3S9CA

Russell's viper venom serine proteinase, rvv-v in complex with the fragment (residues 1533-1546) of human factor v
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
234
structure length
234
Chain Sequence
VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Vipera russelli proteinase RVV-V gamma
total genus 59
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9cA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3s9cA02
3I29A 1H1BA 1CGHA 1GHAF 5EW2H 1Z8JB 3MNCA 1C1UH 1FY4A 3IITA 5CMXH 1O3DA 4I8KA 2FLRH 2XWAA 5C3NA 1RXPA 2BX4A 2Z9LA 1O30A 2R3UA 3SV6A 1P11E 3MTYA 1YM0A 1DICA 1YCPM 1MKWH 1GDUA 3M7TA 4CR5A 5FPTA 3VXEH 1FN8A 1QURH 2W26A 1Y59T 1V2OT 2G5VA 2G5NA 1WSSH 3OSYA 3TH2H 1PYTC 4Y79A 3P6ZB 1QJ6B 3BEIB 3BIVH 1BCUH 1TYNA 1C5UA 1C1MA 3F68H 4JZ1A 1AVGH 3SN8A 4I8HA 3TITA 1NZQH 1RRKA 3UR6A 2Z9GA 3A7YA 1AFEH 1ID5H 1TE0A 1F5KU 4Z0KA 1N6YA 3MOCA 5L2YH 4D9RA 5E8EH 1GMDG 1GBHA 4MPXA 1CA0B 1DLKB 4PROA 1QY6A 1H9HE 1A5GH 1UCYK 1ZPZA 2WV5A 1TPPA 1PPHE 2UUKB 1IQNA 1XUGA 1JIMA 3EDXB 4TY7A 4IMQA 2PKAA 1GJ9B 3DT0H 5AF9H 1DWBH 1CO7E 2FOAA 1WU1A 1C2MA 4AFSA 2ZTZA 1NY22 3RP2A 1WQVH 2Z3CA 5A2MH 1THPB 2AYWA 3PMAB 1XVOA 1EZXC 1UMAH 2XXLA 4UE7H 1RTLA 3KEEA 1EPTC 4Y76A 4X2VA 2EA3A 1C5OH 5AHGH 2CF9H 2BDAA 1O5CB 3UNRA 3MYWA 1PQAA 2BDYA 3FAOA 1ZMNA 2A45B 4XDEA 2XCNA 2ZGHA 4X1RU 1A2CH 1O2MA 5DKMA 5GPIB 1C4Y2 4NIXA 1C2IA 1D6RA 3LONA 3Q76A 4K5ZA 2FODA 5LPEA 5K7RA 3URDA 4U01A 1C2LA 4O03A 1LO6A 5JBTA 4NIWA 3TLOA 2A2XH 1GBBA 2BVRH 3EAJA 3ZVFA 2DE9A 1J17T 4K1EA 2W7SA 2GTBA 5TCCA 2VIWA 3SNCA 5L30H 3RXPA 1O2QA 4E05H 2FLBH 3BSQA 1DSTA 2BD7A 2XRCA 1F5RA 3HGNA 3M36A 1AN1E 3RXQA 7GCHG 1V2UT 2OD3B 1JIRA 4FUDA 1S82A 3STJA 3ZVBA 1DOJA 1HXFH 1NC6A 2ZPRA 1TGCA 1C5QA 1CGIE 1G3CA 2A5IA 2ALVA 2BZAA 4BAOB 1FDPA 2A1DB 4MG3A 5E0HA 1MQ6A 1EOJA 2ZCHP 5J4QA 4K69A 3SV8A 1NPMA 3ZZ4A 1K22H 3P95A 5EPYA 3LT3A 4X6MA 1UJ1A 1VGCC 3ZZ8A 4TPYA 1RD3B 5GXPA 4ZMAH 3GDSA 1O3JA 2NU4E 3BEFB 1YPJH 1Y5UT 1MTWA 2FOCA 1MAYA 2ZZUH 3NKKA 4X6OA 4FVDA 1TNJA 2OXSA 1UO6A 3E1XB 1PFXC 5J4SA 1QHRB 1OS8A 1EATA 1WV7H 2D2DA 3HATH 4JZIA 1DUEA 4MQAA 3RXUA 1GJ6A 5A0BA 1EP6A 1GCTB 1LVYA 3EQ0H 1QA0A 1T32A 3KGPA 5JYIA 2J4IA 4CRBA 1C2HA 1BQYA 1AFQC 1OWDA 1AB9C 4Y10E 1FY1A 3KQCA 2BXUH 4XBDA 2BDIA 3A8BA 1FUJA 2PTCE 1G9IE 2QXIA 2B7DH 4A1XA 5EOKA 1XM1A 1KLTA 1SQTA 1O2OA 4K2YA 4GHQA 1M9UA 5EXMA 3PLBA 1GBAA 3Q3XA 5AFZH 3S7KB 1Z6EA 3G01A 3ZZ3A 4UFDH 2ODPA 1TABE 3O8BA 1AKSB 1ELFA 1TWXB 2VU8E 2G8TA 1TGTA 2Y7ZA 1TQ7B 4OS2A 3Q3YA 1QTFA 3TGJE 3BEUA 7GCHF 1KLJH 1EJAA 2Q1JA 3ZV8A 3T2NA 2G52A 1DLEA 3H7TA 1TNHA 3BIUH 4JCNA 1PPFE 3LJOA 3ZV9A 4KELA 5C1XA 5CE1A 1D3PB 4FUHA 3PMHB 2Q6GA 1OP2A 1O2RA 1ELBA 1SFIA 2ZNKH 3BTWE 1UVSH 5EQQA 1HUTH 3A81A 2ZU3A 2EI6A 5EPNA 2ZF0H 1AE5A 4IGDA 2BLWA 4AG2A 1WOFA 4QT8C 1BIOA 2QXJA 4AGKA 5A09A 2ANYA 1GJ8B 1GBCA 1ZHMA 3F9EA 8GCHG 1L1GA 5JBBS 5F8TA 5LH8A 3GDUA 4UEHH 1P3CA 1SGEE 1AVXA 4ZKSU 3ZZBA 1AFQB 2BY5X 2VWMA 1BDAA 1AUTC 2VWNA 4DIIH 1HXEH 3UR9A 4GAWA 1CT2E 1XMNB 2Z7FE 2UUFB 1BRCE 1P2OA 4AB8A 2PR3A 4YESB 1GPZA 2LPRA 3SQEE 1HBTH 2ILNA 2XYAA 4AYYB 1K1NA 2A4OA 1EXFA 5EQSA 5LGOA 1XUIA 2IJOB 2OC1A 3QGJA 2ZGJA 2CJIA 1FXYA 1YF4A 4FU8A 4KP0A 1Y5BT 1CBWC 2B0FA 1UVUH 2BDGA 1AWHB 1CU1A 1C1TA 2OC8A 1FONA 1LHEH 1BTUA 1DM4B 2SNVA 3D49H 1QJ7B 4OS6A 1UCYE 1O35A 1UTQA 4LXBH 4SGBE 2GZ7A 3BTEE 1YLDA 1B5GH 2A4QA 6CHAB 2GD4B 3KQBA 1QCPA 1GMDF 3SUDA 2I6SA 4X1SU 1GHVH 1K2I1 1EPTB 1S5SA 3QZQA 5GWZA 1KDQA 3SHAH 5T6DA 2BOHB 3RXDA 1TPAE 2VVUA 1EJMA 1X7AC 1TQ0B 4NGAH 1GI6A 2ZG0H 4E7NA 1ELGA 4A5TS 1SR5C 1ZLRA 5AVDA 1NRNH 1P8VC 1KDQB 1MTNB 1GVZA 4MPVA 2IN2A 2ANWA 1K1JA 2O8LA 3AW0A 1C5XB 1WBGB 2ZC9H 2ZO3H 5TJXA 3F9FA 1DVAH 1KXFA 3TJOA 1W0ZU 2BD5A 2HVXA 3O8DA 1O2IA 6GCHG 1YPKH 3GY7A 1IHSH 1MKWK 4NWLA 5ESBA 1YBWA 4IC5A 3ZZAA 3ATIA 1ETTH 1O31A 1RIWB 2ZCKP 1C1RA 1W10U 1ELTA 3V3MA 1ANEA 1T8MA 2QA9E 1TMUH 5A0AE 5F8ZA 2Y81A 3QZRA 2VIPA 2XWBI 2Y5GA 1SGPE 4X6NA 2ZDNA 4CRGA 4CH2B 3RXOA 4LZ1H 1GI3A 2J95A 2W5EA 1T8OA 5JBAS 2AMQA 2ZGXH 1ZRKA 1C2KA 4IS5A 3MH5A 1A61H 4KTUA 2A5AA 5DJ7A 3UQOA 1ELEE 1IHTH 4Q7XA 4B71A 3ZVEA 3ZVAA 1TX6A 2XC4A 3A8DA 3BTKE 3V7TA 2F9BH 1TPSA 3SJ8A 1GBDA 2V0BA 4J1YA 1OXGA 2V3OH 2AMPA 2ZHQH 3TNSA 1GG6B 2BDCA 2F9UA 3GY4A 2K1QA 4UD9H 4I7YH 1FI8A 1P2IA 2ZEBA 1K1PA 2HNTE 3E8LA 4WWYA 1AVWA 1W0YH 1NRSH 1CHGA 4ABHA 1JRTA 3O8RA 4Q7ZA 3ODFA 3VGCB 1IOEA 1O2WA 1O34A 1WTGH 4RSPA 2P59A 3U9AH 1AE8H 3QDZB 1V2TT 3SGAE 4WMFA 5E0JA 3HKIB 5GIBA 2FMJA 1N8OC 3RM0H 5DP9A 1AZZA 3OY5U 3KF2A 1GHYH 1W13U 1DDJA 3Q00A 1ELVA 3MH4A 4X1PU 1K21H 1SL3A 3PV4A 1V2MT 2BYAX 1YPHE 5CHAC 2UWLA 1PQ8A 2PW8H 1C5RA 2ZTXA 3ZZDA 3CS0A 2PKAB 3PO1C 1SGRE 3K2UA 3KQEA 2Z94A 5SGAE 1LCYA 1T7CA 1P0SH 5DGJA 3GY2A 3S9BA 4O3UA 1ETRH 1ARCA 1W14U 2V6NA 4ABDA 4ABGA 2WPKS 1O3CA 4A1VA 1ESBA 1C5TA 5AFYH 1LDTT 1WUNH 4TYDA 2AEIH 2LNCA 1BBRH 2PGQB 1ANCA 3TJVA 3A8AA 1KXBA 3LC3A 1JXPA 3QWCH 1YGCH 1QA7A 1O2HA 2C3SA 5C1UA 2EEKA 1XXDA 1ZJDA 3NCLA 3SGBE 3GCOA 3UY9A 4ABEA 3NPSA 2C93B 1Y3YA 3U8RH 3TK6A 2ZQ2A 1QFKH 5HYOA 4TPIZ 1BHXB 1O3AA 4AFZA 1O3FA 5F03A 3A80A 5FHTA 1GHAG 