3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
3AE8C 3AE1C 1WWPA 3L8IA 3GM3A 1ZOYC 4XEFA 3SFDC 4XEKA 3C8GB 2YWAA 1O3UA 3AE9C 2HSBA 2WQYC 3S9OA 3RQGA 2L6FA 3U0CA 3AEFC 4YXDC 1ZZPA 3C18A 4NQFA 4R32A 2L6HA 1WOLA 1K05A 2H88C 2JPUA 3AEGC 1UFBA 4YTPC 2LK4A 3AE2C 1YQ4C 3AE4C 3AEAC 1JOGA 3B71A 3C8GD 3GM1A 4EBJA 5F28E 3O10A 3AECC 3JZ0A 3AE6C 3RQEA 1KNYA 3AE7C 1PV3A 2G3AA 1K40A 3K7DA 4XEVA 3TULA 1KTMA 3SFEC 2KK1A 3AEDC 3GM2A 3MFNA 3C8GA 1YQ3C 1K04A 1QVXA 3AE3C 1OW8A 2Q00A 2H89C 3L8JA 3AEEC 2L6GA 3ABVC 3AEBC 3AJMA 2FBWC 3U3FA 3AE5C 1OW6A 1V4AA 3RQFA 3BRJA 1ZP0C 1OW7A 2JX0A 2PBEA 3JYYA 1WTYA 4EBKA
chains in the Genus database with same CATH superfamily
4AUWA 3LIDA 3RW0A 3V5YA 2KSFA 5A6KA 3ZG1A 4YXWH 2R32A 4DRJB 3FMSA 1HWTC 3LNMB 3CX5E 4J7YA 1ZHZA 1CI6A 2JJLA 2K9JB 1JR8A 3FVYA 1EZVD 2HV7A 3EGXA 3BVHA 1RMVA 2VCBA 2PP6A 1TKNA 3CAXA 4Z9JA 3W8HA 2WQYC 1GU4A 3M15A 4ASWA 3K1HA 2ZFCA 2KYVA 4TLFA 2WTYA 4JEBA 1N73C 3H1KJ 4YXDC 1S05A 3GHGB 1FAPB 4RESB 1ORJA 4L73A 2BEQD 3H1JD 2OYIA 2Z4EA 2N9BA 5KKZB 5DQZA 2HSQA 3MYFA 4PR9A 4BJ5C 2YL0A 2E43A 4QI0A 4I3MA 3H1IE 4NC3A 3JT1A 1M6TA 2LCHA 1IC2A 5KAIH 2K3RA 1FOSF 3FOOA 2Y69C 4N6CA 3TF5A 4WY4B 2ZXPA 1KYOH 3LW5H 2I1KA 2JP3A 3LS1A 2WPSA 3L4FA 3OJAB 1TWHA 1RE3A 1H9TA 3L71J 3EZHA 1Y47A 3GF3A 1NZEA 4YK5A 1YVIA 3ITKA 2KK1A 1JY2O 2IM8A 1H6GA 2J8WA 1SF8A 5B5EE 2H7HA 3DJUB 4OWFA 1N86A 2PNOA 1ZV8A 1LE2A 5CCHA 3OA1A 2E75B 3U1AA 1MV8A 2OTJP 3TGUD 4HEAJ 4XFJA 1QVFO 1HE1A 4I2LC 3A3YB 4K35A 4U5EE 1Z23A 5AVVB 2WPRA 1A7VA 2LXBA 2J9VA 1KQFB 2J0XA 2JO1A 3D6ZA 3WUVA 1URQC 1VPCA 4C46A 2Q9IA 1FFHA 2W6AA 1VQLP 2NG1A 3KPHA 2A06E 3RQFA 3U8PA 1ZP0C 5KYUA 3W8IA 1OFCX 2ZXXA 2W45A 3GF7A 2FYUK 1C17M 4IJJA 1YI2P 4MVMA 2DGJA 1N2DC 4O6MA 3U9MA 3JCUH 1DOWA 1BDDA 2O01H 4AE4A 2J7PA 1EC5A 2HFED 1L4AA 2P6VA 4IWBA 4KNVA 4CS9C 3H32B 3RK2D 3IPMO 3KQGA 2XS8A 1VQ8P 3PP5A 1Q86Q 2CPSA 1SLQA 4ASVA 1RF1C 1Z7Qc 3K1IA 4EWCA 5L0GA 2P67A 3SWFA 2A68F 3JTLO 3T97A 2L6HA 1G1IA 1K05A 1QL1A 4L6RA 1SVFA 1OKKD 3DZAA 1NWQA 1LNQA 1L0LK 4K3AA 2QIWA 5GTHE 1SR2A 1LP1A 3CCSP 3EQLF 5JVEA 1YQ4C 3ITFA 1GL2C 3I55P 3O10A 4WBAA 1KB9D 3IFMA 1OIPA 2QJPC 1Q0DA 1T9KA 4DXWA 3H1KD 2HJ3A 4LGDE 2LD6A 3K7DA 1PP9G 4KBLA 2N1TD 4YT2A 3RK2B 2PAJA 5L0FA 4MVSA 1HBWA 5CCGA 3MFNA 3F89A 2WSEJ 1HJ0A 1M1JA 2Q3TA 4CPGA 1KFMA 2Q00A 1KYOD 3CLQA 3RL0g 2ZT9B 2BCCE 2ITAA 4U9EA 3U5SA 3RFYA 1BE3J 5AW5B 1FOSE 3UNGC 1VL2A 2QY9A 4MTGA 5KYXA 3G71P 2J46A 3P32A 4K7BA 2B0JA 5GPGB 2Q5UA 4JTDB 5AVYB 3HKKA 1BGYG 4G7HF 2OYOA 1F1MA 2DYRC 1FZGA 3BRJA 1NFOA 1SQPG 1G1JA 4W8PA 2GA0A 3Q5SA 3R4YA 1PP9D 3RK3D 1VQ4P 2OYIC 2N1TB 3MGNA 5F5FA 1M2OA 3AG2C 3UMKA 3WMM0 3ZC4A 3AE1C 1IFMA 2EPLX 1EDLA 1EKYA 1E85A 1EDIA 4U3FJ 2YNYA 3D6YA 2L7AA 3TJ5A 3RGUA 2JR8A 2R5DA 1Q0MA 2Y0CA 3TK1A 1Q0FA 3AE9C 5AW2B 4MVOA 3KYJA 5AW1B 2H7OA 4HE8D 3EFOA 3A2AA 1OXBA 1M56C 3W67A 5AC5A 2L6FA 2YIUC 2XNDH 2M3BA 3U2LA 1QQ3A 2G62A 1NTZJ 4HB1A 2J59M 1B68A 5CJ4A 1BGYD 5L8RJ 1QPUA 3O8ZA 3GW6A 1ZXGA 3RYLA 2RMZA 4JKVA 1L0NJ 4I1OB 4U7JA 1JCCA 1S1CX 2AP3A 3L72E 2HODA 3HTKB 3DKAA 3AGTA 2N9YB 3P8CE 1ZN5A 5CCHC 1CPQA 2FGYA 3CC4P 1M2VB 1OCRC 3RH3A 1T8ZA 2R7VA 3NTNA 3GM1A 4GYTA 3SXKA 2FYUE 2YLIA 4I1MA 3H65A 3L74J 1NTKJ 2NPSD 1L0NK 1KNYA 1PPJE 1PV3A 2O01N 2KQ9A 4K0DA 3L70J 1KTMA 3RVZA 3CL3D 1FZFA 1R5LA 3IQCA 1NTMK 3LLKA 3CCRP 1LKXA 1QVXA 2C04A 4XWJA 2CK3H 1RF0A 5KJ7A 3N4XA 1ZW0A 1C02A 2EINC 3KKBA 4XPXA 4DBRA 3MUDA 3V5BA 3TDKA 1SQVJ 2WSCH 1GW4A 3RIPA 3B5NA 1SQBK 2R3SA 3BASA 1L4AC 5COGA 2NZ2A 4H13B 1PGOA 3S0XA 1W2BO 2YKPA 4BXLA 1FC2C 2I8DA 2FFHA 4U5HA 3NMKA 5CMZA 5GTIE 5L3QA 2PFXA 1FZAA 3K1IC 2G3KA 1LWUB 2PBEA 1ZHTA 1Q0KA 2WZFA 1PFIA 1Z63A 2QJYB 1K8AQ 3K5BA 4N78E 1P84H 1A02J 1BE3D 3CWBJ 1CSBA 5C39A 1J1EC 4MVZA 2HUJA 3KZIH 3C8GB 2YWAA 3E1IA 4CDVA 1VQNP 4PACA 2ZYDA 4MW3A 4OIRF 3U0CA 1Q90D 3AOUA 4AL1A 1N7SA 2XZRA 1NHLA 4JTCB 5CCGC 1PCXA 2WT7B 4LLEA 4R32A 4J32B 1M1JC 3L75J 1LT1A 4IAOA 1A41A 2DB4A 3QTHA 1A02F 1VQPP 1LTAC 4YTPC 3PHF2 3E1RA 1KORA 3AE2C 2L5GB 1S5LE 4WWIA 4JPZB 2XDJA 1BSNA 4ULVA 4WJ0A 4OIOF 2R02A 1OCOC 3LESA 1PL5A 5E2QA 2OGUA 2ETSA 4HFFB 4C3EA 4JF7A 4JTAB 3L0IA 2KB7P 2H7BA 1LTTC 3WU2E 1NTZD 3CCQP 1JOCA 1LPEA 4IAQA 3OAKA 1XZPA 4EI2A 3U8VA 2YKOA 3DAFA 1SQXK 3E7KA 5JS5A 2FYZA 2LSEA 2VCAA 4AL0A 4W7ZA 4UB8E 2YL7A 5APUA 2I8BA 2MJZA 1D1AA 4ZKPA 3H1HE 3CCVP 5APTA 3L74D 3ABVC 3DMDA 2QJKC 4F4BA 2C9NY 4DVZA 2E74C 3L70D 2LFDA 4AX2A 4BEMJ 2HG5D 1RQUA 1Z3IX 4D4XA 2PGDA 3L73E 5DQTA 2SPZA 2FXOA 1E84A 2XM4A 4GDOA 3JYYA 3DJNB 2YHSA 3H1IJ 2OEXA 4EOTA 3V7OA 1OVVA 3ABLC 3J06A 3LLIA 2QTVA 2R7XA 1L0NE 4HYTB 1MMDA 3CZ6A 2YLDA 4H4KC 3GMAA 1URQD 1OCCC 2M4EA 1VF5B 3JRTA 1E86A 3TJ6A 2WVQA 1IJDB 1J8MF 5K5GB 2B87A 1NTME 2P1AA 5CBOA 1SFCD 4JC7A 4IGGA 1AQTA 3N0TA 3S9OA 5TJHA 3VRCA 4G78A 3N2ZB 1SQBE 3C7JA 1P84D 2RN0A 2AVKA 1RF0C 5KJ7C 1BSHA 3MUDC 3M4CA 3W2WA 3HD7A 1Q82Q 3O55A 2K9YA 4DVYP 2A45I 2D2CC 1R5SA 4XLPF 3EGDB 3AEAC 2A1DD 4BWNA 3EFFK 2PX0A 5KYWA 3OW2O 4JZAA 4G7OF 1U7JA 3U2MA 5APXA 3FAJA 3K33A 2IPPA 5EFWB 2OYHB 3TD7A 2Y39A 3CPWO 1SFCB 1FJPA 4EIYA 3EHMA 1ZYRF 3CCLP 2K37A 4MNDA 1TWAA 2FFDA 5CI8A 5F5HA 2VH3A 5BU8B 1NU1G 4RO0A 4EIJA 3MP7B 3FWLA 3N24A 1HMOA 3JYHA 4PK4A 1PD1A 2G3VA 1LS4A 4N6JA 5DVWA 1YYJA 1QX8A 3NRHA 4XA4A 3CWBE 1SS1A 3W4YA 3BCCG 4I6MC 1V74B 1RF1B 2FBWC 1QLEC 3V5XA 4KNWA 4YWQA 2KNHA 5DS5A 2Q3EA 1YJNP 3QWOC 1N7SC 1BCCE 4MVQA 3RBZA 1S72P 1KILE 1HY5A 1FZCA 2R7RA 4JQ0D 3CMEP 4RD9A 1R5ID 1KILA 5AVRB 3PJSK 4UB6H 3L8IA 3GM3A 1EA8A 4U5GA 4H44C 2ASRA 4I7ZC 1RQVA 3GG2A 2M5AB 1EXJA 4IL6H 2CCYA 4HKZH 