3S95A

Crystal structure of the human limk1 kinase domain in complex with staurosporine
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
310
structure length
290
Chain Sequence
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the human LIMK1 kinase domain in complex with staurosporine
rcsb
source organism Homo sapiens
molecule tags Transferase/antibiotic
molecule keywords LIM domain kinase 1
total genus 94
structure length 290
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3s95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3s95A01
3AC4A 2V22A 3P1AA 3FLNC 2G15A 2XBAA 3LFSA 1SVGA 4DFYA 4XRJA 3POZA 2GHMA 4IWPA 2RG6A 1OZ1A 1XBCA 4YPDA 4O84A 2EVAA 2R0UA 1FVTA 3IS5A 1GOLA 3L9NA 4E6DA 5CI7A 2F2UA 2QR8A 4RVLA 3GC7A 4NTSA 1JWHA 3TZ8A 2GDOA 3ZRLA 3E8NA 4Q5EA 3GI3A 4IX5A 3TUDA 4YZDA 4FVPA 2YIRA 1CTPE 2X6EA 4JG8A 2UZEA 3RK7A 4BI2A 5HU3A 3G15A 4CG8A 3C1XA 3GGFA 4MX9A 3DB8A 4WT6A 5EH0A 4AN2A 1GIHA 3F7WA 3QX4A 2A19B 4ZS4A 5ACKA 5J8IA 2HXLA 2ESMA 3LLTA 4QD6A 5A3XA 3V5QA 1DAYA 3QWKA 4O1PA 2KULA 4BDKA 3Q32A 2XH5A 4RZWA 4RX9A 4C4IA 3K5UA 2IJMA 3PPJA 4CFWA 3E62A 1PMUA 2XNOA 4W4YA 3F2NA 3QWJA 2VWUA 2XKFA 1G5SA 2ZV9A 3PJCA 3LOKA 4MH7A 3NUUA 3VF8A 3JYAA 4DG2E 5HTIA 2QKRA 4AT4A 4FMQA 1J7IA 3EHAA 2QR7A 4TW9A 3CGOA 3R8MA 2WPAA 3A8XA 3OFMA 3G9LX 3KMWA 3S95A 1O6LA 1Q61A 5M53A 2I0HA 3PG3A 4IB0A 3QD2B 5IKWA 2IW8A 2OIBA 5ANOA 5JN2A 2V0DA 2YWVA 1REJA 1VEBA 4M69B 4ACCA 1XR1A 2VTOA 2W1ZA 3QKMA 3EZVA 4M84A 4XBRA 4AW0A 4DBNA 3NPCA 4EOLA 3KFAA 3A7GA 4NIFB 4E6AA 4JT3A 4NZWB 4ZSEA 4GMYA 4BTKA 4BCPA 3UNZA 3WF8A 3FC1X 4IJ9A 2WEIA 4TYHB 5K0KA 4MBLA 4QNYA 3E3BX 4DCAA 2HYYA 1Y6BA 1URWA 3VULA 2QHMA 3U87A 1YHVA 4O38A 3H9OA 3QZIA 2YERA 3EN5A 3OXTA 3RAKA 5DNRA 4CFVA 4NJDA 3MVJA 1MQ4A 2GTMA 2QLUA 2WEVA 5AR3A 5C9CA 4FGRA 2ZOQA 4UMTA 3AT3A 3MTLA 3NW5A 5DE2A 5GJDA 1VYWA 4FNZA 4JL9A 3Q3BA 4DTBA 2ETMA 3BV3A 3QGWA 2OO8X 4WNOA 3ACJA 3DJ7A 2XIRA 4ZY6A 4BCMA 3NSZA 2WELA 3QHRA 4D2TA 3E7VA 4LUEA 3NDMA 2GNHA 4PDYA 4CKJA 4PNIA 2CLQA 2I6LA 2VWXA 2JKOA 2LAVA 3BBWA 4FV1A 4IVAA 2PVNA 4NW6A 4PTCA 3ZO3A 4B8MA 4W4XA 4ZK5A 4PMMA 1KV2A 4FR4A 1GY3A 4K11A 4FX3A 5EW3A 3EB0A 3RJCA 5KHXA 3OY3A 1ZAOA 3QCYA 2QURA 4W8EA 3EFLA 5E8YA 2QG5A 2WQMA 3FZTA 5ACBC 5C26A 1G8AA 2VX0A 3BHTA 5J5TA 3OEZA 3GNIB 2HAKA 1OIYA 4QMXA 2J0MB 3FAAA 4DLJA 3IO7A 2QO9A 3MY1A 3W16A 4J97A 4IVCA 2Q0NA 1LUFA 5BVKA 3BELA 3LLAA 2XUUA 4IZ7A 3LCDA 3UQGA 3W33A 5AP3A 4JDJA 3A4OX 3F88A 2C6LA 2WTWA 4FSUA 2XNGA 4Y5HA 3VW6A 5TE0A 3E88A 4XNEA 4MBIA 1PXJA 1RJBA 1VYZA 4IHPA 1LEWA 2XBJA 3CGFA 5AP5A 5E90A 1WVYA 3TZ7A 3UQCA 3DDQA 1KE7A 5DPVA 4V04A 3ORXA 3AOXA 4FT9A 4EJ7A 3MFRA 3UG2A 3O0GA 4XS2A 3PTGA 5LMBA 2B0QA 2CKQA 5EG3A 5HHWA 4W9XA 4F08A 2RFDA 5A4EA 2YIYA 4FUXA 5BYZA 5FXSA 4V01A 5FBOA 2HXQA 4QP3A 3E8EA 3QGYA 4P4CA 3ZO2A 3VJNA 2HW7A 3FQSA 2IZTA 4O0UA 4JG6A 3ERKA 4IDTA 3U51A 4FIGA 3FI8A 1F5QA 3G6GA 1ZYLA 4U79A 4BKYA 3I6UA 4YZNA 2BROA 5EQEA 2W5AA 5IISA 1ZYCA 2QQ7A 1KUTA 3TN8A 3SHEA 3WBLA 3FY2A 4BZNA 3IOPA 3FLZA 5C8NA 5AA9A 4G9CA 2V5QA 5GZ8A 1J7UA 4CFMA 4AE9A 1YQJA 4ACGA 4BDCA 1OPLA 5EDPA 2P3GX 3R7IA 2UZVA 3GU5A 1OKVA 5K9IA 3PRFA 1YXTA 2VU3A 3KF4A 3DBQA 1SVEA 5EI6A 3LKMA 3KY2A 1YVJA 4MHAA 4JG7A 3MB6A 4MXXA 2VWBA 4C4FA 1PXNA 1T45A 3NVKI 2WQOA 3E5AA 2PVLA 4ZP5A 4QQCA 3MVLA 5I5ZA 5AFVA 4IB5A 3QAME 3VHKA 2OFVA 4C58A 3Q4UA 2C6OA 4TNBA 4XMOA 3KQ7A 3RZBA 2JD5A 3OT3A 3SXRA 4ACMA 1LEZA 4EK6A 2QOKA 5BVOA 4HPTE 2UW6A 2W1FA 5IUGA 3UJGA 2FGIA 2JFMA 4WO5A 3A8WA 4QPMA 2UZTA 4ZSLA 4FKPA 4R1VA 4IBMA 4JX7A 4ACDA 3LFFA 2J90A 4BDBA 3VRZA 1MQBA 5F95A 1BX6A 3GCUA 3JPVA 1BL7A 4U97A 3DFCB 3VBVA 2IZUA 3FYKX 5HNGA 4LV5A 5CEMA 2PUNA 1MRVA 4LRMA 5HG7A 4ZZOA 2YM8A 3CXWA 3QQJA 5ANJA 4FV7A 5DRBA 3GP0A 4C4HA 4QQ5A 3RI1A 5JGAA 3EN7A 1KE8A 2J5EA 3E63A 3IGGA 3D4QA 4ARKA 1R3CA 5HESA 1WBPA 3P0MA 5EI2A 2G2FA 4WSYA 5J9LA 2W05A 2BPMA 2QG7A 3R02A 2YABA 2PY3A 5AAEA 4NUSA 4O6EA 5DGZA 4ZSJA 5IQBA 4ERWA 3SLSA 4CXAA 3GB2A 4PQNA 3D5WA 1OPKA 4KABA 4RJ5A 4IXPA 4KIKB 5M56A 4KBKA 1YHWA 4C2WA 3BZ3A 4EI4A 3EQRA 3II5A 3F3VA 3R1YA 2FB8A 3FZ1A 1YKRA 1P5EA 4FZDB 4A9RA 4EH3A 2PZRA 4GUEA 4IW0A 4M8TA 3EFJA 2FSMX 5AP1A 3MS9A 4N6YA 4FKGA 5JGDA 2WB8A 3ZDUA 2R9SA 5LVMA 4II5A 3R9OA 3CY3A 5FBNC 1IA9A 3UPZA 5CNNA 3HL7A 3IONA 3UG1A 4P5ZA 3KRWA 4IVBA 2XS0A 5FDPA 5I9ZA 5TOZA 2A0CX 4ZS0A 3ZO1A 1STCE 3VJOA 2W4JA 5A4CA 1HOWA 1H0WA 1Q5KA 3ZO4A 3R00A 1OIRA 2QNJA 1XKKA 2UW9A 2QOIA 3PP1A 5DFPA 1WAKA 1OM1A 4EH5A 1Y8YA 4C57A 2VTJA 2H96A 3FUPA 4FA2A 3HRFA 4WBOA 1QPJA 4O22A 3F61A 4AG8A 4F63A 1PYEA 2RIOA 3G9NA 2B9IA 4QTAA 4JDIA 4LRJA 4MD7E 3JY9A 4CCBA 2IN6A 5IA4A 4FV8A 4QTBA 1PMNA 1KWPA 1CDKA 2ETRA 3C0IA 4BL1A 4UZHA 1PKGA 2XNBA 4G3EA 3UGCA 3FZOA 1OKYA 5HCXA 4C02A 3FEGA 4PMTA 2VTQA 2XIYA 4GT3A 4U42A 3AT4A 3CJFA 4I93A 3PDTA 5CX9A 2VWYA 3RPYA 3NUYA 4XG6A 3QRKA 2EUFB 2W9ZB 3FZRA 2ACXA 3I79A 4ZY5A 1OKWA 4EQCA 5CF5A 2YM6A 5AR4A 3HGKA 4FTLA 3HMIA 3B2WA 2EXMA 3D15A 3O8PA 5JRQA 1JKTA 4YO6A 2PPQA 3EQIA 2R0IA 3TTIA 3V6SA 3EL8A 4XV9A 4Y5QA 3DOGA 3KC3A 4WNMA 4NCTA 3WOWA 4MNEB 3UQFA 5IA0A 2R3QA 4O0TA 1GNGA 2R3RA 2VTHA 4KAOA 3E8CA 4USFA 