3S9BA

Russell's viper venom serine proteinase, rvv-v (open-form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Vipera russelli proteinase RVV-V gamma
total genus 55
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9bA02
1YP9A 1QIXB 3MU4A 4VGCB 4KKDA 2VB0A 1HLTH 1Y5BT 3GDUA 2GP9B 3KN2A 3K6ZA 1RTKA 4IBLH 1MBQA 2SGPE 4NA8A 1SR5C 1AFQB 1C5LH 3ZZ9A 5EXNA 3CS7A 5A09A 1BMLA 3SV2H 1FN6A 1H9IE 3SJ8A 1Z6EA 1RFNA 2G52A 1A4WH 1B0EA 2QV1A 1B0FA 1S82A 3EDXB 4K3JA 4AN7A 2H6MA 3IITA 1O3GA 4U30A 4K1SA 1P3EA 3RUOA 3M5OA 2QXIA 4NG9H 1LPZB 1VJ9U 2KAIB 1HBTH 3F9FA 1O2IA 1SLVB 4UDWH 4RSPA 2OD3B 2OC0A 3ZYDA 3PMAB 1J16A 1J8AA 5DP9A 3GCOA 2P95A 3RXJA 3VXFH 3UFAA 3Q00A 1YPJH 2YNBA 3ATMA 4I8LA 3MHWU 2FS9A 5EPNA 2XCFA 4TY7A 3ITIA 1O3NA 4Y7AA 1TRNA 1OSSA 1D6RA 1BBRE 1ZMNA 2J94A 4K1EA 3SU5A 3ZZAA 1P2JA 1K1LA 4MVNA 1A5IA 1BTZA 3L33A 1EJNA 1AB9B 5F6MA 2G81E 4MPWA 2OLGA 3LJOA 2ZKSA 4MDSA 1FY8E 2ZHWH 5L30H 1HXEH 1BCUH 1DWCH 3LGTA 3BV9B 1TBQH 1WTHD 1IQMA 3BTME 3T29A 2AIQA 3SGQE 1C5WB 4O3UA 4R8TB 1D6WA 2H1UA 2BLWA 1P2IA 3D65E 1GMHG 2G00A 3PTNA 2A31A 5EQSA 3EYDA 4Y11E 1F5LA 1WOFA 4DJZB 1EAWA 1GMCG 3LGVA 1A7SA 2BDYA 1FONA 1DOJA 2C8WB 1O2VA 3UNSA 1FY3A 2ZHFH 1C2MA 3BSQA 1O37A 3RLYH 2ZPRA 2ZFQH 1BB0B 1Z8GA 1SGRE 1BTHH 2PR3A 3MNSA 3VEQB 2JETB 2BDHA 4O03A 3T25A 2H2ZA 3M7QA 3A7ZA 4H4FA 3OY6U 5AVDA 2ODQA 3ZV9A 1GHZA 4YT7H 1P05A 3QZRA 6CHAC 3D23A 2BD8A 1GBJA 3RXIA 4NIYA 2SNVA 2PKSB 1Q31A 3VGCB 4WXIA 1QQUA 3E0PB 1TQ7B 2FI4E 2ZTZA 2QAAA 3RM2H 4O3TA 4LZ4B 1W14U 3ZVCA 4MNYA 3A7VA 4GSOA 4AORA 1G36A 2BXTH 1O5GH 2JETC 4YESB 1BHXB 4UFDH 4MTBA 1GBCA 5G4BA 2G5VA 5DP5A 3Q77A 1THSH 1ELAA 6CHAB 5A2MH 2GX4A 1EXFA 1ARCA 1C1PA 1O3BA 1NC6A 1EQ9A 1OYTH 1PPZA 6LPRA 1DUAA 3BTTE 5K7RA 1VJAU 3RLWH 1K22H 1UTMA 2IPHA 2ZCHP 3M7UA 4E06H 1SFQB 2AGIX 2GZ8A 2I6QA 2ZDLA 4BTTB 4ESTE 2BTCE 3NZIA 1EJAA 4Y8XA 1TAWA 1XM1A 2H9HA 1QB9A 2BDBA 3MH7A 3W95A 2VIVA 1MTNB 2Y7XA 2TGPZ 1G3CA 1EPTA 3HKIB 3UPEA 1SBWA 4NSVA 1T8MA 4B73A 4ZH8A 2BLVA 5EGMA 1O32A 1KLTA 1GMDF 1O3EA 1GG6C 4D8NA 1K1OA 1TPPA 4I33A 1DICA 3M3SA 1K28D 3ZZ8A 1BTYA 4AOQA 2CHAC 2J38A 4Y76A 3BTHE 4D9RA 1LHDH 1UVTH 1V2JT 3A8BA 1ETSH 1NT1A 1Y3YA 3RXHA 1EKBB 3SV6A 3RMLH 1TNHA 2SGAA 4Z6AH 1BIOA 3TGKE 1P12E 3RC6A 1GHWH 1CHGA 1MTVA 3E6PH 4E7RG 1DLEA 1J14A 1RS0A 1VCWA 4BNRA 3RU4D 1FIWA 2ZGCA 1TMTH 4J1YA 1XXFA 3PLKA 2XBXA 1YM0A 3T2NA 1H8DH 1GJ9B 1O36A 1JIMA 2HGTH 5EXMA 1LHCH 2BY8X 2ULLA 2P8OC 5GCHG 1UTOA 3SU3A 1HIAA 3NUMA 1O2ZA 4GPGA 2FZZA 1FLEE 3UQOA 3A8AA 3MO3A 1O31A 1YPMH 1UTJA 2XC5A 1O2QA 2VVUA 4HZHA 1A1RA 3FP7E 4XBBA 1YPGH 3U8RH 1GBAA 2C3SA 3MH4A 1ARBA 1TABE 1C5PA 2GZ9A 1ESAA 1C4U2 3UOUA 1TMUH 4IC5A 5LGOA 1EP6A 3CENA 1BQYA 3GICB 1EB2A 4RN6A 2FTLE 2FMJA 3SGAE 2A5AA 3RXEA 1TB6H 3MU5A 4JZFH 1O2YA 4ABEA 2F3CE 1A5HA 1ZHMA 1BJVA 2EEKA 5GPIB 1AZZA 1G3BA 3SJKA 4RKOB 3LDXH 5HMAA 1AKSA 3A85A 2Z3DA 2Q6FA 5DP3A 5C1XA 4K8BA 1AVGH 1U6QA 4X1QU 1P3CA 3RXUA 3QGJA 3DFLA 4TYDA 4CRAA 2A45B 3ZZ7A 1ZRKA 4FUBA 1WQVH 3SU6A 3ODDA 3UY9A 3BG4B 2WYJA 1GJ5H 1O2SA 1CBWB 4XDEA 3QLPH 3QN7A 1W13U 2WPJS 1KXEA 1ZJKA 1MU6B 2C8XB 1IQFA 1HAVB 1LVOA 1O5EH 3OTJE 3PB1E 3SORA 1TGCA 1C2HA 1SSXA 2PV9B 1LO6A 2ESTE 1F0TA 1ZSLA 1Y5AT 1QR3E 1T8NA 2PTNA 2Z9JA 2BD5A 1O2MA 4H6TA 1FI8A 2GKVE 4I8JA 4UFEH 5C5NA 4MG3A 3WY8A 1HFDA 4LXBH 1BT7A 1XUGA 7ESTE 3CS0A 1WUNH 1TNIA 2Y81A 1C5SA 1O5AB 2Q6DA 3A82A 1C9PA 1O2OA 4FUJA 4MNXA 1OS8A 8GCHF 2BY5X 3W94A 2P3UB 4A1XA 2WV4A 5EG4A 2GCTB 1GI8B 3UNQA 1WAYB 1FPCH 1OP8A 1PPCE 1HDTH 1KDQA 5JBAS 1MQ5A 1SGFG 1TX7A 2FTMA 3Q3XA 4FUFA 1FIZA 3HGPA 1HPGA 3H7OA 1S0RA 3S9AA 1ESTA 1P2QA 4Y0ZE 2LNCA 4ZHLU 1OWJA 3A8CA 3M5LA 2OC7A 2ZZUH 3SQHE 4QT8C 1E38B 2ZCLP 3BIUH 1LHFH 2DE8A 2O8LA 1O2RA 5DJ7A 5JPMH 1PYTD 1XUIA 5L2YH 2GVFA 5IDKA 1BTUA 3RXRA 2FOGA 4X2YA 3ESTA 2PTCE 2R3YA 2OQ5A 2ZG0H 2JH0D 1C2LA 4ISNA 5A0BA 5JYIA 3ZVGA 1S81A 2F9BH 4MPUA 1KIGH 5T3HA 2GD4B 2BQ6B 1QA7A 1V2KT 5C2ZA 2J34A 2Y5GA 4OGXA 9ESTA 4NIXA 4UFFH 3UQVA 1JBUH 1O5CB 2Z9KA 2O8WA 5K0HA 1C1SA 1MKXK 2EC9H 1L2EA 2QC2A 3F1SB 4AB8A 5F8ZA 1O3CA 1DFPA 2UUKB 1RTLA 2B5TB 3FZZA 1NU7B 1AVWA 3QZQA 1HV7A 1SGIB 3K65B 4OS7A 2VIDA 4E05H 1N6YA 2HPPH 2AGEX 1SFIA 4Y10E 4GHQA 3ZZ3A 1TBZH 3Q76A 1AE5A 3QTVH 2BOKA 1A3EH 1EZXC 4CH8B 3A7YA 1XUHA 2W7UA 3VGCC 1UK3A 4K69A 2I6SA 4U32A 3V0XA 4TWWA 1AKSB 1C5QA 4AYVB 1SHHB 4NIWA 4DCDA 2BMGB 4ZHMU 3SQEE 1L1JA 1ELDE 3R3GB 3SGBE 2ZTXA 4FUEA 1A5GH 2VGCB 3ELAH 1T8LA 1QBOA 1NO9H 1XUJA 1GDUA 3RXMA 3STIA 5J4SA 1C5YB 1THPB 1W3CA 1GDNA 3MMGA 4DT7B 1SVPA 3SU0A 2BVXH 2RCEA 4JZEH 1EUFA 4O97A 4OS6A 3A84A 1P03A 2AH4X 4ABFA 1EZQA 1C5ZB 3P8OA 2Y80A 4MLFB 1C2GA 2HVXA 3QDZB 3A80A 4X6MA 2ZQ1A 1DX5M 1VCPA 1CBWC 1MAXA 1GBBA 2BX3A 3KQEA 4A6LA 1AFQC 2AGGX 2WUBA 4B2CA 1SGNE 2XC4A 1ZPBA 1EPTC 1D9IA 3P8FA 2FLBH 1OWDA 4R0IA 1SGTA 1TNJA 3Q3YA 3BEFB 1H4WA 1GG6B 2ZFSA 1QJ7B 3SI3H 3TLOA 1IHTH 1OXGA 3LU9B 2Z6BD 5T6FA 4D7FA 4K5ZA 3ZV8A 1BUIA 2PFEA 2VH6A 2VIWA 3KIDU 2GDEH 1EP5A 1BTPA 2WPLS 8ESTE 3FAOA 1C2JA 1V3XA 1DSUA 1KXFA 1XX9A 4ABIA 5DP8A 2BHGA 1VITH 1FY5A 4UONA 1N8OC 1DUEA 4Q2KA 1DWEH 3LIWA 