1UK4A 2TGAA 3SV7A 2OLGA 3MU1A 1O39A 1ZHRA 4CR9A 1GJBB 4D76A 3QGNB 1XKAC 2BLOA 4Y6DA 1P2MA 2VIDA 2J94A 1L0ZA 5A8XA 4OS1A 1LPZB 3IWMA 2TRMA 1NFWA 3TNTA 2R9PA 1J8AA 2BY7X 5BPEA 2CXVA 5EU8A 2GCTC 3TU7H 2VNTA 2BXTH 2BDHA 3MNBA 1Z8IB 5JB8S 4DY7B 2TGPZ 3BTFE 4D7FA 3LU9B 2TGTA 1QB6A 4NA7A 2ZIQH 1TOCB 4BXWA 2Y5HA 3M3VA 4HFPB 2BD2A 2NU0E 3UTUH 1B0FA 2AIPA 4BAQB 3RXBA 1NRPH 5ETXA 2YNAA 2FPZA 3E0NB 4B75A 2WPLS 3KCGH 4HGCA 1O2UA 3RXSA 4X6PA 1IQMA 4AFQA 2P3UB 1FN6A 1LHDH 2FX6A 1ANBA 1WCZA 3QUMP 4OGYA 1C2EA 2O8UA 3RXRA 1O2LA 2FS8A 5DP6A 1FZZA 1CE5A 1TOMH 3A85A 5K0HA 4TY6A 1F0RA 1F2SE 3NK8A 4INKA 4JYUH 1ZPBA 4GVUA 1RFNA 3NUMA 1V2KT 1ZSKA 1HB0B 4NZLA 4ZKOU 1TFXA 3E0PB 2NWNA 4CH8B 3LGIA 2AERH 2HLCA 1P2JA 5EGMA 3UWJH 2P95A 4VGCB 1ZTKA 5T6GA 3SZNA 2Q6DA 1VCWA 1A5IA 1GHZA 3MO6A 4FUFA 1HJ9A 1SOTA 4F4OC 1O2VA 2F9NA 3EE0B 1TMTH 5JB9S 4R0IA 1GJ4H 2CN0H 3VB5A 1O2XA 2Z6BD 1ELAA 1P02A 1S6FA 5C20A 4CHAB 3I77A 3BTHE 3MHWU 1UCYH 5EXLA 3VB7A 5I46H 3DHKH 2AMDA 5GCHG 2AH4X 2HNTF 2SGQE 3SUEA 1V2PT 1NN6A 3T62A 5ESTE 3LGWA 3E90B 2GZ8A 1DSUA 3HK6B 2ODYB 1P57B 2FOFA 4LOYH 3NZIA 1XVMA 3NWUA 3UOUA 5FAHA 2PSYA 4AYVB 1O3PB 1QRXA 3UNQA 1FIZA 3A88A 4X8SH 3OY6U 1P09A 4BTUB 4I32A 1EZUC 3PMBB 2BX3A 3E3TA 3H5CB 4XE4A 1O3GA 1O38A 2AGGX 3SV9A 4RKJB 1GI2A 1TB6H 1HLTH 3QK1A 2ZKSA 3KHVA 4LK4A 1HAGE 2BHGA 2ZCLP 4WVPE 1TMBH 3P70B 1FAKH 1IAUA 1SG8B 1G3DA 2P8OB 1MD8A 4X0WU 1O36A 2PKSC 2JETC 2R0KA 1DX5M 1PPCE 4AB9A 1ARBA 1TA2A 2ZHFH 1SGFG 4GCHF 1TAWA 1MD7A 5T6FA 2P94A 3GICB 4IN2A 2G51A 1W8BH 1E34B 1T8LA 1MTVA 3EA7A 1XUHA 2QIQA 1BRAA 1QQ4A 1P05A 3FANA 4DW2U 5IYTA 1BMLA 1HAIH 1MBQA 1Q3XA 3MH6A 4X8TH 5DK1A 2BD4A 2BY6X 1DWEH 4YT7H 1O0DH 1FAXA 3Q77A 2STAE 2VIOA 2PUXB 1Y5AT 3PB1E 2VH6A 1C5YB 1ELCA 2ZU1A 1YP9A 1GBFA 2GMTB 3C1KA 1C1SA 1Z71A 3TIUA 2ZPSA 4CRFA 9ESTA 2O8TA 3SW2B 2ULLA 4DOQA 4IN1A 1QRZA 2J38A 1BTPA 3BTDE 3UWIA 1BTZA 1JRSA 1ABJH 4Y71A 2ZI2H 1WAYB 2JH6D 3BTME 1FNIA 2ZHEH 4ESTE 3RLYH 1VR1H 4OGXA 1GL0E 1EQ9A 3PROA 3O8CA 2M5TA 2RDLA 1V2VT 2GKVE 2HWLB 1VGCB 3PM3A 4GSOA 5EXNA 8LPRA 3M5MA 2ZFRH 2A0QB 1SQOA 3DFJA 4FVBA 1XUKA 3EYDA 1AGJA 1KXEA 3SNBA 2WPMS 1BMNH 4K1SA 4Z6AH 3MO3A 3A83A 1F7ZA 4CBNA 2UWOA 1KXDA 3ATLA 4U2WA 1VITG 1GBEA 4Y0YE 1FV9A 3P92A 1YCPK 3LIWA 1YKTA 3SJ9A 1J14A 1BOQA 3LH1A 1IQHA 3UIRA 1SLXB 3U98H 1BTWA 2V3HH 4DT7B 2W7UA 1C2GA 1OWIA 2Y80A 4GCHG 1AD8H 3S0NA 2VINA 3BTTE 1T4VH 1C1PA 1DE7H 1S85A 5DP3A 2DE8A 4A92A 1HIAA 1XKBC 1NT1A 4DVAU 1SBWA 2I6QA 1QBNA 4AN7A 5FBEA 1Q31A 3R0FA 1KTSB 4M7GA 6ESTA 1D3DB 1GL1A 1GJDB 3L33A 4ZXYH 1OWJA 4X1QU 2H1UA 1W7XH 1P2NA 4YLQH 3GISB 2QAAA 3L3TA 1DANH 1BTYA 3K6YA 1TA6A 2BVXH 1FIWA 1EUFA 1MBMA 3RC6A 2XW9A 3M7QA 5T3HA 3SHCH 2BVSH 2AS9A 2HRVA 1TRMA 2WUBA 1LQDB 2VIQA 3ENSB 1Z8GA 1BTHH 2Q6FA 2OP9A 4ZROA 1TGBA 1IQFA 8ESTE 1SB1H 3FFGA 3DUXH 4X2YA 2FI4E 3LJJA 5I25A 3BG8A 2J2UA 1CT0E 1F0UA 2H9HA 2ZFTA 2GT7A 7KMEH 2XC0A 1GCDA 1HAOH 1C5PA 1PYTD 1GBIA 1GJAB 2GGVB 5DPAA 4Y0ZE 1H4WA 3P8FA 4F49A 4BAHB 1D3TB 2HALA 1UTMA 2C8ZB 1C9PA 4ZHMU 3RXJA 5HGGA 1C5SA 1SGDE 3LC5A 3BTGE 4FU9A 4B2BA 3HK3B 3ATWA 1BITA 2C4FH 1GGDC 2QXGA 3VB6A 3T28A 1DPOA 3D23A 1MAXA 4K1TA 4DGJA 2GDDA 1ELDE 4CHAC 1S81A 1ZHPA 4YZUA 3SI3H 1UK3A 1HRTH 4Y11E 5L2ZH 1IQIA 2OCVB 2SGPE 1YPLH 3U1IB 1LKAA 2ALPA 3RMMH 3A7ZA 1FMGA 2RA3A 4JZFH 5F8XA 3IG6B 3RU4T 1THRH 4DCDA 3TGKE 4AX9H 1Z1JA 2FOGA 2BMGB 2HOBA 1BUIA 1HCGA 1P03A 4K60A 5GCHF 3VB4A 4VGCC 3TJUA 3DFLA 4UFGH 2AIQA 3STIA 1T8NA 2NU3E 4IBLH 3SNDA 1VZQH 1A46H 1VCPA 3BG4B 3FZDA 2GV7A 2FI5E 1BBRK 1O2SA 3QLPH 4NWKA 1T31A 2VVCA 3V12A 2PKSB 3A7WA 1O3EA 1GI5A 2OUAA 1GBTA 4K8BA 3RXIA 1BRUP 1LHFH 1PPBH 2O9QA 2FX4A 3LGVA 5FPYA 2JETB 1XUJA 1DT2A 2CV3A 1ZMJA 1GBJA 3U8TH 3RMOH 4JZEH 4AZ2B 1NRQH 1KY9A 1AI8H 3U8OH 1O37A 2JKHA 1F92A 1BZXE 3MO9A 3SJIA 3DA9B 2WPJS 3M37A 1K1OA 1B7XB 2TGDA 1HJ8A 4Q7YA 3BV9B 4YT6H 1ZOMA 2BY8X 3SU0A 2P8OC 1ZGVA 2WINI 1NTPA 2QF3A 2A7JA 4K3JA 2BQ6B 1RTFB 1G2MA 1G32B 2ZDAH 3SUFA 3ELAH 2VGCC 3M3TA 4WXIA 1O33A 1ZJKA 1MU6B 3RC4A 4HI3A 3P8NA 1HJAB 2H5DA 2QCYA 4I31A 4ZUHA 2D8WA 3RU4E 4YLUA 5H4IB 1ACBE 3RXAA 1AHTH 3E16B 5G4BA 2Y5FA 3GY8A 3MMGA 1PQ5A 1SMFE 3RMLH 3Q3KA 3M5LA 1P12E 5EW1H 3M5NA 2WUCA 2WYGA 1PPZA 3TPIZ 3FP6E 1TBRH 1F0SA 2CF8H 1MKXK 2FOMB 5C5NA 3A7XA 1KTTB 2ZU2A 3UPEA 1Y3WA 4Y8XA 4ZH8A 3ZVDA 2FYRA 2RA0A 2R2MB 1SFQB 5HM9A 3SO3A 3BTQE 2UUJB 4KGAA 1TNGA 3SU4A 3HPTB 4NA9H 4ABBA 3T5FH 2ZDMA 3SQHE 1FLEE 1C5LH 3SU6A 2ANMH 4E7RG 1UTJA 3M35A 6GCHF 1HAXB 2ASUB 2GDEH 1SGQE 1H9LB 3VGCC 4KTSA 2XBYA 1EAIA 1KYNA 1O3IA 2ODQA 2PFEA 2H9TH 4LZ4B 1L2EA 4ZXXH 1C2DA 2VGCB 1TRNA 4NA8A 2P16A 2FS9A 3CS7A 2OC7A 1EZQA 1NESE 2QYIA 1C1QA 2ZECA 2GV6A 3LGYA 4JYTA 1LVOA 1P2QA 3URCA 3EGKH 1L1JA 1G37A 1SGTA 3V13A 4U30A 2XBXA 1F0TA 1A5HA 1GBLA 1WYKA 5DG6A 3SOSA 1IQEA 1TALA 1XUFA 1P10A 3E6PH 1YPEH 4GHTA 4Y8YA 4MNYA 3A8CA 4U32A 3SU2A 1HAHH 2W3KA 2EI7A 2H2ZA 3TGIE 4X2WA 4H6TA 1SLUB 2AGIX 1IQGA 4BOHA 2BQ7B 1GMCG 9LPRA 1DITH 2OBOA 2P3FH 3QTVH 1V2QT 2BLQA 3AW1A 2OQ5A 4B74A 1B0EA 1UTOA 3B8JA 1O5AB 2ZP0H 2GVFA 1S6HA 2F9OA 2D1JA 1XXFA 1FPCH 1P9UA 1GI9B 3UUZA 4MVNA 1D3QB 1G30B 