3S95A

Crystal structure of the human limk1 kinase domain in complex with staurosporine
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
310
structure length
290
Chain Sequence
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LIM domain kinase 1
publication title Crystal structure of the human LIMK1 kinase domain in complex with staurosporine
rcsb
source organism Homo sapiens
molecule tags Transferase/antibiotic
total genus 94
structure length 290
sequence length 310
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3s95A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3s95A01
4O81A 5H8BA 5IQEA 1JAMA 5FM3A 4R6VA 2AUHA 5C4KA 1R3CA 2JAMA 4O1PA 5M4IA 3O8UA 3EYGA 3LM5A 4IB1A 5DRDA 3UQFA 2IN6A 4MF1A 4CV8A 2YN8A 4MX9A 1L3RE 2J9MA 2ITWA 3HKOA 1ZWSA 5AV0A 5A4QA 3JR1A 2XCHA 4BGGA 4H36A 5E8ZA 4BCIA 4O7SA 3A62A 3OCSA 2VTNA 4I6QA 2WMVA 4JDKA 3U4UA 1XH5A 2YJSA 5DG5A 2YDJA 2B0QA 2O5KA 2PVMA 3BU3A 2HW7A 3R21A 4FL2A 4LGHA 4WKQA 2Y6MA 3JUHA 3VBYA 3FLQA 3ROYA 3DBFA 4DGGA 3FAAA 3IW6A 4ASDA 3CTQA 3MW1A 3E87A 4D4SA 2R0IA 3QKKA 4AW1A 3TIZA 5BUJA 3QFVA 2GTMA 1CM8A 5LVPA 3EMGA 1SM2A 4GRBA 4XHKB 4D9TA 4RVLA 4E1ZA 2RIOA 3Q52A 4DTBA 3SHEA 4DBXA 2Z7LA 3QZIA 3RHKA 3BBTB 2YCSA 4HNFA 4RSSA 4YJSA 4FKTA 1B6CB 5GHVA 2YDKA 3DXQA 3TT0A 3E92A 3UBDA 5E91A 5A4TA 2HWPA 4IDTA 4X2KA 2CDZA 3KMUA 5IG1A 3K3IA 3OT8A 4BB4A 4EH5A 4MD9E 5IA2A 3EFJA 4AT3A 4BN1A 5BUEA 2UW3A 4RIYA 4P7EA 3QQFA 4BDGA 2IO6A 3EFKA 3L9LA 3A8XA 1U54A 3PVUA 4BDJA 1H01A 3PWDA 3KMMA 3CKXA 5C01A 5CEOA 2IZSA 3OOMA 2ZV9A 5L3AA 4RIXB 4G17A 3CPCA 3GENA 5JEBA 5D41A 3Q9WA 3NS9A 2HAKA 1XH8A 2JIUA 5FTOA 4LMUA 1YVJA 5AR5A 1ZOGA 1M2RA 2QO2A 3A2CA 4JX7A 2OICA 4ZTSA 4MXAA 4LM5A 5ANJA 4EZ3A 4WIHA 2F7ZE 5DR6A 2G2FA 4L9IA 3V04A 5EI8A 5B2MA 4BI0A 3ROCA 2ZM4A 4XG7A 4IFGA 5ANEA 2XKDA 4EK8A 5ETCA 1J1CA 1UWHA 4YJQA 3L8VA 4FT5A 3UOLA 3RZFA 4MYGA 2Q0BA 4YC8A 3TKIA 2J51A 4DGNA 4DT9A 3DK6A 4GVAA 3ULIA 1R0PA 4FV7A 4NIFA 5CT7A 3RPSA 5HLWA 2QOQA 1J91A 2PZRA 4C2VA 4GW8A 3G2FA 4C4IA 3NW6A 5L2SA 3HX4A 4G16A 4JS8A 3W2SA 3D5UA 4DLIA 1W84A 2R4BA 5C8MA 1P14A 3FMHA 3ORZA 4XP3A 4FR4A 3MH2A 4Y5HA 3LFNA 3IPHA 4FEQA 3PE2A 3AGLA 3C4EA 1OUYA 3HRBA 4JAJA 4QQJA 4F08A 3FXZA 4G3DA 1LP4A 2QOOA 4H1JA 4M14A 5LJJA 5CEIA 4GIIA 4KS8A 4YTFA 2NP8A 4ZLYA 3CE3A 2OG8A 4UX9A 3HNGA 4I41A 3HP5A 4IX5A 5CI7A 4YJRA 4ZSJA 3W2CA 4NZWB 3E8EA 5AAEA 3QBNA 3BBWA 3HLLA 4ZLOA 2HZNA 2OGVA 3IQ7A 3MA6A 3VUTA 4AZWA 3ZEPA 4CNHA 4MD7E 4I24A 4KBKA 5HORA 5J9LA 4HZSA 1H00A 3DCVA 4JDIA 4GUBA 4UMUA 1QPDA 2W7XA 5DN3A 3ZDIA 4RA5A 3AD5A 2GCDA 2W99B 4ZS4A 4FTQA 3VNTA 1OKVA 4KRCA 5JN2A 1F0QA 4D2PA 3BZ3A 4BBEA 5K4IA 2R7BA 5EHLA 3QZGA 2WQEA 4GKHA 5HTCA 4V01A 1WVWA 4DEAA 4GYIA 4OUCA 1DS5A 4RX9A 2YCFA 3R63A 5IEXA 1ND4A 2VN9A 2C6LA 4GT5A 1CTPE 2R9SA 3WARA 2ZV7A 3ANRA 4CV9A 3EQRA 5IPJA 2GS2A 3CXWA 5TE0A 3R9HA 4NW6A 5GIPE 4FKQA 3HV4A 3UP7A 3H10A 3NUYA 5CF4A 2OF2A 4YTHA 3AXWA 5EHOA 3TV7A 5K0KA 3R71A 1Q97A 3BYMA 3D9VA 4BI1A 4XV2A 1G8AA 4N0SA 4QTDA 1SNUA 4RWKA 5B0XA 2BRNA 4AZVA 3A7JA 4G9RA 5J9YA 1O9UA 2BILB 4NM3A 3PJ2A 4DTAA 5JGDA 5TR6A 4ID7A 2XJ0A 3TXOA 3UO4A 3UODA 1YQJA 3OFMA 4HZRA 5IA0A 4IZ7A 4UYAA 3HAMA 1ZOEA 3UVPA 4ENXA 5IQGA 3FLNC 3O71A 4JG8A 4O0RA 3V8TA 4ZY5A 3BYSA 5JZNA 5ETAA 3R7IA 4CQGA 2X7FA 2B9HA 5AV1A 3ZFYA 2QURA 4O0XA 2QOIA 4ZXTA 2PU8A 2PSQA 3KRLA 2AC3A 2PTKA 3W2QA 2NNWB 3RNIA 1KE5A 2PZYA 5J87A 3QHRA 2QODA 3IGGA 3EJ1A 2GNGA 4ZZOA 4H3BA 5EFQA 4JAIA 3O7LB 4PF4A 4L6QA 4CYJA 4AGDA 3LE6A 2VNWA 4YPSA 2C47A 5BMMA 2PUPA 4QP8A 4EJNA 4L3LA 4DYMA 1WBTA 2R3OA 5E8VA 4ACHA 3MH0A 4WSYA 4CFXA 3ORPA 3QUDA 5C9CA 4I5PA 4O0YA 4GG7A 4GMYA 4J96A 3R9OA 3PPKA 2R2PA 2IWIA 4RFMA 2Q83A 2WFYA 2AC5A 2GTNA 2V62A 4Y73A 2XIYA 5ANIA 1SMHA 4QP6A 4DITA 4U8ZA 4BCPA 5JQ5A 3FJQE 1M14A 4TYJA 5EW9A 4PTCA 4BIBA 3IW7A 4O1OA 2VTHA 2CNQA 3FUPA 3GEQA 4M97A 5EKOA 4K1BA 4BC6A 1QPEA 3ZBFA 4CFVA 2WTIA 2XUUA 4TNBA 3QD3A 2BKZA 4BFMA 2B55A 1GNGA 4AU8A 5M56A 4LRJA 3FPMA 1H08A 2FSOX 2HOGA 4RBLA 4F65A 4IX3A 4DEHA 3BLQA 2BZKB 1OL1A 4HGTA 1VYZA 3Q4CA 3OCBA 4ZMFA 3R8UA 2PVYA 3U9NA 2VX3A 4IM3A 4QP7A 2YLFA 5BNJA 4DA5A 3R0TA 3LOKA 5HO8A 5KHXA 3KGAA 2UVXA 1Q61A 4EOSA 5AUXA 3A7FA 4FTMA 4UB7A 4JL9A 3P5KA 4CD0A 5B7VA 2JKMA 3DB6A 3E8DA 3AQVA 3QGWA 4FKJA 3OUKA 3H9RA 1J1BA 3G0FA 2ITZA 3PTGA 4IZ5A 4WBBB 3V5PA 3FZTA 3VS0A 5GZ8A 3WF7A 4BDDA 5HLNA 1ZMWA 3VBVA 4FGBA 4YMJA 3E5AA 1OGUA 2P33A 4TW9A 4U97A 5L8LA 4FVRA 2CNVA 3BRBA 3P7CA 4BTFA 5DOSA 3NDMA 2OK1A 5G1XA 1FBNA 2WQOA 2CGXA 4D55A 4O84A 3E8CA 4L43A 4X2NA 4NL0A 3BU6A 4J1RA 3SRVA 5B2LA 1Q3WA 5EYMA 3NLBA 5IUHA 4TTHB 4ITHA 5CI6A 4EYMA 3C13A 1OUKA 3RAHA 1H0VA 2VO3A 1BLXA 5HIEA 2C3LA 3CLYA 4YJOA 4I4FA 5DR9A 4UMPA 3HMMA 2W9ZB 5KX8A 3TIYA 2JFLA 2Z8CA 2BVAA 4IEBA 4Q2AA 2OIBA 2R3RA 3FMNA 2XK9A 4QTBA 3WYYA 4E6DA 4G6OA 1QPCA 1XBAA 2OIQA 4I20A 3RALA 4LOOA 4CG8A 2BTSA 2C3IB 2YM4A 3G90X 4G2FA 2X7OA 4ZY6A 2ZVAA 4MCVA 3VC4A 1FMOE 2HZIA 3EOCA 3OOGA 3IOKA 3PA5A 5FDPA 3SG9A 3QRJA 2Z60A 2Z7RA 3JPVA 4RIOA 4WA9A 1TVOA 4UWYA 5H8EA 3ZRMA 5LCKA 5HZNA 3L9NA 5DFPA 4F0IA 4UMRA 4MBLA 3UNKA 3PVWA 4F7SA 3NR9A 3QC9A 4S32A 3E63A 5L6OA 