3S8QA

Crystal structure of the r-m controller protein c.esp1396i ol operator complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of dual symmetry by the controller protein C.Esp1396I based on the structure of the transcriptional activation complex.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Protein binding/dna
molecule keywords R-M CONTROLLER PROTEIN
total genus 31
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3s8qA00
1UXDA 3JXCL 1WH6A 2L49A 1X2LA 1QP4A 1ZZBA 2GRMA 1QP0A 1ZS4A 3OMTA 2IUOA 4GQMA 1GT0C 1WETA 1LQCA 4X4FA 2O49A 3SCGA 2BNNA 2KEKA 3HZIB 2BJCA 3QF3A 1JWLA 2O4AA 3G7DA 1PRVA 1ZZ7A 1ZZ9A 3OQOA 3ZKCA 4PU4C 4YG4A 3FMYA 4I6UA 1HF0A 2R1JL 4Z59A 4IVZA 2IVGA 2B5AA 3EUSA 3LISA 4X4BA 1R69A 1CJGA 2IU7A 2EF8A 3D1NI 4YG1A 4MCTA 2LYRA 2BNOA 4PU3C 3LFPA 1BDIA 1X57A 4Z5CA 3OQMA 4IWRA 2HSGA 3BD1A 2XSDC 1IC8A 3VK0A 1OCTC 4JCYA 3KJXA 1QP7A 2PUCA 1LCDA 4O8BA 3GN5A 4NDWA 2KEIA 3ZHIA 5K98B 4PU8A 3GBFA 2LYKA 4J1XA 3OP9A 2GZUA 2LYJA 3FYMA 1SQ8A 1ZZ8A 2LYQA 1UXCA 3G5GA 1RZSA 1ZAYA 2OR1L 2PE5A 2PUAA 4PU7A 2L8NA 2IVQA 3KXAA 1R63A 1YSEA 3FYAA 1Y7YA 3O9XA 1E3OC 3S8QA 1XWRA 3QQ6A 1WH8A 2KPJA 1ZVVA 4MCXA 2LYPA 3QYXA 1LLIA 2XI8A 3BDNA 3F52A 1ZPQA 1O4XA 2PIJA 2CROA 2XCJA 1JFTA 3RZZA 1JH9A 2PUGA 2GRLA 1B0NA 1S7EA 3TRBA 3IVPA 1UTXA 4YBAA 2AXVA 3SCHA 3GN5B 1RZRA 3QWGA 3U3WA 2MEZA 4I6TA 3DNVB 1CQTA 3MLFA 4IA8A 4Z5DA 3SCFA 1WIZA 4OB4A 2CSFA 4YG7B 2LYSA 1ZZCA 1QQAA 2BNMA 2D5VA 3R1FA 3B7HA 2AXUA 2OFYA 1LMB3 1PNRA 1ADRA 3H5TA 2XIUA 2LCVA 2WIUB 3UFDA 1RZRD 2PUFA 1ZZ6A 2IVBA 4FBIA 1AU7A 4I8TA 2AXZA 1PRAA 1ZUGA 2O38A 1PRUA 2R63A 4I6RA 3F6WA 1PERL 2LYLA 3CROL 4Z58A 1POUA 2EWTA 2ICPA 3JXBC 1QPZA 2IV1A 1NEQA 4GHJA 3BS3A 2FJRA 4F8DA 5A7LA 4YARA 2KZ8A 1RIOA 3L1PA 1DW9A 1Y9QA 1VPWA 3OQNA 1NERA 2WUSR 2ICTA 4X4IA 2H8RA 3F51A 3KZ3A 4X4DA 1DWKA 4Z5HA 2A6CA 2AWIA 3CLCA 1OSLA 4X4EA 2JCGA 2KEJA 1BDHA 2PUBA 4JQDA 3CECA 1RPEL 2PUDA 2AUWA 2XJ3A 4X4CA 2JVLA 1JFSA 2PUEA 4JCXA 2AW6A 4FN3A 4X4HA 4X4GA 1LCCA 4J1WA 1L1MA 1EFAA 2EBYA 2PPXA 4Y42A 2HINA 3PXPA 2MQKA 3ZHMA 3JXDL 1QQBA