3P17H 4X1NU 1XUFA 1H9HE 1SPJA 2VNTA 4NZQA 5DP6A 1Z71A 1AIXH 1HRTH 1ABIH 2A4GA 2FLRH 2GCHG 5C1UA 3GCTF 3MU8A 2J2UA 5GJ4B 3UWIA 1KXAA 1TALA 2VINA 4BOHA 4JK6A 1P2MA 1ZOMA 4ZROA 4F4OC 4THNH 1K1IA 2UUFB 1GGDB 1O39A 1PPHE 3AAVA 5ETXA 1VR1H 3H7TA 4WJG2 2FOAA 4JK5A 1VGCB 1XXDA 2G8TA 2VJ1A 5B6OA 2OCVB 3KL6A 4Y79A 5HM9A 1GI7B 1WTGH 1GBMA 4ZAEA 2A4OA 3MO6A 1VCQA 5A0CA 4E7NA 2TBSA 1SLWB 1A0LA 1D4PB 1YKTA 1UVPA 1TGNA 3VB7A 1D3DB 1JRSA 1SGCA 1V2ST 1C1MA 3GOVB 1UTKA 5FX6A 1GI0A 1SQTA 4ZKRU 1SGQE 4U2WA 5C67A 5E2OA 1UTLM 1C5TA 2HRVA 4GCHG 1BMAA 5EOKA 5F8XA 3LOXA 2QXHA 1BMMH 3MNBA 1KYNA 8GCHG 1O2LA 5CMXH 2A2QH 1KY9A 5FX5A 2NU3E 5LPRA 2G55A 2PGBB 1O5FH 1BTWA 4B75A 1B7XB 1EAIA 1IQIA 2A32A 3L3TA 5E0GA 3GY2A 4WH8A 1ELBA 1V6DA 1QL8A 1P10A 5LPEA 2H9EH 5JDUB 3GY5A 3JZ1B 1JMOH 2ZI2H 3EE0B 4WMDA 2OQUA 2WPKS 5EQQA 3U69H 1V2OT 1DVAH 4K2YA 3VB3A 5EU8A 1E37B 1O2WA 5JBTA 1FQ3A 2BQ7B 5H4IB 3PROA 3RU4E 1F5KU 3MWIU 2P16A 1GBDA 2XW9A 2QN5T 1F92A 3RMNH 4HGCA 4AGJA 5EXLA 2FXRA 4LOYH 3A7XA 4ISLA 3U9AH 5AF9H 2ZIQH 1ELVA 2J92A 1N1LA 4HFPB 2Z9GA 1TONA 3MU0A 1HJ9A 1O3KA 1C2FA 2IJOB 3SUFA 2Y82A 2ZU4A 4K60A 3QX5H 1MQ6A 1JOUB 1SLUB 4NSYA 4CH2B 2J4IA 4SGAE 1QGFA 2FDAA 1EB1H 1T32A 4INHA 1RIWB 2ODPA 2PWXA 1J17T 2FOEA 2W7SA 1PYTC 2V6NA 2BLQA 3BTEE 1KXCA 4YOIA 1A0HB 2VVVA 1QTFA 2FIRH 2GGVB 4A92A 1EPTB 1GHYH 1FN8A 1GPZA 1O0DH 1AD8H 2SGFE 1YCPH 4JMYA 4VGCC 4BAHB 6GCHG 4D76A 1KSNA 1Z8RA 4UEHH 1F7ZA 1AQ7A 1QA0A 3RC5A 4GVUA 2FI3E 4TPYA 2AMDA 3RXAA 4BAQB 1TWXB 2Z94A 3LONA 1BZXE 2THFB 3RXGA 4ABJA 4OS2A 1Y3UA 3PMBB 2GT8A 2FS8A 1DS2E 3IG6B 1K1JA 3S9CA 2BM2A 2KAIA 3TH3H 1LQEA 1P04A 2FESH 4OS1A 3MFJA 5E8EH 1C1QA 1P2OA 1LTOA 1O2XA 3EAJA 1MCTA 1WU1A 2K1QA 5EQRA 4M7GA 1EOJA 3RMMH 1ELTA 1S6FA 3A86A 3M7TA 4NWLA 1GJCB 1GBEA 2BVSH 3FFGA 1PQAA 4X2WA 3HKJB 2ZGXH 3A88A 3SJOA 4XBCA 5AFZH 1GJ6A 4AYYB 3G01A 4YLUA 2BQWB 2BDCA 4JYTA 1O30A 3KQCA 1KTSB 1ZZZA 7GCHG 1NRRH 4IMZA 3GCNA 4DW2U 1HAXB 1CO7E 1GDQA 3VB4A 4AFZA 2H5CA 2FYQA 4DIIH 1G32B 4KTUA 1IQJA 1FAKH 2DE9A 4ASHA 1W2KH 2A7CA 3LC3A 3F68H 5HYOA 3PTBA 4GUXA 1NS3A 1BRAA 5FCRA 2QGRA 1SHYA 3SV7A 1YF4A 1HAVA 1IQHA 2BD3A 1TGBA 2W3KA 5JBBS 1SB1H 2BVRH 2F83A 4YOGA 2XWBI 1K2I1 2J95A 1GHXH 3BF6H 3MYWA 3Q3KA 3SU2A 4JCNA 2FM2A 1O2KA 1FJSA 5FPTA 5DK1A 5TCCA 3VFEA 3PWCA 2ANKH 3ZZDA 4CRCA 1AFEH 1UTPA 1TGSZ 1INCA 1P02A 1GHAG 2IOTA 1BRUP 1LHGH 4X8UH 3RC4A 4CRFA 1NRQH 1P57B 2EI8A 1GI1A 4DOQA 3EQ0H 4BTIB 2XWAA 1CHOF 1DXPA 1O2NA 4X8SH 2ILNA 2VU8E 1W0ZU 2OC8A 5IYTA 1G2MA 1PPFE 1UVUH 5FCKA 1C1UH 2QXGA 2PKAB 1W12U 2AMPA 2RA3A 1W7GH 3ZVDA 1GBTA 1Y8TA 3EA7A 2PKSC 2V0BA 1ANBA 1P9SA 2ZFFH 3E0NB 4OGYA 1O3IA 1C5VA 3K9XB 4XOJA 4FVBA 1YPLH 2JH6D 1ACBE 1SQOA 4I7YH 3OYPA 4HI3A 2C4FH 2GCHF 2ZWLH 5CE1A 1Y3XA 3R0FA 2RA0A 2QCYA 4RKJB 1MD7A 1TIOA 4U01A 2H9TH 3E16B 3OY5U 3A7TA 3GYMA 2F9NA 2HOBA 1GHBF 3SNBA 4X6NA 4B1TA 3M3VA 2BDIA 4NIVA 1A2CH 5L2ZH 1AHTH 2D2DA 3SJIA 1WSSH 4AFUA 1F0SA 1GHBG 1QY6A 3BTDE 3SI4H 3OX7U 3P92A 1C5UA 1TPSA 2B9LA 1UVSH 4K1TA 1AGJA 4WF8A 3S0NA 2FX4A 3TJOA 4OS5A 1P0SH 2VIQA 1V2UT 4FUHA 2PUXB 4K8YA 3VXEH 3TITA 3PMJA 2A5KA 3IWMA 2ZNKH 8KME2 5L6NH 1LDTT 3RXSA 3P95A 4ZKNU 3O8CA 4YZUA 4ABBA 3UREA 2QA9E 1K1PA 3A87A 1GI5A 1GJ4H 1QL7A 1Y3WA 3FP6E 5CHAC 1CSOE 2UUJB 1W0YH 1GBHA 4Y0YE 1QCPA 3SHCH 1GI2A 2PGQB 1WBGB 2EI7A 5E0HA 1BDAA 2CHAB 5T6GA 2NU2E 4ZHAA 1BOQA 1GBKA 2P94A 4AB9A 2P93A 3N7OA 2D26C 2ALVA 4ABGA 1ZGVA 4BAMB 2VIOA 3AVZA 4GLYA 1Z7KA 2A4QA 3SJ9A 1UCYH 2G51A 4ABDA 1O3DA 1MD8A 4UFGH 1FY4A 4NFEA 3TNSA 2XXLA 3I29A 2GT7A 1CU1A 1RD3B 7KMEH 2QF0A 1W11U 1TPAE 4ZMAH 1AUTC 1KXBA 5C5OA 2ZPQA 4INLA 2ZF0H 2AERH 4LZ1H 2NWNA 3PO1C 1PFXC 1C5NH 1QJ1B 3LH1A 2ZA5A 2BX4A 4WH6A 1YCPM 2ZECA 3S7KB 3M5MA 1SOTA 4FXGH 1T4UH 1VGCC 1QBNA 3SBKA 1GJAB 1TFXA 1DY8A 2XTTB 5F8TA 4ZKSU 3U8OH 3BEUA 4NA9H 1SOZA 2Y5FA 1QJ6B 2BD7A 5J4QA 5DG6A 3UR6A 1DT2A 1AO5A 2ZC9H 3VB6A 2XYAA 3GCTG 1GVZA 3SO3A 1QQ4A 3FVFB 2G4UA 1C1NA 2FYRA 1SGPE 2O8UA 1MMJN 4WMEA 2Y7ZA 1Z1IA 2HWLB 3BG8A 1DSTA 3BTGE 2BZAA 2GMTB 2ZGHA 3DT0H 1TNGA 1GMDG 1Z8JB 2FEQH 1C4V2 4FU8A 4FU7A 2BZ6H 1LMWB 3SZNA 1S85A 7LPRA 1T4VH 4ISHH 1PQ5A 1UK4A 5JBCS 4X6OA 2BYAX 3ENSB 2GV6A 2V35A 3AAUA 1GWAA 1Y3VA 2ASUB 2VWLA 3B23B 4CRGA 4YO9A 2HALA 1QB6A 4IC6A 4CRDA 2RG3A 2BDAA 2WPHS 1V2TT 3MH5A 1O5DH 2B8OH 1BRBE 1PPGE 2Z3CA 4NFFA 1T31A 2GMTC 4WWYA 3SW2B 3NXPA 1K1NA 1H1BA 1O2GH 1NESE 2F9OA 2D1JA 3C27B 3F9HA 1IQKA 2CMYA 4WY3A 3TIUA 4XBDA 5DGJA 1EJMA 3TGIE 5A8ZA 1O33A 3BTFE 3PMHB 1TX6A 2OC1A 4CBNA 4B2AA 1AE8H 3E8LA 7GCHF 3C1KA 4X1PU 3A83A 3NPSA 3AASA 1CT2E 1HUTH 4AX9H 4MNVA 2VWOA 1HXFH 1BHXF 2ZU1A 2ZU3A 3O8DA 1FV9A 1O3HA 4B74A 2Y6TA 2BD2A 4IN2A 2JH5D 4MPVA 3L6PA 1O3OA 5I25A 4AZ2B 4ABAA 1FZZA 3SNEA 1HCGA 1NFYA 1OWEA 5FPYA 1UTNA 3E1XB 2XBWA 4ZXXH 1IQLA 2BY6X 4MQAA 5BRRE 5EPYA 2XBVA 5JB8S 1TX8A 1J15A 1CT4E 3TJNA 3BTKE 3ZVFA 1K1MA 5BPEA 4YT6H 1SGYE 2STAE 2IN2A 1TOCB 1GBIA 3BTQE 4KGAA 2ZQ2A 3UNRA 1N8OB 2C90B 1O2JA 2BD9A 1LQDB 1O2UA 1MKWH 5PTPA 4X1RU 1C5MD 1KLJH 4SGBE 3KQDA 2PKAA 1A0JA 1IQGA 3TPIZ 2R2MB 1PJPA 1P01A 1OP0A 4AFSA 3GY8A 1TOMH 