3NNXA 2KULA 1MRVA 2G2HA 4D28A 2ACXA 2WU6A 4DEBA 3RCDA 4GYGA 1H26A 3NW7A 3HMPA 4AT4A 1S9IA 2RKUA 4XP0A 2W17A 4IM2A 1HOWA 2RFEA 4KNBA 1GAGA 3UJGA 5L6WL 4KABA 3A8WA 3I60A 4CXAA 4MTAA 4DGLC 5KMNA 4ZTLA 4AOJA 3AC2A 3QHWA 4IWOA 3IGOA 5KCVA 4OAVB 1JQHA 4X21A 1MP8A 3QLGA 3V5JA 4JT3A 5C26A 3L8SA 4A4OA 2WMUA 2XKEA 4RZVA 4DGMA 2I0HA 4YZBA 4O7ZA 1V0OA 4BCMA 1P4FA 3LM0A 2X4ZA 4MVFA 2QI8A 2GFCA 4HYHA 3NYXA 2WQNA 3IKAA 3FKNA 3Q6WA 4PTGA 5IH5A 4ZIMA 2ZMDA 4J7BA 4CRLA 3VUKA 1WBVA 3UZRA 5ITAA 1OECA 1ZXEA 4KIOA 4UXLA 5CASA 4GFGA 4EOLA 1OVEA 5IQFA 5AUWA 5FXRA 4AN9A 3LCDA 3P78A 4U40A 4KBAA 4EHZA 4CYIA 2R3GA 2QKRA 4QP9A 4J8MA 4WHZA 3CQEA 4M67A 3MIYA 4UMTA 3C4WA 3LCKA 2C5VA 4D4YA 2OIDA 4UN0C 4CKJA 3LQ3A 4ZTHA 5CYIA 1YI4A 5FXQA 2RGPA 5HEZA 3ZUUA 4FKVA 3O8PA 2FVDA 4QQTA 2O0UA 4UMQA 3PLSA 3Q9YA 1JSUA 3FZOA 2BDWA 2R5TA 4APPA 4UV0A 4DG3E 3F3TA 4MEDA 5HE0A 2X9FA 5AR7A 2UVZA 4F63A 3HV3A 5IZFA 3PY0A 5IKWA 4DBNA 3LKMA 4RIXA 3BLRA 4NM7A 2QU5A 3FXXA 4MXOA 3MB6A 4QNAA 4MBJA 4C02A 4QMQA 4R7IA 4KAOA 2WMTA 2WTWA 3KKVA 4PMMA 4ANNA 2EB2A 1GZKA 4U3ZA 3V8SA 3VS7A 2ITVA 4EH4A 3H0YA 2WAJA 4YTCA 4AGCA 1BMKA 3TNQB 3R01A 4TWNA 3WI6A 2VX1A 4D2RA 5EQEA 1WAKA 1WBOA 5CF6A 1FVVA 2YIYA 3ZUTA 4L53A 4R1VA 3DKGA 4JX3A 2HZ0A 4KIPA 4WG4A 2C5XA 3V5WA 4MXZA 1XWSA 5L2TA 3QTQA 4Z55A 2B7AA 4OTRA 1Q62A 2UW8A 5AMNA 4IAYA 2C6EA 4AUAA 4W8EA 4RJ8A 5CXHA 5CAQA 1FQ1B 4BL1A 1FPUA 4RJ3A 3EYHA 2CLXA 3I79A 3MVLA 2ZMCA 2XRWA 3ODZX 4DH8A 3HMNA 3V51A 4YLKA 3OWJA 4FV5A 5HHWA 4QMYA 5M4CA 4G3CA 5AM7A 3VRZA 4Z7HA 5CEPA 5I9UA 2B52A 2JDSA 2PVJA 1M7NA 4GG5A 4I22A 3UC3A 4I5HA 4FT0A 3R8MA 5E9EA 5A4LA 4ANMA 2BHHA 4QMXA 4NYEA 2QR8A 3LXNA 4WNOA 4JLCA 5AEPA 5HBJA 2IVTA 3DOGA 5DNRA 5AAGA 2GNFA 2W1ZA 4PDPA 4E4MA 1Y6AA 4Z3VA 3MVJA 5H2UA 5A14A 5CXZA 1IA9A 4PQNA 5BVWA 3FQHA 3ODYX 3A7IA 4D5HA 4IB0A 1WZYA 4UYNA 4FT7A 4YO6A 4ZEGA 4AS0A 2YIWA 4FV1A 4GSBA 1KSWA 3RAKA 2JDTA 2VWBA 3TZMA 4IB5A 1IAJA 4LMNA 2VX0A 2UUEA 5CSHA 5BYYA 5CSWA 3LJ2A 3PG1A 4PL5A 2W9FB 3H9FA 1U59A 2ZYBA 4WRSA 3F6XA 3ATSA 3ATTA 1Y57A 3TV4A 1ZOHA 3EQIA 5DWRA 3TJCA 3ZLWA 2C69A 3GU7A 2C5NA 4AN3A 3VS6A 5LMKC 4QTCA 5BYLA 4F9CA 5EM8A 4M13A 1E1XA 3IO7A 2C6DA 3E3PA 3W10A 5DIAA 4MNFA 5GINE 5EM5A 4B7TA 4YR8A 4O7TA 4B8MA 4BWKA 5DLSA 4I23A 1KE6A 1UKIA 3VUDA 3TUCA 4IX4A 3RK5A 1UNGA 4OT5A 5ANOA 3UTOA 4YZ9A 2VUWA 4FSNA 3VBTA 3TTIA 2JIIA 3OF0A 4IE9A 2XB7A 4LGDA 1YXSA 3UGCA 4EUUA 2BHEA 4DEIA 4QPAA 5FEDA 4RJ4A 3EN5A 4E4XA 3RHXA 3C0HA 5KZIA 2GNHA 4FVQA 3PSCA 4ZTNA 5L2IA 4L3JA 2BTRA 3OCTA 2JKKA 3QGYA 3II5A 5DHJA 5G6VA 4BYIA 5J7BA 3PE1A 3PP1A 3D83A 4CTCA 5F9EA 3DBCA 1YHSA 5ANKA 2PYWA 2UZVA 4IAIA 3OUNB 4YJVA 3QYWA 1ZRZA 3TZ7A 1P4OA 4IADA 2C6IA 3F5GA 5BUIA 4W9WA 3ZOSA 4MD8E 1XKKA 3D5VA 3LFQA 2CLQA 4GS6A 4JRNA 4TRLA 2F2CB 3ZM4A 2PE0A 2UZDA 3MBLA 5AUZA 4U0IA 2IW8A 3UOJA 1JBPE 3FPQA 3SLSA 4JG6A 4KSQA 5AP6A 2DS1A 1PMNA 4FV8A 3WF5A 1V0PA 3UQGA 4XG6A 2J7TA 3ZZWA 3FLSA 4NTTA 5L4QA 2XNPA 3FI3A 5CNOA 1NA7A 4EH3A 3PRFA 4AWIA 4PDOA 4PWNA 4IAZA 2BR1A 3P4KA 1Q4LA 4ASZA 2FGIA 5HICA 5CSPA 2PMNX 4RT7A 5LMKA 2ITXA 2Z7SA 3K2LA 4FBXA 3PXYA 2GQRA 2P55A 2OLCA 4LG4A 3REPA 4DEEA 4Y46A 1TKIA 4E3CA 3UOHA 4M7IA 4FTJA 4FZAB 2PE1A 4JR3A 5CQWA 3WZEA 2BDJA 4X2FA 1WFCA 4BICA 1AGWA 4C57A 4JOAA 5AV2A 5ANGA 3TNHA 3UYSA 3COHA 5F95A 3AMAA 4FTOA 5J9ZA 2VWXA 3NUUA 4ALWA 1WCCA 3QQHA 1Y8GA 4QMVA 2A2AA 4R7BA 3CD3A 5E92A 2F7EE 1OPKA 2E9UA 3L8XA 4NJDA 4DAWA 2LGCA 1I09A 3ETAA 4BKYA 2Y4IB 3KXXA 4FG8A 3PP0A 5E4HA 2F49A 5L2WA 5CEMA 3FBVA 4AW2A 3UIBA 2WD1A 3DA6A 3RI1A 4GK2A 4P90A 4PMPA 3IG7A 5IQDA 1SVEA 2QOCA 5CVGA 4K2RA 5T6KA 3RK9A 2VD5A 2YM5A 4D2SA 4QPMA 2YERA 3I6UA 3QCXA 4QMLA 4R1YA 3QD4A 4DHFA 4IJPA 4FTUA 4QMTA 3KXHA 4GFOA 3FHIA 4WRGA 2PK9A 3PWYA 3ZC6A 4W9XA 4RVKA 5IUIA 5LCJA 2PUIA 3VAPA 5IA1A 3O51A 3MFSA 1IRKA 4O0TA 3QXPA 2KTYA 4FEWA 5B2KA 5TT7A 3C9WA 3Q4TA 3RAIA 4F1TA 3TACA 3NCGA 5HE1A 4TY1A 2E2BA 4AA5A 2J0MB 2O63A 3G33A 1Q8UA 3MVHA 3OS3A 3WYXA 3H4JA 2UZOA 4QTAA 1M52A 3A60A 2G15A 3RAWA 3MPAA 3JVRA 1YOMA 1J7UA 4ZSLA 5CZHA 5E7RA 3ANQA 4BY9E 4O21A 2JKQA 3OZ6A 4OAUC 4IWPA 4L7FA 4C33A 3R7GA 4FIIA 3ORMA 3EQGA 4XUFA 2R3PA 2X2LA 3KF7A 3HUCA 3R7EA 2QR7A 4C61A 3P23A 5JH6A 4RC4A 4U5JA 4MKCA 3EL7A 2C0IA 3KULB 4WG3A 5D11A 4F0GA 2PZPA 3MJ1A 4EK6A 1GZOA 2J0IA 4NKAA 3QUPA 3FLZA 3GU5A 3R6XA 5AA8A 2Y4PA 5JKGA 4CLIA 4J8NA 2XNNA 4GL9A 3BYVA 4RG0A 4E26A 2VWYA 1OL6A 3I6WA 2XIXA 3FZ1A 4ALUA 4FODA 1OL2A 3V5TA 2WIPA 2XH5A 2JDOA 3QX4A 5JFXA 1U46A 1W83A 3MY5A 3FI2A 3ZXTA 3KXZA 4LRMA 4JQ7A 4FOBA 5L8JA 2GS6A 3UOKA 3VJNA 5KMOA 3Q2JA 5FTGA 4FMQA 3I0QA 5A9UA 4FTKA 1PW2A 3W16A 4CCUA 3HV7A 4EJ7A 3F7ZA 5DE2A 5AR8A 4U3YA 3OBJA 4E4NA 4DFXE 3G5DA 3O23A 3QZHA 3IW8A 3T8OA 5CT0A 2VZ6A 3U9CA 2VWZA 4BRXA 4BBFA 5IUGA 4FEUA 1EH4A 4C4EA 3QX2A 2GMXA 2W4OA 1ZYCA 4ITIA 2GNJA 4ZSEA 4CLJA 4AOIA 4KD1A 2ZB1A 3MPMA 2J0JA 3QA0A 3LFAA 5BX0A 4QNYA 4O2ZA 3DTWA 4YHFA 3SAYA 1PXJA 1CKJA 4EZ7A 4WNKA 3DU8A 4BVUA 4A9YA 2YCRA 3A61A 1UNLA 4AE6A 5C4LA 4TN6A 3PXQA 5DYJA 2VGOA 3AT4A 5CAVA 4XV9A 2VRXA 4O91A 1UU9A 4O0UA 4I21A 2HY0A 3NUPA 1TQMA 3VUGA 4AGWA 5D12A 1OIRA 4PNKA 3DY7A 3R02A 4IIRA 3CJGA 4JR7A 4R3CA 