4JCHA 3HJCA 3MX3A 4RJTA 1SQXE 4IFFA 2W27A 1S2EA 2ZXOA 1MNEA 3MHVA 1EZVI 1XZQA 1K9MQ 1LTJC 1ZRTE 3PMRA 2K88A 4Q7CA 1Q81Q 1U6HA 1QL2A 4C7OA 1BR1A 4XPWA 5B3SC 2R25A 3S28A 3MZWB 3AQCA 4GKGA 1KMIZ 2BCCJ 1RKEB 1NKZB 1M56D 5FCLA 1WOLA 1ZR2A 5KAFE 2R44A 1G5ZA 3H6PA 3IEEA 1VYIA 2KSEA 4FAPB 1EDKA 5AW3B 1JOGA 1Y4CA 2XSEA 2QVAA 3B0PA 3CSKA 2NUPB 3V4WA 3RKOF 4YL1A 3TQOA 3AE6C 1D1CA 3RQEA 3DXJF 1KB9H 1T6QA 1E83A 5KLVJ 3NKEA 5A6JA 2AXTH 1LTIC 5CCHD 2R7WA 3EFGA 1L7CA 4CSAA 4LERA 2K9JA 3O6XA 4PFPA 2KNCB 3CCEP 3TGUG 1LM3B 1IW7F 1W2EA 1S9KE 3WG7C 4I1LA 3M9BA 5KLVK 4C7RA 3JRMO 2Y3BA 3GHGA 1SQQG 5L0IA 1HGZA 5CJ0A 3CCMP 1OMIA 3AEBC 5BQGA 2MHRA 2XXAB 2R7OA 2HFIA 5T1DB 2P1JA 1VLTA 4WY4A 2W8ZA 3A0HE 2J7PD 3L72J 2R03A 1EXIA 1L4AD 3T4RA 1EZVE 3HNLA 4M63A 1VQOP 3R2PA 1OQCA 3L1MA 1RE4A 2MKVA 1ZU4A 1S5LX 1GGQA 3NDBB 2FYUJ 3QW1A 3HD7C 2I15A 3MTUE 1H89A 3NXSA 3RL0C 4XEFA 4H0LC 2X0CA 4C7NB 3VTPC 4XTKA 2VASA 1GD2E 3S29A 1JMMA 3H1JE 1SQQD 1OX3A 3G9RA 1LE4A 1QEXA 3EG9B 4MW8A 2QSIA 2G8YA 3G50A 2FFDC 2HPCB 1EDJA 1RJ9B 4CS8A 1PGJA 3HUSB 1RHZB 2ZXRA 3RF3A 1RY3A 3TSIA 2VRSA 1KQLA 2R7TA 1VQMP 5AW6B 2H7VC 4BRYB 4DCKA 3K66A 3CEXA 3H1KG 5IY5C 2CNWD 1JPNA 1U57A 2LKMA 3S90A 4AK9A 3W68A 1JTHB 2QNLA 1HVVA 2IBFA 1GMJA 1L0LJ 3C8VA 1YJGA 1ZHWA 4EHPA 3MD0A 1N1CA 2P10A 2R3CA 1BZ4A 2EIKC 2V4HA 4D6TJ 1J1DB 1FS0E 2IZ0A 3U3BA 2YKQA 3S4RA 3T6JA 2BCCD 3L36A 3ATPA 4NPFX 1FZCC 4DZOA 2WB7A 2QRXA 1KILC 3H32A 1N7LA 1TQGA 3ASNC 1J1EB 1BDJB 3V2NA 1OWAA 1SQPK 3C1LA 3MIWA 3L71G 5JT4A 1SMYF 1KYOI 1RXQA 1I5NA 2GFHA 1JRAA 3FOPA 3A9CA 4D4NA 3ZVRA 5CI9A 1NU9C 5E3CA 1USDA 2GA1A 3PTZA 3FAPB 1E79H 4NTFA 1Z5ZA 1ZW3A 3H1LJ 4YT4A 5TISE 2EPMX 1USEA 3NMJA 5KTBA 5COFA 1VDFA 2FKWB 2WITA 4OGQC 3IN6A 1LS1A 1IZMA 5D91A 1T6IA 3UR3C 3T6BA 3SYNA 2WSEH 5H2FE 4Y99B 4G0HA 1A7EA 1MUUA 1PPJG 3A0BH 4FESA 1HF9A 1CGOA 1IFIA 3GANA 4BEJA 3V5ZA 1UIIA 1NYHA 3ABMC 3NYMA 2HKVA 2E76C 1X8YA 1Q0GA 1S5LH 3W2VA 3EPVA 4Q5SF 1MMNA 2QLAA 4E0IA 3L71D 1GK6A 1QVGO 2HMZA 4WABA 2O3JA 3OWTA 1VLSA 1NFNA 4JW1A 2WSFJ 5KLVE 4CSAC 3L72D 1ZHYA 2AXCA 2OEVA 4P6IC 2GUSA 4JURI 3M91A 3A11A 2DYSC 3F46A 1APCA 2FYUD 3C63A 4Y28J 3H1HJ 3JCUQ 4X0RA 3KXDA 3OA7A 2QJKB 2V7QJ 4W7YA 4PJMA 4BJ1A 3AEGC 2J9WA 1G2CB 1PPJD 5BQHA 3GHGC 3B71A 3L73J 1IZNB 4JYCA 1RE3C 3ZTZA 2Q3IA 2F22A 5KKZC 5B66E 2JKVA 2XLVA 5KAIE 2H43A 4CIHA 2B9BA 3AE7C 2XRHA 2L91A 1KYOE 5E79H 2CGEA 2WZ7A 4QI2A 3BATA 4WY4C 1FU1A 2HODB 1OR3A 3FGAD 2C9LY 3RK3B 3ABKC 1L2PA 4JRZA 1TWGA 5D92A 3S1KA 1RE4C 2B89A 1NTMJ 1T6UA 4NY3A 1KU2A 1Q2NA 1LT9B 2GWWA 1FBMA 1TFKB 2P7VA 5DS4A 3NMDA 3D70A 4M3LA 3AEEC 1FMWA 4OD5A 4E18A 4GIFA 2KS1B 3QVZA 1CZQA 5L0CA 1D7MA 1S7ZA 1SQBJ 3FX0A 2P7JA 3K6BA 4NTAA 2QUPA 3HTKA 2UUIA 3HNKA 2RH0A 2E75C 1HW2A 1NJIQ 1BE3G 1M2VA 3SXMA 4YL0A 4CS8C 1X0TA 2AU5A 1VMAA 3ZTMA 2FYNC 1C03A 1QGKB 3HE4B 2XLDA 2O9XA 2IXOA 1JMWA 1OVUA 2IBZI 2XL4A 5AVTB 1N7SD 4OINF 1DH3A 5AVXB 4OVNF 1VQ5P 4C3BA 3FWNA 1L0LE 1J8YF 1BGYE 2YEVA 2J5UA 2NPSB 1GM5A 3JCUE 3M0AA 4H44D 4U3FG 1SQPE 3DM9B 5AW4B 4D6TE 2OJQA 1V54C 2HYNA 3EHNA 3PHLA 3HE5A 2E5YA 2M64A 4JJFA 1MKMA 2ICWG 4P9TA 1VTMP 1JY2P 3IQTA 1KV4A 1Q7YQ 4AQRD 3V2RA 2QE9A 2GM4A 2E5TA 3M06A 3SEOA 3KL4A 1ORYA 3GORA 3Q7LA 5DJUB 2JPUA 4CDAA 3M1CB 4E17A 2PP4A 2VCCA 3X1OA 1AA0A 2RD9A 4U5BE 1LWUA 1NTZG 1IK7A 2V26A 3SNHA 4KC9A 3NMIA 1BR2A 1UG7A 3KH2A 1RCPA 1L0NG 1G4US 2PFDA 1AVOA 1BCCJ 3H1LE 3SWKA 1YZCA 3FHDA 4XEVA 2EPNA 3BRVB 2YXRB 1LIHA 4U3FD 5AVWB 4H44B 2C03A 2X51A 1YARO 4I7ZB 3C8GA 3IF4A 5JUAA 3L74G 1NTKG 1YJWP 2KJGA 2JD3A 2Q4FA 4JVSA 1H0TB 4P9FA 2AWYA 5KYYB 2W83C 4ZMDA 1SQXJ 3NKDA 3L70G 5AW7B 4O7GA 5T3WA 3RK2C 1LTJB 3L73D 3UGOA 2LQGA 4EUKB 4N6HA 1I4ZA 2WT7A 4LC1A 4NPDA 2L6GA 3CXHI 2P0NA 5AGFA 3S27A 4ANJA 4YT8A 3DWWA 4YJWA 1H7IA 5APYA 5A69A 2IBZE 4JBZA 3ECSA 3HNJA 3O6QB 1L0ND 5L3VA 2ZT9C 256BA 1SQVG 1WT6A 4LLCA 4IRUA 3NFQA 1YA9A 3CI9A 3I4UA 4JE9A 2Y0DA 3CX5H 2B88A 3VN0A 4PJNA 3USSA 1NTMD 1FZBA 5KAFH 2A0BA 4MS2A 2Y9YA 4N4WA 2ZVNB 2QEXP 1DD4A 1NTKD 3V2QA 1N73B 4B86A 4K1OA 5AVQB 3B0VC 1U7MA 3M9QA 2EILC 3VP9A 4DJGA 1I4YA 2Z5HA 1JY3N 1SZIA 3VF0A 1FNTc 2Y3GA 2C0WA 3VMAA 1X22A 4BG0A 3HD7D 1ZHXA 3CWBG 5CIVA 2Q9CA 1ORSC 4H0LD 4W8KA 4IFMA 3RVYA 3UMHA 2NUTB 3PDMP 2XKMA 4JYBA 2H8AA 3C18A 3QVYA 1FDMA 3EWKA 2KZJA 2XL6A 4MTOA 1SQVD 3H2UA 1P84I 1M1KQ 2AEMA 2IFNA 4ZLDA 5AW8B 1T6AA 2POHA 1HH0A 4LLHA 1YTZT 1Y6DA 3LS0A 2LXCB 1NU1K 1M57C 1BCCG 1JPJA 3F5HA 2CPBA 2OJED 3ASOC 4JIOA 4J7TA 4PD4I 1VQ6P 5AVZB 2IFMA 3L75G 2KIKA 2NPUA 1TFOB 5APWA 5CBNA 2G3AA 1JM0A 3TULA 3HTKC 5B5EH 1A0BA 2HV6A 5JP7A 2EPKX 3SFEC 4CJOA 4OIQF 1D0XA 3GM2A 2GAQA 3CXHE 3AGUA 3HD7B 1AFOA 3CWBD 1V55C 1IK9A 2E87A 5KLIC 2CW0F 1YHQP 1J2JB 2WMMA 4JCZA 5B1AC 4AYCA 3B5NC 2A6EF 1JB0J 5E3AA 1URQB 2WZGA 2D4UA 1VOMA 2GDCA 3H1JJ 4GT1A 4XLNF 1VK5A 1JUNA 5AVUB 2Q7RA 3FXHA 1BCCD 3SXZA 4E0HA 1KILD 2Q9BA 1FDIA 3Q1MA 3ZWIA 3M0DA 3V6IA 3CC7P 1HE9A 1NG1A 4U5CE 2WWWA 4WGZA 2YXQB 1GL2D 1KFNA 3L75D 3TNUB 4PV1C 4RKUJ 3EGDA 5AC4A 2LR2A 2HLOA 3D71A 4H13C 4GOFA 1OVRA 2OYHA 3NYJA 4OGQD 1OXZA 3AG3C 1SFCA 2RKLA 3DD7A 2IZ1A 1H88A 4IB4A 1LWUC 2FAPB 3SXYA 2IOQA 3H1IG 4YT5A 2LP4A 3BRTB 1IFNA 1ZR4A 3DE9A 3ZIBA 1P84E 3CC2P 4GQHA 1AUEA 3KYQA 4RDAA 3CX5D 1FTSA 2Y3HA 2E76D 3KZIE 4CS9A 3AEFC 2OCCC 4PD4E 1ZLLA 1GL2B 1X9VA 5HV9A 1M90Q 5GTHH 4YL3A 4ONSA 2M0BA 4KHXA 1FJKA 2YVKA 2QJPB 1EI7A 3G6EP 2AWCA 4O79A 2NSGA 1IFPA 2J58A 1PD0A 2IDBA 1KC8Q 2JEEA 2UUHA 3M4BA 3X2QC 3AECC 1HMDA 3JZ0A 3C8ZA 3H1ID 1CW5A 4XE5B 4Q4ZF 2Z15A 5B1BC 2PF4E 1SQQK 5TJ5E 3POVA 2M5AA 1CI6B 3EGXB 4WVZA 2E76B 2XV5A 1YQ3C 