chains in the Genus database with same CATH superfamily
1QP4A 3A9XA 4ER6A 1ZZBA 1ZS4A 3GZDC 3OMTA 3MEJA 2PXPA 2IUOA 4GQMA 2XXPA 1LQCA 3SCGA 4WVLA 1JWLA 3G7DA 1PRVA 4PU4C 2B5AA 3LISA 2XXQA 2PUFA 3LFPA 3OQMA 3BD1A 1OCTC 1LCDA 2KEIA 3GN5A 2LYKA 3FYMA 4EKIA 2LYQA 3G5GA 2PE5A 2L8NA 3FYAA 1Y7YA 2XXAA 1ZVVA 3GZDA 2PXBA 3A9ZA 2XI8A 1JFTA 3F52A 1O4XA 4OBMA 3RZZA 2PUGA 2GRLA 1UTXA 3SCHA 3GN5B 3QWGA 3U3WA 3DNVB 1CQTA 2PXTA 4IA8A 4Z5DA 3SCFA 2LYSA 2D5VA 2AXUA 2PXDA 3H5TA 5JUWA 4FBIA 3OKZA 3GUUA 1MFQC 2ODRD 1PRUA 2R63A 4I6RA 2LYLA 2EWTA 4YARA 1Y9QA 3OQNA 2PXVA 3KZ3A 4JQDA 1BDHA 3CECA 1RPEL 2PUDA 2AUWA 4X4CA 3ME5A 4FN3A 4X4HA 4X4GA 2HINA 3PXPA 2MQKA 1UXDA 1X2LA 2M4HA 1ZZ7A 1ZZ9A 3ZKCA 4I6UA 1HF0A 4Z59A 2IVGA 4X4BA 1QZXA 2IU7A 3D1NI 4MCTA 3LQXA 3DM5A 2O4AA 2HSGA 2XSDC 3NDBB 4JCYA 4NDWA 3ZHIA 2L1PA 4EZIA 3OP9A 2GZUA 1UXCA 1HQ1A 2OR1L 2PUAA 2PXEA 3KL4A 5DTRA 2IVQA 3KXAA 4Q2JA 1WH8A 4MCXA 3QYXA 1LLIA 1ZPQA 2PIJA 2CROA 1B0NA 3TRBA 2MEZA 4OB4A 1QQAA 1LMB3 1PNRA 2WIUB 4I8TA 1NW3A 1ZUGA 4DE9A 3CROL 5GAHi 2ICPA 2FJRA 5A7LA 1DW9A 2FFHA 4Z5HA 2AWIA 2LLWA 2YBDA 3SX0A 1JFSA 4EQZA 3G0TA 1L1MA 2EBYA 5DRTA 1QQBA 3JXCL 1WH6A 2L49A 2GRMA 1QP0A 1GT0C 5GAGi 1WETA 4X4FA 2O49A 2BNNA 2PXLA 3M9LA 3QF3A 2BJCA 3OQOA 3FMYA 4IVZA 1CJGA 1BDIA 4YG1A 4PU3C 1X57A 2LNMA 3GZCA 4IWRA 1IC8A 3VK0A 4PU8A 2LYJA 1SQ8A 3NROA 1ZZ8A 1ZAYA 1R63A 1YSEA 1E3OC 5DTQA 3S8QA 2KPJA 4ER3A 4EK9A 4ER0A 2LYPA 2HFZA 3TEPA 4DE8A 4YBAA 2PXUA 4ER5A 3MLFA 4YG7B 1WIZA 1ZZCA 5DTMA 4EKGA 3R1FA 2HCNA 3B7HA 2OFYA 3R09A 3UFDA 1RZRD 3QFIA 2IVBA 4HRAA 1PRAA 3F6WA 5DSXA 4Z58A 1POUA 2IV1A 3BS3A 2KZ8A 3L1PA 2J7UA 2WUSR 3F51A 2A6CA 1OSLA 2JCGA 2KEJA 2PUBA 2XJ3A 2JVLA 3TFLA 4JCXA 2AW6A 1LCCA 3OWQA 4Y42A 2PPXA 3ZHMA 1DULA 3TELA 2KEKA 3HZIB 4YG4A 2R1JL 1QB2A 3EUSA 1R69A 2PXQA 2EF8A 2LYRA 2BNOA 4Z5CA 3KJXA 1QP7A 2PUCA 2VEOA 4O8BA 3VWSA 5K98B 3GBFA 4J1XA 1RZSA 4PU7A 3O9XA 1XWRA 3QQ6A 3BDNA 1JH9A 2XCJA 1S7EA 3IVPA 2AXVA 1RZRA 4I6TA 2CSFA 2BNMA 2V3CC 1ADRA 3QOXA 2XIUA 2LCVA 2JQEA 3A9YA 2PXFA 1ZZ6A 1AU7A 2AXZA 2O38A 3SR4A 5DRYA 1PERL 3QOWA 3NZLA 3ZPXA 3JXBC 1QPZA 5DT2A 1NEQA 4GHJA 1U2ZA 4F8DA 1RIOA 1VPWA 1NERA 2HCSA 2ICTA 4X4IA 2H8RA 2MXDA 2LLVA 4X4DA 1DWKA 3CLCA 2J7WA 3NXHA 4X4EA 3UWPA 2PXKA 2PUEA 3PE5A 4J1WA 4ER7A 1EFAA 3JXDL