4RJ5A 4WBOA 4ZLZA 4C3RA 3PXRA 4O7NA 1AQ1A 2C30A 3ZTXA 4QP3A 3QZFA 4JRVA 2IZRA 3A4OX 4C62A 4FTCA 2C5YA 4L44A 3RK7A 4FV0A 3UG2A 3C0GA 4OLIA 5IQIA 1T46A 1NXKA 2J90A 3L9MA 4O0WA 3LIJA 3UMWA 2OJFE 5M55A 3CC6A 5BMSA 2YEXA 3B8QA 3F69A 3QKMA 2XYNA 3R7YA 4B9DA 4J99A 4QP4A 2XZSA 4BCFA 4W4XA 4QQ5A 1PXLA 3W8QA 4CTBA 5KMLA 4D1XA 3AGMA 3NSZA 2W1HA 2XM9A 3TNPC 3VQUA 4C38A 4C4HA 2YJRA 4DCEA 5HD7A 3EKKA 3MH1A 2X39A 2YDIA 3PA3A 3WZJA 3R9NA 1R78A 4FICA 5AUVA 2A0CX 2J50A 2XNBA 4AE9A 3QU0A 1Y8YA 5IH6A 3G9LX 4FOCA 4BCQA 3QQLA 3TG1A 5HU9A 2WB8A 3MSSA 2XM8A 3S0OA 3MGYA 5J8IA 3SV0A 3QAME 4OBPA 3O7LD 4YNOA 3W32A 2CKEA 4YTIA 5FXSA 2EXEA 1H8FA 2PVHA 4E93A 2GS7A 2ZOQA 5E90A 3Q60A 4FL3A 3PVBA 4L8MA 5HNGA 4N57A 4OTPA 3EQFA 2WXVA 4X7QA 2QOKA 2BIYA 4MXXA 3LJ1A 4PP7A 5BYZA 3KRRA 3LFCA 5KMJA 1ZLTA 3F82A 4X0MA 2I0VA 1JKTA 2ERKA 5HO7A 2WMQA 3DKCA 2ESMA 2NPQA 2RG5A 3CQUA 5HG8A 2WEVA 2XNOA 3R8LA 2J5FA 2VWWA 4M15A 2ETMA 4HCUA 2EU9A 2UZEA 2W05A 2YABA 2ZB0A 3QQKA 4JBPA 3TTJA 3NVKI 1H1WA 2OJIA 2VU3A 5EDPA 4E8AA 3C1XA 3R8PA 3N4TA 4FEXA 4IDVA 5LWMA 3FLWA 2OSCA 3F5XA 4MXCA 5KMIA 3C5UA 2R3KA 2R3FA 5EW8A 2WIHA 5JZJA 3AT2A 1URCA 4M66A 1ZMVA 2CPKE 3THBA 2PMOX 4N4SA 4IXPA 2YAKA 4TNDA 1JOWB 4JXFA 2G2IA 4HGLA 2IVUA 3FDNA 4PPAA 4EQCA 1YI6A 2HXLA 4FSYA 2GNLA 2OW3A 4BCJA 1NVSA 3TCPA 5FP6A 2YM6A 3KY2A 4AW0A 4CVAA 4A7CA 4MF0A 4FZ6A 3GFWA 1YOLA 3H9OA 3RJCA 3O50A 4DFBA 5LVOA 4ZP5A 1KV1A 4OTFA 2UW4A 5D10A 4CMTA 1JWHA 3Q6UA 3GGFA 3R2BA 4AXAA 4KIKB 5M4FA 5M57A 2OO8X 3ZS5A 4BDEA 1YHWA 5I4NA 3VF8A 4FI1A 2VWVA 5HIDA 3R28A 3KRJA 3R30A 4FKWA 4FYNA 4PMTA 5GJDA 4JQEA 5HCXA 4BKZA 2A27A 4XMOA 2IVVA 3MESA 3DK3A 3SVVA 2YISA 5AP4A 1Q24A 3ORTA 3LMIA 4O6LA 2HK5A 3ZCLA 3MJ2A 4ERWA 3RM6A 3RP9A 4FIGA 4NFNA 5IA3A 4BDIA 4MBIA 5HVKA 4XRJA 3VW8A 2Y4IC 3QXOA 5CENA 2C6MA 5GJGA 5M53A 3KA0A 3I4BA 2V7AA 2BFXA 4FSWA 4FSRA 5AADA 2VTPA 3ALNA 2PE2A 2FYSA 2WOTA 2WKMA 5A4EA 5F94A 1W0XC 1FGKA 4LFIA 4B99A 4NM0A 1GIJA 3UO5A 4AFEA 5JGAA 4BWPA 1YI3A 3UO6A 3EL8A 5DT4A 1U5RA 5ETFA 4CMUA 4EBWA 2VTSA 4TXCA 3L8PA 3RMFA 5FQDC 3ZMMA 3H3CA 3MB7A 3F3VA 2E9PA 1XO2B 3MYGA 4U6RA 3G15A 5AR2A 1TQPA 4OT6A 5DMZA 3GB2A 4R5YA 2UV2A 2UW5A 1BL7A 1VJYA 4AX8A 1U4DA 4CT2A 1OL5A 2J2IB 3D0EA 4LV5A 1ZZ2A 3MH3A 5CX9A 3V8WA 4R77A 2NRYA 4R3PA 4APCA 2XA4A 2XNEA 3ZXZA 3PDTA 2R3HA 4XCUA 4FV4A 4FG7A 4RX8A 2PVLA 3V01A 1UV5A 1PRYA 4J71A 3OT3A 1XH4A 3A99A 5LMBA 3C4CA 3KL8A 5EG3A 5L2QA 1H4LA 4D4VA 3JY9A 3CKWA 1Q8ZA 4L68A 2A1AB 4EEVA 3MVMA 2R3NA 3BE9A 3LQ5A 3WF8A 3FC1X 3PSBA 1BKXA 4HW7A 1LEZA 3JY0A 3KFAA 3VUHA 3ZU7A 4Q9SA 3CGFA 4ANQA 3FQSA 1WVYA 3ZC5A 3BU5A 5KE0A 3EFLA 1KE9A 5J79A 4HGSA 2CGWA 4FEVA 3FV8A 3D2IA 1J7LA 5KKRB 3UYTA 4AF3A 1RW8A 3B2TA 5FM2A 2W1CA 3I7BA 2JDRA 1G3NA 3OTUA 3KRWA 3ZUVA 5CEQA 5TKDA 1A48A 2YWPA 2B53A 5DT0A 2GU8A 4I92A 3R7OA 4GH2A 5HD4A 3E3BX 3K3JA 3EZVA 2J4ZA 3QUEA 4U79A 5AA9A 2VGPA 4L7SA 3MTFA 5T3QA 2C6KA 3PXZA 1XJDA 1ZYLA 3AD6A 3BYOA 3MTLA 4LQMA 5E8UA 2GSFA 2ITTA 4DH3A 2C4GA 3DBEA 4RFYA 2WMXA 2BIKB 4NW5A 1ERKA 4O7WA 4RIWB 1Q41A 3Q5ZA 1Q99A 2VWIA 1PKGA 4BDFA 4FTLA 2IJMA 2XS0A 3TZ9A 4BI2A 4HVIA 1XH9A 3AC4A 2HYYA 2V7OA 2WTKB 4O96A 2BKKA 2OU7A 1NW1A 3CBLA 4C3PA 3POOA 4DEGA 3RWQA 3VS3A 3BGPA 1MRYA 1K2PA 3MN3A 4RPVA 1UU7A 3MPTA 2BROA 5EW3A 2RL5A 3NX8A 5FUTA 1JKLA 3ZO4A 3WILA 5HQ0A 3CD8A 3GBZA 2QO7A 1RE8A 3KULA 3OP5A 1WVXA 2REIA 1JNKA 3E88A 3LXKA 5EDQA 3NCZA 3WF9A 3F2RA 3OW3A 2JGZA 1UKHA 4BHNA 1OKYA 3WOWA 1DM2A 4EHVA 4MWIA 5BVEA 4U81A 3GCVA 5H3QA 1F3MC 2E9VA 3WBLA 1Y6BA 3KVWA 4ZSAA 2IW9A 1YWVA 3FMDA 5CF8A 5I9VA 2EXCX 3P7AA 3E7OA 5GIOE 5J1VA 2VWUA 3DTCA 5FEEA 5I0BA 5CU2A 5K4JA 4EORA 3FXWA 4QYHA 5JSMA 2ITUA 4TYGA 3ZFXA 3GC9A 4FC0A 2WELA 1ZYJA 2X8DA 1Z9XA 3ALOA 3NWWA 4WG5A 4ACDA 4ZJVA 4AZFA 4C4JA 4EK5A 1R0EA 3I0OA 4FIJA 4F1OA 4ZTQA 4EH2A 5LVMA 1Q8WA 1WBWA 2CSNA 1QMZA 3O8TA 5CU0A 4ARKA 3OBGA 5FEQA 4BCKA 3QQGA 2P2IA 2WU7A 3CEKA 3ZRLA 2PHKA 5JQ8A 5KNJA 4FKLA 4NUSA 4DT8A 4LRKA 2I7QA 2O65A 3KVXA 4GUEA 4IANA 4OGRA 3CGOA 4YP8A 3SOAA 3FE3A 5C1QB 3NVMB 3D4QA 3GOPA 1UA2A 1FGIA 4O38A 5CSXA 4EK4A 3P7BA 2WMSA 4W4YA 3QTUA 4DG2E 3KN6A 3M2WA 4M3QA 1IASA 4BZOA 5KHWA 2C0TA 2RFNA 3KF4A 4X6RA 3ZZEA 4R78A 4EQUA 1B39A 4FA2A 3RGFA 4EWQA 3FZRA 4EOKA 2F57A 4FTAA 2YACA 5JT2A 3ZM9A 4FK3A 1XR1A 1GZNA 3OWPA 3TI1A 4BZNA 4AOTA 3HEGA 4UXQA 1YDTE 2O64A 3HZTA 3PZHA 4U44A 1MQ4A 3WE4A 2OWBA 2RF9A 1XH7A 2JIVA 5IH4A 4QO9A 3U6IA 4IFCA 5BVOA 1XQZA 4O22A 4ERKA 1IEPA 4AA0A 3PJ3A 3CIKA 3QL8A 4OR5A 3RBWA 4CSVA 4ZTMA 2BAJA 5FRIA 2XKFA 2HZ4A 4QPSA 2PVKA 3WZDA 5HNIX 4L52A 4QD6A 4W4VA 3BLHA 4O0VA 2YA9A 4YC6A 1CKPA 2F9GA 3F3WA 3QTZA 5HG9A 5A54A 4O2PA 3M42A 4JIAA 4KWPA 1YXTA 3SDJA 4C4FA 5AX9A 4U7ZA 4MNEB 3V3VA 4IC7A 4LUEA 1Z5MA 4L46A 1FMKA 4RLKA 2QCSA 4GCJA 3ZHPC 2XP2A 3FYKX 5E8SA 3EN4A 4MQ2A 3TDVA 3TUDA 4E5WA 3LZBA 4DEDA 1W98A 3Q4ZA 2BALA 4R3RA 2ERZE 3ZLXA 5A6NA 1PXOA 4AAAA 5CQUA 4OTQA 3LFBA 4FTRA 4Q9ZA 2FUMA 4HVHA 4LV8A 1WBPA 5HI2A 2VO6A 5KBQA 2CMWA 5HIBA 4EKKA 3O96A 5JFVA 4IMYA 3AC3A 3F2NA 2RFSA 5CNNA 5CWZA 1H07A 3GQLA 2RFDA 4D0XA 4I6HA 1Q8TA 2UZBA 3DPKA 2Y8OA 4Y5QA 2ZV2A 4AFJA 4YPDA 2BPMA 2LAVA 4F9AA 4JBVA 