1GWAA 2QF0A 2SGFE 1QRWA 5A8YA 1UK2A 1OWHA 1HNEE 2ZGCA 2G55A 1H8IH 1MUEB 4K8YA 4KKDA 1ABIH 2PV9B 3GY5A 3A7VA 3RU4D 4AGJA 1NO9H 3P17H 3ZVGA 1SHYA 1UVOA 4H42U 1GGDB 2QV1A 1INCA 1ZSLA 1DXPA 3S9AA 2GX4A 1E0FD 3GCTF 1QB1A 2GCTB 1P01A 2BQWB 4RKOB 5HM2A 3TH4H 3H7OA 3M61U 1QBOA 1OP8A 4NSVA 1YCPH 2Y6TA 3UQVA 1ZYOA 1LHCH 1O3NA 2OC0A 4TWYA 4I8LA 1GHWH 2A2QH 1EZSC 1J15A 1UVTH 5L6NH 1QBVH 2ANKH 1TGSZ 4NIYA 1PPEE 2ZA5A 1HGTH 1FQ3A 4CRDA 1AKSA 1MCTA 1V6DA 2SGDE 3SJOA 1BMAA 3ATKA 2IPHA 4WMDA 3PMJA 1SPJA 4BANB 3MH7A 3RXTA 1L1NA 3U69H 1OP0A 3LGUA 4YM9A 1GI8B 1LPGB 1LVBA 4SGAE 3RXEA 1ESTA 2FI3E 4YOGA 1LVMA 5E0GA 5TCAA 1W2KH 1OOKB 3QX5H 4HTCH 4NSYA 1TGNA 3F9HA 1O2GH 2OBQA 1EAWA 2Y82A 3M3SA 3P8GA 1AWFH 2VH0A 1S0RA 1JOUB 1K1LA 5BRRE 2UUYA 3MNXA 3RXGA 1GMHG 1W11U 1LQEA 1ORFA 3MWIU 3GY6A 3QN7A 3PLKA 1V2WT 2ZFQH 3KQDA 2A7CA 1CA0C 4XSKU 3GCHB 5FXLA 2R2WU 1A3EH 1KXAA 5FBIA 2FESH 2TIOA 4WF8A 1O2YA 1JMOH 1K1MA 1G3EA 2O8MA 1GBKA 3AVZA 1AO5A 1NU7B 1SLWB 2FP7B 4WY3A 4ISLA 1EX3A 2TPIZ 3A84A 1HAYB 1BRBE 1VJ9U 4KTCA 1V2JT 4X2XA 2A32A 1SGNE 3F6UH 1O2ZA 1Q2WA 2FWWA 3T29A 1SSXA 1TPOA 3BN9A 3C27B 3CENA 5F6MA 1BMMH 3VPKA 1GHBG 2C90B 1E37B 3FP8E 3ZZ9A 1A0HB 1BHXF 1OYTH 1P9SA 3LH3A 2JH0D 1HAPH 3GYLB 3D62A 3RLWH 1N8OB 1EASA 1DUAA 1DWCH 1UHBA 2VWLA 1C9TA 2VIVA 1Z8RA 1PJPA 2PTNA 2ZTYA 4ZKRU 3VXFH 2NU1E 3K6ZA 2BZ6H 2AFQB 1O5DH 4AG1A 2HGTH 1MTSA 1YLCA 1K28D 2ZHWH 3FP7E 5CHAB 2BTCE 1O5GH 4FUBA 3TVJB 3KIDU 4FXGH 1TNLA 2XBVA 4Y8ZA 1C5WB 1FJSA 1U6QA 3SU1A 2HPPH 2FYQA 2F9PA 4ABIA 5JDUB 1MTUA 2GCHG 3GYMA 3DD2H 1H8DH 3RMNH 2Z9KA 2Z3DA 3F1SB 2STBE 3SV2H 3KL6A 3B9FH 1AY6H 2SNWA 2ZU5A 1TBZH 2SGEE 1C5MD 2V35A 3RC5A 2FOBA 2FM2A 5C5OA 2OTVA 2QY0B 4A1TA 4D8NA 1XX9A 1GDNA 3RUOA 4JK5A 5DP7A 5LPRA 2A4GA 1L4ZA 1TBQH 4Y7AA 2PWXA 4O9VA 1GCTC 3ITIA 4AFUA 1MZAA 1TIOA 1UTPA 3U1JB 5HMAA 1Y3UA 2QGRA 1HAVB 3MU0A 3PTBA 1AQ7A 1QR3E 1AU8A 4I8GA 4DIHH 4ISHH 1QQUA 1QL7A 5DO4H 1GDQA 1VITF 2EI8A 1CSOE 5FX6A 5FPSA 1GBMA 3S69A 1GJ7B 2C8YB 4WH8A 4XOJA 1NFUA 2D26C 1BJUA 1SC8U 1O3KA 2F91A 3GOVB 1V2ST 1ZZZA 2GT8A 2A5KA 4Y7BA 4WMEA 2W3IA 4Q80A 1UTNA 1AMHA 1V2LT 1K1IA 3KNXA 3TH3H 5LPFA 2J9NA 4YOJA 1J9CH 4Q2KA 4MDSA 2O8WA 3ZVCA 1TNKA 3OYPA 3LGTA 4RN6A 1GHBF 1EPTA 1AB9B 1RTKA 2G4TA 2J92A 2G00A 1TRYA 1GI7B 1SQAA 2ZDVH 1HDTH 1BBRE 4WH6A 1EB2A 2H9EH 3PTNA 2QN5T 4FUJA 1OWKA 1Z6JH 4R8TB 1OYQA 2A7HA 3S9CA 3EA9A 1HPGA 3SUGA 4JYVH 3W95A 2Z3EA 1LMWB 1ZRBA 2BOKA 3OTJE 2ZDKA 2XTTB 3SORA 1TLDA 2WV4A 1GMHF 1QNJA 1IQLA 1C2JA 5EODA 1NFYA 1RS0A 4ZKNU 2F83A 2GP9B 4ISOA 3OU0A 1GG6C 3RXCA 3JZ2B 1D6WA 4UONA 3B23B 2THFB 3FZZA 1A1RA 5C2ZA 1MZDA 2HPQH 1W3CA 4FUIA 2BLVA 1L4DA 4J2YB 1C1NA 2VVVA 1EOLA 1O5EH 2CHAB 1FPHH 4AOQA 3ESTA 4X1NU 1HYLA 4A6LA 2FO9A 4ZAEA 3SI4H 5JPMH 1CBWB 1KLIH 4JK6A 3GCTG 2ZU4A 2QXHA 1EAXA 2RCEA 1C5NH 1GI0A 2CGAA 1G3BA 3HKJB 3ZZ5A 2B5TB 2P93A 1CVWH 1E36B 2TBSA 1MMJN 3BF6H 3MU5A 1LTOA 2C8WB 2ZFPH 1YPMH 4ASHA 1C1WH 2ZGBH 1SGYE 1MKXH 2NU2E 1A0LA 1YPHC 2FEQH 2BD8A 1IQKA 4B76A 1OPHB 3SGQE 2C8XB 2SFAA 2ZDLA 3V0XA 1PQ7A 3FVFB 4WJG2 1N6XA 1GJ5H 4JZDH 5EG4A 6CHAC 2B9LA 5A0CA 2BY9X 2XNIA 3PYHA 5GJ4B 3ZZCA 1FY8E 1Y8TA 2ZFFH 1DXWA 1EP5A 1GVKB 1OKXA 1C4V2 5EQRA 6LPRA 4MTBA 1O2PA 1SOZA 5FCKA 1OX1A 3T25A 1SGCA 2QC2A 3F9GA 4BTIB 4H4FA 7LPRA 4I8JA 1MTNC 5FX5A 4OS4A 1TNIA 2P3TB 1HV7A 1QL9A 1QIXB 2ZWLH 3P8OA 4XBBA 3RXLA 1E38B 1MQ5A 5C67A 1KXCA 4WXVA 3VEQB 4XBCA 1SHHB 3PWBA 1NRRH 3UOPA 2HNTC 2OINA 1EB1H 4YTAA 1VCQA 1RJXB 1D4PB 4CRCA 2G81E 2RG3A 1CHOG 1LKBA 2G4UA 4B2AA 1G2LA 1O5FH 1EJNA 3RXMA 1JBUH 1S0QA 2ZQ1A 1VITH 1YYY1 8KME2 2R3YA 3SNAA 4UFFH 1G36A 1V2NT 4B73A 4ABJA 3ATMA 1D9IA 4MNWA 3PWCA 4ISIH 4BAMB 2F3CE 3SU3A 1V3XA 3A89A 3GCHC 3I78A 2A31A 5C1YA 2KAIB 1NM6A 3LPRA 4JMYA 3ZYEA 3ODDA 4INHA 4INLA 4NFFA 4ZHAA 2PSXA 3QTOH 4MLFB 3QO6A 2WYJA 1BT7A 4A7IB 3D65E 3A82A 1IQJA 1DFPA 4ISNA 4GUXA 3RDZA 1A3BH 2YNBA 3TK5A 1S83A 1O2KA 2DUCA 1ZTJA 1UVPA 3HGPA 4CRAA 1RIWC 1HIAB 3UREA 1ESAA 3A86A 1EKBB 5A8ZA 3AAUA 1A7SA 4FUCA 3VB3A 1GMCF 1V2RT 1YC0A 2BD9A 2XCFA 1VJAU 4MNVA 1CQQA 1P06A 3NXPA 2ZHDA 1O3MA 1QGFA 2GCHF 2XC5A 4B2CA 2ZPQA 2PUQH 1CT4E 4HZHA 1P3EA 2F9VA 1FY3A 5B6OA 1CA8B 1NS3A 3TJNA 2KAIA 1SGFA 5HXFA 3GCNA 4OS7A 3TK9A 2BB4A 3CP7A 4BAKB 4ABAA 1FY5A 5DP5A 1O3HA 5IDKA 1C2FA 1O3OA 3A7TA 3W94A 4XFQA 2BM2A 3EA8A 1HAZB 1ZTLA 4BTTB 3M5OA 4IC6A 4NZQA 5E2OA 1ZPCA 4MPUA 1O3LA 1SI5H 4IW4E 4X8VH 2PGBB 4DURA 2VB0A 4ABFA 2BDBA 1P2KA 1TX7A 1O32A 4NIVA 1C4U2 2J34A 1MH0A 3K65B 4NG9H 4NCYA 5DP4A 2PLXA 4OS5A 3GDVA 1AIXH 1ZGIA 4GPGA 1F5LA 4YOIA 4NFEA 1SVPA 1Y3XA 1THSH 1ZSJA 1YPGH 4MPWA 3OX7U 3LDXH 1ETSH 1NU9A 1ZR0A 3PO1B 2FOEA 4E06H 1UTLM 4X8UH 2H6MA 2Z9IA 1RGQA 3S7HB 1BA8B 3K9XB 2ZFSA 1QL8A 1DWDH 1HJAC 1H9IE 2FTMA 1CGJE 2VWOA 2JH5D 1P04A 1UTKA 3E91A 1LHGH 2PHBA 4IMZA 3RXFA 1OSSA 3MI4A 4UFEH 1Z1IA 3N7OA 4B1TA 3SBKA 5ABWA 3R3GB 4D7GA 5JBCS 3SJKA 4UDWH 3UNSA 3M7UA 4BNRA 3L6PA 1K9OE 2BD3A 3GY3A 3KN2A 1C1VH 2Z9JA 2ESTE 3MU4A 1CHOF 2B8OH 1AUJA 3RXHA 5FCRA 1DY8A 1O2TA 4D9QA 3MFJA 3JZ1B 2VJ1A 4AORA 4DG4A 2AGEX 1W12U 1SGIB 1GI1A 1WTHD 5E2PA 1QJ1B 1GHXH 1EAUA 1Y3VA 4I33A 1N1LA 3A87A 3T26A 3RXKA 4FUGA 2UWPA 3ZYDA 1GVLA 3RXVA 1GJCB 4YO9A 5PTPA 3SNEA 3T27A 2H5CA 2GMTC 1BTXA 2SGAA 1O3BA 2GZ9A 1BJVA 1E35B 5GDSH 2FOHA 1O2NA 2EC9H 2R0LA 2FZZA 1PPGE 1T4UH 2CMYA 4THNH 3ZZ7A 1O2JA 2CHAC 1C5VA 1HAVA 1TX8A 1WQSA 3AAVA 4CREA 4DJZB 1C1OA 1W7GH 1ZMLA 4GLYA 2FIRH 1A4WH 4MNXA 2WPIS 5DP8A 3AASA 3SU5A 1C5ZB 1BB0B 1A0JA 1DY9A 2A4RA 1HFDA 2FTLE 3VFEA 2YOLA 1MU8B 3RM2H 2FDAA 2WPHS 1TONA 3WY8A 4BXSA 1S84A 1KIGH 2FXRA 1ANDA 2IOTA 1OWEA 4ZHLU 2Y7XA 1DS2E 2XBWA 3UFAA 1QB9A 3BG4C 4FUEA 3ZZ6A 1KSNA 1NFXA 1GI4A 1MCVA 1LPKB 1SLVB 4FU7A 4O3TA 1NROH 1JWTA 3LOXA 4CBOA 1O5BB 1AZ8A 3MNSA 2OQUA 3MU8A 8GCHF 4H6SB 3PLPA 1Z7KA 4O97A 1J16A 7ESTE 4TWWA 3LKWA 1UHBB