chains in the Genus database with same CATH topology
1UXDA 3JXCL 1WH6A 2L49A 1X2LA 1QP4A 1ZZBA 2GRMA 1QP0A 1ZS4A 3OMTA 2IUOA 4GQMA 1GT0C 1WETA 1LQCA 4X4FA 2O49A 3SCGA 2BNNA 2KEKA 3HZIB 2BJCA 3QF3A 1JWLA 2O4AA 3G7DA 1PRVA 1ZZ7A 1ZZ9A 3OQOA 3ZKCA 4PU4C 4YG4A 3FMYA 4I6UA 1HF0A 2R1JL 4Z59A 4IVZA 2IVGA 2B5AA 3EUSA 3LISA 4X4BA 1R69A 1CJGA 2IU7A 2EF8A 3D1NI 4YG1A 4MCTA 2LYRA 2BNOA 4PU3C 3LFPA 1BDIA 1X57A 4Z5CA 3OQMA 4IWRA 2HSGA 3BD1A 2XSDC 1IC8A 3VK0A 1OCTC 4JCYA 3KJXA 1QP7A 2PUCA 1LCDA 4O8BA 3GN5A 4NDWA 2KEIA 3ZHIA 5K98B 4PU8A 3GBFA 2LYKA 4J1XA 3OP9A 2GZUA 2LYJA 3FYMA 1SQ8A 1ZZ8A 2LYQA 1UXCA 3G5GA 1RZSA 1ZAYA 2OR1L 2PE5A 2PUAA 4PU7A 2L8NA 2IVQA 3KXAA 1R63A 1YSEA 3FYAA 1Y7YA 3O9XA 1E3OC 3S8QA 1XWRA 3QQ6A 1WH8A 2KPJA 1ZVVA 4MCXA 2LYPA 3QYXA 1LLIA 2XI8A 3BDNA 3F52A 1ZPQA 1O4XA 2PIJA 2CROA 2XCJA 1JFTA 3RZZA 1JH9A 2PUGA 2GRLA 1B0NA 1S7EA 3TRBA 3IVPA 1UTXA 4YBAA 2AXVA 3SCHA 3GN5B 1RZRA 3QWGA 3U3WA 2MEZA 4I6TA 3DNVB 1CQTA 3MLFA 4IA8A 4Z5DA 3SCFA 1WIZA 4OB4A 2CSFA 4YG7B 2LYSA 1ZZCA 1QQAA 2BNMA 2D5VA 3R1FA 3B7HA 2AXUA 2OFYA 1LMB3 1PNRA 1ADRA 3H5TA 2XIUA 2LCVA 2WIUB 3UFDA 1RZRD 2PUFA 1ZZ6A 2IVBA 4FBIA 1AU7A 4I8TA 2AXZA 1PRAA 1ZUGA 2O38A 1PRUA 2R63A 4I6RA 3F6WA 1PERL 2LYLA 3CROL 4Z58A 1POUA 2EWTA 2ICPA 3JXBC 1QPZA 2IV1A 1NEQA 4GHJA 3BS3A 2FJRA 4F8DA 5A7LA 4YARA 2KZ8A 1RIOA 3L1PA 1DW9A 1Y9QA 1VPWA 3OQNA 1NERA 2WUSR 2ICTA 4X4IA 2H8RA 3F51A 3KZ3A 4X4DA 1DWKA 4Z5HA 2A6CA 2AWIA 3CLCA 1OSLA 4X4EA 2JCGA 2KEJA 1BDHA 2PUBA 4JQDA 3CECA 1RPEL 2PUDA 2AUWA 2XJ3A 4X4CA 2JVLA 1JFSA 2PUEA 4JCXA 2AW6A 4FN3A 4X4HA 4X4GA 1LCCA 4J1WA 1L1MA 1EFAA 2EBYA 2PPXA 4Y42A 2HINA 3PXPA 2MQKA 3ZHMA 3JXDL 1QQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UXD A;  3JXC L;  1WH6 A;  2L49 A;  1X2L A;  1QP4 A;  1ZZB A;  2GRM A;  1QP0 A;  1ZS4 A;  3OMT