1GZ8A 3ZEWA 2GDOA 3C0IA 3EN9A 3G6GA 3HRCA 3RZBA 4MQ1A 4UZDA 1F5QA 3SW7A 3LFSA 4V0GB 4DFNA 4D58A 2VO0A 3PUPA 2FSMX 4AG8A 2V22A 5AR4A 5AP3A 3Q5IA 3BX5A 3F2AA 3LFDA 4RQKA 1SNXA 3F5PA 3NIEA 1LPUA 3GQIA 4NSTA 4X2JA 2DYLA 1YRPA 4KA3A 4PP9A 4XLVA 3HV5A 4A4XA 3NPCA 4KKGA 3VUIA 1STCE 3G6HA 3ORKA 4XEYA 5BQ0A 3HDNA 2DWBA 2CNUA 2QNJA 4A4LA 4IZAA 4K11A 3V6RA 3W18A 3C4FA 3KXNA 2PULA 2YIXA 1OIUA 3AMBA 4TT7A 2WMWA 2I0YA 1FVRA 4ENYA 4QMSA 3UG1A 3DXPA 5EM6A 3DBDA 2I6LA 1KOAA 3R22A 4L67A 4LOQA 2VO7A 4WSQA 3CCNA 5JFSA 2H8HA 4IWDA 3CJFA 3BHVA 3C5IA 2BRBA 1GY3A 1W82A 3NRMA 3UIXA 2HXQA 1YXXA 4KIKA 4O7RA 4BBMA 2JITA 3OXZA 1XH6A 3KREA 2UZTA 4GKIA 2VV9A 3Q9XA 4AZTA 1T45A 4XX9A 4QYYA 3DB8A 4EH6A 3C4XA 2IVSA 4RJ6A 2YIQA 3QWJA 4TPTA 4ZK5A 4B4LA 4N6YA 3P9JA 2JFMA 2WPAA 3U8WA 4J98A 3PIXA 2XF0A 4FVPA 3T3UA 5LOHA 1ZYSA 2WTVA 3PJ8A 3CR0A 4J52A 2QLQA 4FZ7A 4XV1A 5A3XA 2AYPA 1PMUA 4EC8A 2GPHA 3RVGA 5KKRC 4CKRA 2X6EA 4O7VA 2I0EA 1Z57A 1I44A 1UU8A 4R7HA 3ID6C 1SVGA 3ZSHA 3POZA 4IHPA 3JVSA 5BVNA 2W4KA 3EWHA 4PPBA 2VAGA 2Z7QA 5EI2A 2P4IA 3MFTA 3DDPA 3Q53A 1Q8YA 3WZKA 3QTXA 1AD5A 2QHMA 5AUTA 5A6OA 2BCJA 5I9ZA 4IX6A 1GIHA 3FYJX 2OH0E 1SZMA 3AC5A 5TO8A 4AZEA 4CFWA 4PMSA 4HJOA 4RA4A 5H9BA 5HOAA 2CKPA 4TZRA 1H1QA 3EN6A 2JEDA 3F9NA 3C7QA 3PY1A 3I1AA 5EOBA 2YFXA 5AP1A 2OKRA 3P08A 2WTKC 4G3FA 3WE8A 1JSTA 3VS2A 3KRXA 3PPZA 4MXYA 4C2WA 4H3PA 2PZ5A 5AUYA 3ZYAA 3CS9A 2R3MA 4EOIA 4EYJA 3BIZA 4I5MA 5I9YA 3OEZA 3TEIA 5DGZA 1OBDA 1XHAA 4MK0A 3E64A 4OTWA 5K3YA 4Q5EA 5E8YA 3I5NA 2YZLA 4GT4A 3NAXA 3C50A 3RPRA 4TYHB 4LGGA 2P0CA 4RRVA 5CU4A 5DI1A 1J3HA 5LWNA 2GQSA 1J7IA 4BYJA 5EHYA 4I0SA 3EFWA 4D5KA 2I1MA 1V0BA 4K6ZA 3R7VA 1APME 3V5QA 1CMKE 4X3FB 2BRHA 5AUUA 2XNMA 4M0YA 4MH7A 4QMMA 4FKGA 5M09A 4CEGA 1HCKA 3UE4A 3SW4A 5IF1A 2ONLC 3DJ6A 4ONAA 5GJFA 2YM8A 3JS2A 3GP0A 4YHJA 2OZAB 2WTJA 4XOYA 2C6TA 3FMJA 4QOXA 3BHUA 4X2GA 2CN8A 3SXRA 3BI6A 2X0GA 3S2PA 3W33A 3FMMA 4GFMA 3OROA 3KMWA 4F7JA 1H1SA 2OFUA 1S9JA 4C4GA 3UNJA 1VR2A 3GI3A 4WO5A 5LMAA 5EK7A 2GFSA 3HDMA 4L3PA 2WGJA 4E6AA 3VBXA 4CFMA 1M7QA 1ZAOA 2OFVA 3SKCA 3DKOA 3CPBA 3LVPA 3MV5A 3FL4A 5TOZA 2VTIA 3ZO1A 3EIDA 4A9TA 2BRMA 4HYIA 1W8CA 4RIWA 2FB8A 4XH6A 3UMXA 4A9SA 4K0YA 4DG0E 2C3JA 4DFUA 2EUFB 2FH9A 3LCSA 3COIA 4S31A 4AW5A 1UVRA 5KUPA 4IWQA 4OTGA 3VO3A 4DC2A 4G34A 5BVFA 1A06A 2X9EA 2BZIB 4E73A 4OW8A 5E1SA 4CRSA 3GUBA 4WOVA 4E6QA 2VTAA 4K33A 3VW6A 4DFZE 2QG5A 3PRIA 1V1KA 4B0GA 2BZJA 4AA4A 1E9HA 4N70A 3ENHA 4XLIA 2ZJWA 1DI8A 1LEWA 1R39A 4FIEA 3CSVA 4C7TA 1VEBA 4B8LA 3F5UA 3PXFA 4WNMA 5CLPA 5EYCA 5HU3A 5DVRA 5IU2A 3DZOA 3FLYA 3QCYA 2OJJA 2ZAZA 3D7TB 4CCBA 2C3KA 2H96A 4FKIA 5CVHA 4USFA 4QMWA 1JSVA 4C36A 4UWCA 5IQCA 4FV6A 1IA8A 4IAAA 3IDBA 3ZLSA 1PXPA 3Q3BA 3CP9A 4EUTA 4TYIA 5IMXA 5J5TA 2ONLA 4NTSA 3PSDA 3QTWA 4BCNA 5FBOA 2IPXA 2W5AA 3OD6X 2PZIA 3DJ7A 4LL0A 4C58A 3M1SA 3IW5A 1GIIA 4PY1A 4RFZA 3ZSGA 5AIRA 3R1QA 3AC8A 3KU2A 1LR4A 3LW0A 4FSZA 4FV9A 3BPRA 1OIQA 2PMIA 3IK3A 4RC2A 3NUXA 2ITNA 2PWLA 4GIHA 1SYKA 2B9IA 4FZFB 3RTPA 5C8NA 3LLAA 2BAQA 5AP0A 1H28A 4YZDA 3ITZA 3NUNA 4FG9A 5AM6A 4AZSA 4QT1A 4BDBA 3NIZA 1DI9A 4HOKA 4II5A 4W4WA 5HGIA 4DH5A 5C8KA 4CGAA 2Q0NA 5JK3A 4FKSA 3TM0A 3SA0A 4I3ZA 4BCOA 4IBMA 4R5SA 4YHTA 1KE7A 2QQ7A 4PUZA 4FGRA 4JG7A 2X1NA 3UPXA 3PY3A 2H6DA 1K3AA 4HGEA 2V55A 1JPAA 3TNIA 1FVTA 1L8TA 3QWKA 1MUOA 4EOQA 4D1ZA 2XKCA 3DFAA 1O6YA 4L00A 1KE8A 5JRSA 3KCFA 3F3ZA 2VTOA 3GU6A 2WMBA 5M4UA 3OVVA 4UY9A 1UWJA 3HV6A 4A9RA 3FEGA 4J97A 1FINA 1NVQA 2XK3A 3ZH8A 4IM0A 3QTIA 4FK6A 1M17A 4OBOA 4EK3A 1CDKA 1KWPA 4O86A 3FMLA 4FT3A 1QCFA 2YLEA 4EC9A 5LXMA 2JDVA 5CTPA 4QP1A 4EI4A 3ZSIA 1VYWA 2VTLA 4U45A 4CQEA 3PG3A 1OITA 3BE2A 1JKSA 4KIQA 2OZOA 2ITPA 5FG8A 4MNEA 2WO6A 4EZ5A 3BHHA 4BGQA 5HX6A 5LQFA 4AP7A 2Y9QA 2B1PA 4L45A 4JJRA 2X8IA 3WIKA 1ZMUA 4AQCA 4F9WA 3UDBA 3DAEA 4GU6A 2W0JA 3HGKA 4V05A 1UNHA 3VBQA 3R00A 1NY3A 3D2KA 4BHZA 4I0RA 4FSQA 4JDJA 4EBVA 4U80A 5HCYA 1PMVA 5IEYA 3NAYA 4GK4A 3ORXA 1RQQA 4F09A 3KK9A 4G9CA 4XBRA 4EHEA 4D0WA 3TN8A 4BDAA 3DK7A 5HTIA 3SOCA 1PXIA 3BYUA 3ACJA 4H05A 2YWVA 3MWUA 2NRUA 3GXLA 3B8RA 4UZHA 4YJNA 3U4WA 3R8VA 3U87A 4BDCA 3NNWA 4JIKA 4ZZNA 4Z16A 4DFLA 4USEA 3FY2A 3RINA 2H34A 2QOBA 4FNXA 3BQRA 3DGKA 4IQ6A 3DXNA 4E7WA 5EQPA 2W1EA 4UBAA 4S33A 5HVYA 3TDWA 4TKSA 4RX7A 3QCSA 3VVHA 2OI4X 2J5EA 2XBJA 4C37A 1YDRE 4ACCA 4NJ3A 4E4LA 3BKBA 5ICPA 1H1RA 3DBQA 4FSMA 3R7UA 4V0GA 3FSFA 3NZ0A 5HG7A 2X8EA 4K18A 4DN5A 5DRBA 4QYEA 5HNBA 2WMRA 4JBQA 4M12A 3HP2A 1YWNA 4F70A 3JXWA 4Q5HA 5JFWA 1H27A 2QVSE 4F6WA 4PTEA 4TWOA 4FKPA 3MA3A 4M69B 3BGZA 4HCTA 3HYHA 4J95A 4YZMA 2JD5A 3AMYA 3OCGA 4TYEA 4F7LA 4PPCA 4ZTRA 2XK7A 3FMEA 3U55A 3HAVA 5IMEA 1A9UA 3KK8A 3EHAA 4ZJIA 2ZM1A 1IAHA 2WZJA 4IAFA 3ZLYA 3LJ0A 4PRJA 5CF5A 4FTTA 4CZUA 4CFNA 2R64A 4RLLA 4MWHA 4ASXA 2W4JA 3VHEA 2BAKA 5AP2A 3PJCA 3ACKA 5AX3A 3IONA 5HG5A 1ATPE 4NFMA 3NNUA 1PY5A 3I7CA 2OXYA 4AGUA 4C3FA 3GCQA 3TUBA 1PXKA 3HMOA 3DLZA 3MFRA 2QD9A 3PJ1A 3LMGA 4YSJA 3RPYA 4ZMEA 1QPJA 3GOKA 5BVKA 4N6ZA 2B9FA 3VUMA 5K5NA 2XJ2A 4EONA 3L9PA 4GJ3A 1ZY4A 1OPJA 1XBBA 3DNEA 1E1VA 3E8NA 4FTIA 4NK9A 4P2KA 4QMZA 5DEYA 5FD2A 3S95A 