3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
3S9OA 1JOGA 4EBJA 3AE5C 1WOLA 3AEBC 2WQYC 3AEAC 3RQFA 3AE9C 3AEEC 3JYYA 3AJMA 4XEKA 4XEFA 1OW6A 2PBEA 4XEVA 3AEFC 3AE7C 1QVXA 1WTYA 2JPUA 3C8GB 1K40A 3RQGA 1O3UA 5F28E 3AE1C 3AE6C 3B71A 3C8GA 1V4AA 3AE2C 1OW7A 2HSBA 1PV3A 2G3AA 4R32A 1OW8A 4EBKA 1ZZPA 3BRJA 3ABVC 2KK1A 3MFNA 1ZP0C 2H88C 2L6FA 4YTPC 3AEGC 1K05A 3GM3A 2Q00A 1UFBA 3O10A 3L8IA 3L8JA 3TULA 1ZOYC 3AE3C 1K04A 1YQ3C 3AEDC 3SFEC 1YQ4C 1KTMA 1WWPA 3AE4C 3AECC 2H89C 1KNYA 4YXDC 4NQFA 2L6GA 3C8GD 3GM2A 3GM1A 3SFDC 2FBWC 3K7DA 2JX0A 2YWAA 3AE8C 3RQEA 3U3FA 2LK4A 3C18A 2L6HA 3JZ0A 3U0CA
chains in the Genus database with same CATH superfamily
3Q7LA 4NTFA 1M90Q 5A6KA 5JUAA 1AQTA 5KYYA 3JRTA 4IFMA 1NU1E 4IAQA 4AX2A 1OFCX 1OWAA 3MYIA 3RQFA 3GWNA 1G4US 1HUCA 3CWBD 3FX0A 1KB9H 3QH9A 4YXWH 3HD7D 1RKEB 4MVUA 4BJ1A 1N7SC 1J1EC 2D5RB 2FFDB 1DOWA 1GU4A 2A0BA 4QI2A 2GFHA 4Z9JA 1GL2B 4OIPF 3ZG1A 3FDQA 3NXSA 3CCUP 1M56D 3C8GB 1M2VA 1AFOA 1NFOA 4OVNF 1O3UA 1D0XA 1SFCC 2GA1A 2M0BA 3CX5D 2YLIA 3M0DC 2A68F 4C3EA 1U0BB 1PPJE 1LP1B 3H1JG 4DCKA 1X79B 2NPSD 2HODB 4Z9HA 1RJ9B 3AE2C 4G78A 4ZLDA 1EDKA 1OQCA 3LAYA 1Q82Q 4UB8H 2YKOA 3FHDA 4IL6H 2IPPA 1OW8A 2ZXXA 1JPJA 2OEXA 1W2BO 2FY8A 1GD2E 2G3KA 1VQKP 2NSFA 3BRJA 4E7SA 4I6MC 2L6FA 1D1CA 4BRYB 3H65A 1K05A 5COFA 3OW2O 4Q4ZF 2ICWG 3B0UX 3FXDA 3U1AA 3NG1A 1MKMA 1PGOA 3L35A 4U3FD 2FGYA 1K04A 1OZHA 1PP9E 3CXHI 3ASNC 1JNMA 4MVOA 5KYWA 1MMAA 2G3VA 3CX5H 3HE5A 4M63A 1N73B 2PP6A 4ZKUA 1M8OB 3HJCA 1QZXA 4EUKB 1YLMA 4U5GA 4JEBA 3CCQP 1EDLA 1HGZA 2VCAA 1FJKA 3L74J 3RL0D 1R4TA 4IB4A 2M3BA 1CW5A 1LWUC 2L6GA 3C8GD 4AE4A 4WGYA 2F22A 3KL4A 1VQNP 4G7ZF 1QL1A 2UWJE 1M1JA 3CCSP 4NPDA 4ANJA 3DM5A 1P84D 1YTZT 2KZIA 1BE3G 2J8WA 4GEHA 3Q7GA 1FAPB 5AVXB 5HV9A 1C03A 3OAKA 2FXPA 3C1LA 1OCZC 3EG9A 3L73E 4H44D 2R05A 4X0RA 2KUBA 1IFPA 4I7ZB 3AE5C 1NG1A 3LJBA 2Y3HA 2QUPA 3AEBC 2ZVOB 3UGPA 1FMWA 1QVFO 2KLVA 1SQBG 2XKMA 2HV7A 2FXOA 4U9DA 4LACB 4YT4A 5JT4A 3NKDA 5TISE 1JMMA 2PBEA 3FWLA 1PD1A 2HSQA 4BJ6C 1YTZI 2HJMA 2C0WA 2FFDA 5E3AA 4IRUA 1GL2A 4GQHA 1RXQA 4CPGA 5COMA 5AVRB 2O1JA 3C8GA 4W8PA 4DVZA 1LTTC 2X51A 4ZKPA 1ZVZA 5FZTA 2TMVP 1ZHWA 2Y0DA 5EHHA 4D6TJ 3L74D 4CBEA 3DJNB 1NTMK 2OYIC 1LP1A 3F46A 4R32A 2HODA 2WVNA 1SP4A 2NSGA 1LJ2A 1EXJA 1H6GA 5BVZA 2FYUD 3G71P 2GDCA 3EZIA 1ZHXA 2W27A 2XNDH 2JWAA 1HGVA 1Z3IX 3H1KE 3QMKA 1PGJA 2IYPA 3A0BH 5E33A 4BRYA 5GTIH 4U3FG 3U9JA 1ZR4A 4JTCB 3AGUA 3SFEC 2XL4A 1M1KQ 2YIUB 2M3EA 2A06G 1WWPA 2KP8A 4O6NA 2KGOA 3HUSB 3X1OA 2HS5A 4BWNA 4NQFA 3VM6A 4PJMA 1N73A 1NTZK 1ZYRF 3IFMA 3UGOA 5KLVG 3EZHA 2R9RB 1EA8A 2AEFA 1LTGC 1CPRA 3EH2A 4XTKA 2QSIA 2B0JA 3IQ6A 2Y3GA 2A45H 1G1JA 4N6JA 4I3MA 4JJGA 3US6A 1SQQD 3VYIA 2G8YA 1NTME 1CSBA 1OR2A 3FOPA 1S7ZA 3UIAA 5KLIB 5KLVK 2V7QH 1KILD 1FE6A 1T6QA 3CI9A 2PNOA 4JCZA 4C7RA 4ASWA 4D6TD 3TJ6A 4PR9A 1DOVA 5AW9B 2W83C 3VMXA 3II6A 2R7RA 3AE9C 1Y6DA 3C62A 1WMKA 1CGNA 2XLHA 2C03A 2E74C 5CBNA 3NMDA 2WSSH 3RK2D 1LVKA 3AQBA 2C0XA 5FCLA 3BCCG 3H1HE 3L71J 3V4WA 1EQ7A 4KNWA 3HNLA 3IF4A 3FWNA 2HJ3A 3OA7A 1E79H 1NTZE 2W6AA 3RK3D 2C9NY 3AOUA 1SMYF 2P10A 3FXEA 2ETSA 4PJJA 1V4AA 1N7SB 5CI9A 1BR1A 1J1EB 2KS1B 2R02A 1FZAA 3KKBA 2ZYGA 2UUHA 1X0TA 2A06E 2OYHC 1OKKD 1PGQA 4O7GA 1KC8Q 2IBZG 3ABVC 1Q90D 2GA0A 1WT6A 1FZCB 3O39A 3ZIBA 1SFCB 3IQTA 2KOGA 5GTHH 1YHQP 1ZW2A 4LDKA 1BCCJ 2J9UA 2Y0CA 3O8ZA 5DLJA 4IJJA 1YZCA 1MNEA 4JEAA 1ZXGA 2R7UA 2HUJA 3M0AA 5K5GB 2VH3A 2AVKA 1SQPK 1KN7A 1RF1B 3S29A 2WVQA 1WATA 2O1KA 1LKXA 1TFOB 4DXWA 3HD7C 1OXBA 1LTJB 5AW5B 1M7LA 3Q5PA 3OEOA 1IJDB 2E76D 3MUDA 2PRRA 2QRXA 4YXDC 1SF8A 3IHUA 1JB0J 2L5GB 3HUSA 4GODA 2HG5D 1M56C 3S27A 3MIWA 3L70E 2YQYA 1MV8A 3B5ND 2Y9YA 3L71D 4AL1A 3L75E 2NPSC 3U1CA 2KQ9A 1SQQG 2CDQA 5B66H 3H32B 1OX3A 1TU3F 1XWJA 4PD4I 5AW7B 1VLTA 4YK5A 2V3CC 2G62A 1SQVG 2DW3A 1U89A 3A0HH 3MHVA 2YEVA 1KQFB 5L0HA 1GU5A 3NMJA 1SQXK 1RE3A 4ZMDA 3VTPC 2KB7P 3Q5RA 2OQQA 2D2CD 1DD4A 1FZBA 3OA1A 3L72E 2V26A 1SQPE 3UMIA 1SLQA 3MX3A 3EJNA 1BCCD 2YLGA 1YI2P 4W8KA 1L0LJ 1SQVK 3P8CE 2BC5A 2XSEA 2CW0F 5CMZA 3J06A 2W6JH 3GF3A 2K1AA 3PHLA 3V6IA 5B1BC 2ZXRA 1GW3A 2XLDA 4MQ9F 2BEQD 2H7HA 4U5BE 3H1IE 1JM0A 2D4UA 3LEOA 4CS7A 4UB6E 1LM3B 1A0BA 2E5TA 1N7SA 4CIHA 1KQLA 1W5CE 4L75A 4JCHA 4K1OA 3K66A 2H88C 2XRHA 2P6VA 4JJFA 4FWVA 3VRCA 3VN0A 2FKWB 4YL0A 4Z1MH 4C7OB 4H44C 2CGEA 3BRVB 1H9TA 1FZCA 2C04A 1NU1D 2Q6QA 4PFOA 2AXTE 3SEOA 1EZVG 1SQXE 4OGQD 1PL5A 3M0DA 5APXA 1KORA 2OYIB 2NPUA 1YQ3C 1YDIA 3EFGA 2WITA 3D71A 2GM4A 2GUSA 2AP3A 2YVKA 3KH2A 2XS8A 1RF1A 4GIFA 1G5ZA 2ZXOA 1KNYA 2LFDA 4NC3A 3EHMA 4GT1A 1LTJA 1ST6A 3A9CA 2R7TA 1HMDA 2QIWA 3L4FA 5B1AC 4AK9A 1TWCA 3F89A 2B89A 3TJ5A 3VP9A 2QM7A 3ZTZA 4YT2A 1L0LD 3AE8C 4XPYA 3WUTA 2QNLA 3V4QA 5B3SC 2UUIA 2ZYDA 2LXBA 2P1AA 3ABKC 3RBZA 2EIKC 4LC1A 1NGMB 1X9VA 2J9BA 1ZW3A 1HJBA 3H32A 1E85A 1KU2A 2H8AA 1MFZA 2LKMA 3FAPB 1JO5A 2R7VA 3N0TA 3QW1A 2ZVNB 4L76A 1A41A 1J8MF 1KYOH 1YBKA 1LT1A 5D91A 2J45A 3C7JA 3VYWA 4U5CE 3ZVRA 1PCXA 3POVA 3U59A 1VK5A 4PD4E 3JYHA 4D4XA 2JEEA 3WHNA 3SZRA 5CCGD 4PJNA 1YYXA 2V4HA 3SSUA 1EZVE 1RMVA 2E74B 2BCCE 3VOPA 1I5NA 3JSZA 4PFPA 1ZHZA 2IDBA 3C9IA 3NTNA 3TSIA 1SVFA 3WAQA 1KYOI 4K35A 4BJ6A 1XZPA 4YTPC 1BE3J 1Q2NA 1H88A 1QEXA 2B0HA 2I1KA 2H7BA 3JT1A 2IZ1A 1VYKA 1KILC 4O79A 1NU1G 2H7OA 2P61A 2WVOA 2QE7H 3AE3C 3H1JD 2OYHB 1YARO 2YL7A 1ZHTA 5E79H 2W4MA 1JPNA 3G4ZA 3LNRA 3IQ5A 5DQTA 4DRHB 2OYIA 4WJ0A 2JWDA 1AV1A 3RK2C 3S4RA 1UIXA 1SQBJ 3HNIA 5AVUB 4NY3A 1LTSC 4EKWA 3K5BA 3GM2A 5C39A 1Q0FA 3RYLA 1UIIA 3IN6A 3JCUH 3M4BA 3HD7B 2JX0A 