3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
2WQYC 2JPUA 1ZOYC 3K7DA 1K04A 4EBJA 1YQ3C 1KNYA 3GM2A 3U3FA 3AE6C 1QVXA 3JZ0A 3S9OA 3AE4C 4XEVA 2L6GA 3U0CA 1K40A 3RQFA 1YQ4C 1WWPA 1WTYA 1PV3A 3ABVC 3SFDC 4R32A 1WOLA 1OW8A 3C8GB 3AEAC 5F28E 3L8JA 3AJMA 3L8IA 4EBKA 2JX0A 2KK1A 2H88C 3C18A 3AECC 3C8GD 3AEFC 4NQFA 3SFEC 3TULA 1V4AA 3AE1C 1OW6A 1K05A 3JYYA 3AEEC 4YTPC 3RQGA 2G3AA 3RQEA 3GM1A 1JOGA 2PBEA 2L6HA 3AE9C 2FBWC 1O3UA 3C8GA 3AE8C 2HSBA 2Q00A 3BRJA 3AE2C 3AEGC 3O10A 3AEBC 3AEDC 1OW7A 3AE5C 2YWAA 1ZP0C 2L6FA 3AE3C 3MFNA 4XEKA 1KTMA 3GM3A 3AE7C 2H89C 1ZZPA 2LK4A 4XEFA 3B71A 1UFBA 4YXDC
chains in the Genus database with same CATH superfamily
1ZR2A 2YIUC 1H0TB 2WQYC 5HV9A 5B3IA 3FWLA 3II6A 3AQCA 5KJ7C 3TOLA 1H6GA 1ZV8A 4MVZA 4DRHB 2G3KA 2XL8A 3I5CA 1UIIA 2KLVA 3H1KJ 4OWFA 4E7SA 2WSCH 4CS8A 2IZ1A 4CIPA 3UGPA 5KLIC 4ZMDA 4LDKA 1O5HA 3HRNA 1QQ3A 1BGYD 4RDAA 3OWTA 1Q7YQ 1NFOA 2M0BA 2KSFA 2L5GB 2P2UA 3V2QA 3MUDC 4CX9A 1Z6AA 1I5NA 3A0HH 2R03A 2E76D 2YKZA 1G4US 2A68F 3U59A 1FBMA 3L74G 1YI2P 3KZIE 3BCCG 2YRFA 4IFFA 1LS4A 1NTKE 1SQPK 4IB4A 1ZU4A 3SSUA 3P8CE 5CCHA 1DX7A 5H2FH 4A4AA 1LE4A 2I8DA 3L8IA 1U7MA 4CIHA 1A02F 1SQXG 3HKKA 2J45A 5CHXA 5BU8B 1FOSF 4NQFA 3V4QA 1EZVE 2QY9A 3SFEC 2FYUG 2J0XA 1GU4A 3CCQP 1T6AA 4XWJA 3RYLA 2P10A 3KMIA 2L7AA 1NFNA 2GA1A 2IBZD 5AW9B 3M4BA 1FAPB 2Q1KA 2FXPA 1MQVA 1SVFA 5CCHC 1E84A 5B66H 4YK5A 4XA4A 1N8RQ 2KI7B 1YITP 1NSGB 2JKVA 4AUWA 3PHLA 1FZGA 1QZXA 3TOMA 3V4WA 1HE9A 4OD5A 1N73C 2W6BA 3K1IC 2EPKX 2IDBA 1D0YA 4FESA 4WJ0A 1L4AC 3CC2P 1T6IA 5JUAA 4JC7A 2QLAA 2M4EA 5K0IA 5AW1B 5D91A 2R7OA 2KB7P 1M90Q 3X1OA 2FXMA 2P61A 3H1ID 1GW4A 3AE6C 5JRAA 4NY3A 2HS5A 1T5OA 4WGZA 1HH0A 3CX5E 4W7ZA 1N2DC 4GYTA 1IZNB 2ZAEB 1Z23A 1W2BO 1OQCA 1LP1B 4PD4E 3CCLP 5TISE 3DI5A 2IYOA 2BEZF 3EQLF 3D70A 3ASOC 2XLOA 1S1CX 3AG4C 1RKCA 3L70J 3DZAA 2K9JA 1NU1E 2M3EA 3C63A 1GL2C 3H1IG 3LLIA 4WY4C 1GQAA 4MS2A 1Q90D 2KSJA 1BDJB 3I4UA 4JW1A 2ITAA 2GA0A 1E85A 1VQ8P 1HGZA 5A6KA 5AVWB 3AJMA 2OJED 2K1AA 3LW5H 1Y6DA 4WABA 3RK2D 5CI8A 1APCA 1EKYA 1CGNA 1V4AA 3L73D 5CMZA 1JMBA 3L70D 2CK3H 2TMVP 4H44B 4C46A 3CCSP 3T97B 1PCXA 4N78E 3R7CA 4ZLCA 2OARA 