3O2MA 1BL6A 4IJ9A 3FWQA 5CVFA 3SX9A 4X3FC 3IOPA 3TWJA 3UNZA 3I81A 2CKQA 4QYFA 2QKWB 2P2HA 5D1JA 4IAKA 3R83A 2RG6A 4QMNA 5GZ9A 5DT3A 3F3UA 4H58A 2VTQA 1YWRA 4LOPA 3OG7A 5BVDA 1OL7A 1RDQE 2W1FA 3R9RA 2J0KA 4PDYA 3BHYA 4EQMA 1PHKA 2YITA 5E1EA 2XK8A 1CKIA 4C35A 4EWHA 2E9NA 2OXDA 4G6LA 4YJUA 5I5ZA 2RSVA 5K9IA 3VS4A 3QCQA 5HBEA 1JKKA 3MY0A 4CZTA 3GU8A 3HL7A 4A06A 2Z2WA 4ANLA 5CANA 2C6OA 5CAPA 2BDFA 2QU6A 2XNGA 2O3PA 3AG9A 4EH8A 4EOJA 5EKNA 1OZ1A 3PIYA 5HESA 2A19B 3FY0A 1G5SA 4P5QA 2W5BA 1JLUE 3D14A 4I5CA 5AWMA 3W2OA 3WIGA 5ACBC 4BZDA 3UPZA 3O0GA 1H25A 3K54A 5E8TA 2YIRA 2B54A 2XEYA 4ITJA 3MFUA 4IZYA 4CFFA 3LLTA 3HVCA 1ZARA 2UW9A 4QMUA 1M2QA 2JC6A 3HUBA 3ORIA 4I0TA 4TWCA 2G1TA 2QOLA 4XG8A 3COKA 3D7ZA 3UVRA 2PPQA 4Y83A 4DFYA 4A07A 4S30A 2B4SB 3TKUA 4OTHA 2HENA 3S1HA 1OM1A 5ETIA 3PA4A 3EB0A 1BUHA 4YZCA 4EKLA 3N4UA 4EH9A 4DE4A 3JYAA 3NYVA 4TL0A 4G3EA 4XG2A 3EQBA 5AIKA 2R3QA 3NGAA 4ALVA 2PMLX 3QD0A 5JGBA 2CHLA 4G6NA 3ZFMA 3FI4A 4DLJA 2V5QA 4BKJA 4TYHA 4MHAA 2XBAA 2ZM3A 4OTIA 1WBSA 1REKA 4OBQA 1WMKA 2EB3A 4S34A 4ZAUA 4X3FA 1YXVA 2ITOA 4X3JA 2EVAA 5HBHA 3WF6A 3QQUA 2IZTA 4KUJA 3P0MA 3HA6A 1PXNA 2Y0AA 3PFQA 3DNDA 4FTNA 5HVJA 1PYEA 1KOBA 2IZUA 3FKOA 4RQVA 2OZAA 4EH7A 3E7VA 5LVLA 3VRYA 5IA4A 2FA2A 4R8QA 4CFUA 5HX8A 3EZRA 2R3IA 3BWFA 4QMOA 3ENMA 2PUNA 5CEKA 3R1NA 5DR2A 1MQBA 1OB3A 4E20A 2CN5A 3AD4A 3IDPA 4LI5A 1FOTA 4Y72A 3COMA 3UIMA 3W2RA 4IC8A 1Y91A 3DAJA 2C0OA 2C1BA 2WTCA 4QQCA 3UC4A 5AV3A 4NH1A 2XJ1A 3AC1A 4IH8A 4X6QC 4YBJA 4BTJA 4FIHA 4FYOA 4KKHA 2UZNA 1U5QA 4Z9LA 5J5SA 3WZUA 2YHVA 2GQGA 5F1ZA 4DGOA 1REJA 2H9VA 3OY3A 3FQEA 3OXTA 1XBCA 3GNIB 5GNKA 4F6UA 2F7XE 3GC0A 3BEGA 3UZPA 1K9AA 2F4JA 4G1WA 4YJPA 2BUJA 4UEUA 3F61A 1M2PA 4BCHA 4HVSA 2ZV8A 4EHGA 3GC7A 3F66A 4GJ2A 5HE3A 4HNIA 1YOJA 3H30A 1PXMA 5ANDA 1R1WA 3EQCA 3UIUA 1RJBA 1URWA 3FL5A 3NNVA 4L42A 4RMZA 4ZS0A 4F6SA 3U6JA 2BFYA 2OJ9A 2XIRA 5AR3A 4YC3A 3N9XA 2YAAA 3DAKA 2JBPA 2HW6A 3UVQA 3UZTA 4GEOA 2UZLA 4FSTA 2OH4A 2Z02A 3ERKA 4GU9A 3R9DA 3LXPA 1ZZLA 1NVRA 4U42A 3ORLA 1OKZA 4F9YA 3KXMA 5CAOA 2XEZA 5EOLA 5A46A 5M44A 2ZDTA 3D7TA 5M08A 2HY81 4C34A 5HCZA 4AT5A 1Q5KA 2EXMA 3NEWA 3EQPA 3T9IA 3W2PA 4YU2A 3S00A 4EOMA 5IISA 3PZEA 3K5UA 1YHVA 4F99A 5CAUA 3HA8A 1Q3DA 3G9NA 3RCJA 4BIEA 4C8BA 3MIAA 2F2UA 2WQBA 3OTVA 2QG7A 2XK4A 1BX6A 2FO0A 4DF3A 2EWAA 2XMYA 4QP2A 1OKWA 2X81A 3TJDA 2VTRA 4RWIA 1HCLA 4K77A 5M06A 3DJ5A 4H39A 3N51A 3ET7A 4FF8A 4XOZA 2SRCA 3D5WA 2W96B 5FBNC 4DTKA 2E9OA 2WTDA 1X8BA 4ANOA 3MY1A 3NW5A 4YBKA 3RM7A 4IVCA 3DZQA 4UALA 2BZHB 3G0EA 4JQ8A 1PMEA 3KQ7A 3DLSA 2VNYA 4NM5A 4WNPA 3VS1A 5AP5A 3ZRKA 2X7GA 4AN2A 4QMPA 4RVMA 4HVDA 4EOOA 3LXLA 3PIZA 3RPVA 3QRKA 2X4FA 4GV1A 5IA5A 3BHTA 2G9XA 4BCGA 4DCAA 2UW6A 4BR3A 4C0TA 2UVYA 4XBUA 3DKFA 4S2ZA 2VTMA 3QRTA 5IDPA 4LL5A 2OJGA 4U43A 4D9UA 4O83A 5DA3A 4MAOA 4RC3A 5M51A 4BDKA 3BQCA 4FSUA 2GHMA 1NT2A 3A7GA 3QALE 4O7LA 4UWBA 2CGUA 2XYUA 3OW4A 4WUAA 3NUSA 4IB3A 3PPJA 1YXUA 1O6KA 1YW2A 2WOUA 4I1ZA 3W55A 4A9UA 5M07A 5EI6A 4E5BA 5EYKA 5EM7A 3HECA 3ZDUA 4RIYB 5J1WA 3IW4A 5I9WA 4C59A 3FZPA 1U54B 2PVNA 4O27B 4E5AX 1LUFA 5CU3A 3D5XA 1PKDA 3TZ8A 4CZYB 5I3RA 3FSKA 4P5ZA 5BPYA 3GCPA 4H3QA 2DUVA 4YURA 2O8YA 4ZY4A 3FI8A 5AJQA 3RKBA 3QLFA 1PYXA 3CTJA 3KXGA 3MI9A 1SVHA 5TF9A 4KINA 5DBXA 4IACA 3T9TA 4D1SA 2R0UA 3SQQA 3GFEA 2YZAA 2UZWE 3SGCA 2GHLA 3SD0A 3G51A 2WHBA 2X2MA 3Q4UA 4D4RA 3QF9A 4O0SA 4ACMA 4FV2A 3BEAA 1BYGA 2XIZA 3BV3A 3NYOA 3ELJA 2W1DA 4HCVA 3TV6A 3Q04A 5HO6A 3VJOA 4QRCA 5T68A 4HVGA 4YGAA 3U6HA 5D7AA 1DAWA 4CT1A 2OF4A 4YJTA 3DQXA 5KMMA 4NT4A 4F0FA 4BWXA 2PY3A 4NIFB 5K5XA 4PV0A 3VIDA 5JMSA 4ZZMA 5AV4A 4XG3A 5A4CA 4V04A 2BRGA 3FMKA 3KB7A 5EDRA 5FLFA 5C03A 4CKIA 3IECA 3PLAE 4RZWA 4YSMA 3BELA 3PXKA 2R7IA 2ITYA 4H1MA 4D2WA 3VWAA 3ZBXA 4PL3A 4JDHA 3E62A 2ITQA 2NO3A 1OPLA 1OI9A 2XIKA 3QQJA 4KRDA 3QYZA 4HYUA 4IVDA 4JVGA 4KSPA 3LAUA 2C5OA 3AT3A 3QRUA 2HIWA 3R1SA 4NEUA 3S4QA 5KO1A 4YLLA 3KEXA 2QO9A 3C51A 2YM7A 3OWKA 3P79A 3GCUA 4FUXA 4M69A 4M68A 3LCTA 4YLJA 2ETKA 2UW7A 3GT8A 3NUAA 2DQ7X 3Q9ZA 5HLPA 2VTJA 3HRFA 4E6CA 4HPUE 3P1AA 3O17A 3LPBA 1P2AA 1PF8A 4NCTC 2WEIA 4XG4A 5F4NA 4B6LA 4FX3A 4YNEA 4G5JA 2XK6A 3QRIA 4M84A 3U54A 4IVAA 2FSLX 5KBRA 3V5LA 5AP7A 4F7NA 3W8LA 4FIFA 5JRQA 1W7HA 5CZIA 4Y8DA 2GNIA 2HWOA 5FTQA 4XNEA 3H0ZA 4DH7A 3ZONA 4K9YA 4DINA 5I9XA 5IEVA 3AOXA 5L8KA 5J95A 5CS6A 1KUTA 4FKRA 4XRLA 5HE2A 3QTSA 4WD5A 2W06A 4XS2A 3OHTA 3S3IA 3TKHA 3ULZA 2C68A 3VS5A 1P5EA 4FT9A 2QHNA 4RWJA 4EOPA 3UQCA 2JBOA 2JKOA 3EH9A 4ZOGA 4D2VA 5IQBA 2ZDUA 5H8GA 3OWLA 3EQHA 2YM3A 4YUQA 5CU6A 5HTBA 3Q2MA 4NU1A 3ZO3A 4FNWA 5D9HA 3ZO2A 5EQYA 4DH1A 3GCSA 3GU4A 4G31A 4Y85A 4BF2A 3SG8A 1IR3A 2PVRA 5F20A 2HCKA 2R3JA 2V0DA 1CSNA 2R3LA 3VHKA 2Y7JA 4M8TA 2GHGA 2UW0A 3R2YA 2I40A 1ZY5A 2O2UA 3FC2A 4U41A 3LFEA 4PNIA 5ACKA 2YCQA 4RVTA 3R8ZA 3IS5A 5KMKA 3OY1A 3RNYA 3EN7A 4GVJA 4FNYA 2OBJA 4G3GA 2CCIA 4P4CA 4LYNA 2UZUE 3Q32A 4OTDA 4I4EA 4PL4A 3RWPA 4XV3A 4RGJA 1B38A 1JVPP 5L6PA 4RX5A 3KN5A 5I3OA 4I6BA 4FE2A 4I93A 4Y95A 5EYDA 4BTKA 4I6FA 3FHRA 4O6EA 4F9BA 3OC1A 4Z7GA 3RPOA 3CY2A 2JAVA 3BV2A 4IW0A 3TNWA 4NCTA 3VF9A 