2UZWE 4ASZA 2BCJA 4AGDA 2XRUA 5AMNA 4IX6A 4FIIA 3R7VA 5J5SA 2WMUA 3HV6A 5T68A 3TL8A 4I3ZA 1YI6A 3ATTA 4CZYB 3RPSA 4BCHA 4WNPA 5CQWA 5J7BA 3IW6A 2BAQA 3LFBA 4OTDA 3W2SA 3Q4CA 5JZNA 4S30A 4LV8A 2PZYA 5BVEA 4DH3A 3RVGA 2BAJA 2A4LA 1NA7A 1Z5MA 4Y83A 5T6KA 4BHNA 4OTIA 3NGAA 4QP7A 2W1IA 2WTCA 3IW4A 3UODA 3HMMA 1QCFA 4TYHA 4K33A 2I1MA 5DVRA 3OD6X 3KXNA 4TTHB 5C01A 4R1YA 2BRNA 1K3AA 3W2OA 1K2PA 2O2UA 3HNGA 4I0SA 4XP0A 5FD2A 4IE9A 4ENXA 4JQ8A 4X2GA 4IC8A 4FUYA 1KOAA 3FKOA 3T3UA 2R3LA 4D0XA 2BHEA 3OCSA 5IA1A 5E7RA 3L9MA 3R8UA 3U6HA 3GQLA 5ETCA 4DG0E 2UZUE 4BFMA 4IX3A 4GYIA 5B7VA 5KKRB 1QMZA 3FKLA 3DKOA 5FM3A 1KE9A 4QTEA 2B4SB 1FPUA 4RSSA 3U4WA 4FNXA 3R8LA 3UOJA 4JBVA 3D2KA 4FTUA 2RGPA 5DH3A 5HOAA 2C4GA 3PG1A 2PVMA 2EXEA 3KRJA 2E9PA 2IWIA 4RJ7A 3TUCA 1IRKA 3ORLA 2HOGA 2XJ1A 2XK4A 4LUDA 3OVVA 3UBDA 3UVQA 1GIIA 5AEPA 4RJ4A 3IOKA 1H26A 3OXIA 2XYUA 3EH9A 2JDTA 3FXWA 1UKIA 2BTSA 4FEQA 1RW8A 1U5RA 4YZCA 1W83A 5K5NA 2WIPA 2XJ2A 4RVMA 3COIA 3FMDA 3EQFA 4M14A 1GZKA 2BZJA 1PRYA 4ZLYA 3QC9A 4DG3E 3BV2A 3KXGA 3R71A 3NUPA 5I3RA 5M4CA 5LVLA 4YP8A 2GMXA 5IDNA 4DT9A 4BGHA 4RA5A 2C1AA 2Y0AA 4ASEA 5IU2A 2FSLX 2A1AB 3PRIA 2YZLA 2WMRA 2QOHA 5E8WA 1SMHA 3LHJA 3UIUA 2KTYA 2WTVA 4R7HA 4NL0A 2V7AA 5IQEA 1OL2A 4EUTA 1ZYJA 4OGRA 3RAIA 4RC3A 4FSYA 4EH4A 3HMPA 5CSXA 4EQMA 3ELJA 2DWBA 5M57A 2DS1A 3QLFA 2HCKA 4JDHA 3C50A 4KB8A 2J50A 5CZIA 5LVPA 1M7QA 4D0WA 2C3KA 3WF6A 3PE1A 3DBDA 4CV9A 4FT0A 1RDQE 2OZAA 2B55A 2OJFE 3KK9A 4ITHA 4YTIA 4RLLA 3A99A 1URCA 2B54A 3ZCLA 4F0IA 4FSNA 4LL0A 4G5PA 4YC8A 2PE0A 3OW4A 1TQPA 3OMVA 2OF2A 4FTCA 4QMYA 4RIYB 5EDQA 4FSRA 5I3OA 5IUIA 3NNXA 1XHAA 3EKNA 3BYVA 3QALE 1XH5A 3E3PA 4GU6A 4I24A 4XRLA 4F9BA 4HVDA 3MH2A 4PMPA 4DF3A 2ZM1A 1YWVA 5H8EA 4QRCA 3ANRA 5FUTA 1Q97A 4YHTA 2FA2A 2ITXA 3KXMA 3SW7A 2F7EE 4IANA 2XK9A 5L6WL 4IFGA 3R83A 4FEUA 3TM0A 4QP4A 4QQJA 4USDA 5L3AA 4FT5A 3FL4A 5ANDA 4FKLA 4K0YA 2JKMA 5KX8A 3ZM9A 1IEPA 4ACHA 5T3QA 2V62A 4NW5A 3ZU7A 2ZB0A 3FMJA 2VWZA 3DT1A 3GCVA 3VRYA 3NNVA 5AR7A 3TKHA 2VO6A 3QCSA 3PA3A 2OG8A 4ANOA 3V5TA 5M51A 4ANMA 3HA8A 5JQ8A 4BI1A 5DIAA 5CZHA 3FKNA 5H8BA 2VTAA 1PYXA 3UTOA 1IR3A 3LXLA 4K9YA 4X3FB 5CEPA 2OIQA 2J5FA 4RIXA 3VQUA 4CV8A 1NW1A 2ITWA 3RINA 3DGKA 4GVAA 2QO7A 1M2RA 4D2RA 4YMJA 2C6MA 5FXRA 4I0TA 3PVWA 5DRDA 4AZSA 4YJTA 3F2AA 3FI4A 3NW7A 2F7ZE 2VTMA 5KMIA 3CQWA 4XG7A 3EKKA 3V51A 5CALA 2YCRA 5HE2A 2PZIA 3CIKA 5H9BA 4D28A 2CKEA 3R63A 4A9UA 3MIYA 4JRNA 2X2KA 2O3PA 2R3HA 3FQHA 4JNWA 4BF2A 1KE5A 4NTTA 4QPSA 1RE8A 4EYJA 5L2TA 4FF8A 3OF0A 3TDVA 3QCXA 2PE1A 4BICA 2XM9A 1V0OA 1KSWA 3OZ6A 4ALVA 4D2VA 5IEYA 3NUNA 4V0GB 5AR5A 3BYUA 1WBTA 3SOAA 3PFQA 4JLCA 3KN6A 3W2PA 5GHVA 3PY3A 4TNDA 5D7AA 3P08A 4QP2A 5IQCA 2VTTA 4IAIA 5IQGA 4BIDA 1J91A 4RJ6A 3LMGA 4AGUA 1XH4A 4TWPA 2C6IA 2VRXA 3KKVA 3RHXA 4AQCA 4BN1A 3BX5A 3VBTA 1XH9A 2ZMCA 4H39A 4BRXA 4PNKA 4DFZE 2VAGA 5EKOA 1REKA 3R28A 3AG9A 5IF1A 4YTCA 1PXPA 3DXPA 4D55A 2W0JA 2XNPA 4F9YA 2IZSA 4DHFA 4EHZA 5J9ZA 2OZAB 3KRXA 4EC8A 3ALNA 5IH4A 3FMMA 2YZAA 4QMUA 2OLCA 3FZSA 5AUWA 4Z3VA 4LMUA 4USEA 3ZSIA 2CKOA 2PMLX 2XEZA 1OMWA 4QYEA 1TKIA 4ZZMA 2W17A 3VAPA 5A54A 1JKKA 2OSCA 3M42A 4I92A 4OLIA 5ANGA 2BILB 5JFSA 4FV4A 3C4XA 4E3CA 1YWNA 4PPBA 3U8WA 5AUVA 3DQWA 4NFMA 3ZXZA 4CEGA 1NVRA 5HO7A 4CD0A 3GUBA 4WHZA 3JXWA 3Q6UA 1MRYA 1B6CB 3VUTA 3N4VA 2EWAA 3ORKA 5L8LA 3VWAA 1JOWB 3F82A 3MA6A 3S2PA 3H9FA 3OY1A 4MQ2A 5JH6A 3MYGA 4IACA 4J95A 4PDSA 4DH5A 5CAVA 4YTFA 3EFWA 5TR6A 3HV5A 4GRBA 4GS6A 4PMSA 1V1KA 3TV7A 4NCTC 4G3GA 4TYEA 4N4SA 2BMCA 3FLSA 1PJKA 3BWFA 3DK6A 2BHHA 4GUBA 2YLFA 4TWCA 5HNBA 4DYMA 4QMWA 4L67A 4UEUA 2NO3A 3KMUA 3HECA 5EYDA 3S4QA 3OWJA 4ZTQA 4ANSA 1PXLA 3WYXA 4NIFA 3MESA 1P2AA 2JIIA 4FTNA 3VUMA 3VW8A 4E5WA 3LFCA 4L43A 4IM0A 3LE6A 4QO9A 3IQ7A 5DOSA 4J98A 2HZNA 1H08A 1R1WA 1Z9XA 2VWVA 3A7HA 3G0FA 4R3CA 4U40A 5AADA 2X9EA 4XBUA 5K3YA 5DYJA 1M14A 3ORPA 1LP4A 3MPAA 4BHZA 3UNKA 2H34A 2O65A 2UW3A 3CJGA 3LFNA 2HWOA 4X2FA 2R3OA 2J6MA 2ZAZA 1PF8A 4FG9A 3U9CA 1JNKA 2J51A 5J9YA 2IVSA 4RG0A 2OJIA 2YACA 1VR2A 3R04A 2BIKB 3ROCA 4R3PA 3LFDA 3HA6A 3VS5A 3UO6A 3ORTA 4UYAA 4E26A 3V01A 3NLBA 2CNQA 1W98A 4O0RA 3Q6WA 3MTFA 5TT7A 1YW2A 2BKZA 1UWHA 5I9UA 4O7WA 3GVUA 3WF7A 4R7BA 3FQEA 1WVWA 4WRSA 2UZNA 4BBEA 1H25A 4EH2A 4KNBA 3A4PA 3OCBA 5A4TA 5A6NA 4DEAA 2X7GA 3VS3A 3OBGA 4ZTSA 2XNMA 5J95A 3CQUA 1NT2A 2YEXA 3MA3A 3PVUA 4WOVA 4LOQA 4A9YA 2X39A 3H30A 3Q9XA 5HI2A 2ZB1A 4EK3A 5BUEA 4GVJA 2GNLA 2UUEA 3P4KA 1ZARA 3OWLA 1A06A 2AUHA 2BRMA 3R7GA 3MFSA 5A46A 2I7QA 4HGSA 4NM0A 3P9JA 4C4JA 3JY0A 2O0UA 4EK8A 3C4EA 1FQ1B 5K0XA 3GOPA 2BUJA 4FTJA 1SYKA 4ASXA 4FKIA 5D11A 4X2KA 4HOKA 2UVZA 2RSVA 4R5SA 5E9EA 5CENA 4FYOA 4AZEA 2CN5A 2C6KA 2WQNA 4J1RA 2GPHA 5D7VA 3QX2A 4G6NA 2OZOA 4MVFA 4BZOA 3BWJA 3VHEA 2X9FA 4C61A 5CEKA 3OC1A 3E93A 2P4IA 4DFLA 4H3BA 4GG7A 2JEDA 2ZV7A 3VNTA 2YM7A 5HLNA 4BB4A 5K5XA 5IZFA 1PXIA 4CLIA 4D1ZA 4D4YA 5EI8A 3DLZA 4G6OA 3QZFA 4PY1A 3EIDA 3TACA 4IH8A 4B6LA 5E8VA 5KMNA 3TG1A 3ZFXA 3WYYA 5AIKA 1CMKE 2VX1A 4EONA 1A9UA 2W99B 1UWJA 2J2IB 4C35A 3UZRA 4F9WA 3QCQA 4ITIA 4ITJA 4O7LA 3COMA 5L2SA 4XV1A 4FKUA 1BLXA 