1O5BB 2P8OB 4A5TS 3ZVAA 1TBRH 4HTCH 2F9PA 3RXTA 3SHAH 1UMAH 1MTWA 1LHEH 1LCYA 1GI4A 4ZKOU 1OP2A 1O35A 4DY7B 5T6DA 1T8OA 1XUKA 5FHTA 3PLBA 3PO1B 1WYKA 1SQAA 3RMOH 3GCHB 3MI4A 4I8GA 1GJ8B 1ZTKA 2ANMH 4IMQA 1DPOA 4X6PA 1ZSKA 3LH3A 4ISIH 4Q7XA 1SG8B 4WMFA 4GHTA 1D3TB 1QRZA 4A1VA 1O3JA 3SN8A 2BY9X 2A4RA 4XFQA 2ZCKP 1EATA 1L4DA 3OU0A 2ZHQH 3JZ2B 5A8XA 1K9OE 1UTQA 3U1IB 2VVCA 4ISOA 2FWWA 2VWMA 3D62A 4JYUH 3ZVEA 1NROH 5E2PA 1L4ZA 1D3PB 5AHGH 1V2NT 4Z0KA 1UCYK 5FXLA 4BANB 1QL9A 1G3EA 1GMCF 3QGNB 1AUJA 3BN9A 3GY6A 3DHKH 1TNKA 1ESBA 3QK1A 1FMGA 3RXQA 1A46H 4DURA 3VB5A 2C8YB 2YOLA 1S0QA 5DO4H 4B71A 3SV8A 2FODA 1GVLA 3P70B 1JXPA 1UHBA 2J9NA 4YTAA 1TRYA 5EW1H 2ZP0H 1D3QB 4YM9A 2AMQA 1HAIH 3F9GA 3SNDA 3RXFA 2R0KA 4XSKU 2ZEBA 3EGKH 5A8YA 2A1DB 3M35A 4GAWA 4JZDH 1BTXA 3GY4A 3SV9A 4FUDA 3ZYEA 1S5SA 2ANWA 2VWNA 3A81A 2OINA 3RM0H 1HB0B 1GJBB 1CA0C 2HNTF 1CA0B 1H8IH 3GY3A 3K6YA 1C4Y2 4FUCA 1P2KA 3GDVA 2FOMB 1OWHA 2RDLA 3SUGA 1HAZB 3DFJA 1ANEA 1HAGE 3TK9A 1C1RA 4YOJA 2O9QA 2QXJA 1NTPA 3LC5A 3TU7H 3PWBA 4JYVH 1XVMA 2GCTC 2NU4E 1PQ8A 4NA7A 5FPSA 2QF3A 1KTTB 5F03A 3ATLA 1V2RT 3EA8A 2SGQE 1Z6JH 1MAYA 1UO6A 1EZSC 4Y6DA 1P2NA 3U1JB 1GCTB 2UUYA 1OWKA 1QRXA 1HAPH 2HNTE 1TQ0B 3M37A 1XMNB 4WVPE 4AG2A 4KTSA 3P8GA 1GI9B 1FDPA 1O3LA 1DLKB 1OWIA 1EASA 4KP0A 1ETTH 4NCYA 1YLCA 2FP7B 3T27A 1C1VH 3HGNA 2H5DA 1UCYE 2R3UA 5ESTE 1G2LA 1CGIE 3RXPA 1ZMJA 1CGJE 2OTVA 1O3PB 2PSYA 4Q80A 5FAHA 3PYHA 2ZDVH 4CRBA 2UWOA 2LPRA 2O8TA 5C20A 4I31A 2P3FH 1DXWA 1ELCA 1HJ8A 3LGIA 1DANH 1FY1A 1GJDB 4Y8YA 1MKXH 4TY6A 1AU8A 1MH0A 3CP7A 1C2KA 4Q7ZA 3SUDA 2F9UA 2XRCA 3KGPA 4I8KA 2UWLA 2ZDNA 1XKBC 4FUIA 1YGCH 2XNIA 1YBWA 1YPKH 3RXBA 2F9VA 2OBOA 1DITH 3PLPA 1H9LB 3ATKA 1LKBA 1RXPA 1TYNA 1IQEA 1MCVA 2GZ7A 3T5FH 1ZYOA 1ZJDA 1GBLA 1HAHH 3GCHC 5E0JA 1PPBH 4F49A 4CREA 4X2XA 1ZPZA 2P3TB 3KF2A 4TWYA 2ZDMA 3RXKA 2WINI 2BD4A 1C9TA 1P09A 3UIRA 1YLDA 1L1NA 3NK8A 6ESTA 3PM3A 2SNWA 1L1GA 1SLXB 2JKHA 2ZDAH 2XCNA 3T62A 3KNXA 1UVOA 1BITA 4O9VA 1GHVH 2FOBA 1O34A 2PLXA 3QO6A 5DP4A 3SUEA 1ORFA 3U98H 1P8VC 1CVWH 1JIRA 1TA6A 4YLQH 2ZFTA 2TIOA 1F5RA 5FBIA 1HAYB 4A7IB 1UK2A 2BB4A 1ZHRA 1C1WH 1HNEE 3NWUA 3P6ZB 1BBRH 1DWBH 3GY7A 1EAUA 1KLIH 4CR9A 1ZR0A 3TVJB 3TGJE 1YC0A 2G5NA 2ZPSA 4IW4E 4X0WU 4D9QA 2HPQH 5FBEA 1AZ8A 1GBFA 1TNLA 1QNJA 1RIWC 3E3TA 3TH4H 2HNTC 6GCHF 1MTNC 1XVOA 3MO9A 2FOFA 1FNIA 1O3FA 5HXFA 3A89A 1Q2WA 3GYLB 4BAOB 1B5GH 3TH2H 3V12A 1ELFA 1WQSA 3RDZA 1NRPH 1CGHA 1C5XB 4X1SU 1TE0A 4CR5A 3O8RA 1NN6A 1AI8H 3MH6A 1CT0E 2AS9A 2EA3A 1G3DA 3TJVA 2VH0A 3ZZ5A 2ZFPH 1OYQA 3KHVA 4TPIZ 2GTBA 1EZUC 1HJAB 1NPMA 3LGUA 1RTFB 4ZXYH 1O2TA 1ZRBA 2BOHB 3QWCH 3V3MA 1QHRB 3SOSA 5C3NA 1DE7H 5I46H 3ATIA 1MTSA 1V2VT 3ZZBA 3B9FH 4MPXA 1E34B 2Z3EA 1MU8B 1TPOA 1E35B 2PHBA 3ZVBA 2P59A 1SGDE 1PQ7A 2M5TA 4H42U 1GMHF 1DM4B 2AYWA 4BAKB 3ZZ4A 4IS5A 1HJAC 4UD9H 3RXOA 2GDDA 5HGGA 2TRMA 5GDSH 3E91A 2QYIA 2QIQA 1CE5A 1FAXA 3FANA 1GCDA 1ANDA 2W3IA 1Z8IB 5GXPA 1GGDC 1GI6A 2DUCA 4X8TH 3SU1A 1ABJH 3BIVH 1IOEA 3RP2A 2ZU2A 4BTUB 2VIPA 1K21H 1AN1E 1C2IA 1FXYA 1NRNH 1DWDH 4KTCA 2NU1E 4ABHA 1THRH 2A0QB 4DGJA 3T26A 1MTUA 2V3HH 1C1OA 1G30B 1F0RA 1CHOG 4XE4A 2TGAA 3LPRA 1KDQB 2R0LA 3HK3B 1V2MT 3MTYA 1S6HA 2BXUH 1SL3A 1P11E 1IHSH 2NU0E 2SFAA 1GHAF 2CXVA 2FOHA 3V7TA 4UE7H 3F9EA 2BDGA 1GI3A 1RJXB 1V2QT 3EA9A 5HM2A 1EAXA 5ESBA 1RRKA 1J9CH 4X8VH 3VPKA 1E36B 2FX6A 2B7DH 4CHAC 1KXDA 4CHAB 1ELGA 1NY22 4FUGA 1UJ1A 3RXLA 3UUZA 3ODFA 2UWPA 3RU4T 4I32A 1BBRK 1QBVH 1NU9A 4PROA 3A7WA 1OPHB 3F6UH 1GVKB 2STBE 1VZQH 2WV5A 2W26A 2ANYA 3BG4C 2CGAA 1A61H 2HLCA 1UHBB 1C5OH 2A7HA 4X2VA 3TK5A 1ANCA 3U8TH 3AW0A 1BRCE 3RXCA 1QFKH 1QURH 2CF8H 4JZIA 1P9UA 1ZGIA 4J2YB 1ZPCA 4H6SB 2BLOA 2ALPA 3NCLA 1C2DA 3TNTA 2WUCA 3K2UA 5DKMA 2C93B 2ZFRH 4I8HA 1HGTH 1O3AA 1QRWA 5AFYH 4MNWA 1S84A 3DUXH 4ZUHA 2OXSA 2TGTA 1F0UA 3QTOH 1TRMA 2B0FA 1C2EA 1IAUA 2ZO3H 1ZTJA 2Q6GA 1YYY1 5C1YA 4B2BA 1MZAA 1ELEE 3OSYA 3S69A 1LPKB 9LPRA 5EW2H 2A2XH 3DA9B 1NM6A 5CHAB 2AFQB 3SNCA 3KQBA 1LVBA 5A0AE 1TGTA 1GL1A 1BJUA 3S9BA 1Z1JA 3PV4A 1SC8U 3URDA 3MU1A 4BXSA 1BA8B 2XBYA 3MNCA 1OKXA 3RXDA 1NFXA 2W5EA 1HAOH 1AMHA 2TPIZ 1G37A 1OX1A 1YPHE 3MOCA 1GCTC 3BEIB 3TJUA 3GDSA 1M9UA 1LVMA 2FO9A 1MKWK 5LPFA 4DG4A 2D8WA 2F91A 1SGFA 1V2PT 4DVAU 3KEEA 2O8MA 2TGDA 3GISB 3LGWA 3O8BA 2ZU5A 1ZHPA 2Z7FE 1W7XH 2ZHDA 1F2SE 1JRTA 1NRSH 1FPHH 3UOPA 3B8JA 5LH8A 1X7AC 1WV7H 5GWZA 4NGAH 3RXVA 4KELA 4INKA 4B76A 1TA2A 4LK4A 1O3MA 1NFUA 4IN1A 1C5RA 3TK6A 1LPGB 3NKKA 4NZLA 5TJXA 1AWHB 2FI5E 3BTWE 1A3BH 4WXVA 1YCPK 2Z9LA 4FU9A 1XKAC 2FPZA 1AB9C 1OOKB 1QB1A 3STJA 1E0FD 4FVDA 1MBMA 3HATH 1ETRH 2PSXA 2ZDKA 1MZDA 1NFWA 1CA8B 5GIBA 3I78A 1T7CA 3KCGH 1PPEE 1G9IE 1CQQA 1GL0E 1V2LT 3LJJA 1N6XA 1SI5H 2CF9H 3P8NA 4Y7BA 1W10U 3ATWA 5JB9S 2WPIS 2EI6A 2PUQH 3UTUH 1SGEE 3LKWA 1W8BH 3URCA 5DP7A 3AW1A 3UR9A 4IGDA 2ODYB 1TLDA 3M61U 2OBQA 2WYGA 3QUMP 4JZ1A 4NWKA 2CJIA 3MNXA 4GCHF 4D7GA 2ZHEH 1ZSJA 4Y8ZA 1EOLA 3LGYA 2Y5HA 1FUJA 1LKAA 1AWFH 1BMNH 3HK6B 2GV7A 2WPMS 2ZTYA 1IQNA 5SGAE 3A8DA 2VGCC 3M36A 1HIAB 5TCAA 2R9PA 1O2PA 3DD2H 1JWTA 1ID5H 1Y5UT 2V3OH 2R2WU 2AEIH 1WCZA 1YPEH 2A7JA 2YNAA 1Q3XA 1V2WT 2A5IA 4OS4A 2G4TA 3V13A 3T28A 1L0ZA 2OUAA 2CN0H 1P06A 2OP9A 3UWJH 1ZTLA 2ZGJA 2SGEE 1AY6H 2BY7X 1S83A 3FZDA 3LT3A 1Y59T 1O2HA 3H5CB 2XC0A 1LVYA 1HYLA 1AVXA 1VITG 4AFQA 2SGDE 1ZMLA 4AGKA 4Q7YA 1MUEB 2AIPA 5GCHF 1RGQA 8LPRA 3FP8E 1DY9A 5ABWA 3HPTB 1VITF 1YPHC 1EX3A 1DDJA 3D49H 2Q1JA 1NZQH 3I77A 3ZZ6A 1TMBH 4AG1A 4DIHH 2Z9IA 2FOCA 2CV3A 4CBOA 4Y71A 2QY0B 5DPAA 4BXWA 5EODA 2PW8H 1ZLRA 1C1TA 4A1TA 3ZZCA 3M3TA 3M5NA 3S7HB 3SNAA 1SMFE 1O38A 2ZGBH 3E90B 3SU4A 2C8ZB 1GJ7B