4EL9A 4USDA 2CKOA 2A4LA 5IQAA 3VULA 3B2WA 4O82A 4RWLA 4LUDA 4XG9A 3BCEA 3DT1A 4ORKA 1TQIA 4KBCA 4ACGA 3Q96A 2C1AA 2J6MA 2BMCA 2VTTA 3CQWA 3DQWA 3D15A 1OBGA 3L1SA 3TL8A 4PDSA 2QONA 4YZNA 2XRUA 3D94A 2J0LA 1BI7A 2QOHA 1PJKA 5J7HA 3DV3A 5K0XA 4I94A 1OIYA 4XYFA 2CCHA 3V6SA 3QD2B 3LHJA 3K5VA 1UU3A 2CGVA 4JNWA 3PVGA 1BI8A 4QTEA 4BTMA 5DH3A 2PL0A 3KCKA 3FZSA 2WMAA 3M11A 4FKUA 4M0ZA 2IG7A 2OXXA 5KZ0A 3EKNA 3CTHA 3HMIA 2QLUA 1YKRA 3F88A 4L01A 3DFCB 2W5HA 3SC1A 3VN9A 4JI9A 4BGHA 3BGQA 5FWKK 4CG9A 5CSVA 5IQHA 4FUYA 4G5PA 4XP2A 2QC6A 1GJOA 3F7WA 2ETRA 5CY3A 1VZOA 5GZAA 4BIDA 4GT3A 3LFFA 3GC8A 1H1PA 4ZJJA 4FL1A 4FZDB 4QYGA 3VBWA 3A4PA 3IDCA 5CALA 1O6LA 4W8DA 4AACA 4TWPA 3T3VA 3R73A 2XVDA 1MRUA 3DDQA 3QC4A 1H24A 2P3GX 4WT6A 4YO4A 5C27A 3U51A 3QKLA 4IVBA 3R1YA 4U9AA 4KS7A 3GVUA 5E8WA 3P86A 1IG1A 3QA8A 3UP2A 4F1MA 4D2TA 1GOLA 1H0WA 3A7HA 4K8AA 5D7VA 1DAYA 3FKLA 2IW6A 4ANSA 5AAFA 5DEWA 3W1FA 4NWMA 3E93A 5E8XA 2W1GA 2PVFA 4ZSGA 4WUNA 3LQ8A 3EQDA 4HYSA 3MDYA 3SRVB 1OMWA 2JLDA 3OEFX 3CY3A 5HKMA 2WNTA 4FKOA 4JBOA 3VQHA 2X2KA 2W1IA 1ZYDA 2HELA 4F4PA 3BWJA 4XJ0A 4HPTE 2QOFA 1YDSE 3MS9A 3R04A 3NMUF 4CMOA 5FGKA 4F64A 3I5ZA 3OXIA 3PYYA 5LVNA 3C4ZA 5LARA 3SXFA 4NKSA 3SXSA 3DS6A 1QL6A 4PX6A 2X6DA 4FNZA 4ANBA 5AFVA 5DPVA 1G8SA 3NYNA 2PUUA 1KV2A 2FSTX 5EH0A 3KC3A 3OMVA 3N4VA 2XCKA 4GK3A 3LCOA 4BDHA 2WQMA 4ASEA 2B9JA 4KKEA 2G01A 4RJ7A 4J53A 4FV3A 5IDNA 3QTRA 5FDXA 4O7YA 1WBNA 5FP5A 4KB8A 3LMHA 2Y6OA 3ORNA 2CJMA
chains in the Genus database with same CATH superfamily
4O81A 5H8BA 5IQEA 1JAMA 5FM3A 4R6VA 2AUHA 5C4KA 1R3CA 2JAMA 4O1PA 5M4IA 3O8UA 3EYGA 3LM5A 4IB1A 5DRDA 3UQFA 2IN6A 4MF1A 4CV8A 2YN8A 4MX9A 1L3RE 2J9MA 2ITWA 3HKOA 1ZWSA 5AV0A 5A4QA 3JR1A 2XCHA 4BGGA 4H36A 5E8ZA 4BCIA 4O7SA 3A62A 3OCSA 2VTNA 3TMOA 4I6QA 2WMVA 4JDKA 3U4UA 1XH5A 2YJSA 5DG5A 2YDJA 2B0QA 2O5KA 2PVMA 3BU3A 2HW7A 3R21A 4FL2A 4LGHA 4WKQA 2Y6MA 3JUHA 3VBYA 3FLQA 3ROYA 3DBFA 4DGGA 3FAAA 3IW6A 4ASDA 3CTQA 3MW1A 3E87A 4D4SA 2R0IA 3QKKA 4AW1A 3AKKA 3TIZA 5BUJA 3QFVA 2GTMA 1CM8A 5LVPA 3EMGA 1SM2A 4GRBA 4XHKB 4D9TA 4BJJA 4RVLA 4E1ZA 2RIOA 3Q52A 4DTBA 3SHEA 4DBXA 2Z7LA 3QZIA 3RHKA 3BBTB 2YCSA 4HNFA 4RSSA 4YJSA 4FKTA 1B6CB 5GHVA 2YDKA 3DXQA 3TT0A 3E92A 3UBDA 5E91A 5A4TA 2HWPA 4IDTA 4X2KA 2CDZA 3KMUA 5IG1A 3K3IA 3OT8A 4BB4A 4EH5A 4MD9E 5IA2A 3EFJA 4AT3A 4BN1A 5BUEA 2UW3A 4RIYA 4P7EA 3QQFA 4BDGA 2IO6A 3EFKA 3L9LA 3A8XA 1U54A 3PVUA 4BDJA 1H01A 3PWDA 3KMMA 3CKXA 5C01A 5CEOA 2IZSA 3OOMA 2ZV9A 5L3AA 4RIXB 4G17A 3CPCA 3GENA 5JEBA 5D41A 3Q9WA 3NS9A 2HAKA 1XH8A 2JIUA 5FTOA 4LMUA 1YVJA 5AR5A 1ZOGA 1M2RA 2QO2A 3A2CA 4JX7A 2OICA 4ZTSA 4MXAA 4LM5A 5ANJA 4EZ3A 4WIHA 2F7ZE 5DR6A 2G2FA 4L9IA 3V04A 5EI8A 5B2MA 3BL7A 4BI0A 3ROCA 2ZM4A 4XG7A 4IFGA 5ANEA 2XKDA 4EK8A 5ETCA 1J1CA 1UWHA 4YJQA 3L8VA 4FT5A 3UOLA 3RZFA 4MYGA 2Q0BA 4YC8A 3TKIA 2J51A 4DGNA 4DT9A 3DK6A 4GVAA 3ULIA 1R0PA 4FV7A 4NIFA 5CT7A 3RPSA 5HLWA 2QOQA 1J91A 2PZRA 4C2VA 4GW8A 3G2FA 4C4IA 3NW6A 5L2SA 3HX4A 4G16A 4JS8A 3W2SA 3D5UA 4DLIA 1W84A 2R4BA 5C8MA 1P14A 3FMHA 3ORZA 4XP3A 4FR4A 3MH2A 4Y5HA 3LFNA 3IPHA 4FEQA 3PE2A 3AGLA 3C4EA 1OUYA 3HRBA 4JAJA 4QQJA 4F08A 3FXZA 4G3DA 1LP4A 2QOOA 4H1JA 4M14A 5LJJA 5CEIA 4GIIA 4KS8A 4YTFA 2NP8A 4ZLYA 3CE3A 2OG8A 4UX9A 3HNGA 1W2DA 3HP5A 4I41A 4IX5A 5CI7A 4YJRA 4ZSJA 3W2CA 4NZWB 3E8EA 5AAEA 3QBNA 3BBWA 3HLLA 4ZLOA 2HZNA 2OGVA 3IQ7A 3MA6A 3VUTA 4AZWA 3ZEPA 4CNHA 4MD7E 4I24A 4KBKA 5HORA 5J9LA 4HZSA 1H00A 3DCVA 4JDIA 4GUBA 4UMUA 1QPDA 2W7XA 5DN3A 3ZDIA 4RA5A 3AD5A 2GCDA 2W99B 4ZS4A 4FTQA 3VNTA 1OKVA 4KRCA 5JN2A 1F0QA 4D2PA 3BZ3A 4BBEA 5K4IA 2R7BA 5EHLA 3QZGA 2WQEA 4GKHA 5HTCA 4V01A 1WVWA 4DEAA 4GYIA 4OUCA 1DS5A 4RX9A 2YCFA 3R63A 5IEXA 1ND4A 2VN9A 2C6LA 4GT5A 1CTPE 2R9SA 3WARA 3ANRA 2ZV7A 4CV9A 3EQRA 5IPJA 2GS2A 3CXWA 5TE0A 3R9HA 4NW6A 5GIPE 4FKQA 3UDTA 3HV4A 3UP7A 3H10A 3NUYA 5CF4A 2OF2A 4YTHA 3AXWA 5EHOA 3TV7A 5K0KA 3R71A 1Q97A 3BYMA 3D9VA 4BI1A 4XV2A 1G8AA 4N0SA 4QTDA 1SNUA 4RWKA 5B0XA 2BRNA 4AZVA 3A7JA 4G9RA 5J9YA 1O9UA 2BILB 4NM3A 3PJ2A 4DTAA 5JGDA 5TR6A 4ID7A 2XJ0A 3TXOA 3UO4A 3UODA 1YQJA 3OFMA 4HZRA 5IA0A 3O5AA 4IZ7A 4UYAA 3HAMA 1ZOEA 3UVPA 4ENXA 5IQGA 3FLNC 3O71A 4JG8A 4O0RA 3V8TA 4ZY5A 3BYSA 5JZNA 5ETAA 3R7IA 4CQGA 2X7FA 2B9HA 5AV1A 2IEWA 3ZFYA 2QURA 4O0XA 2QOIA 4ZXTA 2PU8A 2PSQA 3KRLA 2AC3A 2PTKA 3W2QA 2NNWB 3RNIA 1KE5A 2PZYA 5J87A 3QHRA 2QODA 3IGGA 3EJ1A 2GNGA 2A98A 4ZZOA 4H3BA 5EFQA 4JAIA 3O7LB 4PF4A 4L6QA 4CYJA 4AGDA 3LE6A 2VNWA 4YPSA 2C47A 5BMMA 2PUPA 4QP8A 4EJNA 4L3LA 4DYMA 1WBTA 2R3OA 5E8VA 4ACHA 3MH0A 4WSYA 4CFXA 3ORPA 3QUDA 5C9CA 4I5PA 4O0YA 4GG7A 4GMYA 4J96A 3R9OA 3PPKA 2R2PA 2IWIA 4RFMA 2Q83A 2IF8A 2WFYA 2AC5A 2GTNA 2V62A 4Y73A 2XIYA 5ANIA 1SMHA 4QP6A 4DITA 4U8ZA 4BCPA 5JQ5A 3FJQE 1M14A 4TYJA 5EW9A 4PTCA 4BIBA 3IW7A 4O1OA 2VTHA 2CNQA 3FUPA 3GEQA 4M97A 5EKOA 4K1BA 4BC6A 1QPEA 3ZBFA 4CFVA 2WTIA 2XUUA 4TNBA 3QD3A 2BKZA 4BFMA 2B55A 1GNGA 4AU8A 5M56A 4LRJA 3FPMA 1H08A 2FSOX 2HOGA 4RBLA 4F65A 4IX3A 4DEHA 3BLQA 2BZKB 1OL1A 4HGTA 1VYZA 3Q4CA 3OCBA 4ZMFA 3R8UA 2PVYA 3U9NA 2VX3A 4IM3A 4QP7A 2YLFA 5BNJA 4DA5A 3R0TA 3LOKA 5HO8A 5KHXA 