1DI9A 3UDBA 2ONLA 3C51A 3BCEA 4MCVA 1E1VA 4I5PA 2ZYBA 2R3GA 4O27B 4F4PA 2CGXA 4A06A 3FYJX 1WMKA 4IWDA 1BKXA 5JRSA 3D5XA 4I5HA 4ZXTA 5FTQA 2FSOX 3LQ5A 4JR3A 4AZVA 4CFXA 2HENA 3EQDA 3PXQA 4I21A 3FMHA 3FXXA 1OUKA 2YITA 3OCTA 3DDPA 4AFJA 2XCKA 3C4WA 4AUAA 4BZDA 3G33A 3KXZA 3EJ1A 3FLYA 3QTSA 4JBPA 1NY3A 4N6ZA 4O0XA 3PIXA 4ZY4A 4S34A 3B8QA 4ONAA 3CC6A 3NW6A 4PTGA 3HV4A 4DBXA 1FBNA 1V0BA 3FWQA 3ZTXA 2F49A 3RHKA 5AX9A 4LGDA 1P4FA 3HRBA 4YLKA 2GNFA 3TZMA 3WZEA 4U6RA 4RWKA 4AZWA 2PMIA 1UKHA 2B9FA 1XJDA 3R7UA 3UPXA 2JIVA 4GFOA 3DY7A 3HKOA 3BQCA 2F2CB 3QQFA 4ID7A 2Z2WA 4MD9E 3R2YA 4MXAA 4IMYA 4Q5HA 4Y46A 3MW1A 2UW7A 3A60A 3WE8A 5FDXA 4GT5A 2Z7RA 4ANBA 3DAEA 4I22A 4AW5A 4PF4A 5FG8A 3MGYA 4BTMA 3COKA 1SVHA 1ZMVA 3QFVA 2BZHB 4K77A 2BZIB 5DT4A 2GHLA 5E92A 5KMOA 4AU8A 4X6QC 2X8IA 2ONLC 5M4IA 1Q8UA 5ICPA 2IPXA 2RL5A 3FHIA 4FZAB 1PMVA 4IIRA 3VS6A 3I4BA 5DT3A 3TJDA 4KA3A 2QOQA 4E5AX 5CI6A 5FXQA 5BMSA 1U54B 3KCKA 2C68A 1OL5A 3NUAA 4CGAA 2YDJA 5EHOA 4QMSA 2ITTA 2Z7SA 4X3FA 4DCEA 3KCFA 3SRVA 4NM7A 2W1EA 5AIRA 4RWJA 2YLEA 5BVWA 3TJCA 5JFVA 3IW5A 3VS4A 3MY5A 4O0YA 4XV3A 3D0EA 3OWPA 2OJJA 1H1PA 3FHRA 2NPQA 4JBQA 4F1OA 2P33A 3AGMA 3JUHA 4FL3A 3LVPA 2QVSE 2Y8OA 5GIPE 3PSCA 4PWNA 3EN9A 2ZJWA 4FIFA 5LWMA 3ULZA 4AA5A 1JVPP 4O21A 3UNJA 1U4DA 3CEKA 4JVGA 4ZSGA 3TNIA 2CPKE 2ERKA 1UNGA 3GEQA 3HV3A 4CT1A 5KHWA 4YU2A 3OBJA 4KBAA 2C1BA 4O1OA 2HY81 2OH0E 3C0GA 2R3JA 3R22A 5BYLA 1SZMA 2RFNA 4MXOA 4XP3A 5I0BA 2IZRA 2GHGA 2WU6A 3JVRA 5LARA 2PU8A 4I4FA 4O82A 4IM3A 4RMZA 5L6OA 1BUHA 1U5QA 4W8DA 3F3UA 3DBCA 3RWPA 3AT2A 3WARA 3CCNA 4IC7A 1KE6A 4M13A 3VN9A 3QQKA 4NYEA 4I6BA 2BRBA 4EHGA 3PIZA 3Q4TA 1ZYDA 5HKMA 3A61A 3CE3A 4AA4A 1MRUA 4DEEA 4F70A 4L6QA 4BDDA 4IX4A 4EC9A 3MVHA 3QQLA 3DV3A 1WFCA 5K4JA 3AMBA 4WD5A 1XWSA 3P86A 3OHTA 4YUQA 5HVKA 5FRIA 5IQIA 1H4LA 2FO0A 4YBKA 4BDJA 3TV6A 2OFUA 4PL5A 3ZYAA 5CYIA 2FVDA 4D4RA 4MF0A 3TT0A 5C8KA 4M97A 3QXOA 3R73A 3MY0A 3WZKA 4CNHA 4AN3A 1UU3A 2JKQA 3ZZWA 1CSNA 4RC2A 1GAGA 5LCJA 1OUYA 4GL9A 4A4LA 5C03A 2FH9A 2GNIA 3ORIA 4FV9A 3VS7A 3A7IA 3JS2A 4O0SA 3ZM4A 4CLJA 4L7FA 4XG8A 2W9FB 4CRLA 4FK3A 4UYNA 4ZLZA 2XF0A 3LJ2A 3E7OA 5AV1A 3QBNA 3ZUTA 3OW3A 3DU8A 4RIOA 4X2NA 5E8TA 1YOJA 3CTQA 1YI4A 1GIJA 2X4ZA 5D12A 1R0EA 1UVRA 3A62A 4C2VA 5DBXA 3ZEWA 4CFUA 4A9TA 4FTOA 4C37A 2WMVA 2X81A 4ZEGA 3K2LA 4PP9A 3AD5A 1JKLA 3GCQA 4B9DA 3PXRA 1TQMA 3C5UA 3LJ0A 4EHVA 3OXZA 4LYNA 3V3VA 4BKJA 4FTAA 1UU9A 2G1TA 4UWCA 5LWNA 4FTQA 4EH6A 3W8LA 1AGWA 3K54A 3ZFMA 4RFYA 2Q0BA 1UNLA 3A7FA 3O50A 1ZZ2A 4IZAA 2WMAA 3CSVA 2VD5A 3PJ8A 4WBBB 2GCDA 3HP5A 3TTJA 3UMWA 3Q5ZA 3NRMA 4MK0A 3BQRA 3GFEA 2B1PA 2JDRA 3H9RA 5H2UA 2XKEA 4DFXE 4AACA 5L2WA 5TO8A 2VX3A 3QA8A 2Y4IC 4RWLA 4M15A 4HYIA 4QQTA 4M67A 5BQ0A 2B52A 4FT3A 1O9UA 3QLGA 4EBVA 1J7LA 3NIZA 4UZDA 3EN6A 3GOKA 2PULA 5CEOA 2R3KA 4MWHA 4FEWA 5G1XA 3OOMA 2GTNA 1PXOA 2VTIA 1OBDA 1A48A 4E4NA 3ACKA 3U54A 5HX8A 2HZ4A 3ZXTA 4EK4A 3OUNB 4OTPA 1YDSE 3DKFA 4P5QA 5F4NA 4CKIA 4ZMFA 4QP6A 3ENHA 4PL4A 4H1MA 3ZSHA 4UMRA 3LAUA 4K8AA 4HCVA 5EHLA 3FI3A 5AAFA 3GQIA 1M17A 4G3CA 4D1XA 5HGIA 3ZSGA 2OW3A 2OH4A 3G6HA 3IECA 3RP9A 4EUUA 3HMOA 1FGKA 1OITA 3OROA 4MKCA 4BCFA 4G1WA 1Y8GA 2WMBA 4U7ZA 4EH8A 1UA2A 4J96A 3KL8A 4AN9A 5H3QA 1FVRA 4KIKA 2GS6A 3VVHA 4G9RA 4ZJVA 4CSVA 1BL6A 2PWLA 4PRJA 3UVRA 4GKIA 3O7LD 4WG3A 4R5YA 3DXNA 3K5VA 3L8VA 3SQQA 4CRSA 3D94A 3ZLXA 5AM7A 2R7IA 4HJOA 2YM5A 3QU0A 2XRWA 4JRVA 1W84A 5FGKA 5KCVA 4L45A 2B9JA 3QD0A 5BVFA 1XBAA 2XK6A 2DQ7X 3FZPA 1ZMWA 3R9NA 3UOLA 4B99A 4HW7A 4B8LA 4DC2A 4KIOA 1JSTA 2VO7A 3AC8A 4FSTA 2OICA 3FC2A 3VUDA 2F4JA 2H8HA 2H6DA 5ETIA 3T3VA 3V8TA 4UMQA 3WILA 3CP9A 4RX7A 5M4UA 4ZMEA 2GS2A 4RPVA 2C3JA 5EYCA 5AWMA 4E7WA 2UZOA 4QYHA 3GT8A 4G34A 1BYGA 1ZLTA 3SXFA 1FMKA 1ZOGA 1ZZLA 4LG4A 4PUZA 4Y73A 2PVFA 2WTKC 5EW9A 5GZAA 4KBCA 5A4QA 4C3FA 2XP2A 4FTTA 3VBQA 4FK6A 4IZYA 4MYGA 4EK5A 1WZYA 3U6JA 1YWRA 2R3PA 4KSQA 5B2KA 5AAGA 4FL2A 2VTLA 4BWXA 4LL5A 4G2FA 5JFWA 3IGOA 3UO5A 2YDKA 1DS5A 2GU8A 4GK2A 4JJRA 3HV7A 3V5JA 3PXFA 1Q24A 3CTHA 1APME 4HVIA 4FODA 2BZKB 4QYYA 1W82A 2Y6OA 3C4FA 4IB1A 4C34A 4CG9A 3MWUA 5CAPA 4GFMA 3TCPA 4AAAA 3OUKA 3KXHA 4YLLA 2WNTA 4OT5A 5FEQA 1L3RE 2CHLA 3CQEA 4D4VA 2W1CA 2VNWA 5KMKA 3EWHA 4DEBA 3TDWA 3MJ1A 4U44A 3AMAA 3P78A 5CU6A 2YM3A 4AX8A 3FLQA 1FGIA 3QXPA 4D9TA 5C4KA 3LIJA 4F9CA 3BLHA 4DH1A 1PHKA 4U41A 1NXKA 4P90A 2YIWA 3T8OA 5HX6A 3BBTB 3G90X 4C4GA 1UU7A 4FVQA 5DR2A 5E8ZA 3RWQA 2IW6A 3IDPA 1Q8ZA 3QTRA 5EKNA 4MWIA 4AFEA 3KREA 3R8PA 3QUPA 3HVCA 4EZ3A 2CDZA 1R39A 4IWOA 4WG5A 5BUIA 4C3RA 5L2IA 3V6RA 2YAAA 5CT7A 4FIHA 3VS1A 1OKZA 4YHFA 2GS7A 5CT0A 5IH5A 4GIHA 3PXZA 4B0GA 5M4FA 1G8SA 3SAYA 3KVXA 1V0PA 4R3RA 5HD7A 5HBEA 2R4BA 3I5ZA 4AOIA 5CXZA 2Y4PA 3DTCA 1JKSA 3FY0A 2QLQA 4FGBA 4XLIA 3REPA 3NS9A 5CVFA 5D9HA 2PUPA 2ITNA 2UW8A 4BI0A 4XV2A 4CQGA 3UIMA 4S33A 5HE1A 4DH8A 3SG9A 2C6DA 3Q52A 5A6OA 4LGHA 4RIXB 5CS6A 3KN5A 5HQ0A 2XVDA 3QTZA 3MI9A 3AD4A 2WHBA 5CAOA 3BU6A 5HIBA 4J52A 2YIQA 3LW0A 4TT7A 3F69A 4EBWA 2VUWA 5CU3A 4DGNA 4DN5A 3L9PA 4MXYA 1FOTA 3NZ0A 2BDJA 2JFLA 2UZLA 4XG3A 4ZTNA 2J0IA 3CKWA 4E4LA 4N0SA 1HCKA 4X0MA 