1Y9BA 1KN7A 1XWJA 1TWCA 2A06G 2WZLA 3WUUA 3DI5A 2KC3A 1WMKA 2ZJSE 2KGOA 2ZD9A 2NRGA 1G4WR 3LNRA 3OEOA 2OOCA 1FMVA 3DE8A 3B29A 2H89C 4WY4D 5A6BA 1YYCA 2IYPA 1SYQA 1JY3O 1DEEG 2OYIB 3ZDMA 1RKEA 2KLUA 3NYLA 2FY8A 2P61A 3VYWA 1VYKA 3U3FA 3E70C 5L0DA 2QM8A 4OH8B 5APVA 1NU1E 2AEFA 1AEPA 2J9UA 1H9GA 1PGPA 2NUPA 1LJ2A 4MVRA 2VC9A 4TT3H 1JNMA 1NAYA 1IFJA 2TMVP 4NPEA 2YIUB 2A06D 3AG4C 3BCCE 3RBXA 1DOVA 2E75D 3VMYA 2BC5A 1MZ9A 5FZTA 1FR0A 1OXKA 5T3TA 2KNCA 5B66H 1T2KC 2WPQA 1R8EA 4QDLA 3LW5J 2R9RB 4LACB 1FDOA 3PLNA 3QW0A 1VF5C 4OD4A 3R7CA 4A7PA 3GEEA 1NO4A 1PIXA 1RKCA 2CYDA 1IFDA 2R7QA 3G4SP 3B9QA 1MNDA 1AVYA 2FXPA 4DOZA 1ST6A 1CGME 1LI5A 2XXAA 2H88C 4XPYA 1KD1Q 3WAQA 1PP9J 4ZKUA 3HRNA 5KYUB 2YZSA 4NTBA 4R4LA 5F28E 2BCCG 1N8RQ 3B4SA 3M0DC 4PJ0E 4WGYA 3GWNA 2YMYA 4GODA 2FYNB 2PX3A 1ZW2A 2MWQA 4AE4B 5M1BA 4C7NA 1K04A 2R7SA 1L4AB 1DEBA 2OYHC 2A0UA 5CCGD 5KLVG 3CD6P 5KYNA 3S84A 1SFCC 1NOHA 3EG9A 3G4ZA 4HFKB 1K73Q 1BGYJ 1KZUB 3L8JA 2HPCA 1NH4A 1RJ9A 1CPRA 1SQPJ 2O01J 3JSZA 3HUSA 1KB9I 5GTIH 3T97B 1D0YA 4BRYA 3AE5C 3U1CA 1QZXA 3CQZA 2K1AA 3TGUE 1FFTC 1LP1B 3DAGA 5A6AA 3A5TA 2EIMC 1ZVZA 1OW7A 1JTHA 3GEIA 5BQIA 2HS5A 4EBKA 2Q6QA 2PRRA 2W4MA 3QH9A 1NU7D 4YN0B 2ZVOB 1YJ9P 1AV1A 5L0JA 3CCJP 1JAFA 2KSJA 4IOIH 1SQQE 2ZT9D 3AQBA 4HH2A 1YITP 5AVSB 2W9YA 5KLVD 2C0XA 3L72G 2W6JH 3LIEA 4UB6E 3KDPB 2HSBA 1U0BB 1M1JB 2YKZA 1JEKA 3VOPA 4IL6E 2HR3A 3VMXA 2FYUG 3VP8A 2RSEB 3JC22 4DBQA 2IYOA 2E74D 1LTSC 2OU6A 2YO2A 1E5WA 1HJBA 5KYXB 4KI2A 2CNWA 1OCZC 4G7ZF 1CGNA 5DS6A 2XL8A 3I5CA 3ZSUA 3UIAA 1JCDA 1TR2A 4B6IA 4EBJA 3WU2H 3C9IA 3GLMA 1QKRA 4LDKA 1U89A 1TU3F 2ZXEB 4Z9HA 3L34A 2R05A 3P8CD 1OKKA 2WSFH 3A7OA 2YRFA 4ULWA 1M57D 4I44A 3US6A 3ZDLA 4LDQA 1EQ1A 1KB9E 1L0LG 4UB8H 1UIXA 3P7KA 3EFOB 2AXTE 3H1KE 1KQGB 3P8MC 2WSSH 2E74B 3L37A 4D6TG 2XLWA 4MN4C 2V7QH 3DM5A 3WHNA 2VB6A 2N1TA 2OKUA 4DJ9A 5KJ7D 5HSWA 1MFZA 4GOEA 3SZRA 3WODF 2EPOA 4EBBA 2YQYA 1T01A 4L74A 2D2CD 2Y3DA 3B5ND 2ZYAA 2XLHA 2O1JA 1HTLC 3JSEO 2D5RB 1G2CA 4MQ9F 1NSGB 2XS1A 3MYIA 3II6A 3SP1A 2JX0A 2EIJC 3C62A 2OQQA 4C3DA 3UGPA 3L35A 3L71E 3AE8C 3H1LG 1MMGA 2KOGA 2WL8A 1L0LD 2BE5F 3FDQA 2HJMA 2W6BA 2J45A 1O5HA 2XLMA 4PV1D 4O6NA 4A2NB 2ZAEB 2AEJA 2I1JA 1SQPD 3VAYA 2E42A 1PP9E 4D6TD 3RK3E 3SFDC 4XEKA 4GEHA 2HZ8A 2LIGA 1GW3A 4H13D 1T3UA 1LTGC 4XQ1A 3H25A 1NBBA 4N78D 1ZU5A 3LAYA 1JO5A 4MTFA 1NTZK 1JY3P 5KLIB 2Q7CA 1LT9A 2D2CB 4PJLA 3TOLA 3CXHH 1QLED 1R4TA 2V3CC 3B5NB 2WVNA 4PFOA 4QMAA 5COMA 3Q2YA 2KS1A 2IBZG 3G3ZA 1LVKA 3LEVA 5JSLA 4CIPA 3H1LD 4EKWA 1LTBC 4KJMA 2LK4A 4Z9IA 1NTKK 2WSCJ 1GK4A 3HNIA 5JLIA 3C8GD 1M7LA 3HUSC 3B8EB 4R4MA 2P2UA 4PV1B 1FAVA 2J0WA 3HE5B 5EHHA 1YIJP 3H1HG 4N3YB 3Q5PA 3HE4A 1K40A 3LUTB 5K0IA 1NKNA 3PCVA 4DRIB 3JSVC 3AEDC 1W5CE 4CS7A 3L73G 2O1KA 2A6HF 1MQVA 3EH2A 1MMAA 2NPSA 1OW8A 1SQVK 1JMBA 1EQ7A 1J1DC 2IBZD 1XTGB 1AVOB 1HGVA 1GZLA 1N7SB 2XLEA 2R5BA 2ZXWC 3F47A 4IARA 3WUTA 4BJ6A 3AJMA 1YAUO 2XM0A 2GUVA 2NSFA 2R7UA 2HMQA 5EGYA 1SP4A 1NTMG 1DX7A 3Q6NA 2OARA 4U9DA 1W2WA 3Q7GA 2BASA 1WGWA 3QMKA 4PD4H 3Q6MA 3H1HD 4L76A 1AJYA 4CBEA 4J30B 5APQA 1X79B 1T5OA 4IFDK 3EQ2A 5B3IA 3FXEA 5AW9B 2IXNA 4ER9A 2ZYGA 3ZQYA 5BUOA 1SQBG 4N06A 2M3EA 1LI7A 1WWPA 4Z1MH 3QZCA 5E33A 4BJTA 2BEZF 2OTLP 4CDYA 2LFFA 4O6YA 5AW0B 1DD3A 4DOJA 5CHXA 3A0BE 4E7SA 3GEHA 2A45H 5JRAA 1O3UA 4Y99C 2B0HA 1YLMA 2W4BA 2YMKA 3TYYA 1H0TA 5KYYA 3T9OA 3CMAP 1WASA 1BE3E 3N7NA 1D1BA 2L81A 1ZZPA 1LTJA 2WVRA 3SSUA 1GU5A 4MVUA 2OTKE 1T2KD 1BBHA 1GDTA 3PH0A 4NQFA 3LJBA 4CX9A 1FE6A 3BEHA 3O6QA 5EK0A 1UFBA 1VF5D 1SQBD 2FXMA 2N1TC 4FX5A 2H8PD 2A69F 2IYLD 1NU1J 4U3FE 1OZHA 3H2VA 3CXHD 3Q3DA 3U59A 4BPMA 2OQMA 3KPEA 3RL0D 3VM6A 3TOMA 1E2XA 3I5PA 4JEAA 4H54A 1FZEA 2DI3A 1N73A 1XTCC 1BR4A 1WRGA 3V4QA 1HUCA 4ZLCA 1PZQA 1H8AA 3VYIA 3M79A 2ZPAA 2Q9AA 2B87B 2YO3A 3T6GB 3B0UX 3BCCJ 3MBGA 1YDIA 1VB5A 5DJTB 1MFTA 5E79E 5DLJA 1RH5B 3FXDA 1NAFA 1NTZE 3IQ6A 4BJ5A 4CJGA 1ZMEC 2MYSA 1GTWA 2IX7C 3EZIA 3AG1C 4E7ZA 1LGHB 1GS9A 2NUTA 1S4XA 4A4AA 4IL6X 5APSA 4RBNA 4ZNCA 3RK3C 2XU6A 2L9JA 3A0HH 1SQXG 4L75A 4LDRA 4WB4A 2KP8A 1O87A 1S3JA 1OW6A 3MLGA 1LT9C 2P58A 3EH1A 5BU5A 2YLGA 3L74E 1NTKE 2JWDA 1PGQA 3GODA 3RL0B 4H0LB 3GWLA 1WTYA 1IO4A 2JWAA 2A45G 5KYWB 1JY2N 1BDCA 3L70E 1OR2A 2YL3A 1NVOA 4PJJA 2QA4P 4KT0J 1M8OB 1NGMB 4FWVA 2Y0EA 1ZOYC 4UDVA 2OG2A 2FFDB 1KQSO 1AQ5A 4DT0A 2KLVA 5L0HA 4PD4D 1L3PA 4PJ0H 3U9JA 1SQVE 3VMZA 3Q5RA 2KI7B 3RQGA 2Q1KA 1Y8AA 2KUBA 3IR9A 1T3JA 1URQA 3CX5I 2IXMA 1SQXD 2BL2A 2IXPA 4W80A 1VQ7P 1VQKP 4EDFA 3KMIA 2Z5IA 4HJGH 3HLZA 1ZRTD 2QG4A 3E9VA 2W90A 2NPSC 3SWYA 3IAOA 2UWJE 1D0ZA 4DRHB 1YYXA 3KYIA 4JJGA 3TNUA 1YBKA 1YA7O 3AE4C 4BJ6C 1FZCB 2DW3A 2QJYC 1YTZI 3TGUJ 3CCUP 1KILB 1HW1A 2XNXA 2Y9ZA 1QSPA 1WATA 3ZQVA 3I56P 5BVZA 1VQ9P 1G8XA 3EJNA 1DIPA 1RF1A 5A6BD 1A7DA 2M8RA 2KK7A 1SQQJ 4U5FE 4O9BA 3IHUA 4EYYQ 2WVOA 3NG1A 2XLOA 3AE3C 4OIPF 3IQ5A 2KW3C 1EZVG 3V2PA 2KYHA 4OGQB 3UMIA 1NLXA 3TK0A 4YPCA 5TISH 4C7OB 2QE7H 3L75E 1NU1D 3LEOA 2WPVB 3G4XA 1GL2A 2J9BA 1S9KD 3O39A 3I5QA 2JDIH 2QM7A 1YZAA 5H2FH 1WN0A 3PRJA 1Z6AA 3M9HA 2CDQA 2YL1A 1GQAA 1V4AA 3H1JG 4NCQA 2KZIA 3BCCD 2KXPB 4U5DE 1Z56A 3KHUA
chains in the Genus database with same CATH topology