1PPJG 3RK3C 2KJGA 2YXRB 1S3JA 5AVYB 2JKVA 2Z5HA 2MWQA 3H6PA 2FYNC 3L0IA 1GDTA 1N2DC 1LI5A 4E7ZA 1DIPA 3VAYA 4HE8D 1VL2A 2IXOA 2KLUA 2YO3A 4XE5B 1WOLA 5A6AA 2KYHA 1IFNA 4L6RA 1IK7A 3JYYA 4IFFA 2NPSB 3AJMA 3V5YA 3C8VA 4XA4A 4JW1A 3AGTA 2KNCB 4L74A 1PP9G 2LSEA 4XEVA 2LD6A 3G6EP 3W2VA 4U3FJ 1BSHA 1S5LX 1WN0A 2W90A 1WTYA 1TR2A 2LR2A 1QKRA 3RQGA 2E76C 3H1LE 3QVYA 1IFMA 2ZYAA 4O9BA 4B86A 3USSA 1J1DC 1SQBD 5CCHD 1URQD 2DGJA 4Z9IA 2NUPB 3LS1A 3B5NC 2I8DA 3U5SA 1FC2C 2A6HF 1BDDA 1MMDA 2CNWD 1FAVA 2Q3IA 3S90A 2QM8A 3RL0B 3L73G 2R7XA 1OVVA 4ULVA 3WU2E 2O01J 2GAQA 3MD0A 2Q00A 3R4YA 1FZCC 3O10A 2X0CA 1HJ0A 3L8IA 2NRGA 1Y8AA 1ZV8A 4R4MA 3ZDMA 4W7YA 3AG3C 1FTSA 4ULWA 2HLOA 1GK4A 2DB4A 2D2CC 1LNQA 1ZU5A 1KTMA 1IC2A 2OYHA 1RF1C 1KB9I 2CYDA 1V54C 2OG2A 3CAXA 1Q0GA 4H44B 1VYIA 1LTJC 4ZNCA 1Z7Qc 2NZ2A 1GQAA 1JUNA 4N4WA 4K7BA 4IFDK 3BCCJ 2P1JA 5JSLA 2PFDA 1D0YA 1GW4A 2W8ZA 1FOSF 4KBLA 1L0NK 2R03A 1SS1A 5CJ0A 2BEZF 3HNJA 1G4WR 4CJGA 5L3QA 3GODA 3HD7A 5DS6A 3KMIA 2A06D 5CCHA 4YT5A 2Q3EA 2HYNA 5KYXB 4MVZA 1MUUA 2ZPAA 4A2NB 3RL0g 4JPZB 3BASA 2W9YA 4JKVA 4P6IC 5KLVD 1N1CA 4WY4D 1VOMA 1KV4A 3H1KG 2JD3A 2FYUJ 2FFHA 5BQGA 4CS9A 5JS5A 4MTOA 1USEA 5H2FE 1S2EA 1GS9A 5CI8A 4OGQC 1OIPA 3SP1A 2OU6A 5DQZA 1QQ3A 3MYFA 5JVEA 3TGUE 2NPSA 1VQLP 3W8IA 2KNCA 3PTZA 3G9RA 1BGYE 4NTAA 1ZR2A 5F5HA 3VP8A 4IOIH 1NTKK 1D0ZA 2FXMA 2OOCA 2XLOA 3V5ZA 1FR0A 3V5XA 2FYZA 2V7QJ 3CX5I 3GEIA 1VQ8P 1ZRTD 2PX3A 2FAPB 1L4AD 1ZW0A 4C3DA 1S4XA 2XDJA 2MKVA 3PH0A 2IOQA 4XPXA 3CC2P 4HFFB 4I1MA 2JP3A 1L0NE 1ORSC 4R4LA 3LESA 5A6JA 3L75D 1V74B 1A7DA 3S0XA 1NTMG 2H7VC 3ATPA 4JQ0D 1P84H 1HE9A 3BCCD 4B6IA 2NUPA 4E18A 1Z56A 1W2EA 2O01H 2MJZA 1SQQJ 1ORYA 1NFNA 2Z5IA 1FBMA 3ITKA 1EXIA 2CCYA 1LT9C 2MHRA 3RF3A 4JE9A 4N78D 4D4NA 4K0DA 5BQHA 3G4SP 3L72D 5L3VA 1FDMA 2YKPA 2IBZD 3TNUA 3KPHA 1JR8A 3R2PA 1VQPP 4NTBA 4U5HA 1KILB 1NTKE 2J5UA 3H1HG 3P8CD 2WPRA 4CDVA 2WSEJ 2EPOA 2Q9CA 4ZLCA 1QLEC 1T8ZA 4W7ZA 4O6YA 3SFDC 1NTZG 5CCGC 4XLNF 3NDBB 2NUTB 3V2PA 1NO4A 3U3FA 3T97B 1Q86Q 2LK4A 1XTCC 3RK2B 2IYOA 4GOFA 1KB9E 3LS0A 1VQ9P 1EQ1A 2W45A 4CIPA 3AQCA 1HMOA 2KI7B 4LDRA 4H0LB 1CGME 1HW1A 3IR9A 5KYXA 3RK3B 1X8YA 2YO2A 2WWWA 2EPMX 2I8BA 2YLDA 5A69A 5APVA 3SXMA 3O6XA 1A7VA 4JTAB 3CXHE 4XFJA 1S5LH 2FYNB 2RD9A 3WG7C 2E75D 1GGQA 1LTIC 2XLMA 1TQGA 1O87A 2Q9IA 2XM4A 4KC9A 4P9FA 1KQGB 3CCEP 3MGNA 3K6BA 4UB8E 4IL6E 2J0WA 1SQVD 3CSKA 4MNDA 4CSAC 3CWBE 3PHF2 3NRHA 3V2QA 3U8VA 3DAFA 3JSEO 1QX8A 3DKAA 5AW2B 3R7CA 3L70G 1YA9A 1EC5A 2E5YA 3E1RA 5GPGB 3M15A 1VPCA 3CCLP 1QL2A 4L73A 3L75G 4EBKA 2AXTH 1ZZPA 4I1OB 4Q7CA 1HVVA 2J46A 2E76B 3L34A 1VTMP 1NWQA 2A45I 3CX5E 3PDMP 3EGDB 4H0LD 2K88A 3KYQA 4MW8A 1KD1Q 1T5OA 1TKNA 1J1DB 1EI7A 1MNDA 2IBFA 2J7PD 3DI5A 3TULA 3PRJA 1Q0MA 2QVAA 3FAJA 3W4YA 3B5NB 1C17M 4C7NB 5BQIA 3KPEA 1FJPA 3EPVA 3B0VC 3L72G 5KAFH 1SQPG 2R7OA 3GLMA 4J7TA 4JURI 2OJQA 1Y47A 4PD4D 1OCOC 1TFKB 5CIVA 2WSEH 1IK9A 2CK3H 2P7JA 4EWCA 3I4UA 1J2JB 1YIJP 4LDQA 4DBRA 2B88A 4H13D 1KILA 2XM0A 2YHSA 1EZVD 1BR4A 4PV1D 2D2CB 2HR3A 3H1IG 2BCCD 1TWHA 2NUTA 2QJKB 2R7SA 5CCHC 1OR3A 1URQC 2K9YA 1S9KE 5APSA 4WWIA 3T97A 4G0HA 1AVOA 3O6QB 5AW0B 3DD7A 2OTKE 1IZMA 3B9QA 4KJMA 2WSFJ 5L0CA 5KYUB 3DAGA 4WABA 2I15A 3KZIH 4CS9C 1GZLA 1SQXG 4MVQA 3EQLF 3LLIA 4JBZA 4GOEA 1FZEA 1NU1J 1C02A 4YT8A 4RDAA 2HPCB 4QMAA 3AEFC 5L0GA 4N6HA 1FNTc 5T3TA 2JPUA 1OKKA 2KIKA 2L91A 4WGZA 4OGQB 2VB6A 2WPSA 1AEPA 1U7MA 1G1IA 3JTLO 4LGDE 1H89A 3EFFK 4KT0J 2IYLD 2KYVA 3A0BE 4RESB 1T3JA 5GTIE 1LGHB 1VQ7P 2R44A 3AEGC 2QJPC 2AEJA 3W68A 3K1IA 3EGXA 2J0XA 4JIOA 5KAIH 3RL0C 3E1IA 4U9EA 3ABMC 1QGKB 4N3YB 1JCCA 1ZOYC 3L74E 4U5EE 2JDIH 3EGDA 1RKCA 4WY4C 5AVVB 1HTLC 4NPFX 1APCA 3TD7A 2FYUE 3B5NA 1FZFA 4C7NA 4CDAA 1N86A 1VF5B 1Q0DA 3HKKA 4CDYA 3KYJA 1LT9B 2AU5A 1DH3A 3GM1A 5AC5A 3CCJP 3V5BA 2AWCA 3UNGC 3N7NA 5AGFA 1L4AC 2VRSA 3P32A 1JEKA 2BCCG 3RVZA 3S1KA 2RMZA 1XTGB 5JRAA 4HEAJ 5E3CA 4TT3H 1VQOP 4ONSA 1PZQA 3GG2A 3M1CB 2Z4EA 1DX7A 1Z5ZA 3WMM0 2Q3TA 4HYTB 2WSFH 3VMYA 3D70A 1ZLLA 2XLEA 1E86A 5JP7A 3O6QA 1BDCA 2Y9ZA 1LTBC 1HF9A 3L73J 2KSFA 3CEXA 4OD5A 3S84A 2QLAA 5APQA 3I5CA 1PPJD 5KYUA 1Q0KA 1VMAA 1JY2O 1XZQA 1Y4CA 3NYJA 4OINF 3NMIA 1T2KD 1KILE 1OXKA 3H1JJ 2ZD9A 4UDVA 5AVTB 4D6TE 2PX0A 1K40A 1GK6A 1VF5D 4DBQA 2HPCA 3WUUA 1H9GA 4PJ0E 3GEEA 2PAJA 3GHGB 5CJ4A 4OIRF 1CGOA 2Q1KA 4LERA 5GTHE 1LTAC 1OW7A 1FU1A 3ECSA 1LE2A 3RVYA 2HSBA 1PP9D 5KJ7D 2J59M 1W2WA 4U5FE 3V2NA 3D6ZA 2L7AA 3HTKC 1JRAA 4AQRD 3RK3E 3RBXA 3RW0A 2WMMA 5E2QA 3B8EB 3IPMO 2LCHA 3CCMP 2WSCH 1AJYA 2C9LY 4EHPA 1BR2A 2ZJSE 2H8PD 1BBHA 2KZJA 5AW8B 4H4KC 1YITP 2WVRA 3AE4C 3GW6A 1YJNP 3H1KJ 2E42A 3W67A 1JY2N 2ZT9D 4A4AA 3Q2YA 2EIJC 1J8YF 2E75C 1MQVA 1T9KA 1BGYD 3TF5A 5AVQB 3L73D 1RHZB 2Z15A 4MVSA 1SR2A 2VCCA 3T6BA 3G50A 3H1LG 3IAOA 2QJYC 3MLGA 5F5FA 5AVSB 3QVZA 2N1TD 3LIEA 3Q3DA 4DRJB 1LT9A 3A0HE 4EI2A 1YA7O 2Q4FA 3C18A 2IXMA 2ZAEB 3NFQA 4H54A 1L3PA 3TOMA 2BL2A 2QY9A 1YAUO 2RH0A 1NAFA 3PMRA 1JY2P 4XWJA 4AL0A 5APTA 3JSVC 2XNXA 4Q5SF 4I1LA 1B68A 2GUVA 1LE4A 1NLXA 3RH3A 3Q6NA 3P7KA 3NYLA 5AW3B 3L71E 3ASOC 4H0LC 1Z6AA 5CCGA 3ZQYA 1URQB 4RKUJ 2KC3A 4AUWA 2Q9BA 3RKOF 4MTGA 1Y9BA 4Y28J 2KSJA 1JTHB 3AG2C 1E84A 1CPQA 1NH4A 2XL8A 1FOSE 1T6IA 3EQ2A 1OMIA 1H0TB 1FMVA 1NTKD 3BRTB 1FFHA 3PJSK 5TISH 2YL0A 4YL3A 5F28E 3AE1C 2HFED 3V7OA 4O6MA 3H1KD 4OIQF 3H1HJ 2WTYA 1BCCE 5JLIA 4PV1C 3GHGA 1IFJA 1U6HA 4U7JA 3L37A 3M9BA 1CZQA 2G3AA 4WVZA 1NTZJ 2OCCC 1LI7A 5L0FA 3BEHA 3DE9A 3EFOB 1U57A 2Q9AA 4IAOA 4CX9A 1OVRA 4GDOA 1EDJA 3K1IC 3W2WA 2ZXPA 1L0LK 2RSEB 4CSAA 4BXLA 3M9HA 