3CKXA 2PHKA 2CCIA 3BHHA 2YWPA 2C5OA 4EJNA 4Z7HA 5JSMA 3L8PA 5I9YA 4CFFA 4FEXA 4QMZA 4CFNA 1BI7A 4MXZA 5HO8A 2OK1A 2VGPA 3QF9A 2YCFA 2PVKA 4EKLA 4KD1A 5EHYA 2C6TA 4HYSA 3S3IA 4U3ZA 3WZDA 4A9SA 3S1HA 1VZOA 4N57A 3NUSA 3KF7A 1H00A 3UC4A 2W5HA 1HCLA 4I6HA 4WA9A 2I0EA 5AUUA 3U55A 4NKSA 4LRKA 5CSWA 4L01A 4PPCA 4TY1A 2VV9A 4DA5A 2YM4A 4BCIA 3MV5A 4R78A 4FKQA 3AGLA 4AT5A 5ETAA 4E8AA 1OIQA 2QD9A 4FKRA 3DAJA 3GU7A 4C4EA 2WQEA 3ZFYA 5BYYA 4GW8A 3FBVA 3PXKA 4WIHA 4P2KA 5KZIA 2WKMA 3V5LA 4C62A 4DGGA 4J99A 4ZLOA 4F9AA 2QC6A 2Y9QA 2VO0A 3LFQA 4NFNA 2Y7JA 3ZC5A 4JDKA 5HCYA 4DEHA 5BVNA 4DTKA 4IFCA 5IEVA 5IA2A 1Q62A 3TI1A 4BDGA 2WO6A 3ZC6A 4QP1A 1WBOA 3O17A 2Q83A 5HBJA 4UN0C 4QMQA 5M06A 2W1DA 5HIEA 2OWBA 4HZSA 4EORA 3RCJA 1Y57A 3C4ZA 1H1QA 5GZ9A 4AW1A 3I7CA 4I23A 4JAJA 1CKPA 2YA9A 3R6XA 4XHKB 3D5UA 4IQ6A 4O2PA 1H28A 3OWKA 3O23A 5FWKK 3AC2A 4FNWA 4AE6A 1J3HA 2ITVA 3DNEA 1DM2A 4ANNA 5HLPA 4ASDA 4JOAA 4E4MA 4KRCA 3W8QA 2IO6A 2J0KA 4BDAA 5JKGA 4IADA 2B9HA 4PTEA 2YAKA 4GH2A 3RALA 2R3IA 3R30A 3N4UA 1QPDA 1MUOA 1IAJA 4BBMA 4FL1A 4D4SA 4OAUC 3CY2A 2UZDA 3CD3A 2H9VA 2CCHA 2BFYA 3RBWA 3BYOA 4C33A 2ITUA 1H8FA 4I4EA 4GSBA 4ALWA 4ZZNA 4FIJA 5LMAA 4FZ7A 4U0IA 3RNIA 3ORNA 3ZBFA 4QP8A 1P14A 3T9TA 4HVSA 4JXFA 3QUEA 3QTIA 2PMOX 5DMZA 5I4NA 3KRLA 2IW9A 4O7NA 5GINE 1ZMUA 3UP7A 5CWZA 4KUJA 1JBPE 3QHWA 3PJ2A 3MPMA 3P7BA 4D58A 4YJQA 4V05A 4BYJA 5EQPA 4Q2AA 4DAWA 3DBEA 4F1TA 3OEFX 3VUHA 3R9DA 2UW5A 2ITZA 3ATSA 3TKUA 4EOSA 3G0EA 4C36A 5LMKA 1JLUE 2CN8A 4S2ZA 4KS7A 4BC6A 4JAIA 3FV8A 5DI1A 3W18A 1X8BA 3FXZA 4DTAA 3I60A 1U54A 5L2QA 3QC4A 4DT8A 2E9OA 2OF4A 5ANKA 2WXVA 3DA6A 3HYHA 3PIYA 3UO4A 4E6QA 2BALA 1S9JA 4W4WA 1H1SA 3EQCA 4FV5A 4B4LA 5E8SA 2BR1A 2VTPA 3PP0A 4IWQA 1Q99A 3BYSA 4XX9A 2PVRA 3QYZA 4BCJA 4YPSA 1OBGA 4YTHA 1QPCA 4EOPA 4O7SA 4C38A 2OGVA 2C5NA 2P2HA 2VWIA 2WAJA 2X2MA 4JI9A 4NK9A 1H07A 4TPTA 3OOGA 4WNKA 3GU4A 3QKLA 3U9NA 4EOQA 2XJ0A 3FMEA 4W4VA 4TYGA 5DG5A 2CJMA 4X6RA 4FSQA 3BKBA 4F0GA 4YJPA 3POOA 2OJGA 4RJ8A 5EM7A 2DUVA 2HWPA 4LM5A 3ZEPA 4FTIA 2Z8CA 5K4IA 3F3WA 3RAHA 3QRTA 3Q5IA 1GZOA 3DZOA 3ZMMA 2E9VA 1M2QA 3DK7A 4G3FA 4GYGA 5IQFA 3F5UA 4RJ3A 4Z16A 2SRCA 3K3IA 4AZTA 4H05A 4L68A 4MNFA 5AP4A 4EZ5A 2WMXA 2GQSA 2J0JA 2XNNA 4EHEA 2RKUA 3C13A 3CS9A 2ZM4A 1WBWA 5GIOE 1L8TA 4FZ6A 2Z02A 4KKHA 4R7IA 2O63A 3VUGA 1YRPA 4RQVA 4YJOA 3V5WA 4UMUA 4D2PA 3R01A 2HY0A 4MAOA 4RZVA 4RX5A 2XIKA 1VJYA 4QYGA 4QMNA 3FPMA 1PKDA 3PA5A 5I9WA 4TZRA 1YXSA 4BDIA 4BDFA 5JT2A 4DFNA 3I6WA 2PE2A 4UALA 2GQRA 3Q9WA 5M08A 4O0WA 3BHUA 1Q8TA 4FKWA 4KINA 3UE4A 4O7VA 2JIUA 3RPRA 2GFCA 4O86A 4OBQA 2E9UA 3LMHA 5LJJA 3MH0A 3R9RA 4L3JA 5HVYA 1W7HA 2V7OA 5FEDA 3MFUA 4WRGA 3TZ9A 3H0YA 3HDMA 4YJVA 5CAUA 4EZ7A 1UV5A 4ZAUA 4AGWA 4NSTA 4Z9LA 3ZS5A 1OB3A 4H3QA 4AGCA 4BGQA 4CYIA 4OTRA 5KNJA 3SXSA 3VF9A 4RC4A 5M44A 1NVQA 4FKSA 5CVHA 1DI8A 3LJ1A 1GZ8A 4XH6A 3DXQA 4IDVA 5DEYA 4O7YA 3PA4A 4GJ2A 4IB3A 1B38A 4KSPA 3HAVA 2PK9A 5EM8A 3D5VA 4L44A 3ZRMA 2QU6A 4IM2A 4FKTA 2O8YA 1YDRE 5I9VA 3SD0A 4CZTA 3V5PA 5FP5A 4LMNA 4G31A 4Z7GA 4HYHA 4EKKA 2XIZA 2WMTA 5IPJA 3U6IA 2EB3A 3NAYA 4M0ZA 4PV0A 5HCZA 1SM2A 4DGOA 5LXMA 3DZQA 1J1BA 2QOLA 1IAHA 4BCNA 1PMEA 1RQQA 3VO3A 2W7XA 4NT4A 3RM6A 3ZBXA 3ZLYA 4F6UA 3HLLA 2FSTX 3NVMB 4FTKA 2JITA 2YCQA 4R8QA 3UOKA 2Z7LA 4UWYA 3DJ6A 2PVYA 2XM8A 5G6VA 5BX0A 1Q3DA 5ANIA 2PVJA 3ZLSA 5F9EA 3QTXA 1Q8YA 1H01A 2XK3A 4QNAA 3EN4A 3W2RA 5B2MA 4RFMA 2BKKA 3LQ3A 3NYOA 3Q9ZA 4FKJA 4XG2A 5HNIX 3LMIA 3HZTA 4RWIA 3L9LA 1Q8WA 4DGMA 3BRBA 4DEIA 2QOCA 2UW4A 2NRYA 1JAMA 3D83A 3H10A 4MTAA 4XCUA 4APPA 3IPHA 4QTCA 2R7BA 3SDJA 2WGJA 2BIYA 5JEBA 5L8KA 4FVRA 3N4TA 2WTDA 3E8DA 1YOMA 4E93A 2XZSA 2C0OA 5AP6A 2CNVA 4QMLA 2IVVA 4EYMA 3UOHA 5C27A 3WF9A 4F64A 3DQXA 1FMOE 3C0HA 3KULB 3PUPA 4P7EA 5F20A 2PUIA 4Q9ZA 4IJPA 5H8GA 3V8WA 1O6KA 3HP2A 3IW8A 4FBXA 2Y6MA 2ZM3A 2I40A 4HCUA 5KUPA 4MD8E 4BCQA 5BUJA 4DINA 4L9IA 4X3JA 5M55A 3RPOA 3Q53A 3QUDA 5AV2A 4ALUA 4W9WA 2EXCX 2E9NA 1YOLA 2ERZE 5AR8A 4FKVA 3PY1A 4OTHA 3E64A 3UP2A 5CF4A 2OBJA 3DNDA 5L4QA 3VUKA 5KBQA 3FI2A 4TN6A 3W55A 3TXOA 4O81A 3FMNA 2ITOA 4I1ZA 3LM5A 2W1GA 4UX9A 1ZRZA 1GZNA 3TWJA 4RQKA 1W0XC 2CSNA 3LCKA 1ZY4A 2BRGA 3PSBA 4U45A 5F1ZA 4ZTRA 4JS8A 5FTGA 4BTJA 5IH6A 4K6ZA 3E87A 4WKQA 4A4XA 5IQDA 3FPQA 4UWBA 3RNYA 4CTBA 1TVOA 2OXXA 2XYNA 3I7BA 4AP7A 4BCGA 1E1XA 4CQEA 5BPYA 4E73A 2JDOA 1JSUA 2Z60A 4XP2A 1OL6A 2OKRA 3IDBA 3JVSA 4DLIA 4Q9SA 4XG9A 4O7RA 4NM5A 2O5KA 2ITQA 3NEWA 3NYNA 1P4OA 4J8NA 4BIBA 4A07A 4KIPA 2RFSA 3BYMA 4PPAA 4HCTA 5DN3A 4APCA 2G2IA 4S31A 3PSDA 1Z57A 2PMNX 3CR0A 3KGAA 4BVUA 4L52A 2X4FA 2JLDA 2WOUA 3ODZX 4K1BA 2W4KA 3TNHA 3C4CA 5A4LA 4RA4A 2EB2A 3NNWA 4YHJA 2DYLA 2G9XA 2UZBA 3DLSA 3SG8A 4G6LA 4YZBA 2IVTA 4IAFA 2OU7A 3F6XA 3LM0A 1WCCA 4K2RA 1CKJA 2WFYA 4KRDA 4F7NA 4OR5A 5CTPA 3KMMA 3AQVA 3M2WA 4RVKA 4ZIMA 5CU0A 4DE4A 4CMUA 5HLWA 2GQGA 3QTQA 3BGQA 4BWPA 3DBFA 3MVMA 4J8MA 5DHJA 3QQGA 2V55A 4YZMA 5DR9A 2W96B 1CM8A 4QMVA 5A14A 5J1WA 3FSFA 4FKOA 3CTJA 2REIA 3I0QA 3R9HA 2JC6A 3DJ5A 5CNOA 3RK5A 3ZZEA 3LCTA 3MDYA 5J79A 3ORMA 4F99A 5LOHA 1PXMA 2HZIA 5CU4A 5J87A 3SA0A 2XKCA 4HNFA 