3GF7A 3D71A 4H13C 3AE8C 4TT3H 2FYNC 1HF9A 2MKVA 3AE1C 1NYHA 1S5LX 4Z1MH 1WWPA 3GMAA 4OGQD 3GM3A 3L8IA 4H44C 2ZT9D 4KT0J 1DD4A 4I7ZC 2BEZF 2E76C 4PV1D 1NGMB 1RQVA 3D6YA 1ZOYC 1VF5B 2E75D 1EXJA 1DD3A 3RK3E 4H0LC 3SFDC 4XEFA 4XEKA 3C8GB 2YWAA 1O3UA 3AE9C 4H13D 2HSBA 2WQYC 1R8EA 3LW5J 2YMKA 3S9OA 2J5UA 3H25A 1ZRTE 3G9RA 3Q5RA 3RQGA 4H44D 2L6FA 1FDOA 2E76D 2YIUC 2QSIA 3U0CA 2WSFJ 2G8YA 1Q90D 3AEFC 2D2CB 4YXDC 1VF5C 1ZZPA 4H0LD 2E74D 1MKMA 3C18A 1PIXA 3EWKA 5L8RJ 2BEQD 1KMIZ 4NQFA 4R32A 3Q2YA 4U7JA 2L6HA 2FXPA 1WOLA 4Y28J 1K05A 1S1CX 3IAOA 3O6QA 2H88C 2V7QJ 2JPUA 3AEGC 1UFBA 2K9YA 1VF5D 2QIWA 4YTPC 1U57A 2D2CC 1KORA 2LK4A 3AE2C 1YQ4C 2WSCJ 3AE4C 3AEAC 2IDBA 1IK7A 3B71A 1JOGA 3C8GD 3R4YA 4R4LA 3GM1A 4EBJA 4R4MA 2QJYC 4PV1B 1GMJA 3C8VA 3GLMA 3AECC 3O10A 5F28E 5KKZC 2JP3A 3Q3DA 1TU3F 2P10A 3JZ0A 3AE6C 1PL5A 3Q5PA 1KNYA 3RQEA 2QJPC 3AE7C 1PV3A 2G3AA 1K40A 3K7DA 4XEVA 3TULA 1KTMA 3GF3A 1DIPA 3SFEC 2KK1A 3AEDC 5M1BA 4H44B 3GM2A 3MFNA 4I7ZB 2E76B 3FGAD 3C8GA 1UIXA 1YQ3C 1K04A 2WSEJ 1Y9BA 1QVXA 5KLIC 1HJ0A 3AE3C 1KQGB 1OW8A 2E74B 1WMKA 2Q00A 3RL0g 4OGQB 1ZMEC 1JB0J 2ZT9B 2H89C 2E75B 3L8JA 2WPVB 4IL6X 2O01J 3D70A 4XFJA 1VL2A 3AEEC 2L6GA 3ABVC 1OMIA 3AEBC 2NZ2A 2QJKC 3AJMA 4H13B 3T97B 1FDIA 2FBWC 2D2CD 3Q1MA 3U3FA 2E74C 3AE5C 1RQUA 1OW6A 1KQFB 2JO1A 4OGQC 3D6ZA 3IN6A 2ZT9C 4PV1C 1V4AA 3RQFA 1AJYA 3BRJA 2E75C 1ZP0C 4RKUJ 4GDOA 1OW7A 4H0LB 2JX0A 2PBEA 3JYYA 3Q5SA 1WTYA 1KILE 2OQQA 1EXIA 4EBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 C;  3AE1 C;  1WWP A;  3L8I A;  3GM3 A;  1ZOY C;  4XEF A;  3SFD C;  4XEK A;  3C8G B;  2YWA A;  1O3U A;  3AE9 C;  2HSB A;  2WQY C;  3S9O A;  3RQG A;  2L6F A;  3U0C A;  3AEF C;  4YXD C;  1ZZP A;  3C18 A;  4NQF A;  4R32 A;  2L6H A;  1WOL A;  1K05 A;  2H88 C;  2JPU A;  3AEG C;  1UFB A;  4YTP C;  2LK4 A;  3AE2 C;  1YQ4 C;  3AE4 C;  3AEA C;  1JOG A;  3B71 A;  3C8G D;  3GM1 A;  4EBJ A;  5F28 E;  3O10 A;  3AEC C;  3JZ0 A;  3AE6 C;  3RQE A;  1KNY A;  3AE7 C;  1PV3 A;  2G3A A;  1K40 A;  3K7D A;  4XEV A;  3TUL A;  1KTM A;  3SFE C;  2KK1 A;  3AED C;  3GM2 A;  3MFN A;  3C8G A;  1YQ3 C;  1K04 A;  1QVX A;  3AE3 C;  1OW8 A;  2Q00 A;  2H89 C;  3L8J A;  3AEE C;  2L6G A;  3ABV C;  3AEB C;  3AJM A;  2FBW C;  3U3F A;  3AE5 C;  1OW6 A;  1V4A A;  3RQF A;  3BRJ A;  1ZP0 C;  1OW7 A;  2JX0 A;  2PBE A;  3JYY A;  1WTY A;  4EBK A; 
#chains in the Genus database with same CATH topology
 4AUW A;  3LID A;  3RW0 A;  3V5Y A;  2KSF A;  5A6K A;  3ZG1 A;  4YXW H;  2R32 A;  4DRJ B;  3FMS A;  1HWT C;  3LNM B;  3CX5 E;  4J7Y A;  1ZHZ A;  1CI6 A;  2JJL A;  2K9J B;  1JR8 A;  3FVY A;  1EZV D;  2HV7 A;  3EGX A;  3BVH A;  1RMV A;  2VCB A;  2PP6 A;  1TKN A;  3CAX A;  4Z9J A;  3W8H A;  2WQY C;  1GU4 A;  3M15 A;  4ASW A;  3K1H A;  2ZFC A;  2KYV A;  4TLF A;  2WTY A;  4JEB A;  1N73 C;  3H1K J;  4YXD C;  1S05 A;  3GHG B;  1FAP B;  4RES B;  1ORJ A;  4L73 A;  2BEQ D;  3H1J D;  2OYI A;  2Z4E A;  2N9B A;  5KKZ B;  5DQZ A;  2HSQ A;  3MYF A;  4PR9 A;  4BJ5 C;  2YL0 A;  2E43 A;  4QI0 A;  4I3M A;  3H1I E;  4NC3 A;  3JT1 A;  1M6T A;  2LCH A;  1IC2 A;  5KAI H;  2K3R A;  1FOS F;  3FOO A;  2Y69 C;  4N6C A;  3TF5 A;  4WY4 B;  2ZXP A;  1KYO H;  3LW5 H;  2I1K A;  2JP3 A;  3LS1 A;  2WPS A;  3L4F A;  3OJA B;  1TWH A;  1RE3 A;  1H9T A;  3L71 J;  3EZH A;  1Y47 A;  3GF3 A;  1NZE A;  4YK5 A;  1YVI A;  3ITK A;  2KK1 A;  1JY2 O;  2IM8 A;  1H6G A;  2J8W A;  1SF8 A;  5B5E E;  2H7H A;  3DJU B;  4OWF A;  1N86 A;  2PNO A;  1ZV8 A;  1LE2 A;  5CCH A;  3OA1 A;  2E75 B;  3U1A A;  1MV8 A;  2OTJ P;  3TGU D;  4HEA J;  4XFJ A;  1QVF O;  1HE1 A;  4I2L C;  3A3Y B;  4K35 A;  4U5E E;  1Z23 A;  5AVV B;  2WPR A;  1A7V A;  2LXB A;  2J9V A;  1KQF B;  2J0X A;  2JO1 A;  3D6Z A;  3WUV A;  1URQ C;  1VPC A;  4C46 A;  2Q9I A;  1FFH A;  2W6A A;  1VQL P;  2NG1 A;  3KPH A;  2A06 E;  3RQF A;  3U8P A;  1ZP0 C;  5KYU A;  3W8I A;  1OFC X;  2ZXX A;  2W45 A;  3GF7 A;  2FYU K;  1C17 M;  4IJJ A;  1YI2 P;  4MVM A;  2DGJ A;  1N2D C;  4O6M A;  3U9M A;  3JCU H;  1DOW A;  1BDD A;  2O01 H;  4AE4 A;  2J7P A;  1EC5 A;  2HFE D;  1L4A A;  2P6V A;  4IWB A;  4KNV A;  4CS9 C;  3H32 B;  3RK2 D;  3IPM O;  3KQG A;  2XS8 A;  1VQ8 P;  3PP5 A;  1Q86 Q;  2CPS A;  1SLQ A;  4ASV A;  1RF1 C;  1Z7Q c;  3K1I A;  4EWC A;  5L0G A;  2P67 A;  3SWF A;  2A68 F;  3JTL O;  3T97 A;  2L6H A;  1G1I A;  1K05 A;  1QL1 A;  4L6R A;  1SVF A;  1OKK D;  3DZA A;  1NWQ A;  1LNQ A;  1L0L K;  4K3A A;  2QIW A;  5GTH E;  1SR2 A;  1LP1 A;  3CCS P;  3EQL F;  5JVE A;  1YQ4 C;  3ITF A;  1GL2 C;  3I55 P;  3O10 A;  4WBA A;  1KB9 D;  3IFM A;  1OIP A;  2QJP C;  1Q0D A;  1T9K A;  4DXW A;  3H1K D;  2HJ3 A;  4LGD E;  2LD6 A;  3K7D A;  1PP9 G;  4KBL A;  2N1T D;  4YT2 A;  3RK2 B;  2PAJ A;  5L0F A;  4MVS A;  1HBW A;  5CCG A;  3MFN A;  3F89 A;  2WSE J;  1HJ0 A;  1M1J A;  2Q3T A;  4CPG A;  1KFM A;  2Q00 A;  1KYO D;  3CLQ A;  3RL0 g;  2ZT9 B;  2BCC E;  2ITA A;  4U9E A;  3U5S A;  3RFY A;  1BE3 J;  5AW5 B;  1FOS E;  3UNG C;  1VL2 A;  2QY9 A;  4MTG A;  5KYX A;  3G71 P;  2J46 A;  3P32 A;  4K7B A;  2B0J A;  5GPG B;  2Q5U A;  4JTD B;  5AVY B;  3HKK A;  1BGY G;  4G7H F;  2OYO A;  1F1M A;  2DYR C;  1FZG A;  3BRJ A;  1NFO A;  1SQP G;  1G1J A;  4W8P A;  2GA0 A;  3Q5S A;  3R4Y A;  1PP9 D;  3RK3 D;  1VQ4 P;  2OYI C;  2N1T B;  3MGN A;  5F5F A;  1M2O A;  3AG2 C;  3UMK A;  3WMM 0;  3ZC4 A;  3AE1 C;  1IFM A;  2EPL X;  1EDL A;  1EKY A;  1E85 A;  1EDI A;  4U3F J;  2YNY A;  3D6Y A;  2L7A A;  3TJ5 A;  3RGU A;  2JR8 A;  2R5D A;  1Q0M A;  2Y0C A;  3TK1 A;  1Q0F A;  3AE9 C;  5AW2 B;  4MVO A;  3KYJ A;  5AW1 B;  2H7O A;  4HE8 D;  3EFO A;  3A2A A;  1OXB A;  1M56 C;  3W67 A;  5AC5 A;  2L6F A;  2YIU C;  2XND H;  2M3B A;  3U2L A;  1QQ3 A;  2G62 A;  1NTZ J;  4HB1 A;  2J59 M;  1B68 A;  5CJ4 A;  1BGY D;  5L8R J;  1QPU A;  3O8Z A;  3GW6 A;  1ZXG A;  3RYL A;  