chains in the Genus database with same CATH superfamily
3I29A 1H1BA 1CGHA 1GHAF 5EW2H 1Z8JB 3MNCA 1C1UH 1FY4A 3OE7D 3IITA 5CMXH 1O3DA 4I8KA 2FLRH 3UB0A 2XWAA 5C3NA 1RXPA 2BX4A 2Z9LA 1O30A 2R3UA 3SV6A 1P11E 3MTYA 1YM0A 1DICA 1YCPM 1MKWH 3WWBA 1GDUA 3M7TA 4CR5A 5FPTA 3VXEH 1FN8A 4B6FA 1QURH 3OFND 3KYFA 3VG8A 2W26A 1Y59T 1V2OT 2G5VA 2G5NA 1WSSH 3OSYA 3TH2H 1PYTC 4Y79A 3P6ZB 1QJ6B 3BEIB 3BIVH 1BCUH 1TYNA 1C5UA 1C1MA 3F68H 4JZ1A 1AVGH 3SN8A 4I8HA 3TITA 1NZQH 1RRKA 3UR6A 2Z9GA 3A7YA 1AFEH 1ID5H 1TE0A 1F5KU 4Z0KA 1N6YA 3MOCA 5L2YH 4D9RA 5E8EH 1GMDG 1GBHA 4MPXA 5FL7D 1CA0B 1DLKB 4PROA 1QY6A 1H9HE 1A5GH 1SKYE 1UCYK 1ZPZA 2YMSB 1TPPA 1PPHE 2WV5A 2UUKB 1IQNA 1XUGA 1JIMA 2V3MA 3EDXB 4IMQA 4TY7A 2PKAA 2QF5A 1GJ9B 3DT0H 5AF9H 1DWBH 1CO7E 3OAAD 2FOAA 1WU1A 1C2MA 4AFSA 2ZTZA 1NY22 2GJGA 1WQVH 3RP2A 2W6JD 2Z3CA 5A2MH 1THPB 2AYWA 3PMAB 1XVOA 1EZXC 1UMAH 2XXLA 4UE7H 2HVYB 5C94A 1RTLA 3KEEA 1EPTC 4Y76A 4X2VA 2EA3A 1C5OH 5AHGH 4TT3D 2CF9H 2BDAA 1O5CB 3OEED 3MYWA 3UNRA 5DSFA 2HLDD 1PQAA 2BDYA 3FAOA 1ZMNA 2A45B 4XDEA 2XCNA 2ZGHA 4X1RU 1A2CH 1O2MA 5DKMA 5GPIB 3KQ5A 1C4Y2 4NIXA 1C2IA 1D6RA 3LONA 1NBMD 3Q76A 4K5ZA 2FODA 5LPEA 5K7RA 3URDA 3F2FA 1C2LA 4O03A 4U01A 1LO6A 5JBTA 4NIWA 3TLOA 2WV9A 2A2XH 1GBBA 2BVRH 3EAJA 3ZVFA 2DE9A 1J17T 4K1EA 2W7SA 2GTBA 5TCCA 2VIWA 3SNCA 5L30H 3RXPA 1O2QA 4E05H 2FLBH 3BSQA 1DSTA 2BD7A 2XRCA 1F5RA 3HGNA 3M36A 1AN1E 3RXQA 7GCHG 1V2UT 2OD3B 1UW7A 1JIRA 4FUDA 1S82A 3STJA 3ZVBA 1DOJA 1HXFH 1NC6A 2ZPRA 1TGCA 1C5QA 1CGIE 1G3CA 2A5IA 2ALVA 2BZAA 4BAOB 1FDPA 2A1DB 4MG3A 5E0HA 1MQ6A 3DCLA 1EOJA 2ZCHP 5J4QA 4K69A 3SV8A 1NPMA 3ZZ4A 1K22H 5KEDA 3P95A 5EPYA 3LT3A 4X6MA 1UJ1A 3WW7A 1VGCC 3ZZ8A 4TPYA 1VKYA 1RD3B 5GXPA 4ZMAH 3GDSA 1O3JA 2NU4E 3BEFB 1YPJH 1Y5UT 1MTWA 2FOCA 1MAYA 2ZZUH 3NKKA 4X6OA 4FVDA 1TNJA 2OXSA 1UO6A 3E1XB 1PFXC 5J4SA 1QHRB 1OS8A 1EATA 1WV7H 2D2DA 2KFWA 3HATH 4JZIA 1DUEA 4MQAA 3RXUA 1GJ6A 5A0BA 1EP6A 1GCTB 1LVYA 3EQ0H 1QA0A 1T32A 3KGPA 5JYIA 2J4IA 4CRBA 1C2HA 1BQYA 1AFQC 1OWDA 1AB9C 4Y10E 1FY1A 3KQCA 2BXUH 4XBDA 2BDIA 3A8BA 1FUJA 2PTCE 1G9IE 2QXIA 2B7DH 4ZCNA 4A1XA 5EOKA 1XM1A 5HIYA 1KLTA 1SQTA 1O2OA 4K2YA 4GHQA 1M9UA 5EXMA 3SZEA 3PLBA 1GBAA 3Q3XA 5AFZH 3S7KB 1Z6EA 3G01A 3ZZ3A 4UFDH 2ODPA 1TABE 3O8BA 1AKSB 1ELFA 1TWXB 2VU8E 2W6ID 2G8TA 1TGTA 2Y7ZA 1TQ7B 4OS2A 2F43B 3Q3YA 1QTFA 3TGJE 3BEUA 7GCHF 1KLJH 1EJAA 2Q1JA 3ZV8A 3T2NA 2G52A 1DLEA 3H7TA 1TNHA 3BIUH 4JCNA 3KYGA 1PPFE 3LJOA 3ZV9A 4KELA 5C1XA 2IPQX 5CE1A 1D3PB 4FUHA 3PMHB 2Q6GA 1OP2A 4FOUC 1O2RA 1ELBA 1SFIA 2ZNKH 3BTWE 1UVSH 5EQQA 1HUTH 3A81A 2ZU3A 2EI6A 5EPNA 2ZF0H 1AE5A 4IGDA 2BLWA 4AG2A 1WOFA 4QT8C 1BIOA 2QXJA 4AGKA 5A09A 2ANYA 1GJ8B 1GBCA 1ZHMA 3F9EA 8GCHG 1L1GA 5JBBS 5F8TA 5LH8A 3GDUA 4UEHH 1P3CA 1SGEE 3MQKC 1AVXA 4ZKSU 3ZZBA 1AFQB 2BY5X 2VWMA 1BDAA 1AUTC 2VWNA 4DIIH 2KCYA 1HXEH 3UR9A 4GAWA 1CT2E 1XMNB 2Z7FE 4Z1MD 2UUFB 1BRCE 1P2OA 4AB8A 2PR3A 4YESB 1GPZA 2LPRA 3SQEE 1HBTH 2ILNA 2XYAA 4AYYB 2AHME 1K1NA 2A4OA 1EXFA 5EQSA 5LGOA 1XUIA 2IJOB 2OC1A 3QGJA 2ZGJA 2CJIA 1FXYA 1YF4A 4FU8A 4KP0A 1Y5BT 1CBWC 2B0FA 1UVUH 2BDGA 1AWHB 1CU1A 2KM0A 1C1TA 2OC8A 1FONA 1LHEH 1OHHD 1BTUA 1DM4B 2SNVA 3D49H 1QJ7B 4OS6A 1UCYE 1O35A 1UTQA 4LXBH 4SGBE 3F0PA 2GZ7A 3BTEE 1YLDA 1B5GH 2A4QA 6CHAB 2GD4B 3KQBA 1QCPA 1GMDF 3SUDA 2I6SA 4X1SU 1GHVH 1H8HD 1K2I1 1EPTB 1S5SA 3QZQA 5GWZA 1KDQA 3SHAH 5T6DA 2BOHB 3RXDA 1TPAE 2VVUA 4FETA 1EJMA 1X7AC 1TQ0B 4NGAH 1GI6A 2ZG0H 4E7NA 1ELGA 4A5TS 1SR5C 1ZLRA 5AVDA 1NRNH 1P8VC 1KDQB 1MTNB 1GVZA 4MPVA 2IN2A 2ANWA 1K1JA 2O8LA 3AW0A 1C5XB 1WBGB 3GS9A 2ZC9H 2ZO3H 5TJXA 3F9FA 1DVAH 1KXFA 3TJOA 1W0ZU 2BD5A 2HVXA 3O8DA 1O2IA 6GCHG 1YPKH 3GY7A 1IHSH 2J5UA 1MKWK 4NWLA 5ESBA 1YBWA 1W0JD 3F0OA 4IC5A 3ZZAA 2QE7D 3ATIA 1ETTH 1O31A 1RIWB 2ZCKP 1C1RA 1W10U 1ELTA 4XRNA 3V3MA 1ANEA 4P02A 1T8MA 2QA9E 1TMUH 5A0AE 5F8ZA 2Y81A 3QZRA 2VIPA 2XWBI 2Y5GA 1SGPE 4X6NA 2ZDNA 4CRGA 4CH2B 3RXOA 4LZ1H 1GI3A 2J95A 1T8OA 2W5EA 5JBAS 5C0TA 2AMQA 2XOKD 2ZGXH 1ZRKA 1C2KA 4IS5A 3MH5A 1A61H 4KTUA 2A5AA 5DJ7A 3UQOA 1ELEE 1IHTH 2L74A 4Q7XA 4B71A 3ZVEA 3ZVAA 1TX6A 2XC4A 3A8DA 3SYJA 3BTKE 3V7TA 2F9BH 1TPSA 3SJ8A 1GBDA 2V0BA 4J1YA 1OXGA 2V3OH 2AMPA 2ZHQH 3TNSA 1GG6B 2BDCA 2F9UA 3GY4A 2K1QA 4UD9H 4I7YH 1FI8A 1P2IA 2ZEBA 1K1PA 2HNTE 3E8LA 4WWYA 1AVWA 1W0YH 1NRSH 1CHGA 4ABHA 1JRTA 3O8RA 4Q7ZA 3ODFA 3VGCB 1IOEA 3DSPA 1O2WA 1O34A 1WTGH 4RSPA 2P59A 