5D92A 3UR3C 3CCRP 2LP4A 3CXHD 5KLVJ 2OQMA 2QJPB 3TGUG 2AWYA 2H89C 1G2CB 3GWLA 1NTMD 1BGYG 2ASRA 3I56P 5EK0A 1OCRC 2ITAA 3H25A 4WY4B 1HE1A 4N6CA 1QVGO 2EIMC 3K7DA 3HNKA 2WB7A 2E87A 1I4ZA 1NU9C 3TK1A 4E17A 3A2AA 3TNUB 3LIDA 1Z63A 1NJIQ 1HWTC 3D6YA 2YXQB 3GANA 1L0NG 1NU7D 4MS2A 1JOCA 3U0CA 5HSWA 3L70J 2OKUA 1KYOE 1BSNA 2QJKC 3CXHH 3A5TA 1K73Q 3H1HD 2M5AB 2Q7RA 4DRIB 3UMKA 2YNYA 3L75J 1G8XA 2J9VA 3ABLC 1L4AB 2XV5A 3EH1A 2WQYC 5B5EE 1L0LE 5AVZB 1NTZD 2J58A 3LUTB 4XEKA 1M57D 1OW6A 2P2UA 2YL1A 3EHNA 1A7EA 4YJWA 2IXPA 1NHLA 4HKZH 1URQA 2RN0A 2LXCB 2YL3A 4OD4A 3FGAD 4RBNA 3L72J 1SQPJ 1NTKG 2CNWA 5L0IA 3AG4C 1JTHA 3CZ6A 1RQVA 1HY5A 4JF7A 1TWAA 1HW2A 2YRFA 1H0TA 2WZLA 1DEEG 1LS1A 1LIHA 2O01N 2OEVA 1JCDA 3M79A 2IFNA 2LIGA 1GL2D 2KK1A 3H1IJ 1FS0E 2PP4A 3OJAB 1TWGA 2N9YB 2XU6A 4EYYQ 1S9KD 5E79E 1LS4A 3CC7P 2KXPB 1PD0A 2W4BA 4LLCA 3DM9B 4YN0B 2AXCA 3Q6MA 4BJTA 1JAFA 3EFOA 1ZU4A 2J9WA 3QW0A 4KNVA 3L8JA 5BU8B 3CC4P 4BPMA 3SWFA 3QTHA 5A6BD 4G7OF 3L70D 1LPEA 1F1MA 3HTKB 3Q5SA 1T01A 1K9MQ 1YQ4C 4PACA 1E5WA 4LLEA 1E83A 4G7HF 1A02J 3JCUE 1RE4A 3HE4A 4MW3A 5CHXA 2R25A 1K8AQ 3A3YB 3CMEP 1SQXJ 1T2KC 3MTUE 3HLZA 3Q1MA 5KKZB 2A6EF 3H1JE 1WRGA 1VQ6P 1G2CA 3VMAA 1HBWA 1KMIZ 1VF5C 3CWBG 1PFIA 2IZ0A 2OTJP 2Y69C 3C63A 3T9OA 1H7IA 2XL6A 4JYCA 1GTWA 2O9XA 1NBBA 2Q7CA 1SQVJ 3DZAA 4WY4A 4WB4A 3E9VA 2XLVA 2E75B 1SQPD 1RKEA 4EDFA 2QG4A 1JOGA 5KJ7C 3HRNA 3CLQA 1JY3O 3M06A 5CBOA 4Y99C 4EBJA 1RF0C 3SYNA 4FAPB 2QJYB 2HZ8A 4I44A 2B87B 4HJGH 1VDFA 1SQBK 2ZXWC 3FOOA 2R5BA 2JO1A 1P84I 1OVUA 2M5AA 4KHXA 3JC22 1L7CA 2QE9A 3NYMA 3I5QA 3H1ID 1WASA 4XEFA 1L4AA 4J30B 5BUOA 1AVOB 1KZUB 1RJ9A 4N06A 5A6BA 4I2LC 2DYRC 3AE7C 1M2OA 1QVXA 2OARA 3PP5A 4K3AA 3OWTA 2ZT9C 4PJLA 3W8HA 4XLPF 1KFNA 3CPWO 1FDOA 4JC7A 2KSEA 5L0JA 3B71A 5KYNA 5APWA 2P67A 4OWFA 4BEJA 5AW4B 1BE3E 1IW7F 1VB5A 2OJED 4MVMA 1SQXD 4CS8C 1VQMP 3GHGC 3A7OA 1PIXA 2N1TC 4HH2A 2IFMA 2Y3DA 2P0NA 3MFNA 2WT7B 2BCCJ 2YKZA 4UB6H 3SWKA 3GM3A 1NKNA 3K1HA 4MTFA 1JY3N 5M1BA 4BJ5C 5T3WA 4H13B 5B3IA 1VQ4P 1SQBE 3GEHA 5IY5C 4PV1B 3TK0A 2M4EA 3L36A 1KQSO 2CPBA 2YKQA 4NPEA 3B0PA 3PLNA 2IBZI 5AW1B 2DI3A 1N8RQ 3EGXB 2QTVA 3HTKA 3DE8A 5L0DA 4TLFA 3O55A 3G4XA 1S72P 2K9JB 3SNHA 1FDIA 2R3CA 3FVYA 1N7LA 4C46A 3CQZA 1R5ID 1NSGB 2FBWC 1JY3P 3SXZA 3KDPB 3RQEA 4FX5A 3FMSA 1YZAA 1EDIA 1DEBA 2W6BA 3U2LA 3L1MA 1NOHA 2L6HA 3V2RA 3F47A 1S1CX 1AQ5A 2LFFA 5T1DB 1U7JA 4P9TA 4YWQA 3DWWA 3N4XA 3RFYA 3TDKA 4QDLA 3KXDA 2LQGA 4XPWA 4U3FE 4A7PA 2HKVA 3AEAC 4HB1A 1IO4A 3RIPA 2B87A 2QA4P 4RJTA 3L74G 3T6JA 1Z23A 2WZFA 2SPZA 2GWWA 3N2ZB 4PJ0H 3TOLA 4FESA 3U9MA 2FYUG 3ZC4A 4CJOA 3CMAP 3ZWIA 1D1AA 4DZOA 5KLVE 1OXZA 3SWYA 2A45G 1QPUA 3DMDA 3TYYA 3AE6C 4JZAA 1P84E 4PD4H 2Q5UA 1YVIA 1Q81Q 3E70C 1PV3A 2J7PA 1O5HA 2FYUK 3H1LJ 3LNMB 2R7WA 2P7VA 2HV6A 1ZP0C 2XS1A 4EBBA 3GF7A 1ZRTE 5BU5A 2EINC 1SYQA 5DS5A 4YL1A 4OIOF 1QSPA 1UFBA 2YZSA 3E7KA 3TQOA 4LLHA 2WT7A 1T6AA 1M1JC 4RO0A 4E0HA 1N7SD 3B29A 4WBAA 3AEDC 3EWKA 1NVOA 3PCVA 5AC4A 2N9BA 1NAYA 1RE4C 1LWUB 3BCCE 1M57C 5DVWA 4DT0A 4DOZA 2EPNA 2H43A 1SFCD 3U2MA 3M9QA 2OGUA 3JRMO 2POHA 4D6TG 2VASA 1EZVI 1USDA 2WSCJ 2EILC 4N78E 4J7YA 2WZ7A 2M64A 4IGGA 3WODF 2YWAA 2RKLA 1FFTC 4HFKB 1SQQK 2K9JA 4GKGA 1MMGA 1AA0A 3AG1C 1ZHYA 4QI0A 2IBZE 1ORJA 4YPCA 3VMZA 3X2QC 4OH8B 4DJ9A 3ZQVA 2ZFCA 4C3BA 3B4SA 2R32A 2EPKX 2FFDC 2XLWA 2MYSA 1S5LE 2K3RA 4IARA 2KW3C 1VQ5P 1GL2C 1PP9J 3GORA 4EIYA 3WUVA 1VLSA 1DD3A 2HMZA 1CI6B 3H2VA 4BEMJ 3H1LD 3AEEC 3N24A 1RH5B 4ASVA 3A11A 4MVRA 3T6GB 5AVWB 1V55C 4Y99B 2KS1A 3ZTMA 2KNHA 2XXAB 1R8EA 3CL3D 1GMJA 1EKYA 1SZIA 1M6TA 1OCCC 1AUEA 1NZEA 2HMQA 1MFTA 2IM8A 2HFIA 4E0IA 3LW5J 2R5DA 2M8RA 3U3BA 1SFCA 3TGUJ 1R5SA 2R3SA 1S05A 2IXNA 1BGYJ 2P58A 2Y39A 3KYIA 3CD6P 3I55P 1SQQE 1I4YA 2WZGA 4J32B 2QEXP 1RCPA 2ZT9B 1N73C 1SQVE 4IL6X 3LEVA 4MN4C 1KYOD 5KAFE 3IQCA 1L0NJ 1MMNA 3MP7B 2XZRA 3LLKA 3T4RA 1IZNB 3BVHA 1PGPA 1D7MA 1H8AA 3JCUQ 5DJUB 2KK7A 3K33A 5TJ5E 4F4BA 1YJ9P 3U8PA 2N1TB 3L71G 5APYA 2Y0EA 2ZXEB 3FXHA 3WU2H 3QWOC 2WPVB 2K37A 1T3UA 2NG1A 1IFDA 2I1JA 4PK4A 1LWUA 4JYBA 3G3ZA 1KFMA 1JMWA 1T6UA 4I7ZC 1MZ9A 2L81A 3IEEA 1GM5A 1X22A 5EFWB 5KKZC 5APUA 4M3LA 4GYTA 1NTKJ 1D1BA 3ZSUA 1BCCG 4DVYP 5KYYB 3KZIE 3I5PA 3JZ0A 5B5EH 4ER9A 3S9OA 1JMBA 3TGUD 1QLED 3GMAA 4BG0A 1NYHA 1RQUA 1E2XA 1BZ4A 5DS4A 1YJGA 2R7QA 5B66E 4DJGA 4IWBA 4JVSA 2Y3BA 2YMKA 2VCBA 5KTBA 1WGWA 3F5HA 1RY3A 3UMHA 256BA 1CI6A 4JTDB 1YYCA 1A02F 1M2VB 2L9JA 1L0ND 1Q7YQ 3NKEA 3SXYA 2PGDA 5KJ7A 3BATA 5H2FH 2B9BA 1RF0A 5COGA 2EPLX 3LW5H 3C8ZA 4JRZA 2XXAA 3ZDLA 4EOTA 4KI2A 3QZCA 4DOJA 1NTMJ 2A1DD 4C7OA 2JR8A 1UG7A 4EIJA 1R5LA 3P8MC 2OTLP 5K0IA 3RGUA 5KAIE 1L2PA 3CWBJ 4U5DE 3ITFA 3DXJF 2VC9A 2O3JA 3MUDC 1ZN5A 5AW6B 2YIUC 1NU1K 3DJUB 3HUSC 5KYWB 4NCQA 3NMKA 3MZWB 4XQ1A 3HE5B 5L8RJ 1NKZB 1IFIA 2E74D 1L0LG 2E43A 2YMYA 3KHUA 1ZMEC 2PF4E 1YYJA 2WL8A 3M4CA 4H13C 4CS8A 3VF0A 2WPQA 3H2UA 3M91A 5EGYA 4AE4B 2N1TA 3AECC 3MBGA 2JJLA 2DYSC 1KB9D 2OYOA 1M1JB 1AVYA 1YJWP 1RE3C 3KQGA 2CPSA 5KLIC 4W80A 2A0UA 2BASA 2AEMA 4BJ5A 3CCVP 3S28A 5DJTB 2A69F 1HH0A 3EG9B 2PFXA 3SXKA 3HE4B 5TJHA 1BE3D 4RD9A 2BE5F 4AYCA 1BDJB 1FZGA 2IX7C
chains in the Genus database with same CATH topology