3CPCA 4JIAA 5HTBA 2PYWA 5LVOA 3DPKA 5CSHA 3NWWA 3RTPA 3BEGA 3MB7A 2R64A 4CMTA 4J53A 4AT3A 4E1ZA 4IAZA 3IK3A 4TWNA 4O6LA 5EOLA 5AP0A 4FZFB 2GFSA 3GCPA 5KMJA 2EU9A 4BBFA 3BI6A 3LFEA 4YJUA 3U4UA 5LVNA 4PP7A 3GC0A 4U80A 4O91A 3NAXA 4LGGA 3ETAA 3CD8A 3JR1A 3HUBA 3QL8A 4K18A 4G17A 4H1JA 1WVXA 4KS8A 4RLKA 4JX3A 2G2HA 4XEYA 3SRVB 4YJRA 2CNUA 3QD4A 4YJSA 4O7TA 2YFXA 3LXNA 4NU1A 5TF9A 3H0ZA 3FDNA 2YCSA 2PL0A 4TYIA 2X2LA 2R2PA 2VGOA 3A2CA 1U59A 3BHVA 5ITAA 3SOCA 4BDEA 5HU9A 2LGCA 3EL7A 4L42A 3LCOA 4EOMA 2ZMDA 5CVGA 4HZRA 1B39A 4R6VA 4ZJIA 5E8XA 4EOIA 3KA0A 5EM6A 1E9HA 3TNQB 3PLSA 4X21A 3T9IA 4A7CA 3FSKA 5GJGA 2WZJA 4GCJA 5HG5A 4UMPA 3IG7A 3THBA 3DS6A 3VBXA 4EL9A 1M7NA 3W32A 3RMFA 4CKRA 3C7QA 3PYYA 4M3QA 4J7BA 4D2WA 2C0TA 2QCSA 3PLAE 4L3PA 3O51A 3F5GA 5D1JA 3RCDA 2CLXA 4B7TA 4C59A 2NRUA 2YHVA 4M68A 5CAQA 3TKIA 3PXYA 3MIAA 4E6CA 4O0VA 3Q04A 4U43A 3O8TA 4HVHA 4YSJA 5IQAA 3A7JA 1ZY5A 2GNJA 1OVEA 4L7SA 4F7JA 1FVVA 2AC3A 4BTFA 4GV1A 4YURA 3NYVA 4NKAA 3AC1A 3DKGA 3DKCA 2QKWB 4ERKA 5J1VA 3V04A 3QTUA 3FMKA 4FICA 4UXLA 2WU7A 2ZDUA 3AMYA 2NP8A 5AUTA 4JR7A 3CLYA 3R7OA 2OI4X 1Y6AA 3COHA 5AUXA 4OTGA 5CANA 3ZH8A 2VZ6A 5BNJA 3TEIA 1KOBA 3W1FA 4LOOA 3PE2A 3B2TA 3S00A 2XK7A 3ANQA 3EQGA 5JFXA 4XOZA 1DAWA 4IAYA 2RF9A 4U5JA 5AV3A 3LXPA 2Z7QA 3SX9A 3PJ3A 2VNYA 3D7TA 4BYIA 3FMLA 4BY9E 2CMWA 3QKKA 4O2ZA 2YISA 2C5YA 5CEQA 5FEEA 2F7XE 5M07A 3KULA 4I6QA 3Q9YA 3QQUA 5EDRA 4OT6A 1EH4A 3OP5A 2QOOA 4FT7A 4Y85A 3UMXA 3VBWA 5C1QB 2UVYA 2O64A 2QHNA 3MJ2A 4DEDA 2OIDA 4CZUA 5BMMA 3O2MA 5IA5A 1ERKA 3FL5A 2ITYA 5D41A 1H0VA 1ZOEA 4GFGA 3WZJA 3ID6C 5EYKA 4S32A 4BDHA 5HG9A 2QOBA 3WZUA 3ZLWA 3W2CA 4NH1A 1H24A 4M12A 2ZV8A 3EYHA 5KZ0A 5JMSA 4UB7A 5CSPA 4PDOA 3F7ZA 3KU2A 3PJ1A 3O7LB 4XYFA 4Y95A 5EW8A 5AX3A 1UU8A 3QD3A 1TQIA 2R3FA 3F66A 2XIXA 4CVAA 1Y91A 2AC5A 2C6EA 2QO2A 4PL3A 4XJ0A 1OI9A 4L8MA 4F09A 5IMEA 4ORKA 2BRHA 5CF8A 2PTKA 5IMXA 3NMUF 2BVAA 5HZNA 1WBSA 4IAAA 2C47A 5GJFA 4H58A 3R1SA 4D1SA 4HNIA 4OTWA 4OAVB 4M69A 4UV0A 2BDFA 4DFUA 4TXCA 1S9IA 5C8MA 1QPEA 2QI8A 3NX8A 4ZTHA 1OECA 4HGTA 4D5KA 3QA0A 4G3DA 3BLRA 3I81A 3O8UA 1M2PA 2R3MA 2UW0A 5HEZA 1ZYSA 4H36A 5GNKA 2X6DA 3LXKA 2C69A 4JIKA 3PY0A 5FQDC 2X8EA 4BCOA 2ETKA 5A9UA 4O7ZA 3UVPA 4D5HA 4AZFA 1OIUA 1OGUA 1XQZA 4RFZA 3GC8A 2JBOA 4LFIA 2VWWA 1F0QA 3BPRA 4NEUA 4U81A 3GCSA 5HICA 4X2JA 4FG7A 4EH7A 4RGJA 2F9GA 2BAKA 2XA4A 4YBJA 4LQMA 3DCVA 1PXKA 3IKAA 1JQHA 4QTDA 4RX8A 4C7TA 3F5PA 4YZ9A 5FM2A 2ZDTA 1LPUA 4FOBA 4EOOA 3BE2A 1U46A 5HTCA 3EOCA 4GK3A 3HUCA 2GSFA 4PDPA 3LFAA 3BGZA 3VS0A 3GU8A 4AA0A 3PWDA 2PUUA 4ZOGA 3ZUUA 3RPVA 3UIXA 4OTFA 3CBLA 4WUNA 2P2IA 5HD4A 5IUHA 3Q2MA 4MF1A 3ALOA 1ZWSA 2UVXA 3C5IA 4YR8A 1SNUA 1BMKA 3GC9A 3GBZA 4QPAA 4DITA 3WI6A 3UZTA 1QL6A 3R1QA 3QQHA 2I0VA 3OTUA 5HE3A 1PW2A 5HBHA 3L8SA 4KKGA 2IG7A 1ZXEA 4I5MA 3PVBA 2OJ9A 2OXYA 3MPTA 3EZRA 3Q2JA 5KMMA 3I0OA 3TUBA 5B0XA 2WMSA 3TIZA 4QYFA 4C3PA 1XO2B 4HPUE 4KIQA 3DTWA 4C0TA 3VUIA 5AUZA 2X7FA 4FTMA 2PZ5A 3NUXA 1H1WA 4U3YA 2J9MA 1UNHA 2J0LA 3ZRKA 2RG5A 4PX6A 4QMTA 4E4XA 2HELA 4HVGA 3EMGA 4AS0A 2QONA 3MH1A 3RKBA 5CASA 5DWRA 3HAMA 4F1MA 5CXHA 4ANLA 4QMOA 3D9VA 4KKEA 4RIYA 1OL7A 3NR9A 1IASA 3LPBA 4OBPA 3GFWA 5AV0A 1FINA 2YIXA 2XK8A 3D14A 3OS3A 3P7AA 4FTRA 4Y8DA 4HYUA 4XOYA 4YO4A 4F65A 3MN3A 3N9XA 4M0YA 4UXQA 4ENYA 2G01A 3R7EA 2FUMA 3P23A 4QP9A 3OT8A 4GKHA 2PSQA 5AV4A 4O96A 3UYSA 4M66A 2X1NA 4EOJA 5DEWA 3PPZA 3VIDA 3DAKA 1MP8A 3HX4A 4CMOA 4RIWA 1R0PA 5EQYA 3P5KA 4E5BA 4JQ7A 5E91A 2YJRA 5HORA 1WBVA 4IVDA 2B53A 3NIEA 4ZTMA 3K3JA 4DEGA 3RM7A 2C5VA 2YN8A 3O96A 5IDPA 1ATPE 2VTRA 3PPKA 1AD5A 3KB7A 3R7YA 2HZ0A 4X3FC 3G5DA 5ANEA 4QMPA 5IG1A 4H3PA 5TKDA 1F3MC 5L6PA 1NVSA 1Q4LA 3DK3A 4NWMA 5KKRC 4CCUA 4I0RA 1GJOA 3AXWA 3NCZA 2NNWB 3SKCA 1JPAA 3N51A 2BFXA 4Y72A 3D7ZA 2C3IB 3KXXA 4ZJJA 4BIEA 3I5NA 5CSVA 3ITZA 3F2RA 4DGLC 4CYJA 3BHYA 5AA8A 2C0IA 4XUFA 5F94A 2OXDA 4TYJA 3GXLA 2W06A 3KK8A 4G5JA 4D9UA 1YXVA 4YLJA 4C8BA 1W8CA 2C5XA 1Q41A 3ODYX 2XCHA 3EYGA 3NYXA 1T46A 3Q96A 3F5XA 4RBLA 5CEIA 1OL1A 4I20A 3BGPA 3MSSA 5D10A 1AQ1A 3DB6A 4HGEA 4EOKA 3AC3A 3TIYA 2C30A 3Q60A 3H3CA 5HE0A 4N70A 3AC5A 3GENA 5IA3A 3KRRA 2WTJA 3QYWA 3VQHA 4QMMA 2E2BA 3O71A 3PVGA 1H27A 4AOJA 4FIEA 4NM3A 3M1SA 1Q3WA 2VN9A 4GT4A 3V8SA 3P7CA 4BKZA 4YSMA 2WTKB 5AUYA 3TNPC 4AF3A 5DR6A 3BU3A 3QRIA 1CKIA 5BVDA 3PZHA 2JAVA 2X8DA 3NNUA 2A27A 4JBOA 3BU5A 3BEAA 3I1AA 2WOTA 5JGBA 2WTIA 2ZVAA 3QZHA 4ZSAA 2WIHA 1R78A 5E8UA 2HK5A 2BTRA 2GNGA 2X0GA 2A2AA 2WMWA 3NCGA 2Y4IB 4FC0A 1XH7A 4I94A 4YNEA 5JK3A 3KVWA 3WF5A 1BI8A 3F3ZA 3EFKA 3ZOSA 4GK4A 4U9AA 5AM6A 2YJSA 4L3LA 5LQFA 3BIZA 4DFBA 1O6YA 4F0FA 5AP2A 5EM5A 4RT7A 3SVVA 3CPBA 3R1NA 4IAKA 3QRJA 5I9XA 3ZDIA 3RZFA 2UV2A 1I44A 4F7LA 3RK9A 4FG8A 4ZTLA 4EQUA 5KMLA 5E1EA 1LR4A 2XB7A 4FSWA 4QOXA 3PZEA 4EWHA 5LCKA 4F6SA 4WSQA 4FV0A 4EWQA 2W1HA 4QT1A 4YC3A 5DT0A 2R5TA 4U8ZA 5FP6A 3FE3A 4G16A 4MNEA 5HVJA 3W2QA 3R21A 1XBBA 4MEDA 3ULIA 4IZ5A 2JAMA 4TWOA 4L46A 4DH7A 5KBRA 3TV4A 3BLQA 5E1SA 2PVHA 3UYTA 3W10A 5JZJA 2HIWA 5E4HA 1XH6A 5B2LA 3ZONA 3B8RA 3LCSA 1ND4A 5DLSA 3FLWA 1JSVA 2P55A 3G51A 4YGAA 3AD6A 5CF6A 4UBAA 