53X 1UCFA 3KV3O 3FNIA 1U7OA 5AJYA 4TKMA 1FIUA 4CIXA 5MHTA 5EUCA 1T0HB 2RONA 3A4NA 3CEAA 4O4IA 4URZR 3RVNA 3GUHA 3WQBA 5JLJA 5JZVA 2IZ5A 1CZOA 1XLVA 4MPTA 4LPSA 5ED4A 1WQ4A 4B7AA 2V1UA 1IXYA 3K2EA 1P3Y1 1WCV1 4BV8A 2WYWA 2HJ9A 1LFAA 2A7QA 2R84A 3RF6A 4WDRA 1IVNA 4YP6A 2Y77A 4GO1A 4WXPA 3TDMA 1DMRA 2DQKA 3S5JA 1PRYA 2XGOA 3PS9A 3IS3A 1IY2A 3BE4A 4MWCA 4TGLA 1SUFA 2HQRA 1HXHA 3CNOA 1GL6A 1W6UA 3X44A 4AXBA 3ESCA 1O5TA 1URPA 2IEGA 1DFGA 4C03A 4R2MA 4D98A 5CT5A 5AXCA 1UEJA 4YCBA 2MOKA 2HCBA 2X58A 3O8QA 4TV9F 1OTXA 5KQGA 4PQRA 3MWEB 1Q14A 1USGA 3TLBA 2ZYAA 1I13A 4LISA 3IV6A 5KSZA 5JASA 4ZYXA 3ET5A 2NW6A 1SEVA 5JYEA 1GPYA 1YQEA 2ZVDA 4LQDA 2A7XA 1BDMA 3GEIA 4EUEA 3P0JA 4NBUA 3FMVA 1VTKA 3UFXA 2WILA 4DR3B 2PUBA 4BNVA 1Y9ZA 1RRKA 3GYGA 1HTBA 4FJ1A 4F3RA 3IJRA 3WKDA 5IJ9B 4L5BA 4CKCA 3E3LA 4MUBA 4XIIA 2B36A 3EGVA 4PR0A 1Q91A 3WLKX 3AR3A 2O5EA 4JLBA 1YOBA 5JAPA 4Q18A 2G7ZA 1M9NA 4H4CA 1P1KA 1I94B 2I3DA 5AKGA 1HGXA 2AI2A 2QLLA 3I62A 2W58A 3SLRA 2WWHA 4UTVA 3UTDA 2IBSA 1MHPA 1NN1A 3TLMA 1X1AA 3HTXA 4C4YA 5GZ3A 5A0VA 1C4WA 5KOIA 4I50A 2GD2A 2XX3A 1PWXA 2Q2QA 2IYEA 2VBIA 1T0PA 2XZDA 3DE0X 1XYYA 3VVLA 4AZTA 4TZ6A 2OO5A 4YK7A 3C6XA 1JIQA 2O1SA 1ZHHA 2EFEB 2ADOA 2FR0A 1WE2A 2KS6A 3KXPA 4HF7A 4M9QA 2GFQA 4JBNA 3WX0A 2ZW9A 2WJAA 4ENVA 4CKWA 3W90A 3RSFA 2IQ5A 1CZRA 4FWBA 2JIRA 4CTJA 1OZHA 5IXSA 1RYDA 4D56A 2NPOA 2NSYA 1MABA 1VA4A 3K94A 1R27A 4GU5A 4XDYA 3AESB 4Y1EA 4WY8A 3V7FA 4KQFA 1X92A 1UXIA 1O3YA 2B34A 3GHHA 2ZYIA 1ENPA 5DRYA 3F5QA 2DBVO 1DRVA 1IK6A 2VTDA 3C8MA 1Q84A 1IQ0A 1Q17A 3BXPA 3JD0A 4R81A 4M83A 5AI5A 1JF8A 5G2OA 3L8ZA 5K6AA 3UPUA 2ZFUA 3D4LA 5AW2A 4DIEA 2C2MA 4FYYA 1QV7A 3Q2IA 3JQBA 3KG2A 1R3UA 4G86A 1M72A