3S9OA 1DIPA 1JOGA 1S1CX 1VL2A 4H44D 3GMAA 1NGMB 2QJKC 4EBJA 1NYHA 4I7ZB 3AE5C 1RQUA 3RL0g 4H0LB 1WOLA 1KQFB 2WSFJ 1DD3A 3AEBC 3D70A 2WQYC 3AEAC 2YMKA 3O6QA 2JO1A 3Q5RA 1IK7A 3AE9C 2OQQA 3AEEC 3JYYA 4H0LC 3RQFA 3AJMA 1HF9A 3C8VA 2D2CD 1DD4A 1WMKA 4XFJA 4XEKA 4XEFA 4RKUJ 4OGQC 1OW6A 2E74C 2E75D 2PBEA 1Y9BA 4XEVA 4Y28J 1KILE 3AEFC 3G9RA 1S5LX 3AE7C 1R8EA 1GMJA 1KQGB 1QVXA 1WTYA 2JPUA 3C8GB 2V7QJ 3FGAD 1VF5D 1K40A 2ZT9C 3RQGA 3GF3A 1O3UA 1OMIA 2E76C 3LW5J 3U0CA 1FDOA 5F28E 1RQVA 2BEQD 3AE1C 3AE6C 2P10A 3B71A 4OGQB 3C8GA 1V4AA 2E74B 2MKVA 3AE2C 1OW7A 2JP3A 4PV1C 2HSBA 1PV3A 1PIXA 4U7JA 4R4LA 4KT0J 2IDBA 2G3AA 4R32A 1OW8A 3D6ZA 4EBKA 1ZZPA 3BRJA 2ZT9B 3ABVC 1Q90D 1EXJA 2KK1A 2E76B 3MFNA 1ZP0C 2H88C 2YIUC 1U57A 2L6FA 3GF7A 4IL6X 4YTPC 4GDOA 1ZRTE 3AEGC 2QJPC 1K05A 3RK3E 3GM3A 4Z1MH 2O01J 4H0LD 4H44C 2Q00A 1UFBA 3R4YA 3O10A 5M1BA 1MKMA 4H13B 1HJ0A 5L8RJ 1EXIA 1AJYA 4OGQD 3L8JA 1PL5A 4R4MA 3L8IA 3TULA 2E74D 4PV1B 1ZOYC 3AE3C 1KORA 1K04A 1YQ3C 3AEDC 1ZMEC 3SFEC 3D71A 3EWKA 3Q5SA 4H13C 1YQ4C 2D2CC 1KTMA 1WWPA 3AE4C 3GLMA 2WPVB 3Q5PA 3AECC 2ZT9D 2H89C 1UIXA 3Q2YA 2E76D 2E75C 4YXDC 4H44B 1KNYA 4NQFA 1VF5B 2J5UA 2L6GA 3C8GD 3GM2A 1JB0J 2WSEJ 3Q1MA 2NZ2A 5KLIC 1FDIA 2QIWA 3H25A 4I7ZC 1KMIZ 1VF5C 2QJYC 2WSCJ 3IAOA 3IN6A 4H13D 3SFDC 3GM1A 2FBWC 4PV1D 2D2CB 3K7DA 2QSIA 5KKZC 2JX0A 2YWAA 3Q3DA 3AE8C 3RQEA 3U3FA 2BEZF 3T97B 2LK4A 3C18A 2E75B 3D6YA 2L6HA 2G8YA 2FYNC 4TT3H 2FXPA 3JZ0A 2K9YA 1TU3F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9O A;  1JOG A;  4EBJ A;  3AE5 C;  1WOL A;  3AEB C;  2WQY C;  3AEA C;  3RQF A;  3AE9 C;  3AEE C;  3JYY A;  3AJM A;  4XEK A;  4XEF A;  1OW6 A;  2PBE A;  4XEV A;  3AEF C;  3AE7 C;  1QVX A;  1WTY A;  2JPU A;  3C8G B;  1K40 A;  3RQG A;  1O3U A;  5F28 E;  3AE1 C;  3AE6 C;  3B71 A;  3C8G A;  1V4A A;  3AE2 C;  1OW7 A;  2HSB A;  1PV3 A;  2G3A A;  4R32 A;  1OW8 A;  4EBK A;  1ZZP A;  3BRJ A;  3ABV C;  2KK1 A;  3MFN A;  1ZP0 C;  2H88 C;  2L6F A;  4YTP C;  3AEG C;  1K05 A;  3GM3 A;  2Q00 A;  1UFB A;  3O10 A;  3L8I A;  3L8J A;  3TUL A;  1ZOY C;  3AE3 C;  1K04 A;  1YQ3 C;  3AED C;  3SFE C;  1YQ4 C;  1KTM A;  1WWP A;  3AE4 C;  3AEC C;  2H89 C;  1KNY A;  4YXD C;  4NQF A;  2L6G A;  3C8G D;  3GM2 A;  3GM1 A;  3SFD C;  2FBW C;  3K7D A;  2JX0 A;  2YWA A;  3AE8 C;  3RQE A;  3U3F A;  2LK4 A;  3C18 A;  2L6H A;  3JZ0 A;  3U0C A; 
#chains in the Genus database with same CATH topology
 3Q7L A;  4NTF A;  1M90 Q;  5A6K A;  5JUA A;  1AQT A;  5KYY A;  3JRT A;  4IFM A;  1NU1 E;  4IAQ A;  4AX2 A;  1OFC X;  1OWA A;  3MYI A;  3RQF A;  3GWN A;  1G4U S;  1HUC A;  3CWB D;  3FX0 A;  1KB9 H;  3QH9 A;  4YXW H;  3HD7 D;  1RKE B;  4MVU A;  4BJ1 A;  1N7S C;  1J1E C;  2D5R B;  2FFD B;  1DOW A;  1GU4 A;  2A0B A;  4QI2 A;  2GFH A;  4Z9J A;  1GL2 B;  4OIP F;  3ZG1 A;  3FDQ A;  3NXS A;  3CCU P;  1M56 D;  3C8G B;  1M2V A;  1AFO A;  1NFO A;  4OVN F;  1O3U A;  1D0X A;  1SFC C;  2GA1 A;  2M0B A;  3CX5 D;  2YLI A;  3M0D C;  2A68 F;  4C3E A;  1U0B B;  1PPJ E;  1LP1 B;  3H1J G;  4DCK A;  1X79 B;  2NPS D;  2HOD B;  4Z9H A;  1RJ9 B;  3AE2 C;  4G78 A;  4ZLD A;  1EDK A;  1OQC A;  3LAY A;  1Q82 Q;  4UB8 H;  2YKO A;  3FHD A;  4IL6 H;  2IPP A;  1OW8 A;  2ZXX A;  1JPJ A;  2OEX A;  1W2B O;  2FY8 A;  1GD2 E;  2G3K A;  1VQK P;  2NSF A;  3BRJ A;  4E7S A;  4I6M C;  2L6F A;  1D1C A;  4BRY B;  3H65 A;  1K05 A;  5COF A;  3OW2 O;  4Q4Z F;  2ICW G;  3B0U X;  3FXD A;  3U1A A;  3NG1 A;  1MKM A;  1PGO A;  3L35 A;  4U3F D;  2FGY A;  1K04 A;  1OZH A;  1PP9 E;  3CXH I;  3ASN C;  1JNM A;  4MVO A;  5KYW A;  1MMA A;  2G3V A;  3CX5 H;  3HE5 A;  4M63 A;  1N73 B;  2PP6 A;  4ZKU A;  1M8O B;  3HJC A;  1QZX A;  4EUK B;  1YLM A;  4U5G A;  4JEB A;  3CCQ P;  1EDL A;  1HGZ A;  2VCA A;  1FJK A;  3L74 J;  3RL0 D;  1R4T A;  4IB4 A;  2M3B A;  1CW5 A;  1LWU C;  2L6G A;  3C8G D;  4AE4 A;  4WGY A;  2F22 A;  3KL4 A;  1VQN P;  4G7Z F;  1QL1 A;  2UWJ E;  1M1J A;  3CCS P;  4NPD A;  4ANJ A;  3DM5 A;  1P84 D;  1YTZ T;  2KZI A;  1BE3 G;  2J8W A;  4GEH A;  3Q7G A;  1FAP B;  5AVX B;  5HV9 A;  1C03 A;  3OAK A;  2FXP A;  3C1L A;  1OCZ C;  3EG9 A;  3L73 E;  4H44 D;  2R05 A;  4X0R A;  2KUB A;  1IFP A;  4I7Z B;  3AE5 C;  1NG1 A;  3LJB A;  2Y3H A;  2QUP A;  3AEB C;  2ZVO B;  3UGP A;  1FMW A;  1QVF O;  2KLV A;  1SQB G;  2XKM A;  2HV7 A;  2FXO A;  4U9D A;  4LAC B;  4YT4 A;  5JT4 A;  3NKD A;  5TIS E;  1JMM A;  2PBE A;  3FWL A;  1PD1 A;  2HSQ A;  4BJ6 C;  1YTZ I;  2HJM A;  2C0W A;  2FFD A;  5E3A A;  4IRU A;  1GL2 A;  4GQH A;  1RXQ A;  4CPG A;  5COM A;  5AVR B;  2O1J A;  3C8G A;  4W8P A;  4DVZ A;  1LTT C;  2X51 A;  4ZKP A;  1ZVZ A;  5FZT A;  2TMV P;  1ZHW A;  2Y0D A;  5EHH A;  4D6T J;  3L74 D;  4CBE A;  3DJN B;  1NTM K;  2OYI C;  1LP1 A;  3F46 A;  4R32 A;  2HOD A;  2WVN A;  1SP4 A;  2NSG A;  1LJ2 A;  1EXJ A;  1H6G A;  5BVZ A;  2FYU D;  3G71 P;  2GDC A;  3EZI A;  1ZHX A;  2W27 A;  2XND H;  2JWA A;  1HGV A;  1Z3I X;  3H1K E;  3QMK A;  1PGJ A;  2IYP A;  3A0B H;  5E33 A;  4BRY A;  5GTI H;  4U3F G;  3U9J A;  1ZR4 A;  4JTC B;  3AGU A;  3SFE C;  2XL4 A;  1M1K Q;  2YIU B;  2M3E A;  2A06 G;  1WWP A;  2KP8 A;  4O6N A;  2KGO A;  3HUS B;  3X1O A;  2HS5 A;  4BWN A;  4NQF A;  3VM6 A;  4PJM A;  1N73 A;  1NTZ K;  1ZYR F;  3IFM A;  3UGO A;  5KLV G;  3EZH A;  2R9R B;  1EA8 A;  2AEF A;  1LTG C;  1CPR A;  3EH2 A;  4XTK A;  2QSI A;  2B0J A;  3IQ6 A;  2Y3G A;  2A45 H;  1G1J A;  4N6J A;  4I3M A;  4JJG A;  3US6 A;  1SQQ D;  3VYI A;  2G8Y A;  1NTM E;  1CSB A;  1OR2 A;  3FOP A;  1S7Z A;  3UIA A;  5KLI B;  5KLV K;  2V7Q H;  1KIL D;  1FE6 A;  1T6Q A;  3CI9 A;  2PNO A;  4JCZ A;  4C7R A;  4ASW A;  4D6T D;  3TJ6 A;  4PR9 A;  1DOV A;  5AW9 B;  2W83 C;  3VMX A;  3II6 A;  2R7R A;  3AE9 C;  1Y6D A;  3C62 A;  1WMK A;  1CGN A;  2XLH A;  2C03 A;  2E74 C;  5CBN A;  3NMD A;  2WSS H;  3RK2 D;  1LVK A;  3AQB A;  