3U9AH 1AE8H 3QDZB 1V2TT 3SGAE 4WMFA 5E0JA 3HKIB 5EJZA 5GIBA 2FMJA 1N8OC 3RM0H 5DP9A 1AZZA 3OY5U 3KF2A 1GHYH 1W13U 1DDJA 3Q00A 1ELVA 3MH4A 4X1PU 4I86A 1K21H 1SL3A 3PV4A 1V2MT 2BYAX 1YPHE 5CHAC 2UWLA 2EQNA 1PQ8A 2PW8H 1C5RA 2ZTXA 3ZZDA 3CS0A 2PKAB 3PO1C 1SGRE 3K2UA 3KQEA 2Z94A 5KGOA 5SGAE 1LCYA 1T7CA 1P0SH 5DGJA 3GY2A 3S9BA 4O3UA 1ETRH 1ARCA 1W14U 2V6NA 4ABDA 4ABGA 2WPKS 1O3CA 4A1VA 1ESBA 1C5TA 5AFYH 1LDTT 1WUNH 4TYDA 2AEIH 1WXRA 2LNCA 1BBRH 2PGQB 1ANCA 3TJVA 3A8AA 1KXBA 3LC3A 1JXPA 3CNRA 3N99A 3QWCH 1YGCH 1QA7A 1O2HA 2C3SA 5C1UA 2EEKA 1XXDA 1ZJDA 1COWD 3NCLA 3SGBE 3GCOA 3UY9A 4ABEA 3NPSA 2C93B 1Y3YA 3U8RH 3TK6A 2ZQ2A 1QFKH 5HYOA 4TPIZ 1BHXB 1O3AA 4AFZA 1O3FA 5F03A 3A80A 5FHTA 1GHAG 1UK4A 2J97A 2TGAA 3SV7A 2OLGA 3MU1A 1O39A 1ZHRA 4CR9A 1GJBB 4D76A 3QGNB 1XKAC 2BLOA 4Y6DA 1P2MA 2VIDA 2J94A 1L0ZA 5A8XA 4OS1A 1LPZB 3IWMA 2TRMA 1NFWA 3TNTA 2R9PA 1J8AA 2BY7X 5BPEA 2CXVA 1E1RD 5EU8A 2GCTC 3TU7H 2VNTA 2BXTH 2BDHA 3MNBA 1Z8IB 2OK5A 2XNDD 5C0UA 4DY7B 2TGPZ 3BTFE 4D7FA 2WSSD 2TGTA 3LU9B 1QB6A 4NA7A 2ZIQH 1TOCB 3PRDA 2KZ4A 3PV2A 4BXWA 2Y5HA 3M3VA 4HFPB 2BD2A 4ACAA 2NU0E 3NRLA 3UTUH 1B0FA 2AIPA 4BAQB 2PP6A 3RXBA 1NRPH 5ETXA 2YNAA 2FPZA 3E0NB 4B75A 2WPLS 3KCGH 4HGCA 1O2UA 1KMHB 3RXSA 4X6PA 1IQMA 4AFQA 2P3UB 1FN6A 1LHDH 2FX6A 1ANBA 1WCZA 3QUMP 4OGYA 3EE7A 1C2EA 2O8UA 3RXRA 1O2LA 2FS8A 5DP6A 1FZZA 1CE5A 1TOMH 1E79D 3A85A 5K0HA 4TY6A 1F0RA 1F2SE 3NK8A 4INKA 4JYUH 1ZPBA 3DSOA 4GVUA 1RFNA 2KCPA 3NUMA 1V2KT 1ZSKA 3OEHD 1HB0B 4NZLA 4ZKOU 1TFXA 1S6LA 3E0PB 2NWNA 4CH8B 3LGIA 2AERH 2HLCA 1P2JA 5EGMA 3UWJH 2P95A 4VGCB 1ZTKA 5T6GA 3SZNA 2Q6DA 1VCWA 1A5IA 1GHZA 3MO6A 4FUFA 1HJ9A 1SOTA 4F4OC 1O2VA 2F9NA 3EE0B 4RT1A 2F4LA 1TMTH 5JB9S 4R0IA 1GJ4H 2CN0H 3VB5A 1O2XA 2Z6BD 1ELAA 1P02A 5CDFE 1S6FA 5C20A 4CHAB 3I77A 3BTHE 3MHWU 1UCYH 5EXLA 3VB7A 5I46H 3DHKH 2AMDA 5GCHG 2AH4X 2HNTF 2SGQE 3SUEA 1V2PT 1NN6A 3T62A 5ESTE 3LGWA 3E90B 2GZ8A 1DSUA 3HK6B 2ODYB 1P57B 2FOFA 4LOYH 3U28C 3NZIA 1XVMA 3NWUA 3UOUA 5FAHA 2PSYA 4AYVB 1O3PB 1QRXA 3UNQA 1FIZA 3A88A 4X8SH 3OY6U 1P09A 4BTUB 4I32A 1EZUC 3PMBB 2BX3A 3E3TA 3H5CB 4XE4A 1O3GA 1O38A 2AGGX 3SV9A 4RKJB 1GI2A 1TB6H 1HLTH 3QK1A 2ZKSA 3KHVA 4LK4A 1HAGE 2BHGA 2ZCLP 4WVPE 1TMBH 3P70B 1FAKH 1IAUA 1SG8B 1G3DA 2P8OB 1MD8A 4X0WU 1O36A 2PKSC 5EIYA 2JETC 2R0KA 1DX5M 1PPCE 4AB9A 1ARBA 1TA2A 2ZHFH 1SGFG 4GCHF 1TAWA 1MD7A 5T6FA 2P94A 3GICB 4IN2A 2G51A 1W8BH 1E34B 1T8LA 1MTVA 3EA7A 1XUHA 2QIQA 1BRAA 1QQ4A 1P05A 3FANA 4DW2U 5IYTA 1BMLA 1HAIH 1MBQA 1Q3XA 3MH6A 4X8TH 5DK1A 2BD4A 2BY6X 1DWEH 4YT7H 1O0DH 1FAXA 3Q77A 5EJ1A 2STAE 2VIOA 2PUXB 1Y5AT 3PB1E 2VH6A 1C5YB 1ELCA 2ZU1A 1YP9A 1GBFA 2GMTB 1K0HA 3C1KA 1C1SA 1Z71A 3TIUA 2ZPSA 4CRFA 9ESTA 2O8TA 3SW2B 2ULLA 4DOQA 3PV5A 4IN1A 1QRZA 1WDIA 2J38A 1BTPA 3BTDE 3UWIA 1BTZA 1JRSA 1ABJH 4Y71A 2ZI2H 1WAYB 2JH6D 3BTME 1FNIA 2ZHEH 4ESTE 3RLYH 1VR1H 4OGXA 1GL0E 1EQ9A 3PROA 3O8CA 2M5TA 2RDLA 1V2VT 2GKVE 2HWLB 1VGCB 3PM3A 4GSOA 5EXNA 8LPRA 3M5MA 2ZFRH 2A0QB 1SQOA 3DFJA 4FVBA 1XUKA 3EYDA 1AGJA 1KXEA 3SNBA 2WPMS 1BMNH 4K1SA 4Z6AH 3MO3A 3A83A 1F7ZA 4CBNA 2UWOA 1KXDA 3ATLA 4U2WA 1VITG 1GBEA 4Y0YE 1FV9A 3P92A 1YCPK 3LIWA 2RFKC 1YKTA 3SJ9A 1J14A 1BOQA 3LH1A 1IQHA 3UIRA 1SLXB 2VBCA 3U98H 1YLNA 1BTWA 2V3HH 4DT7B 2W7UA 1C2GA 1OWIA 2Y80A 4GCHG 1AD8H 3S0NA 2VINA 3BTTE 1T4VH 1C1PA 1DE7H 1S85A 5DP3A 2DE8A 4A92A 1HIAA 1XKBC 1NT1A 4DVAU 1SBWA 2I6QA 1QBNA 4AN7A 5FBEA 1Q31A 3R0FA 1KTSB 4M7GA 4RT0A 6ESTA 1D3DB 1GL1A 1GJDB 3L33A 4ZXYH 1OWJA 4X1QU 2H1UA 1W7XH 1P2NA 4YLQH 3GISB 2QAAA 3L3TA 1DANH 1BTYA 3K6YA 1BMFD 5IK2D 1TA6A 2BVXH 1FIWA 1EUFA 1MBMA 3RC6A 2XW9A 3M7QA 5T3HA 3SHCH 2BVSH 2AS9A 2HRVA 1TRMA 2WUBA 3UAIC 1LQDB 2VIQA 3ENSB 1Z8GA 2KCAA 1BTHH 2Q6FA 2OP9A 4ZROA 1TGBA 1IQFA 8ESTE 2YMSC 1SB1H 3FFGA 3DUXH 4X2YA 2FI4E 2JIZD 3LJJA 5I25A 3BG8A 2J2UA 1CT0E 1F0UA 2H9HA 5C17A 2ZFTA 2GT7A 7KMEH 2XC0A 1GCDA 1HAOH 1C5PA 1PYTD 1GBIA 1GJAB 2GGVB 5DPAA 4Y0ZE 1H4WA 5HKKD 3P8FA 4F49A 4BAHB 1D3TB 2HALA 1UTMA 2C8ZB 1C9PA 4ZHMU 3RXJA 5HGGA 1C5SA 1SGDE 3LC5A 3BTGE 3DSGA 4FU9A 4B2BA 3HK3B 3ATWA 1BITA 2C4FH 1GGDC 2QXGA 3VB6A 3T28A 1DPOA 3D23A 1MAXA 4K1TA 4B6EA 4DGJA 2GDDA 1ELDE 4CHAC 1S81A 1ZHPA 4YZUA 3SI3H 1UK3A 1HRTH 4Y11E 5L2ZH 1IQIA 2OCVB 2SGPE 1YPLH 3U1IB 1LKAA 2ALPA 3RMMH 3A7ZA 1FMGA 2RA3A 4JZFH 5F8XA 3IG6B 3RU4T 1THRH 4DCDA 3TGKE 4AX9H 1Z1JA 2FOGA 2BMGB 2HOBA 1BUIA 1HCGA 1P03A 4K60A 5GCHF 2JJ1D 4VGCC 3VB4A 3TJUA 3DFLA 4UFGH 2AIQA 3STIA 1T8NA 2NU3E 4IBLH 3SNDA 1VZQH 1A46H 1VCPA 3BG4B 3FZDA 2GV7A 2FI5E 1BBRK 1O2SA 3QLPH 3FO8D 2EY4C 4NWKA 1T31A 2VVCA 3V12A 2PKSB 3A7WA 1O3EA 1GI5A 2OUAA 1GBTA 4K8BA 3RXIA 1BRUP 2WZQA 1LHFH 1PPBH 2O9QA 2FX4A 3LGVA 5FPYA 2JETB 1XUJA 1DT2A 2CV3A 1ZMJA 1GBJA 3U8TH 3RMOH 4JZEH 4AZ2B 1SQRA 1NRQH 1KY9A 1AI8H 3U8OH 1O37A 2JKHA 1F92A 1BZXE 3MO9A 3SJIA 3DA9B 2WPJS 3M37A 1K1OA 1B7XB 2TGDA 1HJ8A 4Q7YA 3BV9B 4YT6H 2QF4A 1ZOMA 2BY8X 3SU0A 2P8OC 1ZGVA 2WINI 1NTPA 2QF3A 4F55A 2A7JA 4K3JA 2BQ6B 1RTFB 1G2MA 1G32B 2ZDAH 3SUFA 3ELAH 2VGCC 3M3TA 4WXIA 1O33A 2IJD1 1ZJKA 4P00A 1MU6B 3RC4A 4HI3A 3P8NA 1HJAB 2H5DA 2QCYA 4I31A 4ZUHA 