chains in the Genus database with same CATH superfamily
1YP9A 1QIXB 3MU4A 4VGCB 4KKDA 2VB0A 1HLTH 1Y5BT 3GDUA 2GP9B 3KN2A 3K6ZA 1RTKA 4IBLH 1MBQA 2SGPE 4NA8A 1SR5C 1AFQB 1C5LH 3ZZ9A 5KECA 5EXNA 3CS7A 5A09A 1BMLA 3SV2H 1FN6A 1H9IE 3SJ8A 1Z6EA 1RFNA 2G52A 1A4WH 1B0EA 2QV1A 1B0FA 1S82A 3EDXB 4K3JA 4AN7A 2H6MA 3IITA 1O3GA 4U30A 1NBME 4K1SA 1P3EA 3RUOA 3M5OA 2QXIA 4NG9H 1LPZB 1VJ9U 2KAIB 1HBTH 3F9FA 1O2IA 1SLVB 4UDWH 4RSPA 2OD3B 2OC0A 3ZYDA 3PMAB 1J16A 1J8AA 5DP9A 3GCOA 2P95A 3RXJA 3VXFH 3UFAA 3Q00A 1YPJH 2YNBA 3ATMA 4I8LA 3MHWU 2FS9A 5EPNA 4ACAA 2XCFA 4TY7A 1BMFD 3F0OA 3ITIA 2KCPA 1O3NA 4Y7AA 1TRNA 1OSSA 1D6RA 1BBRE 1ZMNA 2J94A 4K1EA 3SU5A 3ZZAA 1P2JA 1K1LA 4MVNA 1A5IA 1BTZA 3L33A 1EJNA 1AB9B 5F6MA 2G81E 4MPWA 2OLGA 3LJOA 2ZKSA 4MDSA 4TSFD 1FY8E 2ZHWH 5L30H 1HXEH 1BCUH 2WZQA 1DWCH 3LGTA 3BV9B 1TBQH 1WTHD 1IQMA 3BTME 3T29A 2AIQA 3SGQE 1C5WB 4O3UA 4R8TB 1D6WA 4M9FA 2H1UA 2BLWA 1P2IA 3D65E 1GMHG 2G00A 3PTNA 2A31A 5EQSA 3EYDA 4Y11E 1F5LA 1WOFA 4DJZB 1EAWA 1GMCG 3LGVA 1A7SA 2BDYA 1FONA 1DOJA 2C8WB 1O2VA 3UNSA 1FY3A 2ZHFH 1C2MA 3BSQA 1O37A 3RLYH 2ZPRA 2ZFQH 1BB0B 2J98A 1Z8GA 1SGRE 1BTHH 2PR3A 3MNSA 3VEQB 2JETB 2BDHA 4O03A 3T25A 2H2ZA 3M7QA 3A7ZA 4H4FA 3OY6U 5AVDA 2ODQA 3ZV9A 1GHZA 4YT7H 5EJZA 1P05A 3QZRA 6CHAC 3D23A 2BD8A 3PV5A 1GBJA 2F4LA 3RXIA 4NIYA 2SNVA 2PKSB 1Q31A 3VGCB 4WXIA 1QQUA 3E0PB 1TQ7B 2FI4E 2ZTZA 2QAAA 3RM2H 4O3TA 4LZ4B 1W14U 3ZVCA 4MNYA 3A7VA 4GSOA 4AORA 1G36A 2BXTH 1O5GH 2JETC 4YESB 1BHXB 4UFDH 4MTBA 5C0TA 1GBCA 5G4BA 2G5VA 5DP5A 3Q77A 1THSH 1ELAA 6CHAB 5A2MH 2GX4A 1EXFA 5EJLA 1ARCA 1C1PA 1O3BA 1NC6A 1EQ9A 1OYTH 1PPZA 6LPRA 1DUAA 3BTTE 5K7RA 1VJAU 3RLWH 1K22H 1UTMA 2IPHA 2ZCHP 3M7UA 4E06H 4P02A 1SFQB 2AGIX 2GZ8A 2I6QA 2ZDLA 4BTTB 4ESTE 2BTCE 3NZIA 1EJAA 4Y8XA 1TAWA 1XM1A 2H9HA 1QB9A 2BDBA 3PV2A 3MH7A 4FETA 3W95A 3AK5A 2VIVA 1MTNB 2Y7XA 3WWFA 2TGPZ 1G3CA 1EPTA 3HKIB 3UPEA 1SBWA 4NSVA 1T8MA 4B73A 4ZH8A 2BLVA 5EGMA 3KYFA 1O32A 1KLTA 1GMDF 1O3EA 2XNDD 1GG6C 4D8NA 1K1OA 1TPPA 4I33A 1DICA 3M3SA 1K28D 3ZZ8A 1BTYA 4AOQA 2CHAC 2J38A 4Y76A 3BTHE 4D9RA 1LHDH 1UVTH 1V2JT 3A8BA 1ETSH 1NT1A 1Y3YA 3RXHA 1EKBB 3SV6A 3RMLH 1TNHA 2SGAA 4Z6AH 1BIOA 4Q63A 3TGKE 1P12E 3RC6A 1GHWH 1CHGA 1MTVA 3E6PH 4E7RG 1DLEA 1J14A 1RS0A 1VCWA 4BNRA 3RU4D 1FIWA 2ZGCA 1TMTH 4J1YA 1XXFA 3PLKA 2XBXA 1YM0A 3T2NA 1H8DH 1GJ9B 1O36A 1JIMA 2HGTH 5EXMA 1LHCH 2BY8X 2K0QA 2ULLA 2P8OC 5GCHG 1UTOA 3SU3A 1HIAA 3NUMA 1O2ZA 4GPGA 2FZZA 1FLEE 3UQOA 3A8AA 3MO3A 1O31A 1YPMH 1UTJA 2XC5A 1O2QA 2VVUA 4HZHA 1A1RA 3FP7E 4XBBA 1YPGH 3U8RH 2JIZD 1GBAA 2C3SA 3MH4A 1ARBA 1TABE 1C5PA 2GZ9A 1YWUA 1ESAA 1C4U2 3UOUA 1TMUH 4IC5A 5LGOA 1EP6A 3CENA 1BQYA 3GICB 1EB2A 4RN6A 2FTLE 2FMJA 3SGAE 4FOUC 2A5AA 3RXEA 1TB6H 3MU5A 4JZFH 1O2YA 4ABEA 2F3CE 1A5HA 1ZHMA 1BJVA 2EEKA 5GPIB 1AZZA 1G3BA 3SJKA 4RKOB 3LDXH 5HMAA 1AKSA 3A85A 2Z3DA 2Q6FA 5DP3A 5C1XA 4K8BA 1AVGH 1U6QA 4X1QU 1P3CA 3RXUA 1UW7A 3QGJA 3DFLA 4TYDA 4CRAA 2A45B 3ZZ7A 2YMSC 1ZRKA 4FUBA 1WQVH 3SU6A 3ODDA 3UY9A 3BG4B 2WYJA 2J97A 1GJ5H 1O2SA 1CBWB 4XDEA 3QLPH 3QN7A 1W13U 2WPJS 1KXEA 1ZJKA 1MU6B 2C8XB 1IQFA 1HAVB 1LVOA 1O5EH 3OTJE 3PB1E 3SORA 1TGCA 1C2HA 1SSXA 2PV9B 1LO6A 2ESTE 1F0TA 1ZSLA 1Y5AT 1QR3E 1T8NA 2PTNA 2Z9JA 2BD5A 1O2MA 4H6TA 1FI8A 2GKVE 5DN6D 4I8JA 4UFEH 5C5NA 4MG3A 3WY8A 1HFDA 4LXBH 1BT7A 1XUGA 7ESTE 3CS0A 1WUNH 1TNIA 2Y81A 1C5SA 1O5AB 2Q6DA 3A82A 1C9PA 4OM9A 1O2OA 3F0PA 4FUJA 4MNXA 1OS8A 8GCHF 2BY5X 3W94A 2P3UB 4A1XA 2WV4A 5EG4A 5F53A 3DSOA 2GCTB 1GI8B 3UNQA 1WAYB 1FPCH 1OP8A 1PPCE 1HDTH 1KDQA 5JBAS 1MQ5A 1SGFG 1TX7A 2FTMA 3Q3XA 4FUFA 5FL7D 1FIZA 2F43B 3HGPA 1HPGA 3H7OA 1S0RA 3S9AA 1ESTA 1P2QA 2EY4C 4Y0ZE 2LNCA 4ZHLU 1OWJA 3A8CA 3M5LA 2OC7A 2ZZUH 3SQHE 4QT8C 1E38B 2ZCLP 3BIUH 1LHFH 2DE8A 2O8LA 1O2RA 5DJ7A 5JPMH 1PYTD 1XUIA 5L2YH 2GVFA 5IDKA 1BTUA 2QF5A 3RXRA 2FOGA 4X2YA 3ESTA 2PTCE 2W6ID 2R3YA 2OQ5A 2ZG0H 1H8HD 2JH0D 1C2LA 4ISNA 5A0BA 5JYIA 3ZVGA 1S81A 2F9BH 4MPUA 1KIGH 5T3HA 2GD4B 2BQ6B 1QA7A 1V2KT 5C2ZA 5C94A 2J34A 2Y5GA 4OGXA 9ESTA 4NIXA 4UFFH 3UQVA 1JBUH 1O5CB 2Z9KA 4RI0A 2O8WA 5K0HA 1C1SA 1MKXK 2EC9H 1L2EA 2QC2A 4AC9A 3F1SB 4AB8A 5F8ZA 1O3CA 1DFPA 2UUKB 1RTLA 2B5TB 3FZZA 1OHHD 1NU7B 1AVWA 3QZQA 4ASUD 1HV7A 5B6LA 1SGIB 3K65B 4OS7A 2VIDA 4E05H 1N6YA 2HPPH 2AGEX 1SFIA 4Y10E 4GHQA 3ZZ3A 1TBZH 3Q76A 1AE5A 3DSGA 3QTVH 2BOKA 1A3EH 1EZXC 4CH8B 3A7YA 1XUHA 2WPDD 2W7UA 3VGCC 1UK3A 4K69A 2I6SA 4U32A 3V0XA 4TWWA 1AKSB 1C5QA 4AYVB 1SHHB 4NIWA 4DCDA 2BMGB 4ZHMU 3SQEE 1L1JA 1ELDE 3R3GB 