2RMZ A;  4JKV A;  1L0N J;  4I1O B;  4U7J A;  1JCC A;  1S1C X;  2AP3 A;  3L72 E;  2HOD A;  3HTK B;  3DKA A;  3AGT A;  2N9Y B;  3P8C E;  1ZN5 A;  5CCH C;  1CPQ A;  2FGY A;  3CC4 P;  1M2V B;  1OCR C;  3RH3 A;  1T8Z A;  2R7V A;  3NTN A;  3GM1 A;  4GYT A;  3SXK A;  2FYU E;  2YLI A;  4I1M A;  3H65 A;  3L74 J;  1NTK J;  2NPS D;  1L0N K;  1KNY A;  1PPJ E;  1PV3 A;  2O01 N;  2KQ9 A;  4K0D A;  3L70 J;  1KTM A;  3RVZ A;  3CL3 D;  1FZF A;  1R5L A;  3IQC A;  1NTM K;  3LLK A;  3CCR P;  1LKX A;  1QVX A;  2C04 A;  4XWJ A;  2CK3 H;  1RF0 A;  5KJ7 A;  3N4X A;  1ZW0 A;  1C02 A;  2EIN C;  3KKB A;  4XPX A;  4DBR A;  3MUD A;  3V5B A;  3TDK A;  1SQV J;  2WSC H;  1GW4 A;  3RIP A;  3B5N A;  1SQB K;  2R3S A;  3BAS A;  1L4A C;  5COG A;  2NZ2 A;  4H13 B;  1PGO A;  3S0X A;  1W2B O;  2YKP A;  4BXL A;  1FC2 C;  2I8D A;  2FFH A;  4U5H A;  3NMK A;  5CMZ A;  5GTI E;  5L3Q A;  2PFX A;  1FZA A;  3K1I C;  2G3K A;  1LWU B;  2PBE A;  1ZHT A;  1Q0K A;  2WZF A;  1PFI A;  1Z63 A;  2QJY B;  1K8A Q;  3K5B A;  4N78 E;  1P84 H;  1A02 J;  1BE3 D;  3CWB J;  1CSB A;  5C39 A;  1J1E C;  4MVZ A;  2HUJ A;  3KZI H;  3C8G B;  2YWA A;  3E1I A;  4CDV A;  1VQN P;  4PAC A;  2ZYD A;  4MW3 A;  4OIR F;  3U0C A;  1Q90 D;  3AOU A;  4AL1 A;  1N7S A;  2XZR A;  1NHL A;  4JTC B;  5CCG C;  1PCX A;  2WT7 B;  4LLE A;  4R32 A;  4J32 B;  1M1J C;  3L75 J;  1LT1 A;  4IAO A;  1A41 A;  2DB4 A;  3QTH A;  1A02 F;  1VQP P;  1LTA C;  4YTP C;  3PHF 2;  3E1R A;  1KOR A;  3AE2 C;  2L5G B;  1S5L E;  4WWI A;  4JPZ B;  2XDJ A;  1BSN A;  4ULV A;  4WJ0 A;  4OIO F;  2R02 A;  1OCO C;  3LES A;  1PL5 A;  5E2Q A;  2OGU A;  2ETS A;  4HFF B;  4C3E A;  4JF7 A;  4JTA B;  3L0I A;  2KB7 P;  2H7B A;  1LTT C;  3WU2 E;  1NTZ D;  3CCQ P;  1JOC A;  1LPE A;  4IAQ A;  3OAK A;  1XZP A;  4EI2 A;  3U8V A;  2YKO A;  3DAF A;  1SQX K;  3E7K A;  5JS5 A;  2FYZ A;  2LSE A;  2VCA A;  4AL0 A;  4W7Z A;  4UB8 E;  2YL7 A;  5APU A;  2I8B A;  2MJZ A;  1D1A A;  4ZKP A;  3H1H E;  3CCV P;  5APT A;  3L74 D;  3ABV C;  3DMD A;  2QJK C;  4F4B A;  2C9N Y;  4DVZ A;  2E74 C;  3L70 D;  2LFD A;  4AX2 A;  4BEM J;  2HG5 D;  1RQU A;  1Z3I X;  4D4X A;  2PGD A;  3L73 E;  5DQT A;  2SPZ A;  2FXO A;  1E84 A;  2XM4 A;  4GDO A;  3JYY A;  3DJN B;  2YHS A;  3H1I J;  2OEX A;  4EOT A;  3V7O A;  1OVV A;  3ABL C;  3J06 A;  3LLI A;  2QTV A;  2R7X A;  1L0N E;  4HYT B;  1MMD A;  3CZ6 A;  2YLD A;  4H4K C;  3GMA A;  1URQ D;  1OCC C;  2M4E A;  1VF5 B;  3JRT A;  1E86 A;  3TJ6 A;  2WVQ A;  1IJD B;  1J8M F;  5K5G B;  2B87 A;  1NTM E;  2P1A A;  5CBO A;  1SFC D;  4JC7 A;  4IGG A;  1AQT A;  3N0T A;  3S9O A;  5TJH A;  3VRC A;  4G78 A;  3N2Z B;  1SQB E;  3C7J A;  1P84 D;  2RN0 A;  2AVK A;  1RF0 C;  5KJ7 C;  1BSH A;  3MUD C;  3M4C A;  3W2W A;  3HD7 A;  1Q82 Q;  3O55 A;  2K9Y A;  4DVY P;  2A45 I;  2D2C C;  1R5S A;  4XLP F;  3EGD B;  3AEA C;  2A1D D;  4BWN A;  3EFF K;  2PX0 A;  5KYW A;  3OW2 O;  4JZA A;  4G7O F;  1U7J A;  3U2M A;  5APX A;  3FAJ A;  3K33 A;  2IPP A;  5EFW B;  2OYH B;  3TD7 A;  2Y39 A;  3CPW O;  1SFC B;  1FJP A;  4EIY A;  3EHM A;  1ZYR F;  3CCL P;  2K37 A;  4MND A;  1TWA A;  2FFD A;  5CI8 A;  5F5H A;  2VH3 A;  5BU8 B;  1NU1 G;  4RO0 A;  4EIJ A;  3MP7 B;  3FWL A;  3N24 A;  1HMO A;  3JYH A;  4PK4 A;  1PD1 A;  2G3V A;  1LS4 A;  4N6J A;  5DVW A;  1YYJ A;  1QX8 A;  3NRH A;  4XA4 A;  3CWB E;  1SS1 A;  3W4Y A;  3BCC G;  4I6M C;  1V74 B;  1RF1 B;  2FBW C;  1QLE C;  3V5X A;  4KNW A;  4YWQ A;  2KNH A;  5DS5 A;  2Q3E A;  1YJN P;  3QWO C;  1N7S C;  1BCC E;  4MVQ A;  3RBZ A;  1S72 P;  1KIL E;  1HY5 A;  1FZC A;  2R7R A;  4JQ0 D;  3CME P;  4RD9 A;  1R5I D;  1KIL A;  5AVR B;  3PJS K;  4UB6 H;  3L8I A;  3GM3 A;  1EA8 A;  4U5G A;  4H44 C;  2ASR A;  4I7Z C;  1RQV A;  3GG2 A;  2M5A B;  1EXJ A;  4IL6 H;  2CCY A;  4HKZ H;  4JCH A;  3HJC A;  3MX3 A;  4RJT A;  1SQX E;  4IFF A;  2W27 A;  1S2E A;  2ZXO A;  1MNE A;  3MHV A;  1EZV I;  1XZQ A;  1K9M Q;  1LTJ C;  1ZRT E;  3PMR A;  2K88 A;  4Q7C A;  1Q81 Q;  1U6H A;  1QL2 A;  4C7O A;  1BR1 A;  4XPW A;  5B3S C;  2R25 A;  3S28 A;  3MZW B;  3AQC A;  4GKG A;  1KMI Z;  2BCC J;  1RKE B;  1NKZ B;  1M56 D;  5FCL A;  1WOL A;  1ZR2 A;  5KAF E;  2R44 A;  1G5Z A;  3H6P A;  3IEE A;  1VYI A;  2KSE A;  4FAP B;  1EDK A;  5AW3 B;  1JOG A;  1Y4C A;  2XSE A;  2QVA A;  3B0P A;  3CSK A;  2NUP B;  3V4W A;  3RKO F;  4YL1 A;  3TQO A;  3AE6 C;  1D1C A;  3RQE A;  3DXJ F;  1KB9 H;  1T6Q A;  1E83 A;  5KLV J;  3NKE A;  5A6J A;  2AXT H;  1LTI C;  5CCH D;  2R7W A;  3EFG A;  1L7C A;  4CSA A;  4LER A;  2K9J A;  3O6X A;  4PFP A;  2KNC B;  3CCE P;  3TGU G;  1LM3 B;  1IW7 F;  1W2E A;  1S9K E;  3WG7 C;  4I1L A;  3M9B A;  5KLV K;  4C7R A;  3JRM O;  2Y3B A;  3GHG A;  1SQQ G;  5L0I A;  1HGZ A;  5CJ0 A;  3CCM P;  1OMI A;  3AEB C;  5BQG A;  2MHR A;  2XXA B;  2R7O A;  2HFI A;  5T1D B;  2P1J A;  1VLT A;  4WY4 A;  2W8Z A;  3A0H E;  2J7P D;  3L72 J;  2R03 A;  1EXI A;  1L4A D;  3T4R A;  1EZV E;  3HNL A;  4M63 A;  1VQO P;  3R2P A;  1OQC A;  3L1M A;  1RE4 A;  2MKV A;  1ZU4 A;  1S5L X;  1GGQ A;  3NDB B;  2FYU J;  3QW1 A;  3HD7 C;  2I15 A;  3MTU E;  1H89 A;  3NXS A;  3RL0 C;  4XEF A;  4H0L C;  2X0C A;  4C7N B;  3VTP C;  4XTK A;  2VAS A;  1GD2 E;  3S29 A;  1JMM A;  3H1J E;  1SQQ D;  1OX3 A;  3G9R A;  1LE4 A;  1QEX A;  3EG9 B;  4MW8 A;  2QSI A;  2G8Y A;  3G50 A;  2FFD C;  2HPC B;  1EDJ A;  1RJ9 B;  4CS8 A;  1PGJ A;  3HUS B;  1RHZ B;  2ZXR A;  3RF3 A;  1RY3 A;  3TSI A;  2VRS A;  1KQL A;  2R7T A;  1VQM P;  5AW6 B;  2H7V C;  4BRY