2C0X A;  5FCL A;  3BCC G;  3H1H E;  3L71 J;  3V4W A;  1EQ7 A;  4KNW A;  3HNL A;  3IF4 A;  3FWN A;  2HJ3 A;  3OA7 A;  1E79 H;  1NTZ E;  2W6A A;  3RK3 D;  2C9N Y;  3AOU A;  1SMY F;  2P10 A;  3FXE A;  2ETS A;  4PJJ A;  1V4A A;  1N7S B;  5CI9 A;  1BR1 A;  1J1E B;  2KS1 B;  2R02 A;  1FZA A;  3KKB A;  2ZYG A;  2UUH A;  1X0T A;  2A06 E;  2OYH C;  1OKK D;  1PGQ A;  4O7G A;  1KC8 Q;  2IBZ G;  3ABV C;  1Q90 D;  2GA0 A;  1WT6 A;  1FZC B;  3O39 A;  3ZIB A;  1SFC B;  3IQT A;  2KOG A;  5GTH H;  1YHQ P;  1ZW2 A;  4LDK A;  1BCC J;  2J9U A;  2Y0C A;  3O8Z A;  5DLJ A;  4IJJ A;  1YZC A;  1MNE A;  4JEA A;  1ZXG A;  2R7U A;  2HUJ A;  3M0A A;  5K5G B;  2VH3 A;  2AVK A;  1SQP K;  1KN7 A;  1RF1 B;  3S29 A;  2WVQ A;  1WAT A;  2O1K A;  1LKX A;  1TFO B;  4DXW A;  3HD7 C;  1OXB A;  1LTJ B;  5AW5 B;  1M7L A;  3Q5P A;  3OEO A;  1IJD B;  2E76 D;  3MUD A;  2PRR A;  2QRX A;  4YXD C;  1SF8 A;  3IHU A;  1JB0 J;  2L5G B;  3HUS A;  4GOD A;  2HG5 D;  1M56 C;  3S27 A;  3MIW A;  3L70 E;  2YQY A;  1MV8 A;  3B5N D;  2Y9Y A;  3L71 D;  4AL1 A;  3L75 E;  2NPS C;  3U1C A;  2KQ9 A;  1SQQ G;  2CDQ A;  5B66 H;  3H32 B;  1OX3 A;  1TU3 F;  1XWJ A;  4PD4 I;  5AW7 B;  1VLT A;  4YK5 A;  2V3C C;  2G62 A;  1SQV G;  2DW3 A;  1U89 A;  3A0H H;  3MHV A;  2YEV A;  1KQF B;  5L0H A;  1GU5 A;  3NMJ A;  1SQX K;  1RE3 A;  4ZMD A;  3VTP C;  2KB7 P;  3Q5R A;  2OQQ A;  2D2C D;  1DD4 A;  1FZB A;  3OA1 A;  3L72 E;  2V26 A;  1SQP E;  3UMI A;  1SLQ A;  3MX3 A;  3EJN A;  1BCC D;  2YLG A;  1YI2 P;  4W8K A;  1L0L J;  1SQV K;  3P8C E;  2BC5 A;  2XSE A;  2CW0 F;  5CMZ A;  3J06 A;  2W6J H;  3GF3 A;  2K1A A;  3PHL A;  3V6I A;  5B1B C;  2ZXR A;  1GW3 A;  2XLD A;  4MQ9 F;  2BEQ D;  2H7H A;  4U5B E;  3H1I E;  1JM0 A;  2D4U A;  3LEO A;  4CS7 A;  4UB6 E;  1LM3 B;  1A0B A;  2E5T A;  1N7S A;  4CIH A;  1KQL A;  1W5C E;  4L75 A;  4JCH A;  4K1O A;  3K66 A;  2H88 C;  2XRH A;  2P6V A;  4JJF A;  4FWV A;  3VRC A;  3VN0 A;  2FKW B;  4YL0 A;  4Z1M H;  4C7O B;  4H44 C;  2CGE A;  3BRV B;  1H9T A;  1FZC A;  2C04 A;  1NU1 D;  2Q6Q A;  4PFO A;  2AXT E;  3SEO A;  1EZV G;  1SQX E;  4OGQ D;  1PL5 A;  3M0D A;  5APX A;  1KOR A;  2OYI B;  2NPU A;  1YQ3 C;  1YDI A;  3EFG A;  2WIT A;  3D71 A;  2GM4 A;  2GUS A;  2AP3 A;  2YVK A;  3KH2 A;  2XS8 A;  1RF1 A;  4GIF A;  1G5Z A;  2ZXO A;  1KNY A;  2LFD A;  4NC3 A;  3EHM A;  4GT1 A;  1LTJ A;  1ST6 A;  3A9C A;  2R7T A;  1HMD A;  2QIW A;  3L4F A;  5B1A C;  4AK9 A;  1TWC A;  3F89 A;  2B89 A;  3TJ5 A;  3VP9 A;  2QM7 A;  3ZTZ A;  4YT2 A;  1L0L D;  3AE8 C;  4XPY A;  3WUT A;  2QNL A;  3V4Q A;  5B3S C;  2UUI A;  2ZYD A;  2LXB A;  2P1A A;  3ABK C;  3RBZ A;  2EIK C;  4LC1 A;  1NGM B;  1X9V A;  2J9B A;  1ZW3 A;  1HJB A;  3H32 A;  1E85 A;  1KU2 A;  2H8A A;  1MFZ A;  2LKM A;  3FAP B;  1JO5 A;  2R7V A;  3N0T A;  3QW1 A;  2ZVN B;  4L76 A;  1A41 A;  1J8M F;  1KYO H;  1YBK A;  1LT1 A;  5D91 A;  2J45 A;  3C7J A;  3VYW A;  4U5C E;  3ZVR A;  1PCX A;  3POV A;  3U59 A;  1VK5 A;  4PD4 E;  3JYH A;  4D4X A;  2JEE A;  3WHN A;  3SZR A;  5CCG D;  4PJN A;  1YYX A;  2V4H A;  3SSU A;  1EZV E;  1RMV A;  2E74 B;  2BCC E;  3VOP A;  1I5N A;  3JSZ A;  4PFP A;  1ZHZ A;  2IDB A;  3C9I A;  3NTN A;  3TSI A;  1SVF A;  3WAQ A;  1KYO I;  4K35 A;  4BJ6 A;  1XZP A;  4YTP C;  1BE3 J;  1Q2N A;  1H88 A;  1QEX A;  2B0H A;  2I1K A;  2H7B A;  3JT1 A;  2IZ1 A;  1VYK A;  1KIL C;  4O79 A;  1NU1 G;  2H7O A;  2P61 A;  2WVO A;  2QE7 H;  3AE3 C;  3H1J D;  2OYH B;  1YAR O;  2YL7 A;  1ZHT A;  5E79 H;  2W4M A;  1JPN A;  3G4Z A;  3LNR A;  3IQ5 A;  5DQT A;  4DRH B;  2OYI A;  4WJ0 A;  2JWD A;  1AV1 A;  3RK2 C;  3S4R A;  1UIX A;  1SQB J;  3HNI A;  5AVU B;  4NY3 A;  1LTS C;  4EKW A;  3K5B A;  3GM2 A;  5C39 A;  1Q0F A;  3RYL A;  1UII A;  3IN6 A;  3JCU H;  3M4B A;  3HD7 B;  2JX0 A;  1PPJ G;  3RK3 C;  2KJG A;  2YXR B;  1S3J A;  5AVY B;  2JKV A;  2Z5H A;  2MWQ A;  3H6P A;  2FYN C;  3L0I A;  1GDT A;  1N2D C;  1LI5 A;  4E7Z A;  1DIP A;  3VAY A;  4HE8 D;  1VL2 A;  2IXO A;  2KLU A;  2YO3 A;  4XE5 B;  1WOL A;  5A6A A;  2KYH A;  1IFN A;  4L6R A;  1IK7 A;  3JYY A;  4IFF A;  2NPS B;  3AJM A;  3V5Y A;  3C8V A;  4XA4 A;  4JW1 A;  3AGT A;  2KNC B;  4L74 A;  1PP9 G;  2LSE A;  4XEV A;  2LD6 A;  3G6E P;  3W2V A;  4U3F J;  1BSH A;  1S5L X;  1WN0 A;  2W90 A;  1WTY A;  1TR2 A;  2LR2 A;  1QKR A;  3RQG A;  2E76 C;  3H1L E;  3QVY A;  1IFM A;  2ZYA A;  4O9B A;  4B86 A;  3USS A;  1J1D C;  1SQB D;  5CCH D;  1URQ D;  2DGJ A;  4Z9I A;  2NUP B;  3LS1 A;  3B5N C;  2I8D A;  3U5S A;  1FC2 C;  2A6H F;  1BDD A;  1MMD A;  2CNW D;  1FAV A;  2Q3I A;  3S90 A;  2QM8 A;  3RL0 B;  3L73 G;  2R7X A;  1OVV A;  4ULV A;  3WU2 E;  2O01 J;  2GAQ A;  3MD0 A;  2Q00 A;  3R4Y A;  1FZC C;  3O10 A;  2X0C A;  1HJ0 A;  3L8I A;  2NRG A;  1Y8A A;  1ZV8 A;  4R4M A;  3ZDM A;  4W7Y A;  3AG3 C;  1FTS A;  4ULW A;  2HLO A;  1GK4 A;  2DB4 A;  2D2C C;  1LNQ A;  1ZU5 A;  1KTM A;  1IC2 A;  2OYH A;  1RF1 C;  1KB9 I;  2CYD A;  1V54 C;  2OG2 A;  3CAX A;  1Q0G A;  4H44 B;  1VYI A;  1LTJ C;  4ZNC A;  1Z7Q c;  2NZ2 A;  1GQA A;  1JUN A;  4N4W A;  4K7B A;  4IFD K;  3BCC J;  2P1J A;  5JSL A;  2PFD A;  1D0Y A;  1GW4 A;  2W8Z A;  1FOS F;  4KBL A;  1L0N K;  2R03 A;  1SS1 A;  5CJ0 A;  2BEZ F;  3HNJ A;  1G4W R;  4CJG A;  5L3Q A;  3GOD A;  3HD7 A;  5DS6 A;  3KMI A;  2A06 D;  5CCH A;  4YT5 A;  2Q3E A;  2HYN A;  5KYX B;  4MVZ A;  1MUU A;  2ZPA A;  4A2N B;  3RL0 g;  4JPZ B;  3BAS A;  2W9Y A;  4JKV A;  4P6I C;  5KLV D;  1N1C A;  4WY4 D;  1VOM A;  1KV4 A;  3H1K