3IW7A 3SW4A 5AP7A 3HMNA 5AR2A 5FTOA 1I09A 3ZUVA 4A4OA 4FV6A 1K9AA 4GEOA 4Z55A 3VS2A 3SGCA 4YJNA 2JKKA 4FSZA 1OPJA 3F9NA 3MFTA 4D2SA 1YXUA 3KEXA 3ENMA 5L8JA 4GIIA 2XEYA 2VTNA 2CGUA 2F57A 4GG5A 4FV2A 3SV0A 4BCKA 1J1CA 3OCGA 3SC1A 3R0TA 4O83A 2J4ZA 3GU6A 4TKSA 4E20A 5C4LA 2I0YA 4V0GA 4WUAA 5CLPA 3R8VA 3ET7A 2WQBA 3MH3A 3PWYA 4M7IA 5ETFA 2QOFA 1ZOHA 5DA3A 3QRUA 3HRCA 3H4JA 3M11A 4FV3A 4J71A 5EOBA 3OTVA 5HG8A 1IA8A 4RVTA 5EFQA 4BGGA 4JQEA 1XH8A 5AJQA 2CKPA 4UY9A 4XG4A 3HEGA 3UC3A 1IG1A 3ORZA 3BE9A 5CY3A 2B7AA 2J7TA 4ANQA 3QTWA 2PZPA 4RIWB 3R2BA 2JDSA 4FI1A 3G2FA 1SNXA 4EH9A 4YNOA 3FJQE 3EQPA 2WD1A 2XNEA 3QZGA 5M09A 3ZHPC 3LZBA 5IQHA 2JDVA 1H1RA 4I6FA 2RFEA 4MBJA 4OW8A 2CGWA 4FSMA 4MQ1A 5FLFA 4GJ3A 4L00A 4LI5A 5CU2A 5EYMA 3R8ZA 4BR3A 2CGVA 2W5BA 2ZV2A 3DFAA 3IDCA 2IVUA 4NJ3A 3L1SA 3ROYA 2ITPA 3EQBA 4BWKA 1G3NA 3UIBA 2X7OA 3VC4A 3WIGA 2WMQA 3D2IA 2XKDA 4AW2A 4WG4A 3UZPA 3VBYA 5J7HA 4R77A 2FYSA 4X7QA 3C9WA 4OTQA 4AOTA 4FNYA 4MXCA 2HW6A 3RAWA 4RRVA 4TL0A 5CQUA 1YDTE 4KWPA 4FYNA 4XLVA 3WE4A 4I41A 1YHSA 5KO1A 2R3NA 4OBOA 3E92A 3HDNA 4GU9A 4FE2A 4HGLA 1M52A 4AWIA 1WBNA 5LMKC 1PY5A 5JQ5A 3RGFA 2BDWA 2VO3A 3L8XA 5KE0A 1YXXA 3LQ8A 4YC6A 4AXAA 4LOPA 4CT2A 2QU5A 4CTCA 5IEXA 2XMYA 3D7TB 4F7SA 2VTSA 2YDIA 2P0CA 4FOCA 5HIDA 2C3LA 2JBPA 4IEBA 4FEVA 3OG7A 3TNWA 5EK7A 4OUCA 3Q4ZA 4L53A 4TRLA 4EEVA 2AYPA 4F6WA 1YI3A 3P79A 3EQHA 3WIKA 5HO6A 1KV1A 4I5CA 3S0OA 2QODA 2JGZA 3F3TA 2W4OA 3MBLA
chains in the Genus database with same CATH superfamily
3AC4A 2V22A 3P1AA 3FLNC 2G15A 2XBAA 3LFSA 1SVGA 4DFYA 4XRJA 3POZA 2GHMA 4IWPA 2RG6A 1OZ1A 1XBCA 4YPDA 4O84A 2EVAA 2R0UA 1FVTA 3IS5A 1GOLA 3L9NA 4E6DA 5CI7A 2F2UA 2QR8A 4RVLA 3GC7A 4NTSA 1JWHA 3TZ8A 2GDOA 3ZRLA 3E8NA 4Q5EA 3GI3A 4IX5A 3TUDA 4YZDA 4FVPA 2YIRA 1CTPE 2X6EA 4JG8A 2UZEA 3RK7A 4BI2A 5HU3A 3G15A 4CG8A 3C1XA 3GGFA 4MX9A 3DB8A 4WT6A 5EH0A 4AN2A 1GIHA 3F7WA 3QX4A 2A19B 4ZS4A 5ACKA 5J8IA 2HXLA 2ESMA 3LLTA 4QD6A 5A3XA 3V5QA 1DAYA 3QWKA 4O1PA 2KULA 4BDKA 3Q32A 2XH5A 4RZWA 4RX9A 4C4IA 3K5UA 4AAYA 2IJMA 3PPJA 4CFWA 3E62A 1PMUA 2XNOA 4O4EA 4W4YA 3F2NA 3QWJA 2VWUA 2XKFA 1G5SA 2ZV9A 3PJCA 3LOKA 4MH7A 3NUUA 3VF8A 3JYAA 4DG2E 5HTIA 2QKRA 4AT4A 4FMQA 1J7IA 3EHAA 2QR7A 4TW9A 3CGOA 3R8MA 2WPAA 3A8XA 3OFMA 3G9LX 3KMWA 3S95A 1O6LA 1Q61A 5M53A 2I0HA 3PG3A 4IB0A 3QD2B 5IKWA 2IW8A 2OIBA 5ANOA 3PUFC 5JN2A 2V0DA 2YWVA 1REJA 1VEBA 4M69B 4ACCA 1XR1A 2VTOA 2W1ZA 3QKMA 3EZVA 4M84A 4XBRA 4AW0A 4DBNA 3NPCA 4EOLA 3P5JC 3KFAA 3A7GA 4NIFB 4E6AA 4JT3A 4NZWB 4ZSEA 4GMYA 4BTKA 4BCPA 3UNZA 3WF8A 3FC1X 4IJ9A 2WEIA 4TYHB 5K0KA 4MBLA 4QNYA 3E3BX 4DCAA 2HYYA 1Y6BA 1URWA 3VULA 2QHMA 3U87A 1YHVA 4O38A 3H9OA 3QZIA 2YERA 3EN5A 3OXTA 3RAKA 5DNRA 4CFVA 4NJDA 3MVJA 1MQ4A 2GTMA 2QLUA 2WEVA 5AR3A 5C9CA 4FGRA 2ZOQA 4UMTA 3AT3A 3MTLA 3NW5A 5DE2A 5GJDA 1VYWA 4FNZA 4JL9A 3Q3BA 4DTBA 2ETMA 3BV3A 3QGWA 2OO8X 4WNOA 3ACJA 3DJ7A 2XIRA 4ZY6A 4BCMA 3NSZA 2WELA 3QHRA 4D2TA 3E7VA 4LUEA 3NDMA 2GNHA 4PDYA 4CKJA 4PNIA 2CLQA 2I6LA 2VWXA 2JKOA 2LAVA 3BBWA 4FV1A 4IVAA 2PVNA 4NW6A 4PTCA 3ZO3A 4B8MA 4W4XA 4ZK5A 4PMMA 1KV2A 4FR4A 1GY3A 4K11A 4FX3A 5EW3A 3EB0A 3RJCA 5KHXA 3OY3A 1ZAOA 3QCYA 2QURA 4W8EA 3EFLA 5E8YA 2QG5A 2WQMA 3FZTA 5ACBC 5C26A 1G8AA 2VX0A 3BHTA 5J5TA 3OEZA 3GNIB 2HAKA 1W2CA 1OIYA 4QMXA 2J0MB 3FAAA 4DLJA 3IO7A 2QO9A 3MY1A 3W16A 4J97A 4IVCA 2Q0NA 1LUFA 5BVKA 3BELA 3LLAA 2XUUA 4IZ7A 3LCDA 3UQGA 3W33A 5AP3A 4JDJA 3A4OX 3F88A 2C6LA 2WTWA 4FSUA 2XNGA 4Y5HA 3VW6A 5TE0A 3E88A 4XNEA 4MBIA 1PXJA 1RJBA 1VYZA 4IHPA 1LEWA 2XBJA 3CGFA 5AP5A 5E90A 1WVYA 3TZ7A 3UQCA 3DDQA 1KE7A 5DPVA 4V04A 3ORXA 3AOXA 4FT9A 4EJ7A 3MFRA 3UG2A 3O0GA 4XS2A 3PTGA 5LMBA 2B0QA 2CKQA 5EG3A 5HHWA 4W9XA 4F08A 2RFDA 5A4EA 2YIYA 4FUXA 5BYZA 5FXSA 4V01A 5FBOA 2HXQA 4QP3A 3E8EA 3QGYA 4P4CA 3ZO2A 3VJNA 2HW7A 3FQSA 2IZTA 4O0UA 4JG6A 3ERKA 4IDTA 3U51A 4FIGA 3FI8A 1F5QA 3G6GA 1ZYLA 4U79A 4BKYA 3I6UA 4YZNA 2BROA 4O4DA 5EQEA 2W5AA 5IISA 1ZYCA 2QQ7A 1KUTA 3TN8A 3SHEA 3WBLA 3FY2A 4BZNA 3IOPA 3FLZA 5C8NA 5AA9A 4G9CA 2V5QA 5GZ8A 1J7UA 4CFMA 4AE9A 1YQJA 4ACGA 4BDCA 1OPLA 5EDPA 2P3GX 3R7IA 3W0MA 2UZVA 3GU5A 1OKVA 5K9IA 3PRFA 1YXTA 2VU3A 3KF4A 3DBQA 1SVEA 5EI6A 3LKMA 3KY2A 1YVJA 4MHAA 4JG7A 3MB6A 4MXXA 2VWBA 1W2DA 4C4FA 1PXNA 1T45A 3NVKI 2WQOA 3E5AA 2PVLA 4ZP5A 4QQCA 3MVLA 5I5ZA 5AFVA 4IB5A 3QAME 3VHKA 2OFVA 4C58A 3Q4UA 2C6OA 4TNBA 4XMOA 3KQ7A 3RZBA 2JD5A 3OT3A 3SXRA 4ACMA 1LEZA 3TMOA 4EK6A 2XARA 2QOKA 5BVOA 4HPTE 2UW6A 2W1FA 5IUGA 3UJGA 2FGIA 2JFMA 4WO5A 3A8WA 4QPMA 2UZTA 4ZSLA 4FKPA 4R1VA 4IBMA 4JX7A 4ACDA 3LFFA 2J90A 4BDBA 3VRZA 1MQBA 5F95A 1BX6A 3GCUA 3JPVA 1BL7A 4U97A 3DFCB 3VBVA 2IZUA 3FYKX 5HNGA 4LV5A 5CEMA 2PUNA 4DDGA 1MRVA 4LRMA 5HG7A 4ZZOA 2YM8A 3CXWA 3QQJA 5ANJA 4FV7A 5DRBA 3GP0A 4C4HA 4QQ5A 3RI1A 5JGAA 3EN7A 1KE8A 2J5EA 3E63A 3IGGA 3D4QA 4ARKA 1R3CA 5HESA 1WBPA 3P0MA 5EI2A 2G2FA 4WSYA 5J9LA 2W05A 2BPMA 2QG7A 3R02A 2YABA 2PY3A 5AAEA 4NUSA 4O6EA 5DGZA 4ZSJA 5IQBA 4ERWA 3SLSA 4CXAA 3GB2A 4PQNA 3D5WA 1OPKA 4KABA 4RJ5A 4IXPA 4KIKB 5M56A 4KBKA 1YHWA 4C2WA 3BZ3A 4EI4A 3EQRA 3II5A 3F3VA 3R1YA 2FB8A 3FZ1A 1YKRA 1P5EA 4FZDB 