B;  4DCK A;  3K66 A;  3CEX A;  3H1K G;  5IY5 C;  2CNW D;  1JPN A;  1U57 A;  2LKM A;  3S90 A;  4AK9 A;  3W68 A;  1JTH B;  2QNL A;  1HVV A;  2IBF A;  1GMJ A;  1L0L J;  3C8V A;  1YJG A;  1ZHW A;  4EHP A;  3MD0 A;  1N1C A;  2P10 A;  2R3C A;  1BZ4 A;  2EIK C;  2V4H A;  4D6T J;  1J1D B;  1FS0 E;  2IZ0 A;  3U3B A;  2YKQ A;  3S4R A;  3T6J A;  2BCC D;  3L36 A;  3ATP A;  4NPF X;  1FZC C;  4DZO A;  2WB7 A;  2QRX A;  1KIL C;  3H32 A;  1N7L A;  1TQG A;  3ASN C;  1J1E B;  1BDJ B;  3V2N A;  1OWA A;  1SQP K;  3C1L A;  3MIW A;  3L71 G;  5JT4 A;  1SMY F;  1KYO I;  1RXQ A;  1I5N A;  2GFH A;  1JRA A;  3FOP A;  3A9C A;  4D4N A;  3ZVR A;  5CI9 A;  1NU9 C;  5E3C A;  1USD A;  2GA1 A;  3PTZ A;  3FAP B;  1E79 H;  4NTF A;  1Z5Z A;  1ZW3 A;  3H1L J;  4YT4 A;  5TIS E;  2EPM X;  1USE A;  3NMJ A;  5KTB A;  5COF A;  1VDF A;  2FKW B;  2WIT A;  4OGQ C;  3IN6 A;  1LS1 A;  1IZM A;  5D91 A;  1T6I A;  3UR3 C;  3T6B A;  3SYN A;  2WSE H;  5H2F E;  4Y99 B;  4G0H A;  1A7E A;  1MUU A;  1PPJ G;  3A0B H;  4FES A;  1HF9 A;  1CGO A;  1IFI A;  3GAN A;  4BEJ A;  3V5Z A;  1UII A;  1NYH A;  3ABM C;  3NYM A;  2HKV A;  2E76 C;  1X8Y A;  1Q0G A;  1S5L H;  3W2V A;  3EPV A;  4Q5S F;  1MMN A;  2QLA A;  4E0I A;  3L71 D;  1GK6 A;  1QVG O;  2HMZ A;  4WAB A;  2O3J A;  3OWT A;  1VLS A;  1NFN A;  4JW1 A;  2WSF J;  5KLV E;  4CSA C;  3L72 D;  1ZHY A;  2AXC A;  2OEV A;  4P6I C;  2GUS A;  4JUR I;  3M91 A;  3A11 A;  2DYS C;  3F46 A;  1APC A;  2FYU D;  3C63 A;  4Y28 J;  3H1H J;  3JCU Q;  4X0R A;  3KXD A;  3OA7 A;  2QJK B;  2V7Q J;  4W7Y A;  4PJM A;  4BJ1 A;  3AEG C;  2J9W A;  1G2C B;  1PPJ D;  5BQH A;  3GHG C;  3B71 A;  3L73 J;  1IZN B;  4JYC A;  1RE3 C;  3ZTZ A;  2Q3I A;  2F22 A;  5KKZ C;  5B66 E;  2JKV A;  2XLV A;  5KAI E;  2H43 A;  4CIH A;  2B9B A;  3AE7 C;  2XRH A;  2L91 A;  1KYO E;  5E79 H;  2CGE A;  2WZ7 A;  4QI2 A;  3BAT A;  4WY4 C;  1FU1 A;  2HOD B;  1OR3 A;  3FGA D;  2C9L Y;  3RK3 B;  3ABK C;  1L2P A;  4JRZ A;  1TWG A;  5D92 A;  3S1K A;  1RE4 C;  2B89 A;  1NTM J;  1T6U A;  4NY3 A;  1KU2 A;  1Q2N A;  1LT9 B;  2GWW A;  1FBM A;  1TFK B;  2P7V A;  5DS4 A;  3NMD A;  3D70 A;  4M3L A;  3AEE C;  1FMW A;  4OD5 A;  4E18 A;  4GIF A;  2KS1 B;  3QVZ A;  1CZQ A;  5L0C A;  1D7M A;  1S7Z A;  1SQB J;  3FX0 A;  2P7J A;  3K6B A;  4NTA A;  2QUP A;  3HTK A;  2UUI A;  3HNK A;  2RH0 A;  2E75 C;  1HW2 A;  1NJI Q;  1BE3 G;  1M2V A;  3SXM A;  4YL0 A;  4CS8 C;  1X0T A;  2AU5 A;  1VMA A;  3ZTM A;  2FYN C;  1C03 A;  1QGK B;  3HE4 B;  2XLD A;  2O9X A;  2IXO A;  1JMW A;  1OVU A;  2IBZ I;  2XL4 A;  5AVT B;  1N7S D;  4OIN F;  1DH3 A;  5AVX B;  4OVN F;  1VQ5 P;  4C3B A;  3FWN A;  1L0L E;  1J8Y F;  1BGY E;  2YEV A;  2J5U A;  2NPS B;  1GM5 A;  3JCU E;  3M0A A;  4H44 D;  4U3F G;  1SQP E;  3DM9 B;  5AW4 B;  4D6T E;  2OJQ A;  1V54 C;  2HYN A;  3EHN A;  3PHL A;  3HE5 A;  2E5Y A;  2M64 A;  4JJF A;  1MKM A;  2ICW G;  4P9T A;  1VTM P;  1JY2 P;  3IQT A;  1KV4 A;  1Q7Y Q;  4AQR D;  3V2R A;  2QE9 A;  2GM4 A;  2E5T A;  3M06 A;  3SEO A;  3KL4 A;  1ORY A;  3GOR A;  3Q7L A;  5DJU B;  2JPU A;  4CDA A;  3M1C B;  4E17 A;  2PP4 A;  2VCC A;  3X1O A;  1AA0 A;  2RD9 A;  4U5B E;  1LWU A;  1NTZ G;  1IK7 A;  2V26 A;  3SNH A;  4KC9 A;  3NMI A;  1BR2 A;  1UG7 A;  3KH2 A;  1RCP A;  1L0N G;  1G4U S;  2PFD A;  1AVO A;  1BCC J;  3H1L E;  3SWK A;  1YZC A;  3FHD A;  4XEV A;  2EPN A;  3BRV B;  2YXR B;  1LIH A;  4U3F D;  5AVW B;  4H44 B;  2C03 A;  2X51 A;  1YAR O;  4I7Z B;  3C8G A;  3IF4 A;  5JUA A;  3L74 G;  1NTK G;  1YJW P;  2KJG A;  2JD3 A;  2Q4F A;  4JVS A;  1H0T B;  4P9F A;  2AWY A;  5KYY B;  2W83 C;  4ZMD A;  1SQX J;  3NKD A;  3L70 G;  5AW7 B;  4O7G A;  5T3W A;  3RK2 C;  1LTJ B;  3L73 D;  3UGO A;  2LQG A;  4EUK B;  4N6H A;  1I4Z A;  2WT7 A;  4LC1 A;  4NPD A;  2L6G A;  3CXH I;  2P0N A;  5AGF A;  3S27 A;  4ANJ A;  4YT8 A;  3DWW A;  4YJW A;  1H7I A;  5APY A;  5A69 A;  2IBZ E;  4JBZ A;  3ECS A;  3HNJ A;  3O6Q B;  1L0N D;  5L3V A;  2ZT9 C;  256B A;  1SQV G;  1WT6 A;  4LLC A;  4IRU A;  3NFQ A;  1YA9 A;  3CI9 A;  3I4U A;  4JE9 A;  2Y0D A;  3CX5 H;  2B88 A;  3VN0 A;  4PJN A;  3USS A;  1NTM D;  1FZB A;  5KAF H;  2A0B A;  4MS2 A;  2Y9Y A;  4N4W A;  2ZVN B;  2QEX P;  1DD4 A;  1NTK D;  3V2Q A;  1N73 B;  4B86 A;  4K1O A;  5AVQ B;  3B0V C;  1U7M A;  3M9Q A;  2EIL C;  3VP9 A;  4DJG A;  1I4Y A;  2Z5H A;  1JY3 N;  1SZI A;  3VF0 A;  1FNT c;  2Y3G A;  2C0W A;  3VMA A;  1X22 A;  4BG0 A;  3HD7 D;  1ZHX A;  3CWB G;  5CIV A;  2Q9C A;  1ORS C;  4H0L D;  4W8K A;  4IFM A;  3RVY A;  3UMH A;  2NUT B;  3PDM P;  2XKM A;  4JYB A;  2H8A A;  3C18 A;  3QVY A;  1FDM A;  3EWK A;  2KZJ A;  2XL6 A;  4MTO A;  1SQV D;  3H2U A;  1P84 I;  1M1K Q;  2AEM A;  2IFN A;  4ZLD A;  5AW8 B;  1T6A A;  2POH A;  1HH0 A;  4LLH A;  1YTZ T;  1Y6D A;  3LS0 A;  2LXC B;  1NU1 K;  1M57 C;  1BCC G;  1JPJ A;  3F5H A;  2CPB A;  2OJE D;  3ASO C;  4JIO A;  4J7T A;  4PD4 I;  1VQ6 P;  5AVZ B;  2IFM A;  3L75 G;  2KIK A;  2NPU A;  1TFO B;  5APW A;  5CBN A;  2G3A A;  1JM0 A;  3TUL A;  3HTK C;  5B5E H;  1A0B A;  2HV6 A;  5JP7 A;  2EPK X;  3SFE C;  4CJO A;  4OIQ F;  1D0X A;  3GM2 A;  2GAQ A;  3CXH E;  3AGU A;  3HD7 B;  1AFO A;  3CWB D;  1V55 C;  1IK9 A;  2E87 A;  5KLI C;  2CW0 F;  1YHQ P;  1J2J B;  2WMM A;  4JCZ A;  5B1A C;  4AYC A;  3B5N C;  2A6E F;  1JB0 J;  5E3A A;  1URQ B;  2WZG A;  2D4U A;  1VOM A;  2GDC A;  3H1J J;  4GT1 A;  4XLN F;  1VK5 A;  1JUN A;  5AVU B;  2Q7R A;  3FXH A;  1BCC D;  3SXZ A;  4E0H A;  1KIL D;  2Q9B A;  1FDI A;  