3KGAA 2UVXA 1Q61A 4EOSA 5AUXA 3A7FA 4FTMA 4UB7A 4JL9A 3P5KA 3TYKA 4CD0A 5B7VA 2JKMA 3DB6A 3E8DA 3AQVA 3QGWA 4FKJA 3NFFB 3OUKA 3H9RA 1J1BA 3G0FA 2ITZA 3PTGA 4IZ5A 4WBBB 3V5PA 3FZTA 3VS0A 5GZ8A 3WF7A 4BDDA 5HLNA 1ZMWA 3VBVA 4FGBA 4YMJA 3UDSA 3E5AA 1OGUA 2P33A 4TW9A 4U97A 5L8LA 4FVRA 2CNVA 3BRBA 3P7CA 4BTFA 5DOSA 3NDMA 2OK1A 5G1XA 1FBNA 2WQOA 2CGXA 4D55A 4O84A 3E8CA 4L43A 4X2NA 2X0PA 4NL0A 3BU6A 4J1RA 3SRVA 5B2LA 1Q3WA 5EYMA 3NLBA 5IUHA 4TTHB 3W0RA 4ITHA 5CI6A 4EYMA 3C13A 1OUKA 3RAHA 1H0VA 2VO3A 1BLXA 5HIEA 2C3LA 3CLYA 4YJOA 4I4FA 5DR9A 4UMPA 3HMMA 2W9ZB 5KX8A 3TIYA 2JFLA 2Z8CA 2BVAA 4IEBA 4Q2AA 2OIBA 2R3RA 3FMNA 2XK9A 4QTBA 3WYYA 4E6DA 4G6OA 1QPCA 1XBAA 2OIQA 4I20A 3RALA 4LOOA 4CG8A 2BTSA 2C3IB 2YM4A 3G90X 4G2FA 2X7OA 4ZY6A 2ZVAA 4MCVA 3VC4A 1FMOE 2HZIA 3EOCA 3OOGA 3IOKA 3PA5A 5FDPA 3SG9A 3QRJA 2Z60A 2Z7RA 3JPVA 4RIOA 4WA9A 1TVOA 4UWYA 5H8EA 3ZRMA 5LCKA 5HZNA 3L9NA 5DFPA 4F0IA 4UMRA 4MBLA 3UNKA 3PVWA 4F7SA 3NR9A 3QC9A 4S32A 3E63A 5L6OA 1W2CA 3NNXA 2KULA 1MRVA 2G2HA 4D28A 2ACXA 2WU6A 4DEBA 3RCDA 4GYGA 1H26A 3NW7A 3HMPA 4AT4A 1S9IA 2RKUA 4XP0A 2W17A 4IM2A 1HOWA 2RFEA 4KNBA 1GAGA 4O4BB 3UJGA 4LDTA 5L6WL 4KABA 3A8WA 3I60A 4CXAA 4MTAA 4DGLC 5KMNA 4ZTLA 4AOJA 3AC2A 3QHWA 4IWOA 3IGOA 5KCVA 4OAVB 1JQHA 4X21A 1MP8A 3QLGA 3V5JA 4JT3A 5C26A 3L8SA 4A4OA 2WMUA 2XKEA 1ST4A 4RZVA 4DGMA 2I0HA 4YZBA 4O7ZA 1V0OA 4BCMA 1P4FA 3LM0A 2X4ZA 4MVFA 2QI8A 2GFCA 4HYHA 3NYXA 2WQNA 3IKAA 3FKNA 3Q6WA 4PTGA 5IH5A 4DDIA 4ZIMA 2ZMDA 4J7BA 4CRLA 3VUKA 1WBVA 3UZRA 5ITAA 1OECA 1ZXEA 4KIOA 4UXLA 5CASA 1XMLA 4GFGA 4EOLA 1OVEA 5IQFA 5AUWA 5FXRA 4AN9A 3LCDA 3P78A 4U40A 4KBAA 4EHZA 4CYIA 2R3GA 2QKRA 4QP9A 4J8MA 4WHZA 3CQEA 4M67A 3MIYA 4UMTA 3C4WA 3LCKA 2C5VA 4D4YA 2OIDA 4UN0C 4CKJA 3LQ3A 4ZTHA 5CYIA 1YI4A 5FXQA 2RGPA 5HEZA 3ZUUA 4FKVA 3O8PA 2FVDA 4QQTA 2O0UA 4UMQA 3PLSA 3Q9YA 1JSUA 3FZOA 2BDWA 2R5TA 4APPA 4UV0A 4DG3E 3F3TA 3W0OA 4MEDA 5HE0A 2X9FA 5AR7A 2UVZA 4F63A 3HV3A 5IZFA 3PY0A 5IKWA 4DBNA 3LKMA 4RIXA 3BLRA 4NM7A 2QU5A 3FXXA 4MXOA 3MB6A 4QNAA 4MBJA 4C02A 4QMQA 4R7IA 4KAOA 2WMTA 2WTWA 3KKVA 4PMMA 4ANNA 2EB2A 1GZKA 4U3ZA 3V8SA 3VS7A 2ITVA 4EH4A 3H0YA 2WAJA 4YTCA 4AGCA 1BMKA 3TNQB 3R01A 4DHJA 4TWNA 3WI6A 2VX1A 4D2RA 5EQEA 1WAKA 1WBOA 5CF6A 1FVVA 2YIYA 3ZUTA 4L53A 4R1VA 3DKGA 4JX3A 2HZ0A 4KIPA 4WG4A 2C5XA 3V5WA 4MXZA 1XWSA 5L2TA 3QTQA 4Z55A 2B7AA 4OTRA 1Q62A 2UW8A 5AMNA 4IAYA 2C6EA 4AUAA 4W8EA 4RJ8A 5CXHA 5CAQA 1FQ1B 4BL1A 1FPUA 4RJ3A 3EYHA 2CLXA 3I79A 3MVLA 2ZMCA 2XRWA 3ODZX 4DH8A 3HMNA 3V51A 4YLKA 3OWJA 4FV5A 5HHWA 4QMYA 5M4CA 4G3CA 5AM7A 3VRZA 4Z7HA 5CEPA 5I9UA 2B52A 2JDSA 2PVJA 1M7NA 4GG5A 4I22A 3UC3A 4I5HA 4FT0A 3R8MA 5E9EA 5A4LA 4ANMA 2BHHA 4QMXA 4NYEA 2QR8A 3LXNA 4WNOA 4JLCA 5AEPA 5HBJA 2IVTA 3DOGA 5DNRA 5AAGA 2GNFA 2W1ZA 4PDPA 4E4MA 1Y6AA 4Z3VA 3MVJA 5H2UA 5A14A 5CXZA 1IA9A 4PQNA 5BVWA 3FQHA 3ODYX 3A7IA 4D5HA 4IB0A 1WZYA 4UYNA 4FT7A 4YO6A 4ZEGA 4AS0A 2YIWA 4FV1A 4GSBA 1KSWA 3RAKA 2JDTA 2VWBA 3TZMA 4IB5A 1IAJA 4LMNA 2VX0A 2UUEA 5CSHA 5BYYA 5CSWA 3LJ2A 3PG1A 4PL5A 2W9FB 3H9FA 1U59A 2ZYBA 4WRSA 3F6XA 3ATSA 3ATTA 1Y57A 3TV4A 1ZOHA 3EQIA 5DWRA 3TJCA 3ZLWA 2C69A 3GU7A 2C5NA 4AN3A 3VS6A 5LMKC 4QTCA 5BYLA 4F9CA 5EM8A 4M13A 1E1XA 3IO7A 2C6DA 3E3PA 3W10A 5DIAA 4MNFA 5GINE 5EM5A 4B7TA 4YR8A 4O7TA 4B8MA 4BWKA 5DLSA 4I23A 1KE6A 1UKIA 3VUDA 3TUCA 4IX4A 3RK5A 1UNGA 4OT5A 5ANOA 3UTOA 4YZ9A 2VUWA 4FSNA 3VBTA 3TTIA 2JIIA 3OF0A 4IE9A 2XB7A 4LGDA 1YXSA 3UGCA 4EUUA 2BHEA 4DEIA 4QPAA 5FEDA 4RJ4A 3EN5A 4E4XA 3RHXA 3C0HA 5KZIA 2GNHA 4FVQA 3PSCA 4ZTNA 5L2IA 4L3JA 2BTRA 3OCTA 2JKKA 3QGYA 3II5A 5DHJA 5G6VA 4BYIA 5J7BA 3PE1A 3PP1A 3D83A 4CTCA 5F9EA 3DBCA 1YHSA 2AQXA 5ANKA 2PYWA 2UZVA 4IAIA 3OUNB 4YJVA 3QYWA 1ZRZA 3TZ7A 1P4OA 4IADA 1OGYA 2C6IA 3F5GA 5BUIA 4W9WA 3ZOSA 4MD8E 1XKKA 3D5VA 3LFQA 2CLQA 4GS6A 4JRNA 4TRLA 2F2CB 3ZM4A 2PE0A 2UZDA 3MBLA 5AUZA 4U0IA 2IW8A 3UOJA 1JBPE 3FPQA 3SLSA 3AKJA 4JG6A 4KSQA 5AP6A 2DS1A 1PMNA 4FV8A 3WF5A 1V0PA 3UQGA 4XG6A 2J7TA 3ZZWA 3FLSA 4NTTA 5L4QA 2XNPA 3FI3A 5CNOA 1NA7A 4EH3A 3PRFA 4AWIA 4PDOA 4PWNA 4IAZA 2BR1A 3P4KA 1Q4LA 4ASZA 2FGIA 5HICA 5CSPA 2PMNX 4RT7A 5LMKA 2ITXA 2Z7SA 3K2LA 4FBXA 3PXYA 2GQRA 2P55A 2OLCA 4LG4A 3REPA 4DEEA 4Y46A 1TKIA 4E3CA 3UOHA 4M7IA 4FTJA 4FZAB 2PE1A 4JR3A 5CQWA 3WZEA 5BV3A 2BDJA 4X2FA 1WFCA 4BICA 1AGWA 4C57A 4JOAA 5AV2A 5ANGA 3TNHA 3UYSA 3COHA 5F95A 3AMAA 4FTOA 5J9ZA 2VWXA 3NUUA 4ALWA 1WCCA 3QQHA 1Y8GA 4QMVA 2A2AA 4R7BA 3CD3A 5E92A 2F7EE 1OPKA 2E9UA 3L8XA 4NJDA 4DAWA 2LGCA 1I09A 3ETAA 4BKYA 2Y4IB 3KXXA 4FG8A 3PP0A 5E4HA 2F49A 5L2WA 5CEMA 3FBVA 4AW2A 3UIBA 2WD1A 3DA6A 3RI1A 4GK2A 4P90A 4PMPA 3IG7A 5IQDA 1SVEA 2QOCA 5CVGA 4K2RA 5T6KA 3RK9A 2VD5A 2YM5A 4D2SA 4QPMA 2YERA 3I6UA 3QCXA 4QMLA 4R1YA 3QD4A 4DHFA 4IJPA 4FTUA 4QMTA 3KXHA 4GFOA 3FHIA 4WRGA 2PK9A 3PWYA 3ZC6A 4W9XA 4RVKA 5IUIA 5LCJA 2PUIA 3VAPA 5IA1A 3O51A 3MFSA 1IRKA 4O0TA 3QXPA 2KTYA 4FEWA 5B2KA 5TT7A 3C9WA 3Q4TA 3RAIA 4F1TA 3TACA 3NCGA 5HE1A 4TY1A 2E2BA 4AA5A 2J0MB 2O63A 3G33A 1Q8UA 3MVHA 3OS3A 3WYXA 3H4JA 2UZOA 4QTAA 1M52A 3A60A 2G15A 3RAWA 3MPAA 3JVRA 1YOMA 1J7UA 4ZSLA 1VLRA 5CZHA 4DHIB 