3SGBE 2ZTXA 4FUEA 1A5GH 2VGCB 3ELAH 1T8LA 1QBOA 1NO9H 1XUJA 1GDUA 3RXMA 3STIA 5J4SA 1C5YB 1THPB 1E1QD 1W3CA 1GDNA 3MMGA 4DT7B 1SVPA 3SU0A 2BVXH 2RCEA 4JZEH 1EUFA 4O97A 4OS6A 3A84A 1P03A 2AH4X 4ABFA 1EZQA 1C5ZB 3P8OA 2Y80A 4MLFB 1C2GA 2HVXA 3QDZB 3A80A 3N7DA 4Z1MD 4X6MA 2ZQ1A 1DX5M 1VCPA 3EE7A 1CBWC 1MAXA 1GBBA 2BX3A 3KQEA 4A6LA 1AFQC 2AGGX 2L74A 2WUBA 4B2CA 1SGNE 2XC4A 1ZPBA 1EPTC 1D9IA 1YLNA 3P8FA 2FLBH 1OWDA 4R0IA 1SGTA 1TNJA 3Q3YA 3BEFB 1H4WA 1GG6B 2ZFSA 1QJ7B 3SI3H 3TLOA 1IHTH 1OXGA 3LU9B 2Z6BD 5T6FA 4D7FA 4K5ZA 3ZV8A 1BUIA 2PFEA 2VH6A 2VIWA 3KIDU 2GDEH 1EP5A 3F2FA 1BTPA 2M2AA 2WPLS 8ESTE 3FAOA 1C2JA 1V3XA 1DSUA 1KXFA 1XX9A 5HKKD 4ABIA 2KCYA 5DP8A 2BHGA 1VITH 1FY5A 4UONA 1N8OC 1DUEA 1SQRA 4Q2KA 1DWEH 3LIWA 3P17H 4X1NU 1XUFA 3SZEA 1H9HE 1SPJA 2VNTA 4NZQA 5DP6A 1Z71A 1AIXH 1HRTH 1ABIH 2A4GA 2FLRH 2GCHG 5C1UA 3GCTF 3MU8A 2J2UA 3CNRA 5GJ4B 3UWIA 1KXAA 1TALA 2VINA 4BOHA 4JK6A 1P2MA 1ZOMA 4ZROA 4F4OC 4THNH 4Q4LA 1K1IA 2UUFB 1GGDB 1O39A 1PPHE 3AAVA 5ETXA 1VR1H 3H7TA 4WJG2 2FOAA 4JK5A 1VGCB 1XXDA 2G8TA 2VJ1A 5B6OA 2IPQX 2OCVB 3KL6A 4Y79A 5HM9A 1GI7B 1WTGH 1GBMA 3F3BA 1WXRA 2J5UA 4ZAEA 2A4OA 3MO6A 1VCQA 5A0CA 4E7NA 2TBSA 1SLWB 2J98B 1A0LA 1D4PB 1YKTA 1UVPA 3F2GA 1TGNA 3VB7A 1D3DB 1JRSA 1SGCA 1V2ST 1C1MA 3GOVB 1UTKA 5FX6A 1GI0A 1SQTA 4ZKRU 1SGQE 4U2WA 5C67A 5E2OA 1UTLM 1C5TA 2HRVA 4GCHG 1BMAA 3FN8A 5EOKA 5F8XA 3LOXA 2QXHA 1BMMH 3MNBA 1KYNA 5CDFE 8GCHG 1O2LA 5CMXH 2A2QH 1KY9A 5FX5A 2NU3E 5LPRA 2G55A 3OFND 2PGBB 1O5FH 1BTWA 4B75A 1B7XB 1EAIA 1IQIA 2A32A 3L3TA 5E0GA 4ZCNA 3GY2A 2CK3D 4WH8A 1ELBA 1V6DA 1QL8A 1P10A 5LPEA 2H9EH 5JDUB 2YMSD 3GY5A 3JZ1B 1JMOH 2ZI2H 3EE0B 4WMDA 2OQUA 2WPKS 5EQQA 3U69H 1V2OT 1DVAH 4K2YA 3VB3A 5EU8A 1E37B 1O2WA 5JBTA 1FQ3A 2BQ7B 5H4IB 3PROA 3RU4E 1F5KU 2WHXA 3MWIU 2AHME 2P16A 1GBDA 2XW9A 2QN5T 3DCLA 1F92A 3RMNH 4HGCA 4AGJA 5EXLA 2FXRA 4LOYH 3A7XA 4ISLA 3U9AH 5AF9H 2ZIQH 1ELVA 2J92A 1N1LA 4HFPB 2Z9GA 2OK5A 1TONA 3MU0A 1HJ9A 1O3KA 1C2FA 2IJOB 3SUFA 5C0UA 2Y82A 2ZU4A 4K60A 2YMSB 4YXWD 3QX5H 1MQ6A 1JOUB 1SLUB 4NSYA 4CH2B 2J4IA 4SGAE 1QGFA 2FDAA 1EB1H 1T32A 4INHA 1RIWB 2ODPA 2PWXA 4I86A 1J17T 2FOEA 2W7SA 1PYTC 2V6NA 2BLQA 3BTEE 4XRNA 1KXCA 4YOIA 1A0HB 2VVVA 1QTFA 2FIRH 2GGVB 4A92A 1EPTB 1GHYH 3FOAA 1FN8A 1GPZA 1O0DH 1AD8H 2SGFE 1YCPH 4JMYA 4VGCC 4BAHB 6GCHG 4D76A 4P00A 1KSNA 1Z8RA 4UEHH 1F7ZA 1AQ7A 1QA0A 3RC5A 4GVUA 2FI3E 4ACBA 4TPYA 2AMDA 3RXAA 4BAQB 1TWXB 2Z94A 3LONA 2KM0A 1BZXE 2THFB 3RXGA 4ABJA 4OS2A 1Y3UA 3PMBB 2GT8A 1H8ED 2FS8A 1DS2E 3IG6B 1K1JA 3S9CA 2BM2A 2KAIA 3OEHD 3TH3H 1LQEA 1P04A 2FESH 4OS1A 3MFJA 5E8EH 1C1QA 1P2OA 1LTOA 1O2XA 3EAJA 1MCTA 1WU1A 2K1QA 5EQRA 4M7GA 1EOJA 3RMMH 1ELTA 1S6FA 3A86A 3M7TA 4NWLA 1GJCB 1GBEA 2BVSH 3FFGA 5HIZA 1PQAA 4X2WA 3HKJB 2ZGXH 3A88A 3SJOA 4XBCA 5AFZH 1GJ6A 4AYYB 3G01A 4YLUA 2EQNA 2BQWB 1K0HA 2BDCA 4JYTA 1O30A 3KQCA 1KTSB 1ZZZA 7GCHG 1NRRH 1WDIA 3GCNA 4IMZA 4DW2U 1HAXB 1CO7E 1GDQA 3VB4A 4AFZA 2H5CA 2FYQA 4DIIH 1G32B 4KTUA 1IQJA 1FAKH 2DE9A 4ASHA 1W2KH 1KMHB 2A7CA 3LC3A 3F68H 5HYOA 3PTBA 4GUXA 1NS3A 1BRAA 5FCRA 2QGRA 1SHYA 3SV7A 1YF4A 1HAVA 3SYJA 1IQHA 1QZ8A 2BD3A 1TGBA 2W3KA 5JBBS 1SB1H 2BVRH 2F83A 4YOGA 2XWBI 1K2I1 2J95A 1GHXH 3BF6H 3MYWA 3Q3KA 3SU2A 4JCNA 2FM2A 1O2KA 1FJSA 5FPTA 4RT0A 5DK1A 5TCCA 3VFEA 3PWCA 2ANKH 3ZZDA 4CRCA 1AFEH 1UTPA 1TGSZ 1INCA 1P02A 1GHAG 2IOTA 1BRUP 1LHGH 4X8UH 3RC4A 4CRFA 1NRQH 1P57B 2EI8A 1GI1A 4DOQA 3EQ0H 4BTIB 2XWAA 1CHOF 1DXPA 1O2NA 4X8SH 2ILNA 2VU8E 1W0ZU 2OC8A 5IYTA 1G2MA 1PPFE 1UVUH 5FCKA 1C1UH 2QXGA 2PKAB 1W12U 2AMPA 2RA3A 1W7GH 3ZVDA 1GBTA 2W6JD 4B6EA 1Y8TA 3EA7A 2PKSC 2V0BA 1ANBA 1P9SA 2ZFFH 3E0NB 4OGYA 1O3IA 1C5VA 3K9XB 4XOJA 4FVBA 1YPLH 2JH6D 1ACBE 1SQOA 4I7YH 3OYPA 4HI3A 2C4FH 2GCHF 2ZWLH 5CE1A 2IJD1 1Y3XA 3R0FA 2RA0A 2QCYA 4RKJB 1MD7A 1TIOA 4U01A 2H9TH 3E16B 3OY5U 3A7TA 3GYMA 2F9NA 2HOBA 1GHBF 3SNBA 4X6NA 5T1VA 4B1TA 3M3VA 2BDIA 4NIVA 1A2CH 5L2ZH 3UB0A 1AHTH 2D2DA 3SJIA 1WSSH 4AFUA 3WWBA 1F0SA 1GHBG 1QY6A 3BTDE 3SI4H 3OX7U 3P92A 1C5UA 1TPSA 2RFKC 2B9LA 1UVSH 4K1TA 1AGJA 4WF8A 3S0NA 2FX4A 3TJOA 4OS5A 1P0SH 2VIQA 1V2UT 4FUHA 2PUXB 4K8YA 3VXEH 3TITA 3PMJA 2A5KA 3IWMA 2ZNKH 8KME2 5L6NH 1LDTT 3RXSA 3P95A 4ZKNU 3O8CA 1E79D 4YZUA 4ABBA 3UREA 2QA9E 1K1PA 3A87A 1GI5A 1GJ4H 1QL7A 1Y3WA 3FP6E 5CHAC 1CSOE 2UUJB 1W0YH 1GBHA 4Y0YE 1QCPA 3SHCH 1GI2A 2PGQB 1WBGB 2EI7A 5E0HA 1BDAA 2CHAB 5T6GA 1YY3A 2NU2E 4ZHAA 3OTPA 1BOQA 1GBKA 2P94A 4AB9A 2P93A 3OE7D 3N7OA 2D26C 2ALVA 4ABGA 1ZGVA 4BAMB 2VIOA 3AVZA 4GLYA 1Z7KA 2A4QA 3SJ9A 1UCYH 2G51A 4ABDA 1O3DA 1MD8A 4UFGH 1FY4A 4NFEA 3TNSA 2XXLA 3I29A 2GT7A 1CU1A 1RD3B 7KMEH 2QF0A 1W11U 1TPAE 4ZMAH 2KFWA 1AUTC 1KXBA 5C5OA 2ZPQA 4INLA 2ZF0H 2AERH 4LZ1H 2NWNA 3PO1C 1PFXC 1C5NH 1QJ1B 3LH1A 2ZA5A 2BX4A 4WH6A 1YCPM 2ZECA 3S7KB 4XD7D 3M5MA 1SOTA 4FXGH 1T4UH 1VGCC 1QBNA 3SBKA 1GJAB 1TFXA 1DY8A 2XTTB 5F8TA 4ZKSU 3U8OH 3BEUA 4NA9H 1SOZA 2Y5FA 1QJ6B 2BD7A 5J4QA 5DG6A 3UR6A 1DT2A 1AO5A 2ZC9H 3VB6A 1W0JD 2XYAA 3GCTG 1GVZA 3SO3A 1QQ4A 3FVFB 2G4UA 1C1NA 2FYRA 1SGPE 2KX4A 2O8UA 1MMJN 4WMEA 2Y7ZA 