3Q1M A;  3ZWI A;  3M0D A;  3V6I A;  3CC7 P;  1HE9 A;  1NG1 A;  4U5C E;  2WWW A;  4WGZ A;  2YXQ B;  1GL2 D;  1KFN A;  3L75 D;  3TNU B;  4PV1 C;  4RKU J;  3EGD A;  5AC4 A;  2LR2 A;  2HLO A;  3D71 A;  4H13 C;  4GOF A;  1OVR A;  2OYH A;  3NYJ A;  4OGQ D;  1OXZ A;  3AG3 C;  1SFC A;  2RKL A;  3DD7 A;  2IZ1 A;  1H88 A;  4IB4 A;  1LWU C;  2FAP B;  3SXY A;  2IOQ A;  3H1I G;  4YT5 A;  2LP4 A;  3BRT B;  1IFN A;  1ZR4 A;  3DE9 A;  3ZIB A;  1P84 E;  3CC2 P;  4GQH A;  1AUE A;  3KYQ A;  4RDA A;  3CX5 D;  1FTS A;  2Y3H A;  2E76 D;  3KZI E;  4CS9 A;  3AEF C;  2OCC C;  4PD4 E;  1ZLL A;  1GL2 B;  1X9V A;  5HV9 A;  1M90 Q;  5GTH H;  4YL3 A;  4ONS A;  2M0B A;  4KHX A;  1FJK A;  2YVK A;  2QJP B;  1EI7 A;  3G6E P;  2AWC A;  4O79 A;  2NSG A;  1IFP A;  2J58 A;  1PD0 A;  2IDB A;  1KC8 Q;  2JEE A;  2UUH A;  3M4B A;  3X2Q C;  3AEC C;  1HMD A;  3JZ0 A;  3C8Z A;  3H1I D;  1CW5 A;  4XE5 B;  4Q4Z F;  2Z15 A;  5B1B C;  2PF4 E;  1SQQ K;  5TJ5 E;  3POV A;  2M5A A;  1CI6 B;  3EGX B;  4WVZ A;  2E76 B;  2XV5 A;  1YQ3 C;  1Y9B A;  1KN7 A;  1XWJ A;  1TWC A;  2A06 G;  2WZL A;  3WUU A;  3DI5 A;  2KC3 A;  1WMK A;  2ZJS E;  2KGO A;  2ZD9 A;  2NRG A;  1G4W R;  3LNR A;  3OEO A;  2OOC A;  1FMV A;  3DE8 A;  3B29 A;  2H89 C;  4WY4 D;  5A6B A;  1YYC A;  2IYP A;  1SYQ A;  1JY3 O;  1DEE G;  2OYI B;  3ZDM A;  1RKE A;  2KLU A;  3NYL A;  2FY8 A;  2P61 A;  3VYW A;  1VYK A;  3U3F A;  3E70 C;  5L0D A;  2QM8 A;  4OH8 B;  5APV A;  1NU1 E;  2AEF A;  1AEP A;  2J9U A;  1H9G A;  1PGP A;  2NUP A;  1LJ2 A;  4MVR A;  2VC9 A;  4TT3 H;  1JNM A;  1NAY A;  1IFJ A;  2TMV P;  4NPE A;  2YIU B;  2A06 D;  3AG4 C;  3BCC E;  3RBX A;  1DOV A;  2E75 D;  3VMY A;  2BC5 A;  1MZ9 A;  5FZT A;  1FR0 A;  1OXK A;  5T3T A;  2KNC A;  5B66 H;  1T2K C;  2WPQ A;  1R8E A;  4QDL A;  3LW5 J;  2R9R B;  4LAC B;  1FDO A;  3PLN A;  3QW0 A;  1VF5 C;  4OD4 A;  3R7C A;  4A7P A;  3GEE A;  1NO4 A;  1PIX A;  1RKC A;  2CYD A;  1IFD A;  2R7Q A;  3G4S P;  3B9Q A;  1MND A;  1AVY A;  2FXP A;  4DOZ A;  1ST6 A;  1CGM E;  1LI5 A;  2XXA A;  2H88 C;  4XPY A;  1KD1 Q;  3WAQ A;  1PP9 J;  4ZKU A;  3HRN A;  5KYU B;  2YZS A;  4NTB A;  4R4L A;  5F28 E;  2BCC G;  1N8R Q;  3B4S A;  3M0D C;  4PJ0 E;  4WGY A;  3GWN A;  2YMY A;  4GOD A;  2FYN B;  2PX3 A;  1ZW2 A;  2MWQ A;  4AE4 B;  5M1B A;  4C7N A;  1K04 A;  2R7S A;  1L4A B;  1DEB A;  2OYH C;  2A0U A;  5CCG D;  5KLV G;  3CD6 P;  5KYN A;  3S84 A;  1SFC C;  1NOH A;  3EG9 A;  3G4Z A;  4HFK B;  1K73 Q;  1BGY J;  1KZU B;  3L8J A;  2HPC A;  1NH4 A;  1RJ9 A;  1CPR A;  1SQP J;  2O01 J;  3JSZ A;  3HUS A;  1KB9 I;  5GTI H;  3T97 B;  1D0Y A;  4BRY A;  3AE5 C;  3U1C A;  1QZX A;  3CQZ A;  2K1A A;  3TGU E;  1FFT C;  1LP1 B;  3DAG A;  5A6A A;  3A5T A;  2EIM C;  1ZVZ A;  1OW7 A;  1JTH A;  3GEI A;  5BQI A;  2HS5 A;  4EBK A;  2Q6Q A;  2PRR A;  2W4M A;  3QH9 A;  1NU7 D;  4YN0 B;  2ZVO B;  1YJ9 P;  1AV1 A;  5L0J A;  3CCJ P;  1JAF A;  2KSJ A;  4IOI H;  1SQQ E;  2ZT9 D;  3AQB A;  4HH2 A;  1YIT P;  5AVS B;  2W9Y A;  5KLV D;  2C0X A;  3L72 G;  2W6J H;  3LIE A;  4UB6 E;  3KDP B;  2HSB A;  1U0B B;  1M1J B;  2YKZ A;  1JEK A;  3VOP A;  4IL6 E;  2HR3 A;  3VMX A;  2FYU G;  3VP8 A;  2RSE B;  3JC2 2;  4DBQ A;  2IYO A;  2E74 D;  1LTS C;  2OU6 A;  2YO2 A;  1E5W A;  1HJB A;  5KYX B;  4KI2 A;  2CNW A;  1OCZ C;  4G7Z F;  1CGN A;  5DS6 A;  2XL8 A;  3I5C A;  3ZSU A;  3UIA A;  1JCD A;  1TR2 A;  4B6I A;  4EBJ A;  3WU2 H;  3C9I A;  3GLM A;  1QKR A;  4LDK A;  1U89 A;  1TU3 F;  2ZXE B;  4Z9H A;  3L34 A;  2R05 A;  3P8C D;  1OKK A;  2WSF H;  3A7O A;  2YRF A;  4ULW A;  1M57 D;  4I44 A;  3US6 A;  3ZDL A;  4LDQ A;  1EQ1 A;  1KB9 E;  1L0L G;  4UB8 H;  1UIX A;  3P7K A;  3EFO B;  2AXT E;  3H1K E;  1KQG B;  3P8M C;  2WSS H;  2E74 B;  3L37 A;  4D6T G;  2XLW A;  4MN4 C;  2V7Q H;  3DM5 A;  3WHN A;  2VB6 A;  2N1T A;  2OKU A;  4DJ9 A;  5KJ7 D;  5HSW A;  1MFZ A;  4GOE A;  3SZR A;  3WOD F;  2EPO A;  4EBB A;  2YQY A;  1T01 A;  4L74 A;  2D2C D;  2Y3D A;  3B5N D;  2ZYA A;  2XLH A;  2O1J A;  1HTL C;  3JSE O;  2D5R B;  1G2C A;  4MQ9 F;  1NSG B;  2XS1 A;  3MYI A;  3II6 A;  3SP1 A;  2JX0 A;  2EIJ C;  3C62 A;  2OQQ A;  4C3D A;  3UGP A;  3L35 A;  3L71 E;  3AE8 C;  3H1L G;  1MMG A;  2KOG A;  2WL8 A;  1L0L D;  2BE5 F;  3FDQ A;  2HJM A;  2W6B A;  2J45 A;  1O5H A;  2XLM A;  4PV1 D;  4O6N A;  4A2N B;  2ZAE B;  2AEJ A;  2I1J A;  1SQP D;  3VAY A;  2E42 A;  1PP9 E;  4D6T D;  3RK3 E;  3SFD C;  4XEK A;  4GEH A;  2HZ8 A;  2LIG A;  1GW3 A;  4H13 D;  1T3U A;  1LTG C;  4XQ1 A;  3H25 A;  1NBB A;  4N78 D;  1ZU5 A;  3LAY A;  1JO5 A;  4MTF A;  1NTZ K;  1JY3 P;  5KLI B;  2Q7C A;  1LT9 A;  2D2C B;  4PJL A;  3TOL A;  3CXH H;  1QLE D;  1R4T A;  2V3C C;  3B5N B;  2WVN A;  4PFO A;  4QMA A;  5COM A;  3Q2Y A;  2KS1 A;  2IBZ G;  3G3Z A;  1LVK A;  3LEV A;  5JSL A;  4CIP A;  3H1L D;  4EKW A;  1LTB C;  4KJM A;  2LK4 A;  4Z9I A;  1NTK K;  2WSC J;  1GK4 A;  3HNI A;  5JLI A;  3C8G D;  1M7L A;  3HUS C;  3B8E B;  4R4M A;  2P2U A;  4PV1 B;  1FAV A;  2J0W A;  3HE5 B;  5EHH A;  1YIJ P;  3H1H G;  4N3Y B;  3Q5P A;  3HE4 A;  1K40 A;  3LUT B;  5K0I A;  1NKN A;  3PCV A;  4DRI B;  3JSV C;  3AED C;  1W5C E;  4CS7 A;  3L73 G;  2O1K A;  2A6H F;  1MQV A;  3EH2 A;  1MMA A;  2NPS A;  1OW8 A;  1SQV K;  1JMB A;  1EQ7 A;  1J1D C;  2IBZ D;  1XTG B;  1AVO B;  1HGV A;  1GZL A;  1N7S B;  2XLE A;  2R5B A;  2ZXW C;  3F47 A;  4IAR A;  3WUT A;  4BJ6 A;  3AJM A;  1YAU O;  2XM0 A;  2GUV A;  2NSF A;  2R7U A;  2HMQ A;  5EGY A;  1SP4 A;  1NTM G;  