G;  2JD3 A;  2FYU J;  2FFH A;  5BQG A;  4CS9 A;  5JS5 A;  4MTO A;  1USE A;  5H2F E;  1S2E A;  1GS9 A;  5CI8 A;  4OGQ C;  1OIP A;  3SP1 A;  2OU6 A;  5DQZ A;  1QQ3 A;  3MYF A;  5JVE A;  3TGU E;  2NPS A;  1VQL P;  3W8I A;  2KNC A;  3PTZ A;  3G9R A;  1BGY E;  4NTA A;  1ZR2 A;  5F5H A;  3VP8 A;  4IOI H;  1NTK K;  1D0Z A;  2FXM A;  2OOC A;  2XLO A;  3V5Z A;  1FR0 A;  3V5X A;  2FYZ A;  2V7Q J;  3CX5 I;  3GEI A;  1VQ8 P;  1ZRT D;  2PX3 A;  2FAP B;  1L4A D;  1ZW0 A;  4C3D A;  1S4X A;  2XDJ A;  2MKV A;  3PH0 A;  2IOQ A;  4XPX A;  3CC2 P;  4HFF B;  4I1M A;  2JP3 A;  1L0N E;  1ORS C;  4R4L A;  3LES A;  5A6J A;  3L75 D;  1V74 B;  1A7D A;  3S0X A;  1NTM G;  2H7V C;  3ATP A;  4JQ0 D;  1P84 H;  1HE9 A;  3BCC D;  4B6I A;  2NUP A;  4E18 A;  1Z56 A;  1W2E A;  2O01 H;  2MJZ A;  1SQQ J;  1ORY A;  1NFN A;  2Z5I A;  1FBM A;  3ITK A;  1EXI A;  2CCY A;  1LT9 C;  2MHR A;  3RF3 A;  4JE9 A;  4N78 D;  4D4N A;  4K0D A;  5BQH A;  3G4S P;  3L72 D;  5L3V A;  1FDM A;  2YKP A;  2IBZ D;  3TNU A;  3KPH A;  1JR8 A;  3R2P A;  1VQP P;  4NTB A;  4U5H A;  1KIL B;  1NTK E;  2J5U A;  3H1H G;  3P8C D;  2WPR A;  4CDV A;  2WSE J;  2EPO A;  2Q9C A;  4ZLC A;  1QLE C;  1T8Z A;  4W7Z A;  4O6Y A;  3SFD C;  1NTZ G;  5CCG C;  4XLN F;  3NDB B;  2NUT B;  3V2P A;  1NO4 A;  3U3F A;  3T97 B;  1Q86 Q;  2LK4 A;  1XTC C;  3RK2 B;  2IYO A;  4GOF A;  1KB9 E;  3LS0 A;  1VQ9 P;  1EQ1 A;  2W45 A;  4CIP A;  3AQC A;  1HMO A;  2KI7 B;  4LDR A;  4H0L B;  1CGM E;  1HW1 A;  3IR9 A;  5KYX A;  3RK3 B;  1X8Y A;  2YO2 A;  2WWW A;  2EPM X;  2I8B A;  2YLD A;  5A69 A;  5APV A;  3SXM A;  3O6X A;  1A7V A;  4JTA B;  3CXH E;  4XFJ A;  1S5L H;  2FYN B;  2RD9 A;  3WG7 C;  2E75 D;  1GGQ A;  1LTI C;  2XLM A;  1TQG A;  1O87 A;  2Q9I A;  2XM4 A;  4KC9 A;  4P9F A;  1KQG B;  3CCE P;  3MGN A;  3K6B A;  4UB8 E;  4IL6 E;  2J0W A;  1SQV D;  3CSK A;  4MND A;  4CSA C;  3CWB E;  3PHF 2;  3NRH A;  3V2Q A;  3U8V A;  3DAF A;  3JSE O;  1QX8 A;  3DKA A;  5AW2 B;  3R7C A;  3L70 G;  1YA9 A;  1EC5 A;  2E5Y A;  3E1R A;  5GPG B;  3M15 A;  1VPC A;  3CCL P;  1QL2 A;  4L73 A;  3L75 G;  4EBK A;  2AXT H;  1ZZP A;  4I1O B;  4Q7C A;  1HVV A;  2J46 A;  2E76 B;  3L34 A;  1VTM P;  1NWQ A;  2A45 I;  3CX5 E;  3PDM P;  3EGD B;  4H0L D;  2K88 A;  3KYQ A;  4MW8 A;  1KD1 Q;  1T5O A;  1TKN A;  1J1D B;  1EI7 A;  1MND A;  2IBF A;  2J7P D;  3DI5 A;  3TUL A;  3PRJ A;  1Q0M A;  2QVA A;  3FAJ A;  3W4Y A;  3B5N B;  1C17 M;  4C7N B;  5BQI A;  3KPE A;  1FJP A;  3EPV A;  3B0V C;  3L72 G;  5KAF H;  1SQP G;  2R7O A;  3GLM A;  4J7T A;  4JUR I;  2OJQ A;  1Y47 A;  4PD4 D;  1OCO C;  1TFK B;  5CIV A;  2WSE H;  1IK9 A;  2CK3 H;  2P7J A;  4EWC A;  3I4U A;  1J2J B;  1YIJ P;  4LDQ A;  4DBR A;  2B88 A;  4H13 D;  1KIL A;  2XM0 A;  2YHS A;  1EZV D;  1BR4 A;  4PV1 D;  2D2C B;  2HR3 A;  3H1I G;  2BCC D;  1TWH A;  2NUT A;  2QJK B;  2R7S A;  5CCH C;  1OR3 A;  1URQ C;  2K9Y A;  1S9K E;  5APS A;  4WWI A;  3T97 A;  4G0H A;  1AVO A;  3O6Q B;  5AW0 B;  3DD7 A;  2OTK E;  1IZM A;  3B9Q A;  4KJM A;  2WSF J;  5L0C A;  5KYU B;  3DAG A;  4WAB A;  2I15 A;  3KZI H;  4CS9 C;  1GZL A;  1SQX G;  4MVQ A;  3EQL F;  3LLI A;  4JBZ A;  4GOE A;  1FZE A;  1NU1 J;  1C02 A;  4YT8 A;  4RDA A;  2HPC B;  4QMA A;  3AEF C;  5L0G A;  4N6H A;  1FNT c;  5T3T A;  2JPU A;  1OKK A;  2KIK A;  2L91 A;  4WGZ A;  4OGQ B;  2VB6 A;  2WPS A;  1AEP A;  1U7M A;  1G1I A;  3JTL O;  4LGD E;  1H89 A;  3EFF K;  4KT0 J;  2IYL D;  2KYV A;  3A0B E;  4RES B;  1T3J A;  5GTI E;  1LGH B;  1VQ7 P;  2R44 A;  3AEG C;  2QJP C;  2AEJ A;  3W68 A;  3K1I A;  3EGX A;  2J0X A;  4JIO A;  5KAI H;  3RL0 C;  3E1I A;  4U9E A;  3ABM C;  1QGK B;  4N3Y B;  1JCC A;  1ZOY C;  3L74 E;  4U5E E;  2JDI H;  3EGD A;  1RKC A;  4WY4 C;  5AVV B;  1HTL C;  4NPF X;  1APC A;  3TD7 A;  2FYU E;  3B5N A;  1FZF A;  4C7N A;  4CDA A;  1N86 A;  1VF5 B;  1Q0D A;  3HKK A;  4CDY A;  3KYJ A;  1LT9 B;  2AU5 A;  1DH3 A;  3GM1 A;  5AC5 A;  3CCJ P;  3V5B A;  2AWC A;  3UNG C;  3N7N A;  5AGF A;  1L4A C;  2VRS A;  3P32 A;  1JEK A;  2BCC G;  3RVZ A;  3S1K A;  2RMZ A;  1XTG B;  5JRA A;  4HEA J;  5E3C A;  4TT3 H;  1VQO P;  4ONS A;  1PZQ A;  3GG2 A;  3M1C B;  2Z4E A;  1DX7 A;  1Z5Z A;  3WMM 0;  2Q3T A;  4HYT B;  2WSF H;  3VMY A;  3D70 A;  1ZLL A;  2XLE A;  1E86 A;  5JP7 A;  3O6Q A;  1BDC A;  2Y9Z A;  1LTB C;  1HF9 A;  3L73 J;  2KSF A;  3CEX A;  4OD5 A;  3S84 A;  2QLA A;  5APQ A;  3I5C A;  1PPJ D;  5KYU A;  1Q0K A;  1VMA A;  1JY2 O;  1XZQ A;  1Y4C A;  3NYJ A;  4OIN F;  3NMI A;  1T2K D;  1KIL E;  1OXK A;  3H1J J;  2ZD9 A;  4UDV A;  5AVT B;  4D6T E;  2PX0 A;  1K40 A;  1GK6 A;  1VF5 D;  4DBQ A;  2HPC A;  3WUU A;  1H9G A;  4PJ0 E;  3GEE A;  2PAJ A;  3GHG B;  5CJ4 A;  4OIR F;  1CGO A;  2Q1K A;  4LER A;  5GTH E;  1LTA C;  1OW7 A;  1FU1 A;  3ECS A;  1LE2 A;  3RVY A;  2HSB A;  1PP9 D;  5KJ7 D;  2J59 M;  1W2W A;  4U5F E;  3V2N A;  3D6Z A;  2L7A A;  3HTK C;  1JRA A;  4AQR D;  3RK3 E;  3RBX A;  3RW0 A;  2WMM A;  5E2Q A;  3B8E B;  3IPM O;  2LCH A;  3CCM P;  2WSC H;  1AJY A;  2C9L Y;  4EHP A;  1BR2 A;  2ZJS E;  2H8P D;  1BBH A;  2KZJ A;  5AW8 B;  4H4K C;  1YIT P;  2WVR A;  3AE4 C;  3GW6 A;  1YJN P;  3H1K J;  2E42 A;  3W67 A;  1JY2 N;  2ZT9 D;  4A4A A;  3Q2Y A;  2EIJ C;  1J8Y F;  2E75 C;  1MQV A;  1T9K A;  1BGY D;  3TF5 A;  5AVQ B;  3L73 D;  1RHZ B;  2Z15 A;  4MVS A;  1SR2 A;  2VCC A;  3T6B A;  3G50 A;  3H1L G;  3IAO A;  2QJY C;  3MLG A;  5F5F A;  5AVS B;  3QVZ A;  2N1T D;  3LIE A;  3Q3D A;  4DRJ B;  1LT9 A;  3A0H E;  