1Z1IA 2HWLB 3BG8A 1DSTA 3BTGE 2BZAA 2GMTB 2ZGHA 3DT0H 1TNGA 1GMDG 4DT4A 1Z8JB 3NRLA 2FEQH 1C4V2 4FU8A 4FU7A 2BZ6H 1LMWB 3SZNA 1S85A 7LPRA 1T4VH 4ISHH 1PQ5A 1UK4A 4B6FA 5JBCS 4X6OA 2BYAX 3ENSB 2GV6A 2V35A 3AAUA 1GWAA 1Y3VA 2ASUB 2VWLA 3B23B 4CRGA 4YO9A 2HALA 1QB6A 4IC6A 4CRDA 2RG3A 2BDAA 2WPHS 1V2TT 3MH5A 1O5DH 2B8OH 1BRBE 1PPGE 2Z3CA 4NFFA 1T31A 2GMTC 4WWYA 3SW2B 3NXPA 1K1NA 1H1BA 1O2GH 1NESE 2F9OA 2D1JA 3C27B 3F9HA 1IQKA 2CMYA 4WY3A 3TIUA 4XBDA 5DGJA 1EJMA 3TGIE 5A8ZA 1O33A 3BTFE 3PMHB 1TX6A 2OC1A 4CBNA 4B2AA 1AE8H 3E8LA 7GCHF 3C1KA 4X1PU 3A83A 3NPSA 2WSSD 3AASA 1CT2E 1HUTH 4AX9H 4MNVA 2VWOA 1HXFH 1BHXF 2ZU1A 2ZU3A 5IK2D 3O8DA 1FV9A 1O3HA 4B74A 2Y6TA 2BD2A 4IN2A 2JH5D 2KR7A 4MPVA 3L6PA 1O3OA 5I25A 4AZ2B 4ABAA 1FZZA 3SNEA 1HCGA 1NFYA 1OWEA 5FPYA 1UTNA 3E1XB 2XBWA 3PRDA 4ZXXH 1IQLA 2BY6X 4MQAA 5BRRE 5EPYA 2XBVA 5JB8S 1TX8A 1J15A 1CT4E 3TJNA 3BTKE 3ZVFA 1K1MA 1NBMD 2KZ4A 5BPEA 4YT6H 1SGYE 2STAE 2IN2A 1TOCB 1GBIA 3BTQE 4KGAA 2ZQ2A 3UNRA 1N8OB 2C90B 1O2JA 2BD9A 1LQDB 1O2UA 3PRBA 1MKWH 2VBCA 5PTPA 3KQ5A 4X1RU 1C5MD 1KLJH 4SGBE 2JJ1D 3KQDA 2PKAA 1A0JA 1IQGA 3TPIZ 2R2MB 1PJPA 1P01A 1OP0A 4AFSA 3GY8A 1TOMH 1O5BB 2P8OB 4A5TS 3ZVAA 1TBRH 4HTCH 2F9PA 3RXTA 3SHAH 1UMAH 1MTWA 1LHEH 1LCYA 1GI4A 4ZKOU 1OP2A 1O35A 4DY7B 5T6DA 1T8OA 1XUKA 5FHTA 3PLBA 3PO1B 1WYKA 1SQAA 3RMOH 3GCHB 3MI4A 4I8GA 1GJ8B 1ZTKA 2ANMH 4TT3D 4IMQA 1DPOA 4X6PA 1ZSKA 3LH3A 4ISIH 4Q7XA 1SG8B 4WMFA 4GHTA 1D3TB 1QRZA 4A1VA 1O3JA 3DSPA 3SN8A 2BY9X 2A4RA 4XFQA 2ZCKP 1EATA 1L4DA 3OU0A 2ZHQH 3JZ2B 5A8XA 5KGOA 1K9OE 1UTQA 3U1IB 2VVCA 4ISOA 2FWWA 2VWMA 3D62A 4JYUH 3ZVEA 1NROH 5E2PA 1L4ZA 1D3PB 5AHGH 1V2NT 4Z0KA 3ZIAD 2WV9A 1UCYK 5FXLA 4BANB 1QL9A 1G3EA 1GMCF 3QGNB 1AUJA 3BN9A 3GY6A 3DHKH 1TNKA 1ESBA 3QK1A 1FMGA 3RXQA 1A46H 4DURA 3VB5A 2C8YB 2YOLA 1S0QA 5DO4H 4B71A 3SV8A 2FODA 1GVLA 3P70B 1JXPA 1UHBA 2J9NA 4YTAA 1TRYA 5EW1H 2ZP0H 1D3QB 4YM9A 2AMQA 1HAIH 3F9GA 3FO8D 3SNDA 3RXFA 2R0KA 4XSKU 2ZEBA 3EGKH 5A8YA 2A1DB 3M35A 4GAWA 4JZDH 1BTXA 3GY4A 3SV9A 4FUDA 3ZYEA 4F55A 3KYGA 1S5SA 2ANWA 2VWNA 3A81A 2OINA 3RM0H 1HB0B 1GJBB 1CA0C 2HNTF 1CA0B 3N7EA 1H8IH 3GY3A 3K6YA 1C4Y2 4FUCA 1P2KA 3GDVA 2FOMB 1OWHA 1VKYA 2RDLA 3SUGA 1HAZB 3DFJA 1ANEA 5GNDA 1HAGE 3TK9A 1C1RA 4YOJA 2O9QA 5C17A 2QXJA 1NTPA 3LC5A 3TU7H 3PWBA 4JYVH 1XVMA 5CHBA 2GCTC 2NU4E 3WW7A 1PQ8A 4NA7A 5FPSA 2QF3A 1KTTB 5F03A 3ATLA 1V2RT 3EA8A 2SGQE 1Z6JH 1MAYA 2L6OA 1UO6A 1EZSC 4Y6DA 1P2NA 3U1JB 1GCTB 2UUYA 1OWKA 1QRXA 1HAPH 2HNTE 1TQ0B 3M37A 1XMNB 4WVPE 4AG2A 4KTSA 3P8GA 1GI9B 1FDPA 1O3LA 1DLKB 1OWIA 1EASA 4KP0A 1ETTH 4NCYA 1YLCA 2FP7B 3T27A 1C1VH 3HGNA 2H5DA 1UCYE 2R3UA 5ESTE 2QF4A 3FKSD 1G2LA 1CGIE 3RXPA 1ZMJA 1CGJE 2OTVA 1O3PB 2PSYA 4Q80A 5FAHA 3PYHA 2ZDVH 4CRBA 2UWOA 2LPRA 2O8TA 5C20A 4I31A 2P3FH 1DXWA 1ELCA 1HJ8A 3LGIA 1DANH 1FY1A 1GJDB 4Y8YA 1MKXH 4TY6A 1AU8A 1MH0A 3CP7A 1C2KA 2K8IA 3GS9A 4Q7ZA 3SUDA 2F9UA 2XRCA 3KGPA 4I8KA 2UWLA 2ZDNA 1XKBC 4FUIA 1YGCH 2XNIA 1YBWA 1YPKH 3RXBA 2F9VA 2OBOA 1DITH 3PLPA 1H9LB 3ATKA 1LKBA 1RXPA 2KCAA 1TYNA 1IQEA 1MCVA 2GZ7A 3T5FH 1ZYOA 1ZJDA 1GBLA 1HAHH 3GCHC 5E0JA 1PPBH 4F49A 4CREA 4X2XA 1ZPZA 2P3TB 3KF2A 4TWYA 2ZDMA 3RXKA 2WINI 2BD4A 1C9TA 1P09A 3UIRA 1YLDA 1L1NA 3NK8A 6ESTA 3PM3A 2PP6A 2SNWA 1L1GA 1SLXB 2JKHA 2ZDAH 2XCNA 3T62A 3KNXA 1UVOA 2KCOA 1BITA 4O9VA 1GHVH 1EFRD 2FOBA 1O34A 2PLXA 3QO6A 5DP4A 3SUEA 1ORFA 3U98H 1P8VC 1CVWH 1JIRA 1TA6A 4YLQH 2ZFTA 2TIOA 1F5RA 5FBIA 1HAYB 4A7IB 1UK2A 2BB4A 1ZHRA 1C1WH 1HNEE 3NWUA 3P6ZB 1BBRH 1DWBH 3GY7A 1EAUA 1KLIH 4CR9A 1ZR0A 3TVJB 3TGJE 1YC0A 3F2HA 2G5NA 2ZPSA 4IW4E 4X0WU 4D9QA 2HPQH 5FBEA 1AZ8A 1GBFA 1TNLA 1QNJA 1RIWC 3E3TA 3TH4H 2HNTC 6GCHF 1MTNC 1XVOA 3MO9A 2FOFA 1FNIA 1O3FA 5HXFA 3A89A 1Q2WA 3GYLB 4BAOB 1B5GH 3TH2H 3V12A 1ELFA 1WQSA 3RDZA 1NRPH 1CGHA 1C5XB 4X1SU 1TE0A 4CR5A 3O8RA 1NN6A 1AI8H 3MH6A 1CT0E 2AS9A 2EA3A 1G3DA 3TJVA 2VH0A 3ZZ5A 2ZFPH 1OYQA 3KHVA 4TPIZ 2GTBA 1EZUC 1HJAB 1COWD 1NPMA 3LGUA 1RTFB 4ZXYH 2JDID 1O2TA 1ZRBA 2BOHB 3QWCH 3V3MA 1QHRB 3SOSA 5C3NA 1DE7H 5I46H 3ATIA 1MTSA 1V2VT 3ZZBA 3B9FH 4MPXA 1E34B 2Z3EA 1MU8B 4RT1A 1TPOA 1E35B 2PHBA 3ZVBA 2P59A 1SGDE 1PQ7A 2M5TA 4H42U 1GMHF 1DM4B 2AYWA 4BAKB 3ZZ4A 4IS5A 1HJAC 4UD9H 3RXOA 2GDDA 5HGGA 2TRMA 5GDSH 3E91A 2QYIA 2QIQA 1CE5A 1FAXA 3FANA 1GCDA 1ANDA 2W3IA 1Z8IB 5GXPA 1GGDC 1GI6A 2DUCA 3OEED 4X8TH 1S6LA 3SU1A 1ABJH 3BIVH 1IOEA 3RP2A 1MABB 2ZU2A 4BTUB 2VIPA 1K21H 1AN1E 1C2IA 1FXYA 1NRNH 1DWDH 4KTCA 2NU1E 3U28C 4ABHA 1THRH 2A0QB 4DGJA 3T26A 1MTUA 2V3HH 1C1OA 1G30B 2JJ2D 1F0RA 1CHOG 4XE4A 2TGAA 3LPRA 1KDQB 2R0LA 3HK3B 1V2MT 3MTYA 1S6HA 2BXUH 1SL3A 1P11E 1IHSH 2NU0E 2SFAA 1GHAF 2CXVA 2FOHA 3V7TA 4UE7H 3F9EA 2BDGA 1GI3A 1RJXB 1V2QT 3EA9A 5HM2A 2RDEA 1EAXA 5ESBA 1RRKA 1J9CH 4X8VH 2HLDD 3VPKA 1E36B 2FX6A 2B7DH 4CHAC 1KXDA 4CHAB 1ELGA 1NY22 4FUGA 1UJ1A 3RXLA 3UUZA 3ODFA 2UWPA 3RU4T 4I32A 1BBRK 1QBVH 1NU9A 4PROA 3A7WA 1OPHB 3F6UH 1GVKB 2STBE 1VZQH 2WV5A 1E1RD 2W26A 3H09A 2ANYA 3BG4C 2CGAA 1A61H 2HLCA 1UHBB 1C5OH 2A7HA 4X2VA 3TK5A 1ANCA 3U8TH 3AW0A 1BRCE 3RXCA 1QFKH 1QURH 2CF8H 