A;  2IUO A;  4GQM A;  1GT0 C;  1WET A;  1LQC A;  4X4F A;  2O49 A;  3SCG A;  2BNN A;  2KEK A;  3HZI B;  2BJC A;  3QF3 A;  1JWL A;  2O4A A;  3G7D A;  1PRV A;  1ZZ7 A;  1ZZ9 A;  3OQO A;  3ZKC A;  4PU4 C;  4YG4 A;  3FMY A;  4I6U A;  1HF0 A;  2R1J L;  4Z59 A;  4IVZ A;  2IVG A;  2B5A A;  3EUS A;  3LIS A;  4X4B A;  1R69 A;  1CJG A;  2IU7 A;  2EF8 A;  3D1N I;  4YG1 A;  4MCT A;  2LYR A;  2BNO A;  4PU3 C;  3LFP A;  1BDI A;  1X57 A;  4Z5C A;  3OQM A;  4IWR A;  2HSG A;  3BD1 A;  2XSD C;  1IC8 A;  3VK0 A;  1OCT C;  4JCY A;  3KJX A;  1QP7 A;  2PUC A;  1LCD A;  4O8B A;  3GN5 A;  4NDW A;  2KEI A;  3ZHI A;  5K98 B;  4PU8 A;  3GBF A;  2LYK A;  4J1X A;  3OP9 A;  2GZU A;  2LYJ A;  3FYM A;  1SQ8 A;  1ZZ8 A;  2LYQ A;  1UXC A;  3G5G A;  1RZS A;  1ZAY A;  2OR1 L;  2PE5 A;  2PUA A;  4PU7 A;  2L8N A;  2IVQ A;  3KXA A;  1R63 A;  1YSE A;  3FYA A;  1Y7Y A;  3O9X A;  1E3O C;  3S8Q A;  1XWR A;  3QQ6 A;  1WH8 A;  2KPJ A;  1ZVV A;  4MCX A;  2LYP A;  3QYX A;  1LLI A;  2XI8 A;  3BDN A;  3F52 A;  1ZPQ A;  1O4X A;  2PIJ A;  2CRO A;  2XCJ A;  1JFT A;  3RZZ A;  1JH9 A;  2PUG A;  2GRL A;  1B0N A;  1S7E A;  3TRB A;  3IVP A;  1UTX A;  4YBA A;  2AXV A;  3SCH A;  3GN5 B;  1RZR A;  3QWG A;  3U3W A;  2MEZ A;  4I6T A;  3DNV B;  1CQT A;  3MLF A;  4IA8 A;  4Z5D A;  3SCF A;  1WIZ A;  4OB4 A;  2CSF A;  4YG7 B;  2LYS A;  1ZZC A;  1QQA A;  2BNM A;  2D5V A;  3R1F A;  3B7H A;  2AXU A;  2OFY A;  1LMB 3;  1PNR A;  1ADR A;  3H5T A;  2XIU A;  2LCV A;  2WIU B;  3UFD A;  1RZR D;  2PUF A;  1ZZ6 A;  2IVB A;  4FBI A;  1AU7 A;  4I8T A;  2AXZ A;  1PRA A;  1ZUG A;  2O38 A;  1PRU A;  2R63 A;  4I6R A;  3F6W A;  1PER L;  2LYL A;  3CRO L;  4Z58 A;  1POU A;  2EWT A;  2ICP A;  3JXB C;  1QPZ A;  2IV1 A;  1NEQ A;  4GHJ A;  3BS3 A;  2FJR A;  4F8D A;  5A7L A;  4YAR A;  2KZ8 A;  1RIO A;  3L1P A;  1DW9 A;  1Y9Q A;  1VPW A;  3OQN A;  1NER A;  2WUS R;  2ICT A;  4X4I A;  2H8R A;  3F51 A;  3KZ3 A;  4X4D A;  1DWK A;  4Z5H A;  2A6C A;  2AWI A;  3CLC A;  1OSL A;  4X4E A;  2JCG A;  2KEJ A;  1BDH A;  2PUB A;  4JQD A;  3CEC A;  1RPE L;  2PUD A;  2AUW A;  2XJ3 A;  4X4C A;  2JVL A;  1JFS A;  2PUE A;  4JCX A;  2AW6 A;  4FN3 A;  4X4H A;  4X4G A;  1LCC A;  4J1W A;  1L1M A;  1EFA A;  2EBY A;  2PPX A;  4Y42 A;  2HIN A;  3PXP A;  2MQK A;  3ZHM A;  3JXD L;  1QQB A; 