4EI2 A;  1YA7 O;  2Q4F A;  3C18 A;  2IXM A;  2ZAE B;  3NFQ A;  4H54 A;  1L3P A;  3TOM A;  2BL2 A;  2QY9 A;  1YAU O;  2RH0 A;  1NAF A;  3PMR A;  1JY2 P;  4XWJ A;  4AL0 A;  5APT A;  3JSV C;  2XNX A;  4Q5S F;  4I1L A;  1B68 A;  2GUV A;  1LE4 A;  1NLX A;  3RH3 A;  3Q6N A;  3P7K A;  3NYL A;  5AW3 B;  3L71 E;  3ASO C;  4H0L C;  1Z6A A;  5CCG A;  3ZQY A;  1URQ B;  4RKU J;  2KC3 A;  4AUW A;  2Q9B A;  3RKO F;  4MTG A;  1Y9B A;  4Y28 J;  2KSJ A;  1JTH B;  3AG2 C;  1E84 A;  1CPQ A;  1NH4 A;  2XL8 A;  1FOS E;  1T6I A;  3EQ2 A;  1OMI A;  1H0T B;  1FMV A;  1NTK D;  3BRT B;  1FFH A;  3PJS K;  5TIS H;  2YL0 A;  4YL3 A;  5F28 E;  3AE1 C;  2HFE D;  3V7O A;  4O6M A;  3H1K D;  4OIQ F;  3H1H J;  2WTY A;  1BCC E;  5JLI A;  4PV1 C;  3GHG A;  1IFJ A;  1U6H A;  4U7J A;  3L37 A;  3M9B A;  1CZQ A;  2G3A A;  4WVZ A;  1NTZ J;  2OCC C;  1LI7 A;  5L0F A;  3BEH A;  3DE9 A;  3EFO B;  1U57 A;  2Q9A A;  4IAO A;  4CX9 A;  1OVR A;  4GDO A;  1EDJ A;  3K1I C;  3W2W A;  2ZXP A;  1L0L K;  2RSE B;  4CSA A;  4BXL A;  3M9H A;  5D92 A;  3UR3 C;  3CCR P;  2LP4 A;  3CXH D;  5KLV J;  2OQM A;  2QJP B;  3TGU G;  2AWY A;  2H89 C;  1G2C B;  3GWL A;  1NTM D;  1BGY G;  2ASR A;  3I56 P;  5EK0 A;  1OCR C;  2ITA A;  3H25 A;  4WY4 B;  1HE1 A;  4N6C A;  1QVG O;  2EIM C;  3K7D A;  3HNK A;  2WB7 A;  2E87 A;  1I4Z A;  1NU9 C;  3TK1 A;  4E17 A;  3A2A A;  3TNU B;  3LID A;  1Z63 A;  1NJI Q;  1HWT C;  3D6Y A;  2YXQ B;  3GAN A;  1L0N G;  1NU7 D;  4MS2 A;  1JOC A;  3U0C A;  5HSW A;  3L70 J;  2OKU A;  1KYO E;  1BSN A;  2QJK C;  3CXH H;  3A5T A;  1K73 Q;  3H1H D;  2M5A B;  2Q7R A;  4DRI B;  3UMK A;  2YNY A;  3L75 J;  1G8X A;  2J9V A;  3ABL C;  1L4A B;  2XV5 A;  3EH1 A;  2WQY C;  5B5E E;  1L0L E;  5AVZ B;  1NTZ D;  2J58 A;  3LUT B;  4XEK A;  1M57 D;  1OW6 A;  2P2U A;  2YL1 A;  3EHN A;  1A7E A;  4YJW A;  2IXP A;  1NHL A;  4HKZ H;  1URQ A;  2RN0 A;  2LXC B;  2YL3 A;  4OD4 A;  3FGA D;  4RBN A;  3L72 J;  1SQP J;  1NTK G;  2CNW A;  5L0I A;  3AG4 C;  1JTH A;  3CZ6 A;  1RQV A;  1HY5 A;  4JF7 A;  1TWA A;  1HW2 A;  2YRF A;  1H0T A;  2WZL A;  1DEE G;  1LS1 A;  1LIH A;  2O01 N;  2OEV A;  1JCD A;  3M79 A;  2IFN A;  2LIG A;  1GL2 D;  2KK1 A;  3H1I J;  1FS0 E;  2PP4 A;  3OJA B;  1TWG A;  2N9Y B;  2XU6 A;  4EYY Q;  1S9K D;  5E79 E;  1LS4 A;  3CC7 P;  2KXP B;  1PD0 A;  2W4B A;  4LLC A;  3DM9 B;  4YN0 B;  2AXC A;  3Q6M A;  4BJT A;  1JAF A;  3EFO A;  1ZU4 A;  2J9W A;  3QW0 A;  4KNV A;  3L8J A;  5BU8 B;  3CC4 P;  4BPM A;  3SWF A;  3QTH A;  5A6B D;  4G7O F;  3L70 D;  1LPE A;  1F1M A;  3HTK B;  3Q5S A;  1T01 A;  1K9M Q;  1YQ4 C;  4PAC A;  1E5W A;  4LLE A;  1E83 A;  4G7H F;  1A02 J;  3JCU E;  1RE4 A;  3HE4 A;  4MW3 A;  5CHX A;  2R25 A;  1K8A Q;  3A3Y B;  3CME P;  1SQX J;  1T2K C;  3MTU E;  3HLZ A;  3Q1M A;  5KKZ B;  2A6E F;  3H1J E;  1WRG A;  1VQ6 P;  1G2C A;  3VMA A;  1HBW A;  1KMI Z;  1VF5 C;  3CWB G;  1PFI A;  2IZ0 A;  2OTJ P;  2Y69 C;  3C63 A;  3T9O A;  1H7I A;  2XL6 A;  4JYC A;  1GTW A;  2O9X A;  1NBB A;  2Q7C A;  1SQV J;  3DZA A;  4WY4 A;  4WB4 A;  3E9V A;  2XLV A;  2E75 B;  1SQP D;  1RKE A;  4EDF A;  2QG4 A;  1JOG A;  5KJ7 C;  3HRN A;  3CLQ A;  1JY3 O;  3M06 A;  5CBO A;  4Y99 C;  4EBJ A;  1RF0 C;  3SYN A;  4FAP B;  2QJY B;  2HZ8 A;  4I44 A;  2B87 B;  4HJG H;  1VDF A;  1SQB K;  2ZXW C;  3FOO A;  2R5B A;  2JO1 A;  1P84 I;  1OVU A;  2M5A A;  4KHX A;  3JC2 2;  1L7C A;  2QE9 A;  3NYM A;  3I5Q A;  3H1I D;  1WAS A;  4XEF A;  1L4A A;  4J30 B;  5BUO A;  1AVO B;  1KZU B;  1RJ9 A;  4N06 A;  5A6B A;  4I2L C;  2DYR C;  3AE7 C;  1M2O A;  1QVX A;  2OAR A;  3PP5 A;  4K3A A;  3OWT A;  2ZT9 C;  4PJL A;  3W8H A;  4XLP F;  1KFN A;  3CPW O;  1FDO A;  4JC7 A;  2KSE A;  5L0J A;  3B71 A;  5KYN A;  5APW A;  2P67 A;  4OWF A;  4BEJ A;  5AW4 B;  1BE3 E;  1IW7 F;  1VB5 A;  2OJE D;  4MVM A;  1SQX D;  4CS8 C;  1VQM P;  3GHG C;  3A7O A;  1PIX A;  2N1T C;  4HH2 A;  2IFM A;  2Y3D A;  2P0N A;  3MFN A;  2WT7 B;  2BCC J;  2YKZ A;  4UB6 H;  3SWK A;  3GM3 A;  1NKN A;  3K1H A;  4MTF A;  1JY3 N;  5M1B A;  4BJ5 C;  5T3W A;  4H13 B;  5B3I A;  1VQ4 P;  1SQB E;  3GEH A;  5IY5 C;  4PV1 B;  3TK0 A;  2M4E A;  3L36 A;  1KQS O;  2CPB A;  2YKQ A;  4NPE A;  3B0P A;  3PLN A;  2IBZ I;  5AW1 B;  2DI3 A;  1N8R Q;  3EGX B;  2QTV A;  3HTK A;  3DE8 A;  5L0D A;  4TLF A;  3O55 A;  3G4X A;  1S72 P;  2K9J B;  3SNH A;  1FDI A;  2R3C A;  3FVY A;  1N7L A;  4C46 A;  3CQZ A;  1R5I D;  1NSG B;  2FBW C;  1JY3 P;  3SXZ A;  3KDP B;  3RQE A;  4FX5 A;  3FMS A;  1YZA A;  1EDI A;  1DEB A;  2W6B A;  3U2L A;  3L1M A;  1NOH A;  2L6H A;  3V2R A;  3F47 A;  1S1C X;  1AQ5 A;  2LFF A;  5T1D B;  1U7J A;  4P9T A;  4YWQ A;  3DWW A;  3N4X A;  3RFY A;  3TDK A;  4QDL A;  3KXD A;  2LQG A;  4XPW A;  4U3F E;  4A7P A;  2HKV A;  3AEA C;  4HB1 A;  1IO4 A;  3RIP A;  2B87 A;  2QA4 P;  4RJT A;  3L74 G;  3T6J A;  1Z23 A;  2WZF A;  2SPZ A;  2GWW A;  3N2Z B;  4PJ0 H;  3TOL A;  4FES A;  3U9M A;  2FYU G;  3ZC4 A;  4CJO A;  3CMA P;  3ZWI A;  1D1A A;  4DZO A;  5KLV E;  1OXZ A;  3SWY A;  2A45 G;  1QPU A;  3DMD A;  3TYY A;  3AE6 C;  4JZA A;  1P84 E;  4PD4 H;  2Q5U A;  1YVI A;  1Q81 Q;  3E70 C;  1PV3 A;  2J7P A;  1O5H A;  2FYU K;  3H1L J;  3LNM B;  2R7W A;  2P7V A;  2HV6 A;  1ZP0 C;  2XS1 A;  4EBB A;  3GF7 A;  1ZRT E;  5BU5 A;  2EIN C;  1SYQ A;  5DS5 A;  4YL1 A;  4OIO F;  1QSP A;  1UFB A;  2YZS A;  3E7K A;  3TQO A;  4LLH A;  2WT7 A;  1T6A A;  1M1J C;  4RO0 A;  4E0H A;  1N7S D;  3B29 A;  4WBA A;  3AED C;  3EWK A;  1NVO A;  3PCV A;  5AC4 