2D8WA 3RU4E 4YLUA 5H4IB 1ACBE 3RXAA 1AHTH 3E16B 5G4BA 2Y5FA 3GY8A 3MMGA 1PQ5A 1SMFE 3RMLH 3Q3KA 3M5LA 1P12E 5EW1H 3M5NA 2WUCA 2WYGA 1PPZA 3TPIZ 5JB8S 3FP6E 1TBRH 1F0SA 2CF8H 1MKXK 2FOMB 5C5NA 3A7XA 1KTTB 2ZU2A 3UPEA 1Y3WA 4Y8XA 4ZH8A 3ZVDA 2FYRA 2RA0A 2R2MB 1SFQB 2KR7A 5HM9A 3SO3A 3BTQE 2UUJB 4KGAA 1TNGA 3SU4A 3HPTB 4NA9H 4ABBA 3T5FH 2ZDMA 3SQHE 1FLEE 1C5LH 3SU6A 2ANMH 4E7RG 1UTJA 3M35A 3OTPA 6GCHF 1HAXB 2ASUB 2GDEH 1SGQE 1YY3A 1H9LB 3VGCC 4KTSA 2XBYA 1EAIA 1KYNA 1O3IA 2ODQA 2PFEA 2H9TH 4LZ4B 1L2EA 4ZXXH 1C2DA 2VGCB 1TRNA 4NA8A 2P16A 2FS9A 3CS7A 2OC7A 1EZQA 1NESE 2QYIA 1C1QA 2ZECA 2GV6A 3LGYA 3PRBA 4JYTA 1LVOA 1P2QA 3URCA 3EGKH 1L1JA 1G37A 1SGTA 3V13A 4U30A 2XBXA 1F0TA 1A5HA 1GBLA 1WYKA 5DG6A 3SOSA 1IQEA 1TALA 1XUFA 1P10A 3E6PH 1YPEH 4GHTA 4Y8YA 4MNYA 3A8CA 4U32A 3SU2A 1HAHH 2W3KA 2EI7A 2H2ZA 3TGIE 4X2WA 4H6TA 1SLUB 2AGIX 1IQGA 3H09A 4BOHA 2BQ7B 1GMCG 9LPRA 1DITH 2OBOA 2P3FH 2K0QA 3QTVH 1V2QT 2BLQA 3AW1A 2OQ5A 4B74A 1B0EA 1UTOA 3B8JA 1O5AB 2ZP0H 2GVFA 1S6HA 2F9OA 2D1JA 1XXFA 1FPCH 1P9UA 1GI9B 3UUZA 4MVNA 1D3QB 1G30B 1GWAA 2QF0A 2SGFE 1QRWA 5A8YA 1UK2A 1OWHA 1HNEE 2ZGCA 2G55A 1H8IH 1MUEB 4K8YA 4KKDA 1ABIH 2PV9B 3GY5A 3A7VA 3RU4D 4AGJA 1NO9H 3P17H 3ZVGA 1SHYA 1UVOA 4H42U 1GGDB 2QV1A 1INCA 1ZSLA 1DXPA 3S9AA 2GX4A 5F53A 1E0FD 3GCTF 1QB1A 2GCTB 1P01A 2LP6A 2BQWB 4RKOB 5HM2A 3TH4H 3H7OA 3M61U 1QBOA 1OP8A 4NSVA 1YCPH 2Y6TA 3UQVA 1ZYOA 1LHCH 1O3NA 2OC0A 4TWYA 4I8LA 3F2GA 1GHWH 2A2QH 1EZSC 1J15A 1UVTH 5L6NH 1QBVH 2ANKH 1TGSZ 4NIYA 1PPEE 2ZA5A 1HGTH 1FQ3A 4CRDA 1AKSA 1MCTA 1V6DA 2SGDE 1YWUA 3SJOA 1BMAA 3ATKA 2IPHA 4WMDA 3PMJA 1SPJA 4BANB 3MH7A 4ASUD 3RXTA 1L1NA 3U69H 1H8ED 1OP0A 3LGUA 4YM9A 1GI8B 1LPGB 1LVBA 4SGAE 3RXEA 1ESTA 2FI3E 4YOGA 1LVMA 5E0GA 4M9FA 5TCAA 1W2KH 1OOKB 3QX5H 4HTCH 4NSYA 2WHXA 4F48B 1TGNA 3F9HA 1O2GH 2OBQA 1EAWA 2Y82A 3M3SA 3P8GA 1AWFH 2VH0A 1S0RA 1JOUB 1K1LA 5BRRE 2UUYA 3MNXA 3RXGA 1GMHG 1W11U 1LQEA 1ORFA 3MWIU 3GY6A 3QN7A 3PLKA 1V2WT 2ZFQH 3KQDA 2A7CA 1CA0C 4XSKU 3GCHB 5FXLA 2R2WU 1A3EH 1KXAA 5FBIA 2FESH 2TIOA 3FKSD 4WF8A 1O2YA 1JMOH 1K1MA 1G3EA 2O8MA 1GBKA 3AVZA 1AO5A 1NU7B 1SLWB 2FP7B 4WY3A 4ISLA 1EX3A 2TPIZ 3A84A 5DN6D 1HAYB 1BRBE 1VJ9U 4KTCA 1V2JT 4X2XA 2A32A 1SGNE 3F6UH 2RDEA 1O2ZA 1Q2WA 2FWWA 3T29A 1SSXA 1TPOA 3BN9A 3C27B 3CENA 5F6MA 1BMMH 3VPKA 1GHBG 2C90B 1E37B 3FP8E 3ZZ9A 1A0HB 1BHXF 2KCOA 1OYTH 1P9SA 3LH3A 2JH0D 1HAPH 3GYLB 3D62A 3RLWH 1N8OB 1EASA 1DUAA 1DWCH 1UHBA 1C9TA 1Z8RA 2VIVA 2VWLA 1PJPA 2PTNA 2ZTYA 4ZKRU 3VXFH 2NU1E 3K6ZA 2BZ6H 2AFQB 1O5DH 5B6LA 4AG1A 4Q4LA 2HGTH 1MTSA 1YLCA 1K28D 2ZHWH 5EJLA 3FP7E 5CHAB 2BTCE 1O5GH 4FUBA 3TVJB 3KIDU 4FXGH 1TNLA 2XBVA 4Y8ZA 1C5WB 1FJSA 1U6QA 3SU1A 2HPPH 2FYQA 2F9PA 4ABIA 5JDUB 1MTUA 2GCHG 3GYMA 3DD2H 1H8DH 3RMNH 2Z9KA 2Z3DA 3F1SB 2STBE 3SV2H 3KL6A 3B9FH 1AY6H 3ZIAD 2SNWA 2ZU5A 1TBZH 2SGEE 1C5MD 2V35A 3RC5A 2FOBA 2FM2A 5C5OA 2OTVA 2QY0B 4A1TA 4D8NA 1XX9A 1GDNA 3RUOA 4JK5A 2JJ2D 5DP7A 5LPRA 2A4GA 1L4ZA 1TBQH 4Y7AA 2PWXA 4O9VA 1GCTC 2J98A 3ITIA 1MZAA 1TIOA 1UTPA 4AFUA 3U1JB 5HMAA 1Y3UA 2QGRA 1HAVB 3MU0A 3PTBA 1AQ7A 1QR3E 1AU8A 4I8GA 4DIHH 4ISHH 1QQUA 1QL7A 5DO4H 1GDQA 1VITF 2EI8A 1CSOE 5FX6A 5FPSA 1GBMA 3S69A 1GJ7B 2C8YB 4WH8A 4XOJA 1NFUA 2K8IA 2D26C 1BJUA 1SC8U 1O3KA 2F91A 3GOVB 1V2ST 1ZZZA 2GT8A 2A5KA 4Y7BA 4WMEA 2W3IA 4Q80A 1UTNA 1AMHA 1V2LT 1K1IA 3KNXA 3TH3H 5LPFA 2J9NA 4YOJA 1J9CH 4Q2KA 4MDSA 2O8WA 3ZVCA 1TNKA 3FOAA 3OYPA 3LGTA 4RN6A 5GNDA 1GHBF 1EPTA 1AB9B 1RTKA 2G4TA 2J92A 2G00A 1TRYA 1GI7B 1SQAA 2ZDVH 1HDTH 1BBRE 4WH6A 1EB2A 2H9EH 3PTNA 2QN5T 4FUJA 1MABB 1OWKA 1Z6JH 4R8TB 1FX0B 1OYQA 2A7HA 3S9CA 3EA9A 1HPGA 2J98B 3SUGA 4JYVH 3W95A 2Z3EA 1LMWB 1ZRBA 2LELA 2BOKA 3OTJE 2ZDKA 2XTTB 3SORA 1TLDA 2WV4A 1GMHF 1QNJA 1IQLA 1C2JA 1NBME 5EODA 1NFYA 1RS0A 4ZKNU 2F83A 2GP9B 3F3BA 4ISOA 3OU0A 1GG6C 3RXCA 3JZ2B 1D6WA 4UONA 3B23B 2THFB 3FZZA 1A1RA 5C2ZA 1MZDA 3W1EA 2HPQH 1W3CA 4FUIA 2BLVA 4YXWD 1L4DA 4J2YB 1C1NA 2VVVA 4AC9A 1EOLA 1O5EH 2CHAB 1FPHH 4AOQA 3ESTA 4X1NU 1HYLA 4A6LA 2FO9A 4ZAEA 3SI4H 5JPMH 1CBWB 1KLIH 4JK6A 3GCTG 2CK3D 2ZU4A 2QXHA 1EAXA 2RCEA 1C5NH 1GI0A 4RI0A 2CGAA 1G3BA 3HKJB 3ZZ5A 2B5TB 2P93A 1CVWH 1E36B 2TBSA 1MMJN 3BF6H 3MU5A 1LTOA 2C8WB 2ZFPH 1YPMH 4ASHA 1C1WH 2ZGBH 1SGYE 1MKXH 2NU2E 1A0LA 1YPHC 4OM9A 2FEQH 2BD8A 1IQKA 4B76A 1OPHB 3SGQE 2C8XB 2SFAA 2ZDLA 3V0XA 1PQ7A 3FVFB 4WJG2 1N6XA 1GJ5H 4JZDH 5EG4A 6CHAC 1W0KD 2B9LA 5A0CA 2BY9X 2XNIA 3PYHA 5GJ4B 3ZZCA 1FY8E 1Y8TA 2ZFFH 1DXWA 1EP5A 1GVKB 1OKXA 1C4V2 5EQRA 6LPRA 4MTBA 1O2PA 1SOZA 5FCKA 1OX1A 3T25A 1SGCA 2QC2A 3F9GA 4BTIB 4H4FA 7LPRA 4I8JA 1MTNC 2YMSD 5FX5A 4OS4A 1TNIA 2P3TB 1HV7A 1QL9A 1QIXB 2ZWLH 3P8OA 3AK5A 4XBBA 3RXLA 1E38B 1MQ5A 5C67A 1KXCA 4WXVA 3VEQB 4XBCA 1SHHB 3PWBA 1NRRH 3UOPA 2HNTC 2OINA 1EB1H 4YTAA 2M2AA 1VCQA 1RJXB 1D4PB 4CRCA 2G81E 2RG3A 4TSFD 1CHOG 1LKBA 2L6OA 2G4UA 4B2AA 1G2LA 1O5FH 1EJNA 3RXMA 1JBUH 1S0QA 2ZQ1A 1VITH 1YYY1 8KME2 2R3YA 3SNAA 4UFFH 1G36A 1V2NT 4B73A 4ABJA 3ATMA 1D9IA 4MNWA 3PWCA 4HG6A 4ISIH 4BAMB 2F3CE 3SU3A 1V3XA 3A89A 3GCHC 3I78A 2A31A 5C1YA 2KAIB 1NM6A 3LPRA 4JMYA 3ZYEA 