#chains in the Genus database with same CATH topology
 1QP4 A;  3A9X A;  4ER6 A;  1ZZB A;  1ZS4 A;  3GZD C;  3OMT A;  3MEJ A;  2PXP A;  2IUO A;  4GQM A;  2XXP A;  1LQC A;  3SCG A;  4WVL A;  1JWL A;  3G7D A;  1PRV A;  4PU4 C;  2B5A A;  3LIS A;  2XXQ A;  2PUF A;  3LFP A;  3OQM A;  3BD1 A;  1OCT C;  1LCD A;  2KEI A;  3GN5 A;  2LYK A;  3FYM A;  4EKI A;  2LYQ A;  3G5G A;  2PE5 A;  2L8N A;  3FYA A;  1Y7Y A;  2XXA A;  1ZVV A;  3GZD A;  2PXB A;  3A9Z A;  2XI8 A;  1JFT A;  3F52 A;  1O4X A;  4OBM A;  3RZZ A;  2PUG A;  2GRL A;  1UTX A;  3SCH A;  3GN5 B;  3QWG A;  3U3W A;  3DNV B;  1CQT A;  2PXT A;  4IA8 A;  4Z5D A;  3SCF A;  2LYS A;  2D5V A;  2AXU A;  2PXD A;  3H5T A;  5JUW A;  4FBI A;  3OKZ A;  3GUU A;  1MFQ C;  2ODR D;  1PRU A;  2R63 A;  4I6R A;  2LYL A;  2EWT A;  4YAR A;  1Y9Q A;  3OQN A;  2PXV A;  3KZ3 A;  4JQD A;  1BDH A;  3CEC A;  1RPE L;  2PUD A;  2AUW A;  4X4C A;  3ME5 A;  4FN3 A;  4X4H A;  4X4G A;  2HIN A;  3PXP A;  2MQK A;  1UXD A;  1X2L A;  2M4H A;  1ZZ7 A;  1ZZ9 A;  3ZKC A;  4I6U A;  1HF0 A;  4Z59 A;  2IVG A;  4X4B A;  1QZX A;  2IU7 A;  3D1N I;  4MCT A;  3LQX A;  3DM5 A;  2O4A A;  2HSG A;  2XSD C;  3NDB B;  4JCY A;  4NDW A;  3ZHI A;  2L1P A;  4EZI A;  3OP9 A;  2GZU A;  1UXC A;  1HQ1 A;  2OR1 L;  2PUA A;  2PXE A;  3KL4 A;  5DTR A;  2IVQ A;  3KXA A;  4Q2J A;  1WH8 A;  4MCX A;  3QYX A;  1LLI A;  1ZPQ A;  2PIJ A;  2CRO A;  1B0N A;  3TRB A;  2MEZ A;  4OB4 A;  1QQA A;  1LMB 3;  1PNR A;  2WIU B;  4I8T A;  1NW3 A;  1ZUG A;  4DE9 A;  3CRO L;  5GAH i;  2ICP A;  2FJR A;  5A7L A;  1DW9 A;  2FFH A;  4Z5H A;  2AWI A;  2LLW A;  2YBD A;  3SX0 A;  1JFS A;  4EQZ A;  3G0T A;  1L1M A;  2EBY A;  5DRT A;  1QQB A;  3JXC L;  1WH6 A;  2L49 A;  2GRM A;  1QP0 A;  1GT0 C;  5GAG i;  1WET A;  4X4F A;  2O49 A;  2BNN