A;  2N9B A;  1NAY A;  1RE4 C;  1LWU B;  3BCC E;  1M57 C;  5DVW A;  4DT0 A;  4DOZ A;  2EPN A;  2H43 A;  1SFC D;  3U2M A;  3M9Q A;  2OGU A;  3JRM O;  2POH A;  4D6T G;  2VAS A;  1EZV I;  1USD A;  2WSC J;  2EIL C;  4N78 E;  4J7Y A;  2WZ7 A;  2M64 A;  4IGG A;  3WOD F;  2YWA A;  2RKL A;  1FFT C;  4HFK B;  1SQQ K;  2K9J A;  4GKG A;  1MMG A;  1AA0 A;  3AG1 C;  1ZHY A;  4QI0 A;  2IBZ E;  1ORJ A;  4YPC A;  3VMZ A;  3X2Q C;  4OH8 B;  4DJ9 A;  3ZQV A;  2ZFC A;  4C3B A;  3B4S A;  2R32 A;  2EPK X;  2FFD C;  2XLW A;  2MYS A;  1S5L E;  2K3R A;  4IAR A;  2KW3 C;  1VQ5 P;  1GL2 C;  1PP9 J;  3GOR A;  4EIY A;  3WUV A;  1VLS A;  1DD3 A;  2HMZ A;  1CI6 B;  3H2V A;  4BEM J;  3H1L D;  3AEE C;  3N24 A;  1RH5 B;  4ASV A;  3A11 A;  4MVR A;  3T6G B;  5AVW B;  1V55 C;  4Y99 B;  2KS1 A;  3ZTM A;  2KNH A;  2XXA B;  1R8E A;  3CL3 D;  1GMJ A;  1EKY A;  1SZI A;  1M6T A;  1OCC C;  1AUE A;  1NZE A;  2HMQ A;  1MFT A;  2IM8 A;  2HFI A;  4E0I A;  3LW5 J;  2R5D A;  2M8R A;  3U3B A;  1SFC A;  3TGU J;  1R5S A;  2R3S A;  1S05 A;  2IXN A;  1BGY J;  2P58 A;  2Y39 A;  3KYI A;  3CD6 P;  3I55 P;  1SQQ E;  1I4Y A;  2WZG A;  4J32 B;  2QEX P;  1RCP A;  2ZT9 B;  1N73 C;  1SQV E;  4IL6 X;  3LEV A;  4MN4 C;  1KYO D;  5KAF E;  3IQC A;  1L0N J;  1MMN A;  3MP7 B;  2XZR A;  3LLK A;  3T4R A;  1IZN B;  3BVH A;  1PGP A;  1D7M A;  1H8A A;  3JCU Q;  5DJU B;  2KK7 A;  3K33 A;  5TJ5 E;  4F4B A;  1YJ9 P;  3U8P A;  2N1T B;  3L71 G;  5APY A;  2Y0E A;  2ZXE B;  3FXH A;  3WU2 H;  3QWO C;  2WPV B;  2K37 A;  1T3U A;  2NG1 A;  1IFD A;  2I1J A;  4PK4 A;  1LWU A;  4JYB A;  3G3Z A;  1KFM A;  1JMW A;  1T6U A;  4I7Z C;  1MZ9 A;  2L81 A;  3IEE A;  1GM5 A;  1X22 A;  5EFW B;  5KKZ C;  5APU A;  4M3L A;  4GYT A;  1NTK J;  1D1B A;  3ZSU A;  1BCC G;  4DVY P;  5KYY B;  3KZI E;  3I5P A;  3JZ0 A;  5B5E H;  4ER9 A;  3S9O A;  1JMB A;  3TGU D;  1QLE D;  3GMA A;  4BG0 A;  1NYH A;  1RQU A;  1E2X A;  1BZ4 A;  5DS4 A;  1YJG A;  2R7Q A;  5B66 E;  4DJG A;  4IWB A;  4JVS A;  2Y3B A;  2YMK A;  2VCB A;  5KTB A;  1WGW A;  3F5H A;  1RY3 A;  3UMH A;  256B A;  1CI6 A;  4JTD B;  1YYC A;  1A02 F;  1M2V B;  2L9J A;  1L0N D;  1Q7Y Q;  3NKE A;  3SXY A;  2PGD A;  5KJ7 A;  3BAT A;  5H2F H;  2B9B A;  1RF0 A;  5COG A;  2EPL X;  3LW5 H;  3C8Z A;  4JRZ A;  2XXA A;  3ZDL A;  4EOT A;  4KI2 A;  3QZC A;  4DOJ A;  1NTM J;  2A1D D;  4C7O A;  2JR8 A;  1UG7 A;  4EIJ A;  1R5L A;  3P8M C;  2OTL P;  5K0I A;  3RGU A;  5KAI E;  1L2P A;  3CWB J;  4U5D E;  3ITF A;  3DXJ F;  2VC9 A;  2O3J A;  3MUD C;  1ZN5 A;  5AW6 B;  2YIU C;  1NU1 K;  3DJU B;  3HUS C;  5KYW B;  4NCQ A;  3NMK A;  3MZW B;  4XQ1 A;  3HE5 B;  5L8R J;  1NKZ B;  1IFI A;  2E74 D;  1L0L G;  2E43 A;  2YMY A;  3KHU A;  1ZME C;  2PF4 E;  1YYJ A;  2WL8 A;  3M4C A;  4H13 C;  4CS8 A;  3VF0 A;  2WPQ A;  3H2U A;  3M91 A;  5EGY A;  4AE4 B;  2N1T A;  3AEC C;  3MBG A;  2JJL A;  2DYS C;  1KB9 D;  2OYO A;  1M1J B;  1AVY A;  1YJW P;  1RE3 C;  3KQG A;  2CPS A;  5KLI C;  4W80 A;  2A0U A;  2BAS A;  2AEM A;  4BJ5 A;  3CCV P;  3S28 A;  5DJT B;  2A69 F;  1HH0 A;  3EG9 B;  2PFX A;  3SXK A;  3HE4 B;  5TJH A;  1BE3 D;  4RD9 A;  2BE5 F;  4AYC A;  1BDJ B;  1FZG A;  2IX7 C; 
#chains in the Genus database with same CATH homology
 3S9O A;  1DIP A;  1JOG A;  1S1C X;  1VL2 A;  4H44 D;  3GMA A;  1NGM B;  2QJK C;  4EBJ A;  1NYH A;  4I7Z B;  3AE5 C;  1RQU A;  3RL0 g;  4H0L B;  1WOL A;  1KQF B;  2WSF J;  1DD3 A;  3AEB C;  3D70 A;  2WQY C;  3AEA C;  2YMK A;  3O6Q A;  2JO1 A;  3Q5R A;  1IK7 A;  3AE9 C;  2OQQ A;  3AEE C;  3JYY A;  4H0L C;  3RQF A;  3AJM A;  1HF9 A;  3C8V A;  2D2C D;  1DD4 A;  1WMK A;  4XFJ A;  4XEK A;  4XEF A;  4RKU J;  4OGQ C;  1OW6 A;  2E74 C;  2E75 D;  2PBE A;  1Y9B A;  4XEV A;  4Y28 J;  1KIL E;  3AEF C;  3G9R A;  1S5L X;  3AE7 C;  1R8E A;  1GMJ A;  1KQG B;  1QVX A;  1WTY A;  2JPU A;  3C8G B;  2V7Q J;  3FGA D;  1VF5 D;  1K40 A;  2ZT9 C;  3RQG A;  3GF3 A;  1O3U A;  1OMI A;  2E76 C;  3LW5 J;  3U0C A;  1FDO A;  5F28 E;  1RQV A;  2BEQ D;  3AE1 C;  3AE6 C;  2P10 A;  3B71 A;  4OGQ B;  3C8G A;  1V4A A;  2E74 B;  2MKV A;  3AE2 C;  1OW7 A;  2JP3 A;  4PV1 C;  2HSB A;  1PV3 A;  1PIX A;  4U7J A;  4R4L A;  4KT0 J;  2IDB A;  2G3A A;  4R32 A;  1OW8 A;  3D6Z A;  4EBK A;  1ZZP A;  3BRJ A;  2ZT9 B;  3ABV C;  1Q90 D;  1EXJ A;  2KK1 A;  2E76 B;  3MFN A;  1ZP0 C;  2H88 C;  2YIU C;  1U57 A;  2L6F A;  3GF7 A;  4IL6 X;  4YTP C;  4GDO A;  1ZRT E;  3AEG C;  2QJP C;  1K05 A;  3RK3 E;  3GM3 A;  4Z1M H;  2O01 J;  4H0L D;  4H44 C;  2Q00 A;  1UFB A;  3R4Y A;  3O10 A;  5M1B A;  1MKM A;  4H13 B;  1HJ0 A;  5L8R J;  1EXI A;  1AJY A;  4OGQ D;  3L8J A;  1PL5 A;  4R4M A;  3L8I A;  3TUL A;  2E74 D;  4PV1 B;  1ZOY C;  3AE3 C;  1KOR A;  1K04 A;  1YQ3 C;  3AED C;  1ZME C;  3SFE C;  3D71 A;  3EWK A;  3Q5S A;  4H13 C;  1YQ4 C;  2D2C C;  1KTM A;  1WWP A;  3AE4 C;  3GLM A;  2WPV B;  3Q5P A;  3AEC C;  2ZT9 D;  2H89 C;  1UIX A;  3Q2Y A;  2E76 D;  2E75 C;  4YXD C;  4H44 B;  1KNY A;  4NQF A;  1VF5 B;  2J5U A;  2L6G A;  3C8G D;  3GM2 A;  1JB0 J;  2WSE J;  3Q1M A;  2NZ2 A;  5KLI C;  1FDI A;  2QIW A;  3H25 A;  4I7Z C;  1KMI Z;  1VF5 C;  2QJY C;  2WSC J;  3IAO A;  3IN6 A;  4H13 D;  3SFD C;  3GM1 A;  2FBW C;  4PV1 D;  2D2C B;  3K7D A;  2QSI A;  5KKZ C;  2JX0 A;  2YWA A;  3Q3D A;  3AE8 C;  3RQE A;  3U3F A;  2BEZ F;  3T97 B;  2LK4 A;  3C18 A;  2E75 B;  3D6Y A;  2L6H A;  2G8Y A;  2FYN C;  4TT3 H;  2FXP A;  3JZ0 A;  2K9Y A;  1TU3 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...