4JZIA 1P9UA 1ZGIA 4J2YB 2HVYB 1ZPCA 4H6SB 2BLOA 2ALPA 3NCLA 2V3MA 1C2DA 3TNTA 2WUCA 3K2UA 5DKMA 2C93B 2ZFRH 4I8HA 1HGTH 1O3AA 1QRWA 5AFYH 4MNWA 1FX0B 1S84A 3DUXH 4ZUHA 2OXSA 2TGTA 1F0UA 3QTOH 1TRMA 2LP6A 2B0FA 1C2EA 1IAUA 2ZO3H 1ZTJA 2Q6GA 1YYY1 5C1YA 4B2BA 1MZAA 1ELEE 3OSYA 3S69A 1LPKB 9LPRA 5EW2H 2A2XH 2GJGA 3DA9B 1NM6A 5CHAB 2AFQB 3SNCA 3KQBA 1LVBA 5A0AE 1TGTA 1GL1A 1BJUA 3S9BA 1Z1JA 3PV4A 1SC8U 3URDA 3MU1A 4BXSA 1BA8B 2XBYA 3MNCA 1OKXA 5HIYA 3RXDA 1NFXA 2W5EA 1HAOH 1AMHA 2TPIZ 1G37A 1OX1A 1YPHE 3UAIC 3MOCA 1GCTC 3BEIB 3TJUA 3GDSA 1M9UA 1LVMA 2FO9A 1MKWK 5LPFA 4DG4A 2D8WA 2F91A 1SGFA 1V2PT 4DVAU 3KEEA 2O8MA 2TGDA 3GISB 3LGWA 3O8BA 2ZU5A 1ZHPA 2Z7FE 1W7XH 2ZHDA 1F2SE 1JRTA 1NRSH 1FPHH 3UOPA 3B8JA 5EJ1A 5LH8A 1X7AC 1WV7H 5GWZA 4NGAH 3RXVA 2LELA 4KELA 4INKA 4B76A 1TA2A 4LK4A 1O3MA 4HG6A 1NFUA 4IN1A 1C5RA 3TK6A 2QE7D 1LPGB 3NKKA 4NZLA 5TJXA 1AWHB 2FI5E 3BTWE 1A3BH 4WXVA 1YCPK 2Z9LA 4FU9A 1XKAC 2FPZA 1AB9C 1OOKB 1QB1A 5KEDA 3STJA 1E0FD 4FVDA 1MBMA 3HATH 1ETRH 2PSXA 2ZDKA 1MZDA 1NFWA 1CA8B 5GIBA 3I78A 1T7CA 3KCGH 1PPEE 1G9IE 1CQQA 1GL0E 1V2LT 3LJJA 1N6XA 1SI5H 2CF9H 3P8NA 4Y7BA 1W10U 5EIYA 3ATWA 5JB9S 3W1EA 2WPIS 2EI6A 2PUQH 3UTUH 1SGEE 3LKWA 1W8BH 3URCA 5DP7A 3AW1A 3UR9A 2V7QD 4IGDA 2ODYB 1TLDA 3M61U 3OAAD 2OBQA 2WYGA 3QUMP 4JZ1A 4NWKA 2CJIA 3N99A 3MNXA 4GCHF 4D7GA 2ZHEH 1ZSJA 4Y8ZA 1EOLA 3LGYA 2Y5HA 1FUJA 1LKAA 1AWFH 1BMNH 3HK6B 2GV7A 2WPMS 2ZTYA 1IQNA 4F48B 5SGAE 3A8DA 2VGCC 3M36A 1HIAB 5TCAA 2R9PA 1O2PA 3DD2H 1JWTA 1ID5H 1Y5UT 2V3OH 2R2WU 2XOKD 2AEIH 1WCZA 1YPEH 2A7JA 2YNAA 1Q3XA 1V2WT 2A5IA 4OS4A 2G4TA 3V13A 3T28A 1L0ZA 2OUAA 2CN0H 1P06A 2OP9A 3UWJH 1ZTLA 2ZGJA 1W0KD 2SGEE 1AY6H 2BY7X 1S83A 3FZDA 3LT3A 1Y59T 1SKYE 1O2HA 3H5CB 2XC0A 1LVYA 1HYLA 1AVXA 1VITG 4AFQA 2SGDE 1ZMLA 4AGKA 4Q7YA 1MUEB 2AIPA 5GCHF 1RGQA 8LPRA 3FP8E 1DY9A 5ABWA 3HPTB 1VITF 1YPHC 1EX3A 3MQKC 1DDJA 3D49H 2Q1JA 1NZQH 3I77A 3ZZ6A 1TMBH 4AG1A 3VG8A 2Z9IA 2FOCA 4DIHH 2CV3A 4CBOA 4Y71A 2QY0B 5DPAA 4BXWA 5EODA 2PW8H 1ZLRA 1C1TA 4A1TA 3ZZCA 3M3TA 3M5NA 3S7HB 3SNAA 1SMFE 1O38A 2ZGBH 5DSFA 3E90B 3SU4A 2C8ZB 1GJ7B
chains in the Genus database with same CATH topology
1YP9A 1QIXB 3MU4A 4VGCB 4KKDA 2VB0A 1HLTH 1Y5BT 3GDUA 2GP9B 3KN2A 3K6ZA 1RTKA 4IBLH 1MBQA 2SGPE 4NA8A 1SR5C 1AFQB 1C5LH 3ZZ9A 5EXNA 3CS7A 5A09A 1BMLA 3SV2H 1FN6A 1H9IE 3SJ8A 1Z6EA 1RFNA 2G52A 1A4WH 1B0EA 2QV1A 1B0FA 1S82A 3EDXB 4K3JA 4AN7A 2H6MA 3IITA 1O3GA 4U30A 4K1SA 1P3EA 3RUOA 3M5OA 2QXIA 4NG9H 1LPZB 1VJ9U 2KAIB 1HBTH 3F9FA 1O2IA 1SLVB 4UDWH 4RSPA 2OD3B 2OC0A 3ZYDA 3PMAB 1J16A 1J8AA 5DP9A 3GCOA 2P95A 3RXJA 3VXFH 3UFAA 3Q00A 1YPJH 2YNBA 3ATMA 4I8LA 3MHWU 2FS9A 5EPNA 2XCFA 4TY7A 3ITIA 1O3NA 4Y7AA 1TRNA 1OSSA 1D6RA 1BBRE 1ZMNA 2J94A 4K1EA 3SU5A 3ZZAA 1P2JA 1K1LA 4MVNA 1A5IA 1BTZA 3L33A 1EJNA 1AB9B 5F6MA 2G81E 4MPWA 2OLGA 3LJOA 2ZKSA 4MDSA 1FY8E 2ZHWH 5L30H 1HXEH 1BCUH 1DWCH 3LGTA 3BV9B 1TBQH 1WTHD 1IQMA 3BTME 3T29A 2AIQA 3SGQE 1C5WB 4O3UA 4R8TB 1D6WA 2H1UA 2BLWA 1P2IA 3D65E 1GMHG 2G00A 3PTNA 2A31A 5EQSA 3EYDA 4Y11E 1F5LA 1WOFA 4DJZB 1EAWA 1GMCG 3LGVA 1A7SA 2BDYA 1FONA 1DOJA 2C8WB 1O2VA 3UNSA 1FY3A 2ZHFH 1C2MA 3BSQA 1O37A 3RLYH 2ZPRA 2ZFQH 1BB0B 1Z8GA 1SGRE 1BTHH 2PR3A 3MNSA 3VEQB 2JETB 2BDHA 4O03A 3T25A 2H2ZA 3M7QA 3A7ZA 4H4FA 3OY6U 5AVDA 2ODQA 3ZV9A 1GHZA 4YT7H 1P05A 3QZRA 6CHAC 3D23A 2BD8A 1GBJA 3RXIA 4NIYA 2SNVA 2PKSB 1Q31A 3VGCB 4WXIA 1QQUA 3E0PB 1TQ7B 2FI4E 2ZTZA 2QAAA 3RM2H 4O3TA 4LZ4B 1W14U 3ZVCA 4MNYA 3A7VA 4GSOA 4AORA 1G36A 2BXTH 1O5GH 2JETC 4YESB 1BHXB 4UFDH 4MTBA 1GBCA 5G4BA 2G5VA 5DP5A 3Q77A 1THSH 1ELAA 6CHAB 5A2MH 2GX4A 1EXFA 1ARCA 1C1PA 1O3BA 1NC6A 1EQ9A 1OYTH 1PPZA 6LPRA 1DUAA 3BTTE 5K7RA 1VJAU 3RLWH 1K22H 1UTMA 2IPHA 2ZCHP 3M7UA 4E06H 1SFQB 2AGIX 2GZ8A 2I6QA 2ZDLA 4BTTB 4ESTE 2BTCE 3NZIA 1EJAA 4Y8XA 1TAWA 1XM1A 2H9HA 1QB9A 2BDBA 3MH7A 3W95A 2VIVA 1MTNB 2Y7XA 2TGPZ 1G3CA 1EPTA 3HKIB 3UPEA 1SBWA 4NSVA 1T8MA 4B73A 4ZH8A 2BLVA 5EGMA 1O32A 1KLTA 1GMDF 1O3EA 1GG6C 4D8NA 1K1OA 1TPPA 4I33A 1DICA 3M3SA 1K28D 3ZZ8A 1BTYA 4AOQA 2CHAC 2J38A 4Y76A 3BTHE 4D9RA 1LHDH 1UVTH 1V2JT 3A8BA 1ETSH 1NT1A 1Y3YA 3RXHA 1EKBB 3SV6A 3RMLH 1TNHA 2SGAA 4Z6AH 1BIOA 3TGKE 1P12E 3RC6A 1GHWH 1CHGA 1MTVA 3E6PH 4E7RG 1DLEA 1J14A 1RS0A 1VCWA 4BNRA 3RU4D 1FIWA 2ZGCA 1TMTH 4J1YA 1XXFA 3PLKA 2XBXA 1YM0A 3T2NA 1H8DH 1GJ9B 1O36A 1JIMA 2HGTH 5EXMA 1LHCH 2BY8X 2ULLA 2P8OC 5GCHG 1UTOA 3SU3A 1HIAA 3NUMA 1O2ZA 4GPGA 2FZZA 1FLEE 3UQOA 3A8AA 3MO3A 1O31A 1YPMH 1UTJA 2XC5A 1O2QA 2VVUA 4HZHA 1A1RA 3FP7E 4XBBA 1YPGH 3U8RH 1GBAA 2C3SA 3MH4A 1ARBA 1TABE 1C5PA 2GZ9A 1ESAA 1C4U2 3UOUA 1TMUH 4IC5A 5LGOA 1EP6A 3CENA 1BQYA 3GICB 1EB2A 4RN6A 2FTLE 2FMJA 3SGAE 2A5AA 3RXEA 1TB6H 3MU5A 4JZFH 1O2YA 4ABEA 2F3CE 1A5HA 1ZHMA 1BJVA 2EEKA 5GPIB 1AZZA 1G3BA 3SJKA 4RKOB 3LDXH 5HMAA 1AKSA 3A85A 2Z3DA 2Q6FA 5DP3A 5C1XA 4K8BA 1AVGH 1U6QA 4X1QU 1P3CA 3RXUA 3QGJA 3DFLA 4TYDA 4CRAA 2A45B 3ZZ7A 1ZRKA 4FUBA 1WQVH 3SU6A 3ODDA 3UY9A 3BG4B 2WYJA 1GJ5H 1O2SA 1CBWB 4XDEA 3QLPH 3QN7A 1W13U 2WPJS 1KXEA 1ZJKA 1MU6B 2C8XB 1IQFA 1HAVB 1LVOA 