A;  2PXL A;  3M9L A;  3QF3 A;  2BJC A;  3OQO A;  3FMY A;  4IVZ A;  1CJG A;  1BDI A;  4YG1 A;  4PU3 C;  1X57 A;  2LNM A;  3GZC A;  4IWR A;  1IC8 A;  3VK0 A;  4PU8 A;  2LYJ A;  1SQ8 A;  3NRO A;  1ZZ8 A;  1ZAY A;  1R63 A;  1YSE A;  1E3O C;  5DTQ A;  3S8Q A;  2KPJ A;  4ER3 A;  4EK9 A;  4ER0 A;  2LYP A;  2HFZ A;  3TEP A;  4DE8 A;  4YBA A;  2PXU A;  4ER5 A;  3MLF A;  4YG7 B;  1WIZ A;  1ZZC A;  5DTM A;  4EKG A;  3R1F A;  2HCN A;  3B7H A;  2OFY A;  3R09 A;  3UFD A;  1RZR D;  3QFI A;  2IVB A;  4HRA A;  1PRA A;  3F6W A;  5DSX A;  4Z58 A;  1POU A;  2IV1 A;  3BS3 A;  2KZ8 A;  3L1P A;  2J7U A;  2WUS R;  3F51 A;  2A6C A;  1OSL A;  2JCG A;  2KEJ A;  2PUB A;  2XJ3 A;  2JVL A;  3TFL A;  4JCX A;  2AW6 A;  1LCC A;  3OWQ A;  4Y42 A;  2PPX A;  3ZHM A;  1DUL A;  3TEL A;  2KEK A;  3HZI B;  4YG4 A;  2R1J L;  1QB2 A;  3EUS A;  1R69 A;  2PXQ A;  2EF8 A;  2LYR A;  2BNO A;  4Z5C A;  3KJX A;  1QP7 A;  2PUC A;  2VEO A;  4O8B A;  3VWS A;  5K98 B;  3GBF A;  4J1X A;  1RZS A;  4PU7 A;  3O9X A;  1XWR A;  3QQ6 A;  3BDN A;  1JH9 A;  2XCJ A;  1S7E A;  3IVP A;  2AXV A;  1RZR A;  4I6T A;  2CSF A;  2BNM A;  2V3C C;  1ADR A;  3QOX A;  2XIU A;  2LCV A;  2JQE A;  3A9Y A;  2PXF A;  1ZZ6 A;  1AU7 A;  2AXZ A;  2O38 A;  3SR4 A;  5DRY A;  1PER L;  3QOW A;  3NZL A;  3ZPX A;  3JXB C;  1QPZ A;  5DT2 A;  1NEQ A;  4GHJ A;  1U2Z A;  4F8D A;  1RIO A;  1VPW A;  1NER A;  2HCS A;  2ICT A;  4X4I A;  2H8R A;  2MXD A;  2LLV A;  4X4D A;  1DWK A;  3CLC A;  2J7W A;  3NXH A;  4X4E A;  3UWP A;  2PXK A;  2PUE A;  3PE5 A;  4J1W A;  4ER7 A;  1EFA A;  3JXD L; 
#chains in the Genus database with same CATH homology
 1UXD A;  3JXC L;  1WH6 A;  2L49 A;  1X2L A;  1QP4 A;  1ZZB A;  2GRM A;  1QP0 A;  1ZS4 A;  3OMT A;  2IUO A;  4GQM A;  1GT0 C;  1WET A;  1LQC A;  4X4F A;  2O49 A;  3SCG A;  2BNN A;  2KEK A;  3HZI B;  2BJC A;  3QF3 A;  1JWL A;  2O4A A;  3G7D A;  1PRV A;  1ZZ7 A;  1ZZ9 A;  3OQO A;  3ZKC A;  4PU4 C;  4YG4 A;  3FMY A;  4I6U A;  1HF0 A;  2R1J L;  4Z59 A;  4IVZ A;  2IVG A;  2B5A A;  3EUS A;  3LIS