3ODDA 4INHA 4INLA 4NFFA 4ZHAA 2PSXA 3QTOH 4MLFB 3QO6A 2WYJA 1BT7A 4A7IB 3D65E 3A82A 1IQJA 1DFPA 4ISNA 4GUXA 3RDZA 1A3BH 1QZ8A 2YNBA 3TK5A 1S83A 1O2KA 2DUCA 1ZTJA 1UVPA 3HGPA 4CRAA 1RIWC 1HIAB 3FN8A 1ESAA 3A86A 1EKBB 3UREA 5A8ZA 3AAUA 1A7SA 4FUCA 3VB3A 1GMCF 1V2RT 1YC0A 2BD9A 2JDID 2XCFA 1VJAU 4MNVA 1CQQA 1P06A 3NXPA 2ZHDA 1O3MA 1QGFA 2GCHF 2XC5A 4B2CA 2ZPQA 2PUQH 1CT4E 4HZHA 1P3EA 2F9VA 1FY3A 5B6OA 1CA8B 1NS3A 3TJNA 2KAIA 1SGFA 5HXFA 3GCNA 4OS7A 3TK9A 2BB4A 3CP7A 4BAKB 4ABAA 1FY5A 5DP5A 1O3HA 5IDKA 1C2FA 1O3OA 3A7TA 3W94A 4XFQA 2BM2A 2V7QD 3EA8A 1EFRD 3N7EA 1HAZB 1ZTLA 4BTTB 3M5OA 4IC6A 4NZQA 5E2OA 1ZPCA 4MPUA 1O3LA 1SI5H 4IW4E 4X8VH 2PGBB 4DURA 2VB0A 4ABFA 2BDBA 1P2KA 1TX7A 1O32A 4NIVA 1C4U2 2J34A 1MH0A 3K65B 4NG9H 4Q63A 4NCYA 5DP4A 2PLXA 4OS5A 3GDVA 1AIXH 1ZGIA 4GPGA 1F5LA 4YOIA 4NFEA 1SVPA 1Y3XA 1THSH 1ZSJA 1E1QD 1YPGH 4MPWA 3OX7U 3LDXH 1ETSH 1NU9A 1ZR0A 3PO1B 2FOEA 4E06H 4XD7D 1UTLM 4X8UH 2H6MA 2Z9IA 1RGQA 3S7HB 1BA8B 3K9XB 2ZFSA 1QL8A 1DWDH 1HJAC 1H9IE 2FTMA 1CGJE 2VWOA 2JH5D 1P04A 1UTKA 3E91A 1LHGH 2PHBA 4IMZA 3RXFA 1OSSA 3MI4A 4UFEH 1Z1IA 3N7OA 4B1TA 3SBKA 5ABWA 3R3GB 4D7GA 5JBCS 3SJKA 4UDWH 3UNSA 3M7UA 4BNRA 4DT4A 3L6PA 1K9OE 2BD3A 3GY3A 3KN2A 1C1VH 2Z9JA 2ESTE 3MU4A 5HIZA 1CHOF 2B8OH 3N7DA 1AUJA 3RXHA 5FCRA 1DY8A 1O2TA 4D9QA 3MFJA 3JZ1B 2VJ1A 4AORA 4DG4A 2AGEX 1W12U 1SGIB 1GI1A 1WTHD 5E2PA 1QJ1B 1GHXH 1EAUA 1Y3VA 2WPDD 4I33A 1N1LA 3A87A 3T26A 3RXKA 4FUGA 2UWPA 3ZYDA 1GVLA 3RXVA 1GJCB 4YO9A 5PTPA 3SNEA 3T27A 2H5CA 2GMTC 1BTXA 2SGAA 1O3BA 2GZ9A 1BJVA 1E35B 5GDSH 2FOHA 1O2NA 2EC9H 2R0LA 2FZZA 1PPGE 1T4UH 2CMYA 5T1VA 4THNH 3ZZ7A 5KECA 1O2JA 2CHAC 1C5VA 1HAVA 1TX8A 1WQSA 3AAVA 4CREA 4DJZB 1C1OA 1W7GH 1ZMLA 4GLYA 2FIRH 1A4WH 4MNXA 2WPIS 5DP8A 3AASA 3SU5A 1C5ZB 1BB0B 1A0JA 1DY9A 5CHBA 2A4RA 1HFDA 2FTLE 3VFEA 2YOLA 1MU8B 3RM2H 2FDAA 2WPHS 1TONA 3WY8A 4BXSA 1S84A 1KIGH 4ACBA 2FXRA 1ANDA 2IOTA 1OWEA 4ZHLU 2Y7XA 1DS2E 2XBWA 3UFAA 1QB9A 3BG4C 4FUEA 3ZZ6A 1KSNA 1NFXA 1GI4A 1MCVA 1LPKB 1SLVB 3WWFA 4FU7A 2KX4A 1NROH 4O3TA 1JWTA 3F2HA 3LOXA 4CBOA 1O5BB 1AZ8A 3MNSA 2OQUA 3MU8A 8GCHF 4H6SB 3PLPA 1Z7KA 4O97A 1J16A 7ESTE 4TWWA 3LKWA 1UHBB
chains in the Genus database with same CATH topology
3I29A 1H1BA 1CGHA 1GHAF 5EW2H 1Z8JB 3MNCA 1C1UH 1FY4A 3IITA 5CMXH 1O3DA 4I8KA 2FLRH 2XWAA 5C3NA 1RXPA 2BX4A 2Z9LA 1O30A 2R3UA 3SV6A 1P11E 3MTYA 1YM0A 1DICA 1YCPM 1MKWH 1GDUA 3M7TA 4CR5A 5FPTA 3VXEH 1FN8A 1QURH 2W26A 1Y59T 1V2OT 2G5VA 2G5NA 1WSSH 3OSYA 3TH2H 1PYTC 4Y79A 3P6ZB 1QJ6B 3BEIB 3BIVH 1BCUH 1TYNA 1C5UA 1C1MA 3F68H 4JZ1A 1AVGH 3SN8A 4I8HA 3TITA 1NZQH 1RRKA 3UR6A 2Z9GA 3A7YA 1AFEH 1ID5H 1TE0A 1F5KU 4Z0KA 1N6YA 3MOCA 5L2YH 4D9RA 5E8EH 1GMDG 1GBHA 4MPXA 1CA0B 1DLKB 4PROA 1QY6A 1H9HE 1A5GH 1UCYK 1ZPZA 2WV5A 1TPPA 1PPHE 2UUKB 1IQNA 1XUGA 1JIMA 3EDXB 4TY7A 4IMQA 2PKAA 1GJ9B 3DT0H 5AF9H 1DWBH 1CO7E 2FOAA 1WU1A 1C2MA 4AFSA 2ZTZA 1NY22 3RP2A 1WQVH 2Z3CA 5A2MH 1THPB 2AYWA 3PMAB 1XVOA 1EZXC 1UMAH 2XXLA 4UE7H 1RTLA 3KEEA 1EPTC 4Y76A 4X2VA 2EA3A 1C5OH 5AHGH 2CF9H 2BDAA 1O5CB 3UNRA 3MYWA 1PQAA 2BDYA 3FAOA 1ZMNA 2A45B 4XDEA 2XCNA 2ZGHA 4X1RU 1A2CH 1O2MA 5DKMA 5GPIB 1C4Y2 4NIXA 1C2IA 1D6RA 3LONA 3Q76A 4K5ZA 2FODA 5LPEA 5K7RA 3URDA 4U01A 1C2LA 4O03A 1LO6A 5JBTA 4NIWA 3TLOA 2A2XH 1GBBA 2BVRH 3EAJA 3ZVFA 2DE9A 1J17T 4K1EA 2W7SA 2GTBA 5TCCA 2VIWA 3SNCA 5L30H 3RXPA 1O2QA 4E05H 2FLBH 3BSQA 1DSTA 2BD7A 2XRCA 1F5RA 3HGNA 3M36A 1AN1E 3RXQA 7GCHG 1V2UT 2OD3B 1JIRA 4FUDA 1S82A 3STJA 3ZVBA 1DOJA 1HXFH 1NC6A 2ZPRA 1TGCA 1C5QA 1CGIE 1G3CA 2A5IA 2ALVA 2BZAA 4BAOB 1FDPA 2A1DB 4MG3A 5E0HA 1MQ6A 1EOJA 2ZCHP 5J4QA 4K69A 3SV8A 1NPMA 3ZZ4A 1K22H 3P95A 5EPYA 3LT3A 4X6MA 1UJ1A 1VGCC 3ZZ8A 4TPYA 1RD3B 5GXPA 4ZMAH 3GDSA 1O3JA 2NU4E 3BEFB 1YPJH 1Y5UT 1MTWA 2FOCA 1MAYA 2ZZUH 3NKKA 4X6OA 4FVDA 1TNJA 2OXSA 1UO6A 3E1XB 1PFXC 5J4SA 1QHRB 1OS8A 1EATA 1WV7H 2D2DA 3HATH 4JZIA 1DUEA 4MQAA 3RXUA 1GJ6A 5A0BA 1EP6A 1GCTB 1LVYA 3EQ0H 1QA0A 1T32A 3KGPA 5JYIA 2J4IA 4CRBA 1C2HA 1BQYA 1AFQC 1OWDA 1AB9C 4Y10E 1FY1A 3KQCA 2BXUH 4XBDA 2BDIA 3A8BA 1FUJA 2PTCE 1G9IE 2QXIA 2B7DH 4A1XA 5EOKA 1XM1A 1KLTA 1SQTA 1O2OA 4K2YA 4GHQA 1M9UA 5EXMA 3PLBA 1GBAA 3Q3XA 5AFZH 3S7KB 1Z6EA 3G01A 3ZZ3A 4UFDH 2ODPA 1TABE 3O8BA 1AKSB 1ELFA 1TWXB 2VU8E 2G8TA 1TGTA 2Y7ZA 1TQ7B 4OS2A 3Q3YA 1QTFA 3TGJE 3BEUA 7GCHF 1KLJH 1EJAA 2Q1JA 3ZV8A 3T2NA 2G52A 1DLEA 3H7TA 1TNHA 3BIUH 4JCNA 1PPFE 3LJOA 3ZV9A 4KELA 5C1XA 5CE1A 1D3PB 4FUHA 3PMHB 2Q6GA 1OP2A 1O2RA 1ELBA 1SFIA 2ZNKH 3BTWE 1UVSH 5EQQA 1HUTH 3A81A 2ZU3A 2EI6A 5EPNA 2ZF0H 1AE5A 4IGDA 2BLWA 4AG2A 1WOFA 4QT8C 1BIOA 2QXJA 4AGKA 5A09A 2ANYA 1GJ8B 1GBCA 1ZHMA 3F9EA 8GCHG 1L1GA 5JBBS 5F8TA 5LH8A 3GDUA 4UEHH 1P3CA 1SGEE 1AVXA 4ZKSU 3ZZBA 1AFQB 2BY5X 2VWMA 1BDAA 1AUTC 2VWNA 4DIIH 1HXEH 3UR9A 4GAWA 1CT2E 1XMNB 2Z7FE 2UUFB 1BRCE 1P2OA 4AB8A 2PR3A 4YESB 1GPZA 2LPRA 3SQEE 1HBTH 2ILNA 2XYAA 4AYYB 1K1NA 2A4OA 1EXFA 5EQSA 5LGOA 1XUIA 2IJOB 2OC1A 3QGJA 2ZGJA 2CJIA 1FXYA 1YF4A 4FU8A 4KP0A 1Y5BT 1CBWC 2B0FA 1UVUH 2BDGA 1AWHB 1CU1A 1C1TA 2OC8A 1FONA 1LHEH 1BTUA 1DM4B 2SNVA 3D49H 1QJ7B 4OS6A 1UCYE 