1O5EH 3OTJE 3PB1E 3SORA 1TGCA 1C2HA 1SSXA 2PV9B 1LO6A 2ESTE 1F0TA 1ZSLA 1Y5AT 1QR3E 1T8NA 2PTNA 2Z9JA 2BD5A 1O2MA 4H6TA 1FI8A 2GKVE 4I8JA 4UFEH 5C5NA 4MG3A 3WY8A 1HFDA 4LXBH 1BT7A 1XUGA 7ESTE 3CS0A 1WUNH 1TNIA 2Y81A 1C5SA 1O5AB 2Q6DA 3A82A 1C9PA 1O2OA 4FUJA 4MNXA 1OS8A 8GCHF 2BY5X 3W94A 2P3UB 4A1XA 2WV4A 5EG4A 2GCTB 1GI8B 3UNQA 1WAYB 1FPCH 1OP8A 1PPCE 1HDTH 1KDQA 5JBAS 1MQ5A 1SGFG 1TX7A 2FTMA 3Q3XA 4FUFA 1FIZA 3HGPA 1HPGA 3H7OA 1S0RA 3S9AA 1ESTA 1P2QA 4Y0ZE 2LNCA 4ZHLU 1OWJA 3A8CA 3M5LA 2OC7A 2ZZUH 3SQHE 4QT8C 1E38B 2ZCLP 3BIUH 1LHFH 2DE8A 2O8LA 1O2RA 5DJ7A 5JPMH 1PYTD 1XUIA 5L2YH 2GVFA 5IDKA 1BTUA 3RXRA 2FOGA 4X2YA 3ESTA 2PTCE 2R3YA 2OQ5A 2ZG0H 2JH0D 1C2LA 4ISNA 5A0BA 5JYIA 3ZVGA 1S81A 2F9BH 4MPUA 1KIGH 5T3HA 2GD4B 2BQ6B 1QA7A 1V2KT 5C2ZA 2J34A 2Y5GA 4OGXA 9ESTA 4NIXA 4UFFH 3UQVA 1JBUH 1O5CB 2Z9KA 2O8WA 5K0HA 1C1SA 1MKXK 2EC9H 1L2EA 2QC2A 3F1SB 4AB8A 5F8ZA 1O3CA 1DFPA 2UUKB 1RTLA 2B5TB 3FZZA 1NU7B 1AVWA 3QZQA 1HV7A 1SGIB 3K65B 4OS7A 2VIDA 4E05H 1N6YA 2HPPH 2AGEX 1SFIA 4Y10E 4GHQA 3ZZ3A 1TBZH 3Q76A 1AE5A 3QTVH 2BOKA 1A3EH 1EZXC 4CH8B 3A7YA 1XUHA 2W7UA 3VGCC 1UK3A 4K69A 2I6SA 4U32A 3V0XA 4TWWA 1AKSB 1C5QA 4AYVB 1SHHB 4NIWA 4DCDA 2BMGB 4ZHMU 3SQEE 1L1JA 1ELDE 3R3GB 3SGBE 2ZTXA 4FUEA 1A5GH 2VGCB 3ELAH 1T8LA 1QBOA 1NO9H 1XUJA 1GDUA 3RXMA 3STIA 5J4SA 1C5YB 1THPB 1W3CA 1GDNA 3MMGA 4DT7B 1SVPA 3SU0A 2BVXH 2RCEA 4JZEH 1EUFA 4O97A 4OS6A 3A84A 1P03A 2AH4X 4ABFA 1EZQA 1C5ZB 3P8OA 2Y80A 4MLFB 1C2GA 2HVXA 3QDZB 3A80A 4X6MA 2ZQ1A 1DX5M 1VCPA 1CBWC 1MAXA 1GBBA 2BX3A 3KQEA 4A6LA 1AFQC 2AGGX 2WUBA 4B2CA 1SGNE 2XC4A 1ZPBA 1EPTC 1D9IA 3P8FA 2FLBH 1OWDA 4R0IA 1SGTA 1TNJA 3Q3YA 3BEFB 1H4WA 1GG6B 2ZFSA 1QJ7B 3SI3H 3TLOA 1IHTH 1OXGA 3LU9B 2Z6BD 5T6FA 4D7FA 4K5ZA 3ZV8A 1BUIA 2PFEA 2VH6A 2VIWA 3KIDU 2GDEH 1EP5A 1BTPA 2WPLS 8ESTE 3FAOA 1C2JA 1V3XA 1DSUA 1KXFA 1XX9A 4ABIA 5DP8A 2BHGA 1VITH 1FY5A 4UONA 1N8OC 1DUEA 4Q2KA 1DWEH 3LIWA 3P17H 4X1NU 1XUFA 1H9HE 1SPJA 2VNTA 4NZQA 5DP6A 1Z71A 1AIXH 1HRTH 1ABIH 2A4GA 2FLRH 2GCHG 5C1UA 3GCTF 3MU8A 2J2UA 5GJ4B 3UWIA 1KXAA 1TALA 2VINA 4BOHA 4JK6A 1P2MA 1ZOMA 4ZROA 4F4OC 4THNH 1K1IA 2UUFB 1GGDB 1O39A 1PPHE 3AAVA 5ETXA 1VR1H 3H7TA 4WJG2 2FOAA 4JK5A 1VGCB 1XXDA 2G8TA 2VJ1A 5B6OA 2OCVB 3KL6A 4Y79A 5HM9A 1GI7B 1WTGH 1GBMA 4ZAEA 2A4OA 3MO6A 1VCQA 5A0CA 4E7NA 2TBSA 1SLWB 1A0LA 1D4PB 1YKTA 1UVPA 1TGNA 3VB7A 1D3DB 1JRSA 1SGCA 1V2ST 1C1MA 3GOVB 1UTKA 5FX6A 1GI0A 1SQTA 4ZKRU 1SGQE 4U2WA 5C67A 5E2OA 1UTLM 1C5TA 2HRVA 4GCHG 1BMAA 5EOKA 5F8XA 3LOXA 2QXHA 1BMMH 3MNBA 1KYNA 8GCHG 1O2LA 5CMXH 2A2QH 1KY9A 5FX5A 2NU3E 5LPRA 2G55A 2PGBB 1O5FH 1BTWA 4B75A 1B7XB 1EAIA 1IQIA 2A32A 3L3TA 5E0GA 3GY2A 4WH8A 1ELBA 1V6DA 1QL8A 1P10A 5LPEA 2H9EH 5JDUB 3GY5A 3JZ1B 1JMOH 2ZI2H 3EE0B 4WMDA 2OQUA 2WPKS 5EQQA 3U69H 1V2OT 1DVAH 4K2YA 3VB3A 5EU8A 1E37B 1O2WA 5JBTA 1FQ3A 2BQ7B 5H4IB 3PROA 3RU4E 1F5KU 3MWIU 2P16A 1GBDA 2XW9A 2QN5T 1F92A 3RMNH 4HGCA 4AGJA 5EXLA 2FXRA 4LOYH 3A7XA 4ISLA 3U9AH 5AF9H 2ZIQH 1ELVA 2J92A 1N1LA 4HFPB 2Z9GA 1TONA 3MU0A 1HJ9A 1O3KA 1C2FA 2IJOB 3SUFA 2Y82A 2ZU4A 4K60A 3QX5H 1MQ6A 1JOUB 1SLUB 4NSYA 4CH2B 2J4IA 4SGAE 1QGFA 2FDAA 1EB1H 1T32A 4INHA 1RIWB 2ODPA 2PWXA 1J17T 2FOEA 2W7SA 1PYTC 2V6NA 2BLQA 3BTEE 1KXCA 4YOIA 1A0HB 2VVVA 1QTFA 2FIRH 2GGVB 4A92A 1EPTB 1GHYH 1FN8A 1GPZA 1O0DH 1AD8H 2SGFE 1YCPH 4JMYA 4VGCC 4BAHB 6GCHG 4D76A 1KSNA 1Z8RA 4UEHH 1F7ZA 1AQ7A 1QA0A 3RC5A 4GVUA 2FI3E 4TPYA 2AMDA 3RXAA 4BAQB 1TWXB 2Z94A 3LONA 1BZXE 2THFB 3RXGA 4ABJA 4OS2A 1Y3UA 3PMBB 2GT8A 2FS8A 1DS2E 3IG6B 1K1JA 3S9CA 2BM2A 2KAIA 3TH3H 1LQEA 1P04A 2FESH 4OS1A 3MFJA 5E8EH 1C1QA 1P2OA 1LTOA 1O2XA 3EAJA 1MCTA 1WU1A 2K1QA 5EQRA 4M7GA 1EOJA 3RMMH 1ELTA 1S6FA 3A86A 3M7TA 4NWLA 1GJCB 1GBEA 2BVSH 3FFGA 1PQAA 4X2WA 3HKJB 2ZGXH 3A88A 3SJOA 4XBCA 5AFZH 1GJ6A 4AYYB 3G01A 4YLUA 2BQWB 2BDCA 4JYTA 1O30A 3KQCA 1KTSB 1ZZZA 7GCHG 1NRRH 4IMZA 3GCNA 4DW2U 1HAXB 1CO7E 1GDQA 3VB4A 4AFZA 2H5CA 2FYQA 4DIIH 1G32B 4KTUA 1IQJA 1FAKH 2DE9A 4ASHA 1W2KH 2A7CA 3LC3A 3F68H 5HYOA 3PTBA 4GUXA 1NS3A 1BRAA 5FCRA 2QGRA 1SHYA 3SV7A 1YF4A 1HAVA 1IQHA 2BD3A 1TGBA 2W3KA 5JBBS 1SB1H 2BVRH 2F83A 4YOGA 2XWBI 1K2I1 2J95A 1GHXH 3BF6H 3MYWA 3Q3KA 3SU2A 4JCNA 2FM2A 1O2KA 1FJSA 5FPTA 5DK1A 5TCCA 3VFEA 3PWCA 2ANKH 3ZZDA 4CRCA 1AFEH 1UTPA 1TGSZ 1INCA 1P02A 1GHAG 2IOTA 1BRUP 1LHGH 4X8UH 3RC4A 4CRFA 1NRQH 1P57B 2EI8A 1GI1A 4DOQA 3EQ0H 4BTIB 2XWAA 1CHOF 1DXPA 1O2NA 4X8SH 2ILNA 2VU8E 1W0ZU 2OC8A 5IYTA 1G2MA 1PPFE 1UVUH 5FCKA 1C1UH 2QXGA 2PKAB 1W12U 2AMPA 2RA3A 1W7GH 3ZVDA 1GBTA 1Y8TA 3EA7A 2PKSC 2V0BA 1ANBA 1P9SA 2ZFFH 3E0NB 4OGYA 1O3IA 1C5VA 3K9XB 4XOJA 4FVBA 1YPLH 2JH6D 1ACBE 1SQOA 4I7YH 3OYPA 4HI3A 2C4FH 2GCHF 2ZWLH 5CE1A 1Y3XA 3R0FA 2RA0A 2QCYA 4RKJB 1MD7A 1TIOA 4U01A 2H9TH 3E16B 3OY5U 3A7TA 3GYMA 2F9NA 2HOBA 1GHBF 3SNBA 4X6NA 4B1TA 3M3VA 2BDIA 4NIVA 1A2CH 5L2ZH 1AHTH 2D2DA 3SJIA 1WSSH 4AFUA 1F0SA 1GHBG 1QY6A 3BTDE 3SI4H 3OX7U 3P92A 1C5UA 1TPSA 2B9LA 1UVSH 4K1TA 1AGJA 4WF8A 3S0NA 2FX4A 3TJOA 4OS5A 1P0SH 2VIQA 1V2UT 4FUHA 2PUXB 4K8YA 3VXEH 3TITA 3PMJA 2A5KA 3IWMA 2ZNKH 8KME2