1DX7 A;  3Q6N A;  2OAR A;  4U9D A;  1W2W A;  3Q7G A;  2BAS A;  1WGW A;  3QMK A;  4PD4 H;  3Q6M A;  3H1H D;  4L76 A;  1AJY A;  4CBE A;  4J30 B;  5APQ A;  1X79 B;  1T5O A;  4IFD K;  3EQ2 A;  5B3I A;  3FXE A;  5AW9 B;  2IXN A;  4ER9 A;  2ZYG A;  3ZQY A;  5BUO A;  1SQB G;  4N06 A;  2M3E A;  1LI7 A;  1WWP A;  4Z1M H;  3QZC A;  5E33 A;  4BJT A;  2BEZ F;  2OTL P;  4CDY A;  2LFF A;  4O6Y A;  5AW0 B;  1DD3 A;  4DOJ A;  5CHX A;  3A0B E;  4E7S A;  3GEH A;  2A45 H;  5JRA A;  1O3U A;  4Y99 C;  2B0H A;  1YLM A;  2W4B A;  2YMK A;  3TYY A;  1H0T A;  5KYY A;  3T9O A;  3CMA P;  1WAS A;  1BE3 E;  3N7N A;  1D1B A;  2L81 A;  1ZZP A;  1LTJ A;  2WVR A;  3SSU A;  1GU5 A;  4MVU A;  2OTK E;  1T2K D;  1BBH A;  1GDT A;  3PH0 A;  4NQF A;  3LJB A;  4CX9 A;  1FE6 A;  3BEH A;  3O6Q A;  5EK0 A;  1UFB A;  1VF5 D;  1SQB D;  2FXM A;  2N1T C;  4FX5 A;  2H8P D;  2A69 F;  2IYL D;  1NU1 J;  4U3F E;  1OZH A;  3H2V A;  3CXH D;  3Q3D A;  3U59 A;  4BPM A;  2OQM A;  3KPE A;  3RL0 D;  3VM6 A;  3TOM A;  1E2X A;  3I5P A;  4JEA A;  4H54 A;  1FZE A;  2DI3 A;  1N73 A;  1XTC C;  1BR4 A;  1WRG A;  3V4Q A;  1HUC A;  4ZLC A;  1PZQ A;  1H8A A;  3VYI A;  3M79 A;  2ZPA A;  2Q9A A;  2B87 B;  2YO3 A;  3T6G B;  3B0U X;  3BCC J;  3MBG A;  1YDI A;  1VB5 A;  5DJT B;  1MFT A;  5E79 E;  5DLJ A;  1RH5 B;  3FXD A;  1NAF A;  1NTZ E;  3IQ6 A;  4BJ5 A;  4CJG A;  1ZME C;  2MYS A;  1GTW A;  2IX7 C;  3EZI A;  3AG1 C;  4E7Z A;  1LGH B;  1GS9 A;  2NUT A;  1S4X A;  4A4A A;  4IL6 X;  5APS A;  4RBN A;  4ZNC A;  3RK3 C;  2XU6 A;  2L9J A;  3A0H H;  1SQX G;  4L75 A;  4LDR A;  4WB4 A;  2KP8 A;  1O87 A;  1S3J A;  1OW6 A;  3MLG A;  1LT9 C;  2P58 A;  3EH1 A;  5BU5 A;  2YLG A;  3L74 E;  1NTK E;  2JWD A;  1PGQ A;  3GOD A;  3RL0 B;  4H0L B;  3GWL A;  1WTY A;  1IO4 A;  2JWA A;  2A45 G;  5KYW B;  1JY2 N;  1BDC A;  3L70 E;  1OR2 A;  2YL3 A;  1NVO A;  4PJJ A;  2QA4 P;  4KT0 J;  1M8O B;  1NGM B;  4FWV A;  2Y0E A;  1ZOY C;  4UDV A;  2OG2 A;  2FFD B;  1KQS O;  1AQ5 A;  4DT0 A;  2KLV A;  5L0H A;  4PD4 D;  1L3P A;  4PJ0 H;  3U9J A;  1SQV E;  3VMZ A;  3Q5R A;  2KI7 B;  3RQG A;  2Q1K A;  1Y8A A;  2KUB A;  3IR9 A;  1T3J A;  1URQ A;  3CX5 I;  2IXM A;  1SQX D;  2BL2 A;  2IXP A;  4W80 A;  1VQ7 P;  1VQK P;  4EDF A;  3KMI A;  2Z5I A;  4HJG H;  3HLZ A;  1ZRT D;  2QG4 A;  3E9V A;  2W90 A;  2NPS C;  3SWY A;  3IAO A;  2UWJ E;  1D0Z A;  4DRH B;  1YYX A;  3KYI A;  4JJG A;  3TNU A;  1YBK A;  1YA7 O;  3AE4 C;  4BJ6 C;  1FZC B;  2DW3 A;  2QJY C;  1YTZ I;  3TGU J;  3CCU P;  1KIL B;  1HW1 A;  2XNX A;  2Y9Z A;  1QSP A;  1WAT A;  3ZQV A;  3I56 P;  5BVZ A;  1VQ9 P;  1G8X A;  3EJN A;  1DIP A;  1RF1 A;  5A6B D;  1A7D A;  2M8R A;  2KK7 A;  1SQQ J;  4U5F E;  4O9B A;  3IHU A;  4EYY Q;  2WVO A;  3NG1 A;  2XLO A;  3AE3 C;  4OIP F;  3IQ5 A;  2KW3 C;  1EZV G;  3V2P A;  2KYH A;  4OGQ B;  3UMI A;  1NLX A;  3TK0 A;  4YPC A;  5TIS H;  4C7O B;  2QE7 H;  3L75 E;  1NU1 D;  3LEO A;  2WPV B;  3G4X A;  1GL2 A;  2J9B A;  1S9K D;  3O39 A;  3I5Q A;  2JDI H;  2QM7 A;  1YZA A;  5H2F H;  1WN0 A;  3PRJ A;  1Z6A A;  3M9H A;  2CDQ A;  2YL1 A;  1GQA A;  1V4A A;  3H1J G;  4NCQ A;  2KZI A;  3BCC D;  2KXP B;  4U5D E;  1Z56 A;  3KHU A; 
#chains in the Genus database with same CATH homology
 3GF7 A;  3D71 A;  4H13 C;  3AE8 C;  4TT3 H;  2FYN C;  1HF9 A;  2MKV A;  3AE1 C;  1NYH A;  1S5L X;  4Z1M H;  1WWP A;  3GMA A;  4OGQ D;  3GM3 A;  3L8I A;  4H44 C;  2ZT9 D;  4KT0 J;  1DD4 A;  4I7Z C;  2BEZ F;  2E76 C;  4PV1 D;  1NGM B;  1RQV A;  3D6Y A;  1ZOY C;  1VF5 B;  2E75 D;  1EXJ A;  1DD3 A;  3RK3 E;  4H0L C;  3SFD C;  4XEF A;  4XEK A;  3C8G B;  2YWA A;  1O3U A;  3AE9 C;  4H13 D;  2HSB A;  2WQY C;  1R8E A;  3LW5 J;  2YMK A;  3S9O A;  2J5U A;  3H25 A;  1ZRT E;  3G9R A;  3Q5R A;  3RQG A;  4H44 D;  2L6F A;  1FDO A;  2E76 D;  2YIU C;  2QSI A;  3U0C A;  2WSF J;  2G8Y A;  1Q90 D;  3AEF C;  2D2C B;  4YXD C;  1VF5 C;  1ZZP A;  4H0L D;  2E74 D;  1MKM A;  3C18 A;  1PIX A;  3EWK A;  5L8R J;  2BEQ D;  1KMI Z;  4NQF A;  4R32 A;  3Q2Y A;  4U7J A;  2L6H A;  2FXP A;  1WOL A;  4Y28 J;  1K05 A;  1S1C X;  3IAO A;  3O6Q A;  2H88 C;  2V7Q J;  2JPU A;  3AEG C;  1UFB A;  2K9Y A;  1VF5 D;  2QIW A;  4YTP C;  1U57 A;  2D2C C;  1KOR A;  2LK4 A;  3AE2 C;  1YQ4 C;  2WSC J;  3AE4 C;  3AEA C;  2IDB A;  1IK7 A;  3B71 A;  1JOG A;  3C8G D;  3R4Y A;  4R4L A;  3GM1 A;  4EBJ A;  4R4M A;  2QJY C;  4PV1 B;  1GMJ A;  3C8V A;  3GLM A;  3AEC C;  3O10 A;  5F28 E;  5KKZ C;  2JP3 A;  3Q3D A;  1TU3 F;  2P10 A;  3JZ0 A;  3AE6 C;  1PL5 A;  3Q5P A;  1KNY A;  3RQE A;  2QJP C;  3AE7 C;  1PV3 A;  2G3A A;  1K40 A;  3K7D A;  4XEV A;  3TUL A;  1KTM A;  3GF3 A;  1DIP A;  3SFE C;  2KK1 A;  3AED C;  5M1B A;  4H44 B;  3GM2 A;  3MFN A;  4I7Z B;  2E76 B;  3FGA D;  3C8G A;  1UIX A;  1YQ3 C;  1K04 A;  2WSE J;  1Y9B A;  1QVX A;  5KLI C;  1HJ0 A;  3AE3 C;  1KQG B;  1OW8 A;  2E74 B;  1WMK A;  2Q00 A;  3RL0 g;  4OGQ B;  1ZME C;  1JB0 J;  2ZT9 B;  2H89 C;  2E75 B;  3L8J A;  2WPV B;  4IL6 X;  2O01 J;  3D70 A;  4XFJ A;  1VL2 A;  3AEE C;  2L6G A;  3ABV C;  1OMI A;  3AEB C;  2NZ2 A;  2QJK C;  3AJM A;  4H13 B;  3T97 B;  1FDI A;  2FBW C;  2D2C D;  3Q1M A;  3U3F A;  2E74 C;  3AE5 C;  1RQU A;  1OW6 A;  1KQF B;  2JO1 A;  4OGQ C;  3D6Z A;  3IN6 A;  2ZT9 C;  4PV1 C;  1V4A A;  3RQF A;  1AJY A;  3BRJ A;  2E75 C;  1ZP0 C;  4RKU J;  4GDO A;  1OW7 A;  4H0L B;  2JX0 A;  2PBE A;  3JYY A;  3Q5S A;  1WTY A;  1KIL E;  2OQQ A;  1EXI A;  4EBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...