4A9RA 4EH3A 2PZRA 4GUEA 4IW0A 4M8TA 3EFJA 2FSMX 5AP1A 3MS9A 4N6YA 4FKGA 5JGDA 2WB8A 3ZDUA 2R9SA 5LVMA 4II5A 3R9OA 3CY3A 5FBNC 1IA9A 3UPZA 5CNNA 3HL7A 3IONA 3UG1A 4P5ZA 3KRWA 4IVBA 2XS0A 5FDPA 5I9ZA 5TOZA 2A0CX 4ZS0A 3ZO1A 1STCE 3VJOA 2W4JA 5A4CA 1HOWA 1H0WA 1Q5KA 3ZO4A 3R00A 1OIRA 2QNJA 1XKKA 2UW9A 2QOIA 3PP1A 5DFPA 1WAKA 1OM1A 4EH5A 1Y8YA 4C57A 2VTJA 2H96A 3FUPA 4FA2A 3HRFA 4WBOA 1QPJA 4O22A 3F61A 4AG8A 4F63A 1PYEA 2RIOA 3G9NA 2B9IA 4QTAA 4JDIA 4LRJA 2XAOA 4AXFA 4MD7E 3JY9A 4CCBA 2IN6A 5IA4A 4FV8A 4QTBA 1PMNA 1KWPA 1CDKA 2ETRA 3C0IA 4BL1A 4UZHA 1PKGA 2XNBA 4G3EA 3UGCA 3FZOA 1OKYA 5HCXA 4C02A 3FEGA 4PMTA 2VTQA 2XIYA 4GT3A 4U42A 3AT4A 3CJFA 4I93A 3PDTA 5CX9A 2VWYA 3RPYA 3NUYA 4XG6A 3QRKA 2EUFB 2W9ZB 3FZRA 2ACXA 3I79A 4ZY5A 1OKWA 4EQCA 5CF5A 2YM6A 5AR4A 3HGKA 4FTLA 3HMIA 3B2WA 2EXMA 3D15A 3O8PA 5JRQA 1JKTA 4YO6A 2PPQA 3EQIA 2R0IA 3TTIA 3V6SA 3EL8A 4XV9A 4Y5QA 3DOGA 3KC3A 4WNMA 4NCTA 3WOWA 4MNEB 3UQFA 5IA0A 2R3QA 4O0TA 1GNGA 2R3RA 4LV7A 2VTHA 4KAOA 3E8CA 4USFA 2UZWE 4ASZA 2BCJA 4AGDA 2XRUA 5AMNA 4IX6A 4FIIA 3R7VA 5J5SA 2WMUA 3HV6A 5T68A 3TL8A 4I3ZA 1YI6A 3ATTA 4CZYB 3RPSA 4BCHA 4WNPA 5CQWA 5J7BA 3IW6A 2BAQA 3LFBA 4OTDA 3W2SA 3Q4CA 5JZNA 4S30A 4LV8A 2PZYA 5BVEA 4DH3A 3RVGA 2BAJA 2A4LA 1NA7A 1Z5MA 4Y83A 5T6KA 4BHNA 4OTIA 3NGAA 4QP7A 2ZFYA 2W1IA 2WTCA 3IW4A 3UODA 3HMMA 1QCFA 4TYHA 4K33A 2I1MA 5DVRA 3OD6X 3KXNA 4TTHB 5C01A 4R1YA 2BRNA 1K3AA 3W2OA 1K2PA 2O2UA 3HNGA 4I0SA 4XP0A 5FD2A 4IE9A 4ENXA 4JQ8A 4X2GA 4IC8A 4FUYA 1KOAA 3FKOA 3T3UA 2R3LA 4D0XA 2BHEA 2AQXA 3OCSA 5IA1A 5E7RA 3L9MA 3R8UA 3U6HA 3GQLA 5ETCA 4DG0E 2UZUE 4BFMA 4IX3A 4GYIA 5B7VA 5KKRB 1QMZA 3FKLA 3DKOA 5FM3A 1KE9A 4QTEA 2B4SB 1FPUA 4RSSA 3U4WA 4FNXA 3R8LA 3UOJA 4JBVA 3D2KA 4FTUA 2RGPA 5DH3A 5HOAA 2C4GA 3PG1A 2PVMA 2EXEA 3KRJA 2E9PA 2IWIA 4RJ7A 3TUCA 1IRKA 3ORLA 2HOGA 2XJ1A 2XK4A 4LUDA 3OVVA 3UBDA 3UVQA 1GIIA 5AEPA 4RJ4A 3IOKA 1H26A 3OXIA 2XYUA 3EH9A 2JDTA 3FXWA 1UKIA 2BTSA 4FEQA 1RW8A 1U5RA 4YZCA 1W83A 5K5NA 2WIPA 2XJ2A 4RVMA 3COIA 3FMDA 3EQFA 4M14A 1GZKA 2BZJA 1PRYA 4ZLYA 3QC9A 4DG3E 3BV2A 3KXGA 3R71A 3NUPA 5I3RA 5M4CA 5LVLA 4YP8A 2GMXA 5IDNA 4DT9A 4BGHA 4RA5A 2C1AA 2Y0AA 4ASEA 5IU2A 2FSLX 2A1AB 3PRIA 2YZLA 2WMRA 2QOHA 5E8WA 1SMHA 3LHJA 3UIUA 2KTYA 2WTVA 4R7HA 4NL0A 2V7AA 5IQEA 1OL2A 4EUTA 1ZYJA 4OGRA 3RAIA 4RC3A 4FSYA 4EH4A 3HMPA 5CSXA 4EQMA 3ELJA 2DWBA 5M57A 2DS1A 3QLFA 2HCKA 4JDHA 3C50A 4KB8A 2J50A 5CZIA 5LVPA 1M7QA 4D0WA 2C3KA 3WF6A 3PE1A 3DBDA 4CV9A 4FT0A 1RDQE 2OZAA 3W0SA 2B55A 2OJFE 3KK9A 4ITHA 4YTIA 4RLLA 3A99A 1URCA 2B54A 3ZCLA 4F0IA 4FSNA 4LL0A 4G5PA 4YC8A 2PE0A 3OW4A 1TQPA 3OMVA 2OF2A 4FTCA 4QMYA 4RIYB 5EDQA 4FSRA 5I3OA 5IUIA 3NNXA 1XHAA 3EKNA 3BYVA 3QALE 1XH5A 3E3PA 4GU6A 4I24A 4XRLA 4F9BA 4HVDA 3MH2A 4PMPA 4DF3A 2ZM1A 1YWVA 5H8EA 4QRCA 3ANRA 2AEGA 5FUTA 1Q97A 4YHTA 2FA2A 2ITXA 3KXMA 3SW7A 2F7EE 4IANA 2XK9A 5L6WL 4IFGA 3R83A 4FEUA 3TM0A 4QP4A 4QQJA 4USDA 5L3AA 4FT5A 3FL4A 5ANDA 4FKLA 4K0YA 3AKKA 2JKMA 5KX8A 4AXEA 3ZM9A 1IEPA 4ACHA 5T3QA 2V62A 4NW5A 3ZU7A 2ZB0A 3FMJA 2VWZA 3DT1A 3GCVA 3VRYA 3NNVA 5AR7A 3TKHA 2VO6A 3QCSA 3PA3A 2OG8A 4ANOA 3V5TA 5M51A 4ANMA 3HA8A 5JQ8A 4BI1A 5DIAA 5CZHA 3FKNA 5H8BA 2VTAA 1PYXA 3UTOA 1IR3A 3LXLA 4K9YA 4X3FB 5CEPA 4AXDA 2OIQA 2J5FA 4RIXA 3VQUA 4CV8A 1NW1A 2ITWA 3RINA 3DGKA 4GVAA 2QO7A 1M2RA 4D2RA 4YMJA 2C6MA 5FXRA 4I0TA 3PVWA 5DRDA 4AZSA 4YJTA 3F2AA 3FI4A 3NW7A 2F7ZE 2VTMA 5KMIA 3CQWA 4XG7A 3EKKA 3V51A 5CALA 2YCRA 5HE2A 2PZIA 3CIKA 5H9BA 4D28A 2CKEA 3R63A 4A9UA 3MIYA 4JRNA 2X2KA 2O3PA 2R3HA 3FQHA 4JNWA 4BF2A 1KE5A 4NTTA 4QPSA 1RE8A 4EYJA 5L2TA 4FF8A 3OF0A 3TDVA 3QCXA 2PE1A 4BICA 2XM9A 1V0OA 1KSWA 3OZ6A 4ALVA 4D2VA 5IEYA 3NUNA 4V0GB 5AR5A 3BYUA 1WBTA 3SOAA 3PFQA 4JLCA 3KN6A 3W2PA 5GHVA 3PY3A 4TNDA 5D7AA 3O5AA 3P08A 4QP2A 5IQCA 2VTTA 4IAIA 5IQGA 4BIDA 1J91A 4RJ6A 3LMGA 4AGUA 1XH4A 4TWPA 2C6IA 2VRXA 3KKVA 3RHXA 4AQCA 4BN1A 3BX5A 3VBTA 1XH9A 2ZMCA 4H39A 4BRXA 4PNKA 4DFZE 2VAGA 5EKOA 1REKA 3R28A 3AG9A 5IF1A 4YTCA 1PXPA 3DXPA 4D55A 2W0JA 2XNPA 4F9YA 2IZSA 4DHFA 4EHZA 5J9ZA 2OZAB 3KRXA 4EC8A 3ALNA 5IH4A 3FMMA 2YZAA 4QMUA 2OLCA 3FZSA 5AUWA 4Z3VA 4LMUA 4USEA 3ZSIA 2CKOA 2PMLX 2XEZA 1OMWA 4QYEA 1TKIA 4ZZMA 2W17A 3UDZA 3VAPA 5A54A 1JKKA 2OSCA 3M42A 4I92A 4OLIA 5ANGA 2BILB 5JFSA 4FV4A 3C4XA 4E3CA 1YWNA 4PPBA 3U8WA 5AUVA 3DQWA 4NFMA 3ZXZA 4CEGA 1NVRA 5HO7A 4CD0A 3GUBA 4WHZA 3JXWA 3Q6UA 1MRYA 3UDTA 1B6CB 3VUTA 3N4VA 2EWAA 3ORKA 5L8LA 3VWAA 1JOWB 3F82A 3MA6A 3S2PA 3H9FA 3OY1A 4MQ2A 5JH6A 3MYGA 4IACA 4J95A 4PDSA 4DH5A 5CAVA 4YTFA 3EFWA 5TR6A 3HV5A 4GRBA 4GS6A 4PMSA 1V1KA 3TV7A 4NCTC 4G3GA 4TYEA 4N4SA 2BMCA 3FLSA 1PJKA 3BWFA 3DK6A 2BHHA 4GUBA 2YLFA 4TWCA 5HNBA 4DYMA 4QMWA 5BV3A 4L67A 4UEUA 2NO3A 3KMUA 3HECA 5EYDA 3S4QA 3OWJA 4ZTQA 4FJVA 4ANSA 1PXLA 3WYXA 4NIFA 3MESA 1P2AA 2JIIA 4FTNA 3VUMA 3VW8A 4E5WA 3LFCA 4L43A 4IM0A 3LE6A 4QO9A 3IQ7A 5DOSA 3W0PA 4J98A 2XALA 2HZNA 1H08A 1R1WA 1Z9XA 2VWVA 3A7HA 3G0FA 4R3CA 4U40A 5AADA 2X9EA 4XBUA 5K3YA 5DYJA 1M14A 3ORPA 1LP4A 3MPAA 4BHZA 3UNKA 2H34A 2O65A 2UW3A 3CJGA 3LFNA 2HWOA 4X2FA 2R3OA 2J6MA 2ZAZA 1PF8A 4FG9A 3U9CA 