5E7RA 3ANQA 4BY9E 4O21A 2JKQA 3OZ6A 4OAUC 4IWPA 4L7FA 4C33A 3R7GA 4FIIA 3ORMA 3EQGA 4XUFA 2R3PA 2X2LA 3KF7A 3HUCA 3R7EA 2QR7A 4C61A 3P23A 5JH6A 4RC4A 4U5JA 4MKCA 3EL7A 2C0IA 3KULB 4WG3A 5D11A 4F0GA 2PZPA 3MJ1A 4EK6A 1GZOA 2J0IA 4AXDA 4NKAA 3QUPA 3FLZA 3GU5A 3R6XA 5AA8A 2Y4PA 5JKGA 4CLIA 4J8NA 2XNNA 4GL9A 3BYVA 4RG0A 4E26A 2VWYA 1OL6A 3I6WA 2XIXA 3FZ1A 4ALUA 4FODA 1OL2A 3V5TA 2WIPA 2XH5A 2JDOA 3QX4A 5JFXA 1U46A 1W83A 3MY5A 3FI2A 4AQKA 2XALA 3ZXTA 3KXZA 4LRMA 4JQ7A 4FOBA 1TZDA 5L8JA 2GS6A 4I6LA 4AXEA 3UOKA 3VJNA 5KMOA 3Q2JA 5FTGA 3W0NA 4FMQA 3I0QA 5A9UA 4FTKA 1PW2A 3W16A 4CCUA 3HV7A 4EJ7A 3F7ZA 5DE2A 5AR8A 4U3YA 3OBJA 4E4NA 4DFXE 3G5DA 3O23A 3QZHA 3IW8A 3T8OA 5CT0A 2VZ6A 3U9CA 2VWZA 4BRXA 4BBFA 5IUGA 4FEUA 1EH4A 4C4EA 3QX2A 2GMXA 2W4OA 1ZYCA 4ITIA 2GNJA 4ZSEA 4CLJA 4AOIA 4KD1A 2ZB1A 3MPMA 2J0JA 3QA0A 3LFAA 5BX0A 4QNYA 4O2ZA 3DTWA 4YHFA 3SAYA 1PXJA 1CKJA 4EZ7A 4WNKA 3DU8A 4BVUA 1TFFA 4A9YA 2YCRA 3A61A 1UNLA 4AE6A 5C4LA 4TN6A 3PXQA 5DYJA 2VGOA 3AT4A 5CAVA 4XV9A 2VRXA 4O91A 1UU9A 4FRFA 4O0UA 4I21A 2HY0A 3NUPA 1TQMA 3VUGA 4AGWA 5D12A 1OIRA 4PNKA 3DY7A 3R02A 1ST0A 4IIRA 3CJGA 4JR7A 4R3CA 4RJ5A 4WBOA 4ZLZA 4C3RA 3PXRA 4O7NA 1AQ1A 2C30A 3ZTXA 4QP3A 3QZFA 4JRVA 2IZRA 3A4OX 4C62A 4FTCA 2C5YA 4L44A 3RK7A 4FV0A 3UG2A 3C0GA 4OLIA 5IQIA 1T46A 1NXKA 2J90A 3L9MA 4O0WA 3LIJA 3UMWA 2OJFE 5M55A 3CC6A 5BMSA 2YEXA 3B8QA 3F69A 3QKMA 2XYNA 3R7YA 4B9DA 4J99A 4QP4A 2XZSA 4BCFA 4W4XA 4QQ5A 1PXLA 3W8QA 4CTBA 5KMLA 4D1XA 3AGMA 3NSZA 2W1HA 2XM9A 3TNPC 3VQUA 4C38A 4C4HA 2YJRA 4DCEA 5HD7A 3EKKA 3MH1A 2X39A 2YDIA 3PA3A 3WZJA 3R9NA 1R78A 4FICA 5AUVA 2A0CX 2J50A 2XNBA 4AE9A 3QU0A 1Y8YA 5IH6A 3G9LX 4FOCA 4BCQA 3QQLA 3TG1A 5HU9A 2WB8A 3MSSA 2XM8A 3S0OA 3MGYA 5J8IA 3SV0A 3QAME 4OBPA 3O7LD 4YNOA 3W32A 2CKEA 4YTIA 5FXSA 2EXEA 1H8FA 2PVHA 4E93A 2GS7A 2ZOQA 5E90A 3Q60A 4FL3A 3PVBA 4L8MA 5HNGA 4N57A 4OTPA 3EQFA 2WXVA 4X7QA 2QOKA 2BIYA 4MXXA 3LJ1A 4PP7A 5BYZA 3KRRA 3LFCA 5KMJA 1ZLTA 3F82A 4X0MA 2I0VA 1JKTA 2ERKA 5HO7A 2WMQA 3DKCA 2ESMA 2NPQA 2RG5A 3CQUA 5HG8A 2WEVA 2XNOA 3R8LA 2J5FA 2VWWA 4M15A 2ETMA 4HCUA 2EU9A 2UZEA 2YABA 2W05A 2ZB0A 3QQKA 4JBPA 3TTJA 3NVKI 1H1WA 2OJIA 2VU3A 5EDPA 4E8AA 3C1XA 3R8PA 3N4TA 4FEXA 4IDVA 5LWMA 3FLWA 2OSCA 3F5XA 4MXCA 5KMIA 3C5UA 2R3KA 2R3FA 5EW8A 2WIHA 5JZJA 3AT2A 1URCA 4M66A 4AAYA 1ZMVA 2CPKE 3THBA 2PMOX 4N4SA 4IXPA 2YAKA 4TNDA 1JOWB 4JXFA 2G2IA 4HGLA 2IVUA 3FDNA 4PPAA 4EQCA 1YI6A 2HXLA 4FSYA 2GNLA 2OW3A 4BCJA 1NVSA 3TCPA 5FP6A 2YM6A 3KY2A 4AW0A 4CVAA 4DDGA 4A7CA 4MF0A 4FZ6A 3GFWA 1YOLA 3H9OA 3RJCA 3O50A 4DFBA 5LVOA 4ZP5A 1KV1A 4OTFA 2UW4A 5D10A 4CMTA 1JWHA 3Q6UA 3GGFA 3R2BA 4AXAA 4KIKB 5M4FA 5M57A 2OO8X 3ZS5A 4BDEA 1YHWA 5I4NA 3VF8A 4FI1A 2VWVA 5HIDA 3R28A 3KRJA 3R30A 4FKWA 4FYNA 4PMTA 5GJDA 4JQEA 5HCXA 4BKZA 2A27A 4XMOA 2IVVA 3MESA 3DK3A 3SVVA 2YISA 5AP4A 1Q24A 3ORTA 3LMIA 4O6LA 2HK5A 3ZCLA 3MJ2A 4ERWA 3RM6A 3RP9A 4FIGA 4NFNA 5IA3A 3BL9A 4BDIA 4MBIA 5HVKA 4XRJA 3VW8A 2Y4IC 3QXOA 5CENA 2C6MA 5GJGA 5M53A 3KA0A 3I4BA 2V7AA 2BFXA 4FSWA 4FSRA 5AADA 2VTPA 3ALNA 2PE2A 2FYSA 2WOTA 2WKMA 5A4EA 5F94A 1W0XC 1FGKA 4LFIA 4B99A 4NM0A 1GIJA 3UO5A 4AFEA 5JGAA 4BWPA 1YI3A 3UO6A 3EL8A 5DT4A 1U5RA 5ETFA 4CMUA 4EBWA 2VTSA 4TXCA 3L8PA 3RMFA 5FQDC 3ZMMA 3H3CA 3MB7A 3F3VA 2E9PA 1XO2B 3MYGA 4U6RA 3G15A 5AR2A 1TQPA 4OT6A 5DMZA 3GB2A 4R5YA 2UV2A 2UW5A 1BL7A 1VJYA 4AX8A 1U4DA 4CT2A 1OL5A 2J2IB 3D0EA 4LV5A 3W0SA 1ZZ2A 3MH3A 5CX9A 3V8WA 4R77A 2NRYA 4R3PA 4APCA 2XA4A 2XNEA 3ZXZA 3PDTA 2R3HA 4XCUA 4FV4A 4FG7A 4RX8A 2PVLA 3V01A 1UV5A 1PRYA 4J71A 3OT3A 1XH4A 3A99A 5LMBA 3C4CA 3KL8A 5EG3A 5L2QA 1H4LA 4D4VA 3JY9A 3CKWA 1Q8ZA 4L68A 2A1AB 4EEVA 3MVMA 2R3NA 3BE9A 3LQ5A 3WF8A 3FC1X 3PSBA 1BKXA 4HW7A 1LEZA 3JY0A 3KFAA 3VUHA 3ZU7A 4Q9SA 3CGFA 4O4EA 4ANQA 3FQSA 1WVYA 3ZC5A 3BU5A 5KE0A 3EFLA 1KE9A 5J79A 4HGSA 2CGWA 4FEVA 3FV8A 3D2IA 2XAMA 1J7LA 5KKRB 3UYTA 4AF3A 1RW8A 3B2TA 5FM2A 2W1CA 3I7BA 2JDRA 1G3NA 3OTUA 3KRWA 3ZUVA 5CEQA 5TKDA 1A48A 2YWPA 2B53A 5DT0A 2GU8A 4I92A 3R7OA 4GH2A 5HD4A 3E3BX 3K3JA 3EZVA 2J4ZA 3QUEA 4U79A 5AA9A 2VGPA 4L7SA 3MTFA 5T3QA 2C6KA 3PXZA 1XJDA 1ZYLA 3AD6A 3BYOA 3MTLA 4LQMA 5E8UA 2GSFA 2ITTA 4DH3A 2C4GA 3DBEA 4RFYA 2WMXA 2BIKB 4NW5A 1ERKA 4O7WA 4RIWB 1Q41A 3Q5ZA 1Q99A 2VWIA 1PKGA 4BDFA 4FTLA 2IJMA 2XS0A 3TZ9A 4BI2A 4HVIA 1XH9A 3AC4A 2HYYA 2V7OA 2WTKB 4O96A 2BKKA 2OU7A 1NW1A 3CBLA 4C3PA 3POOA 4DEGA 3RWQA 3VS3A 3BGPA 1MRYA 1K2PA 3MN3A 4RPVA 1UU7A 3MPTA 2BROA 5EW3A 2RL5A 3NX8A 5FUTA 1JKLA 3ZO4A 3WILA 5HQ0A 3CD8A 3GBZA 2QO7A 1RE8A 3KULA 3OP5A 1WVXA 2REIA 1JNKA 3E88A 3LXKA 5EDQA 3NCZA 3WF9A 3F2RA 3OW3A 2JGZA 1UKHA 4BHNA 1OKYA 3WOWA 1DM2A 4EHVA 4MWIA 5BVEA 4U81A 3GCVA 5H3QA 1F3MC 2E9VA 3WBLA 1Y6BA 2AEGA 3KVWA 4ZSAA 2IW9A 1YWVA 3FMDA 5CF8A 5I9VA 2EXCX 3P7AA 3E7OA 5GIOE 5J1VA 2VWUA 3DTCA 5FEEA 5I0BA 5CU2A 5K4JA 4EORA 3FXWA 4QYHA 5JSMA 2ITUA 4TYGA 3ZFXA 3GC9A 4FC0A 2WELA 1ZYJA 2X8DA 1Z9XA 3ALOA 3NWWA 4WG5A 4ACDA 4ZJVA 4AZFA 4C4JA 4EK5A 1R0EA 3I0OA 4FIJA 4F1OA 4ZTQA 4EH2A 5LVMA 1Q8WA 1WBWA 2CSNA 1QMZA 3O8TA 5CU0A 4ARKA 3OBGA 5FEQA 4BCKA 3QQGA 2P2IA 2WU7A 3CEKA 3ZRLA 2PHKA 5JQ8A 5KNJA