1O35A 1UTQA 4LXBH 4SGBE 2GZ7A 3BTEE 1YLDA 1B5GH 2A4QA 6CHAB 2GD4B 3KQBA 1QCPA 1GMDF 3SUDA 2I6SA 4X1SU 1GHVH 1K2I1 1EPTB 1S5SA 3QZQA 5GWZA 1KDQA 3SHAH 5T6DA 2BOHB 3RXDA 1TPAE 2VVUA 1EJMA 1X7AC 1TQ0B 4NGAH 1GI6A 2ZG0H 4E7NA 1ELGA 4A5TS 1SR5C 1ZLRA 5AVDA 1NRNH 1P8VC 1KDQB 1MTNB 1GVZA 4MPVA 2IN2A 2ANWA 1K1JA 2O8LA 3AW0A 1C5XB 1WBGB 2ZC9H 2ZO3H 5TJXA 3F9FA 1DVAH 1KXFA 3TJOA 1W0ZU 2BD5A 2HVXA 3O8DA 1O2IA 6GCHG 1YPKH 3GY7A 1IHSH 1MKWK 4NWLA 5ESBA 1YBWA 4IC5A 3ZZAA 3ATIA 1ETTH 1O31A 1RIWB 2ZCKP 1C1RA 1W10U 1ELTA 3V3MA 1ANEA 1T8MA 2QA9E 1TMUH 5A0AE 5F8ZA 2Y81A 3QZRA 2VIPA 2XWBI 2Y5GA 1SGPE 4X6NA 2ZDNA 4CRGA 4CH2B 3RXOA 4LZ1H 1GI3A 2J95A 2W5EA 1T8OA 5JBAS 2AMQA 2ZGXH 1ZRKA 1C2KA 4IS5A 3MH5A 1A61H 4KTUA 2A5AA 5DJ7A 3UQOA 1ELEE 1IHTH 4Q7XA 4B71A 3ZVEA 3ZVAA 1TX6A 2XC4A 3A8DA 3BTKE 3V7TA 2F9BH 1TPSA 3SJ8A 1GBDA 2V0BA 4J1YA 1OXGA 2V3OH 2AMPA 2ZHQH 3TNSA 1GG6B 2BDCA 2F9UA 3GY4A 2K1QA 4UD9H 4I7YH 1FI8A 1P2IA 2ZEBA 1K1PA 2HNTE 3E8LA 4WWYA 1AVWA 1W0YH 1NRSH 1CHGA 4ABHA 1JRTA 3O8RA 4Q7ZA 3ODFA 3VGCB 1IOEA 1O2WA 1O34A 1WTGH 4RSPA 2P59A 3U9AH 1AE8H 3QDZB 1V2TT 3SGAE 4WMFA 5E0JA 3HKIB 5GIBA 2FMJA 1N8OC 3RM0H 5DP9A 1AZZA 3OY5U 3KF2A 1GHYH 1W13U 1DDJA 3Q00A 1ELVA 3MH4A 4X1PU 1K21H 1SL3A 3PV4A 1V2MT 2BYAX 1YPHE 5CHAC 2UWLA 1PQ8A 2PW8H 1C5RA 2ZTXA 3ZZDA 3CS0A 2PKAB 3PO1C 1SGRE 3K2UA 3KQEA 2Z94A 5SGAE 1LCYA 1T7CA 1P0SH 5DGJA 3GY2A 3S9BA 4O3UA 1ETRH 1ARCA 1W14U 2V6NA 4ABDA 4ABGA 2WPKS 1O3CA 4A1VA 1ESBA 1C5TA 5AFYH 1LDTT 1WUNH 4TYDA 2AEIH 2LNCA 1BBRH 2PGQB 1ANCA 3TJVA 3A8AA 1KXBA 3LC3A 1JXPA 3QWCH 1YGCH 1QA7A 1O2HA 2C3SA 5C1UA 2EEKA 1XXDA 1ZJDA 3NCLA 3SGBE 3GCOA 3UY9A 4ABEA 3NPSA 2C93B 1Y3YA 3U8RH 3TK6A 2ZQ2A 1QFKH 5HYOA 4TPIZ 1BHXB 1O3AA 4AFZA 1O3FA 5F03A 3A80A 5FHTA 1GHAG 1UK4A 2TGAA 3SV7A 2OLGA 3MU1A 1O39A 1ZHRA 4CR9A 1GJBB 4D76A 3QGNB 1XKAC 2BLOA 4Y6DA 1P2MA 2VIDA 2J94A 1L0ZA 5A8XA 4OS1A 1LPZB 3IWMA 2TRMA 1NFWA 3TNTA 2R9PA 1J8AA 2BY7X 5BPEA 2CXVA 5EU8A 2GCTC 3TU7H 2VNTA 2BXTH 2BDHA 3MNBA 1Z8IB 5JB8S 4DY7B 2TGPZ 3BTFE 4D7FA 3LU9B 2TGTA 1QB6A 4NA7A 2ZIQH 1TOCB 4BXWA 2Y5HA 3M3VA 4HFPB 2BD2A 2NU0E 3UTUH 1B0FA 2AIPA 4BAQB 3RXBA 1NRPH 5ETXA 2YNAA 2FPZA 3E0NB 4B75A 2WPLS 3KCGH 4HGCA 1O2UA 3RXSA 4X6PA 1IQMA 4AFQA 2P3UB 1FN6A 1LHDH 2FX6A 1ANBA 1WCZA 3QUMP 4OGYA 1C2EA 2O8UA 3RXRA 1O2LA 2FS8A 5DP6A 1FZZA 1CE5A 1TOMH 3A85A 5K0HA 4TY6A 1F0RA 1F2SE 3NK8A 4INKA 4JYUH 1ZPBA 4GVUA 1RFNA 3NUMA 1V2KT 1ZSKA 1HB0B 4NZLA 4ZKOU 1TFXA 3E0PB 2NWNA 4CH8B 3LGIA 2AERH 2HLCA 1P2JA 5EGMA 3UWJH 2P95A 4VGCB 1ZTKA 5T6GA 3SZNA 2Q6DA 1VCWA 1A5IA 1GHZA 3MO6A 4FUFA 1HJ9A 1SOTA 4F4OC 1O2VA 2F9NA 3EE0B 1TMTH 5JB9S 4R0IA 1GJ4H 2CN0H 3VB5A 1O2XA 2Z6BD 1ELAA 1P02A 1S6FA 5C20A 4CHAB 3I77A 3BTHE 3MHWU 1UCYH 5EXLA 3VB7A 5I46H 3DHKH 2AMDA 5GCHG 2AH4X 2HNTF 2SGQE 3SUEA 1V2PT 1NN6A 3T62A 5ESTE 3LGWA 3E90B 2GZ8A 1DSUA 3HK6B 2ODYB 1P57B 2FOFA 4LOYH 3NZIA 1XVMA 3NWUA 3UOUA 5FAHA 2PSYA 4AYVB 1O3PB 1QRXA 3UNQA 1FIZA 3A88A 4X8SH 3OY6U 1P09A 4BTUB 4I32A 1EZUC 3PMBB 2BX3A 3E3TA 3H5CB 4XE4A 1O3GA 1O38A 2AGGX 3SV9A 4RKJB 1GI2A 1TB6H 1HLTH 3QK1A 2ZKSA 3KHVA 4LK4A 1HAGE 2BHGA 2ZCLP 4WVPE 1TMBH 3P70B 1FAKH 1IAUA 1SG8B 1G3DA 2P8OB 1MD8A 4X0WU 1O36A 2PKSC 2JETC 2R0KA 1DX5M 1PPCE 4AB9A 1ARBA 1TA2A 2ZHFH 1SGFG 4GCHF 1TAWA 1MD7A 5T6FA 2P94A 3GICB 4IN2A 2G51A 1W8BH 1E34B 1T8LA 1MTVA 3EA7A 1XUHA 2QIQA 1BRAA 1QQ4A 1P05A 3FANA 4DW2U 5IYTA 1BMLA 1HAIH 1MBQA 1Q3XA 3MH6A 4X8TH 5DK1A 2BD4A 2BY6X 1DWEH 4YT7H 1O0DH 1FAXA 3Q77A 2STAE 2VIOA 2PUXB 1Y5AT 3PB1E 2VH6A 1C5YB 1ELCA 2ZU1A 1YP9A 1GBFA 2GMTB 3C1KA 1C1SA 1Z71A 3TIUA 2ZPSA 4CRFA 9ESTA 2O8TA 3SW2B 2ULLA 4DOQA 4IN1A 1QRZA 2J38A 1BTPA 3BTDE 3UWIA 1BTZA 1JRSA 1ABJH 4Y71A 2ZI2H 1WAYB 2JH6D 3BTME 1FNIA 2ZHEH 4ESTE 3RLYH 1VR1H 4OGXA 1GL0E 1EQ9A 3PROA 3O8CA 2M5TA 2RDLA 1V2VT 2GKVE 2HWLB 1VGCB 3PM3A 4GSOA 5EXNA 8LPRA 3M5MA 2ZFRH 2A0QB 1SQOA 3DFJA 4FVBA 1XUKA 3EYDA 1AGJA 1KXEA 3SNBA 2WPMS 1BMNH 4K1SA 4Z6AH 3MO3A 3A83A 1F7ZA 4CBNA 2UWOA 1KXDA 3ATLA 4U2WA 1VITG 1GBEA 4Y0YE 1FV9A 3P92A 1YCPK 3LIWA 1YKTA 3SJ9A 1J14A 1BOQA 3LH1A 1IQHA 3UIRA 1SLXB 3U98H 1BTWA 2V3HH 4DT7B 2W7UA 1C2GA 1OWIA 2Y80A 4GCHG 1AD8H 3S0NA 2VINA 3BTTE 1T4VH 1C1PA 1DE7H 1S85A 5DP3A 2DE8A 4A92A 1HIAA 1XKBC 1NT1A 4DVAU 1SBWA 2I6QA 1QBNA 4AN7A 5FBEA 1Q31A 3R0FA 1KTSB 4M7GA 6ESTA 1D3DB 1GL1A 1GJDB 3L33A 4ZXYH 1OWJA 4X1QU 2H1UA 1W7XH 1P2NA 4YLQH 3GISB 2QAAA 3L3TA 1DANH 1BTYA 3K6YA 1TA6A 2BVXH 1FIWA 1EUFA 1MBMA 3RC6A 2XW9A 3M7QA 5T3HA 3SHCH 2BVSH 2AS9A 2HRVA 1TRMA 2WUBA 1LQDB 2VIQA 3ENSB 1Z8GA 1BTHH 2Q6FA 2OP9A 4ZROA 1TGBA 1IQFA 8ESTE 1SB1H 3FFGA 3DUXH 4X2YA 2FI4E 3LJJA 5I25A 3BG8A 2J2UA 1CT0E 1F0UA 2H9HA 2ZFTA 2GT7A 7KMEH 2XC0A 1GCDA 1HAOH 1C5PA 1PYTD 1GBIA 1GJAB 2GGVB 5DPAA 4Y0ZE 1H4WA 3P8FA 4F49A 4BAHB 1D3TB 2HALA 1UTMA 2C8ZB 1C9PA 4ZHMU 3RXJA 5HGGA 1C5SA 1SGDE 3LC5A 3BTGE 4FU9A 4B2BA 3HK3B 3ATWA 1BITA 2C4FH 1GGDC 2QXGA 3VB6A 3T28A 1DPOA 3D23A 1MAXA 4K1TA 4DGJA 2GDDA 1ELDE 4CHAC 1S81A 1ZHPA 4YZUA 3SI3H 1UK3A 1HRTH 4Y11E 5L2ZH 1IQIA 2OCVB 2SGPE 1YPLH 3U1IB 1LKAA 2ALPA 3RMMH 3A7ZA 1FMGA 2RA3A 4JZFH 5F8XA 3IG6B 3RU4T