1JNKA 2J51A 5J9YA 4QDVA 2IVSA 4RG0A 2OJIA 2YACA 1VR2A 3R04A 2BIKB 3ROCA 4R3PA 1W2FA 3LFDA 3HA6A 3VS5A 3UO6A 3ML1A 3ORTA 4UYAA 4E26A 3V01A 3NLBA 2CNQA 1W98A 4O0RA 3Q6WA 3MTFA 5TT7A 1YW2A 2BKZA 1UWHA 5I9UA 4O7WA 1ST4A 3GVUA 3WF7A 4R7BA 3BL9A 3FQEA 1WVWA 4WRSA 2UZNA 4BBEA 1H25A 3PFYA 4EH2A 4KNBA 3A4PA 3OCBA 5A4TA 5A6NA 4DEAA 2X7GA 3VS3A 3OBGA 3NFGB 4ZTSA 2XNMA 5J95A 3CQUA 1NT2A 2YEXA 3MA3A 3PVUA 4WOVA 4LOQA 4A9YA 2X39A 3H30A 3Q9XA 5HI2A 2ZB1A 4EK3A 5BUEA 4GVJA 2GNLA 2UUEA 3P4KA 1ZARA 3OWLA 1A06A 2AUHA 2BRMA 3R7GA 3MFSA 5A46A 2I7QA 4HGSA 4NM0A 3P9JA 4C4JA 3JY0A 2O0UA 4EK8A 3C4EA 1FQ1B 5K0XA 3GOPA 2BUJA 4FTJA 1SYKA 4ASXA 4FKIA 5D11A 4X2KA 4HOKA 2UVZA 2RSVA 4R5SA 5E9EA 5CENA 4FYOA 4AZEA 2CN5A 2C6KA 2WQNA 4J1RA 2GPHA 5D7VA 3QX2A 4G6NA 2OZOA 4MVFA 4BZOA 3BWJA 3VHEA 2X9FA 4C61A 5CEKA 3OC1A 3E93A 2P4IA 4DFLA 4H3BA 4GG7A 2JEDA 2ZV7A 3VNTA 2YM7A 5HLNA 4BB4A 5K5XA 5IZFA 1PXIA 4CLIA 4D1ZA 4D4YA 5EI8A 3DLZA 4G6OA 3QZFA 4PY1A 3EIDA 3TACA 4IH8A 4B6LA 5E8VA 5KMNA 3TG1A 3ZFXA 3WYYA 5AIKA 1CMKE 2VX1A 4EONA 1A9UA 2W99B 1UWJA 2J2IB 4C35A 3UZRA 4F9WA 3QCQA 4ITIA 4ITJA 4O7LA 3COMA 5L2SA 4XV1A 3VONA 4FKUA 1BLXA 1DI9A 3UDBA 2ONLA 3C51A 3BCEA 4MCVA 3AKLA 1E1VA 4I5PA 2ZYBA 2R3GA 4O27B 4F4PA 2CGXA 4A06A 3FYJX 1WMKA 4IWDA 1BKXA 5JRSA 3D5XA 4I5HA 4ZXTA 5FTQA 2FSOX 3LQ5A 4JR3A 4LDTA 4AZVA 4CFXA 2HENA 3EQDA 3PXQA 4I21A 3FMHA 3FXXA 1OUKA 2YITA 3OCTA 3DDPA 4AFJA 2XCKA 3C4WA 4AUAA 4BZDA 3G33A 3KXZA 3EJ1A 3FLYA 3QTSA 4JBPA 1NY3A 4N6ZA 4O0XA 3PIXA 4ZY4A 4S34A 3B8QA 4ONAA 3CC6A 3NW6A 4PTGA 3HV4A 4DBXA 1FBNA 1V0BA 3FWQA 3ZTXA 2F49A 3RHKA 5AX9A 4LGDA 1P4FA 3HRBA 4YLKA 2GNFA 3TZMA 3WZEA 4U6RA 4RWKA 4AZWA 2PMIA 1UKHA 2B9FA 1XJDA 3R7UA 3UPXA 2JIVA 4GFOA 3DY7A 3HKOA 3BQCA 2F2CB 3QQFA 4ID7A 2Z2WA 4MD9E 3R2YA 4MXAA 4IMYA 4Q5HA 4Y46A 3MW1A 2UW7A 3A60A 3WE8A 5FDXA 4GT5A 2Z7RA 4ANBA 3DAEA 4I22A 4AW5A 4PF4A 5FG8A 3MGYA 4BTMA 3COKA 1SVHA 1ZMVA 3QFVA 2BZHB 4K77A 2BZIB 5DT4A 2GHLA 5E92A 5KMOA 4AU8A 4X6QC 2X8IA 2ONLC 5M4IA 1Q8UA 5ICPA 2IPXA 2RL5A 3FHIA 4FZAB 1PMVA 4IIRA 3VS6A 3I4BA 5DT3A 3TJDA 4KA3A 2QOQA 4E5AX 5CI6A 5FXQA 5BMSA 1U54B 3KCKA 2C68A 1OL5A 3NUAA 4CGAA 2YDJA 5EHOA 4QMSA 2ITTA 2Z7SA 4X3FA 4DCEA 3KCFA 3SRVA 4NM7A 2W1EA 5AIRA 4RWJA 2YLEA 5BVWA 3TJCA 5JFVA 3IW5A 3VS4A 3KIOC 3MY5A 4O0YA 4XV3A 3D0EA 3OWPA 2OJJA 2IF8A 1H1PA 3FHRA 2NPQA 4JBQA 4F1OA 2P33A 3AGMA 3JUHA 4FL3A 3LVPA 2QVSE 2Y8OA 5GIPE 3PSCA 4PWNA 3EN9A 2ZJWA 4FIFA 5LWMA 3ULZA 4AA5A 1JVPP 4O21A 3UNJA 1U4DA 3CEKA 4JVGA 4ZSGA 3TNIA 2CPKE 2ERKA 1UNGA 3GEQA 3HV3A 4CT1A 5KHWA 4YU2A 3OBJA 4KBAA 2C1BA 4O1OA 2HY81 2OH0E 3C0GA 2R3JA 3R22A 5BYLA 1SZMA 2RFNA 4MXOA 4XP3A 5I0BA 2IZRA 2GHGA 2WU6A 3JVRA 5LARA 2PU8A 4I4FA 4O82A 4IM3A 4RMZA 5L6OA 1BUHA 1U5QA 4W8DA 3F3UA 3DBCA 3RWPA 3AT2A 3WARA 3CCNA 4IC7A 1KE6A 4M13A 3VN9A 3QQKA 4NYEA 4I6BA 2BRBA 4EHGA 3PIZA 3Q4TA 1ZYDA 5HKMA 3A61A 3CE3A 4AA4A 1MRUA 4DEEA 4F70A 4L6QA 4BDDA 4IX4A 4EC9A 3MVHA 3QQLA 3DV3A 1WFCA 5K4JA 3AMBA 4WD5A 1XWSA 3P86A 3OHTA 4YUQA 5HVKA 5FRIA 5IQIA 1H4LA 2FO0A 4YBKA 4BDJA 3TV6A 2OFUA 4PL5A 3ZYAA 5CYIA 2FVDA 4D4RA 4MF0A 3TT0A 5C8KA 4M97A 3QXOA 3R73A 3MY0A 3WZKA 4CNHA 4AN3A 1UU3A 2JKQA 3ZZWA 1CSNA 4RC2A 3W0OA 1GAGA 5LCJA 1OUYA 4GL9A 4A4LA 5C03A 2FH9A 2GNIA 3ORIA 4FV9A 3VS7A 3A7IA 3JS2A 4O0SA 3ZM4A 4CLJA 4L7FA 4XG8A 2W9FB 4CRLA 4FK3A 4UYNA 4ZLZA 2XF0A 3LJ2A 3E7OA 5AV1A 3QBNA 3ZUTA 3OW3A 3DU8A 4RIOA 4X2NA 5E8TA 1YOJA 3CTQA 1YI4A 1GIJA 2X4ZA 5D12A 1R0EA 1UVRA 3A62A 4C2VA 5DBXA 3ZEWA 4CFUA 4A9TA 4FTOA 4C37A 2WMVA 2X81A 4ZEGA 3K2LA 4PP9A 3AD5A 1JKLA 3GCQA 4B9DA 3PXRA 1TQMA 3C5UA 3LJ0A 4EHVA 3OXZA 4LYNA 3V3VA 4BKJA 4FTAA 1UU9A 2G1TA 4UWCA 5LWNA 4FTQA 4EH6A 3W8LA 1AGWA 3K54A 3ZFMA 4RFYA 2Q0BA 1UNLA 3A7FA 2A98A 1ZZ2A 3O50A 4IZAA 2WMAA 3CSVA 2VD5A 3PJ8A 4WBBB 2GCDA 3HP5A 3TTJA 3UMWA 3Q5ZA 3NRMA 4MK0A 3BQRA 3GFEA 2B1PA 2JDRA 3H9RA 5H2UA 2XKEA 4DFXE 4AACA 5L2WA 5TO8A 2VX3A 3QA8A 2Y4IC 4RWLA 4M15A 4HYIA 4QQTA 4M67A 5BQ0A 2B52A 4FT3A 1O9UA 3QLGA 4EBVA 1J7LA 3NIZA 4UZDA 3EN6A 3GOKA 2PULA 5CEOA 2R3KA 4MWHA 4FEWA 5G1XA 3OOMA 2GTNA 1PXOA 2VTIA 1OBDA 1A48A 4E4NA 3ACKA 3U54A 5HX8A 2HZ4A 3ZXTA 4EK4A 3OUNB 4OTPA 1YDSE 3DKFA 4P5QA 5F4NA 4CKIA 4ZMFA 4QP6A 3ENHA 4PL4A 4H1MA 3ZSHA 4UMRA 3LAUA 4K8AA 4HCVA 5EHLA 3FI3A 5AAFA 3GQIA 1M17A 4G3CA 4D1XA 5HGIA 3ZSGA 2OW3A 2OH4A 3G6HA 3IECA 3RP9A 4EUUA 3HMOA 1FGKA 1OITA 3OROA 4MKCA 4BCFA 4G1WA 1Y8GA 2WMBA 4U7ZA 4EH8A 1UA2A 4J96A 3KL8A 4AN9A 5H3QA 1FVRA 4KIKA 2GS6A 3VVHA 4G9RA 4ZJVA 4CSVA 1BL6A 2PWLA 4PRJA 3UVRA 4GKIA 3O7LD 4WG3A 4R5YA 3DXNA 3K5VA 3L8VA 3SQQA 4CRSA 3D94A 3ZLXA 4F78A 5AM7A 2R7IA 4HJOA 2YM5A 3QU0A 2XRWA 4JRVA 1W84A 5FGKA 5KCVA 4L45A 2B9JA 3QD0A 5BVFA 1XBAA 2XK6A 2DQ7X 3FZPA 1ZMWA 3R9NA 3UOLA 4B99A 4HW7A 4B8LA 4DC2A 4KIOA 1JSTA 2VO7A 3AC8A 4FSTA 2OICA 3FC2A 3VUDA 2F4JA 2H8HA 2H6DA 5ETIA 3T3VA 3V8TA 4UMQA 3WILA 3CP9A 4RX7A 5M4UA 4ZMEA 4O4BB 2GS2A 4RPVA 1G8KA 2C3JA 5EYCA 5AWMA 4E7WA 2UZOA 4QYHA 3GT8A 4G34A 1BYGA 1ZLTA 3SXFA 1FMKA 1ZOGA 1ZZLA 4LG4A 4PUZA 4Y73A 2PVFA 2WTKC 5EW9A 5GZAA 4KBCA 5A4QA 4C3FA 2XP2A 4FTTA 3VBQA 4FK6A 4IZYA 4MYGA 4EK5A 1WZYA 3U6JA