A;  4X4B A;  1R69 A;  1CJG A;  2IU7 A;  2EF8 A;  3D1N I;  4YG1 A;  4MCT A;  2LYR A;  2BNO A;  4PU3 C;  3LFP A;  1BDI A;  1X57 A;  4Z5C A;  3OQM A;  4IWR A;  2HSG A;  3BD1 A;  2XSD C;  1IC8 A;  3VK0 A;  1OCT C;  4JCY A;  3KJX A;  1QP7 A;  2PUC A;  1LCD A;  4O8B A;  3GN5 A;  4NDW A;  2KEI A;  3ZHI A;  5K98 B;  4PU8 A;  3GBF A;  2LYK A;  4J1X A;  3OP9 A;  2GZU A;  2LYJ A;  3FYM A;  1SQ8 A;  1ZZ8 A;  2LYQ A;  1UXC A;  3G5G A;  1RZS A;  1ZAY A;  2OR1 L;  2PE5 A;  2PUA A;  4PU7 A;  2L8N A;  2IVQ A;  3KXA A;  1R63 A;  1YSE A;  3FYA A;  1Y7Y A;  3O9X A;  1E3O C;  3S8Q A;  1XWR A;  3QQ6 A;  1WH8 A;  2KPJ A;  1ZVV A;  4MCX A;  2LYP A;  3QYX A;  1LLI A;  2XI8 A;  3BDN A;  3F52 A;  1ZPQ A;  1O4X A;  2PIJ A;  2CRO A;  2XCJ A;  1JFT A;  3RZZ A;  1JH9 A;  2PUG A;  2GRL A;  1B0N A;  1S7E A;  3TRB A;  3IVP A;  1UTX A;  4YBA A;  2AXV A;  3SCH A;  3GN5 B;  1RZR A;  3QWG A;  3U3W A;  2MEZ A;  4I6T A;  3DNV B;  1CQT A;  3MLF A;  4IA8 A;  4Z5D A;  3SCF A;  1WIZ A;  4OB4 A;  2CSF A;  4YG7 B;  2LYS A;  1ZZC A;  1QQA A;  2BNM A;  2D5V A;  3R1F A;  3B7H A;  2AXU A;  2OFY A;  1LMB 3;  1PNR A;  1ADR A;  3H5T A;  2XIU A;  2LCV A;  2WIU B;  3UFD A;  1RZR D;  2PUF A;  1ZZ6 A;  2IVB A;  4FBI A;  1AU7 A;  4I8T A;  2AXZ A;  1PRA A;  1ZUG A;  2O38 A;  1PRU A;  2R63 A;  4I6R A;  3F6W A;  1PER L;  2LYL A;  3CRO L;  4Z58 A;  1POU A;  2EWT A;  2ICP A;  3JXB C;  1QPZ A;  2IV1 A;  1NEQ A;  4GHJ A;  3BS3 A;  2FJR A;  4F8D A;  5A7L A;  4YAR A;  2KZ8 A;  1RIO A;  3L1P A;  1DW9 A;  1Y9Q A;  1VPW A;  3OQN A;  1NER A;  2WUS R;  2ICT A;  4X4I A;  2H8R A;  3F51 A;  3KZ3 A;  4X4D A;  1DWK A;  4Z5H A;  2A6C A;  2AWI A;  3CLC A;  1OSL A;  4X4E A;  2JCG A;  2KEJ A;  1BDH A;  2PUB A;  4JQD A;  3CEC A;  1RPE L;  2PUD A;  2AUW A;  2XJ3 A;  4X4C A;  2JVL A;  1JFS A;  2PUE A;  4JCX A;  2AW6 A;  4FN3 A;  4X4H A;  4X4G A;  1LCC A;  4J1W A;  1L1M A;  1EFA A;  2EBY A;  2PPX A;  4Y42 A;  2HIN A;  3PXP A;  2MQK A;  3ZHM A;  3JXD L;  1QQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...