2QJKC 4J32B 5CBOA 1WMKA 5KYWB 1Q0KA 3LESA 3PTZA 1RJ9B 2I1JA 2XM0A 1S9KE 4L6RA 2P58A 3WU2H 2EPNA 2H8AA 3W67A 1OXKA 2IOQA 4Q7CA 2NPSB 5A6BD 1OVUA 1OCOC 1EZVG 3EFGA 2C04A 1M1JC 3CI9A 2ZXEB 3Q6MA 3QMKA 1G8XA 1HGVA 2K3RA 3UGOA 2AXCA 1S7ZA 2KW3C 4OVNF 1OIPA 1RF0C 3K1HA 3UMIA 1T8ZA 3HD7D 5KAIH 3O39A 5M1BA 2DYRC 1KN7A 4W7YA 4EHPA 3G50A 1ZLLA 3DE9A 1ZHWA 1U57A 3EZHA 3L75J 1T6UA 1Y8AA 5CCGC 3S0XA 2QRXA 1K04A 1BSHA 3RL0D 1VOMA 3ABKC 4IARA 1IFMA 4JZAA 1CI6B 1CZQA 2G8YA 3TNUB 4H0LC 3WHNA 1Q0DA 1PGQA 5AVXB 4MTOA 2IBFA 5GTIH 5BQGA 3K6BA 1FE6A 2KYVA 2W83C 5AVVB 1GL2D 2H7BA 4PD4H 1TU3F 4P6IC 1TR2A 2UUHA 3M91A 2VASA 4Z9JA 3RVYA 4WY4B 2ZYGA 3R2PA 3B29A 3H1KE 2GUSA 3U5SA 3ABLC 1M6TA 4HFFB 3RK3D 1HTLC 1EXIA 3BASA 3M4CA 3SFDC 3U1CA 2Q3IA 4C3BA 4PFPA 3HUSC 1OR3A 2E5YA 2GFHA 3HUSB 4ULWA 1VMAA 3L74E 3VN0A 1PD1A 4GQHA 3I55P 2AEJA 5AVQB 1NTKG 4MVMA 1Q82Q 3HLZA 1JUNA 2B89A 1FC2C 5APYA 1Q0FA 1BCCD 2AWYA 3ABMC 4MVOA 3QH9A 3AEFC 3KYJA 1JMWA 2W8ZA 2ZYDA 3AE1C 1LI5A 3E1IA 1VQOP 4YTPC 4D6TJ 1A7VA 3RQGA 2FYUJ 3E70C 2G3AA 2ZT9B 2KUBA 1L4AD 3H1LJ 4E17A 1D0XA 3EWKA 2XLEA 2OYHC 1TWAA 4H13C 2E87A 3SWFA 3JCUE 2IFNA 3HE4A 3MYFA 2WVOA 2E5TA 3CC7P 3CZ6A 3GORA 1O3UA 3E9VA 1EQ1A 3F47A 2IXNA 2C9LY 2UWJE 3AEGC 1VQ6P 4OGQD 5E2QA 1QLEC 2FFDA 5A6BA 1OCRC 3L4FA 5JT4A 1PGPA 3NRHA 3QTHA 1C17M 4YWQA 2B0JA 1NTMK 1SQVK 2KS1B 3ZDMA 2MWQA 1USEA 5A6JA 2H8PD 2IBZI 1IFPA 3IEEA 2JEEA 1VF5C 3B71A 5H2FE 2CCYA 3M15A 4RD9A 5BQHA 1L7CA 1M1KQ 3G4ZA 1H9GA 5KAIE 2CW0F 5T3TA 1LTAC 5AC4A 3T97A 3CXHH 3PDMP 1Y4CA 3Q7LA 1OXZA 1GK4A 4RO0A 3EFOA 3LUTB 3B8EB 1HWTC 1SQQG 4IL6E 3U2LA 2BE5F 3ECSA 3CCUP 1E86A 1NU1J 1ZHYA 4WWIA 2E76C 3EG9A 1JY2P 3UR3C 2YL1A 3RQFA 2VRSA 3CX5D 1WWPA 4DZOA 1SQXD 3OAKA 1JEKA 2Q7CA 2M64A 3K5BA 2R25A 5KYXA 3CXHI 3QWOC 2QE7H 2WT7B 2R3CA 2LR2A 4YXWH 3GMAA 2CGEA 3C8GB 3A0BH 3RL0C 1Q81Q 4P9FA 1HMDA 4M63A 1NOHA 3H1KG 3DE8A 2O1KA 2EPMX 4YN0B 4HEAJ 3TSIA 1P84I 2L91A 1S5LH 4O9BA 1JMMA 2J58A 1LS1A 3H1HG 1MFZA 1FJPA 1SQQE 4K35A 2LSEA 1FZBA 1VTMP 4KNVA 1Z63A 1WATA 1I4ZA 1LJ2A 1NTZJ 3L74J 2YHSA 1QLED 4NPEA 3DXJF 4EWCA 4H13B 3NYJA 3FOPA 1PL5A 4GODA 4N3YB 2YXRB 2HPCB 2HSBA 2Y39A 1N7SC 2H7OA 1PIXA 2A06E 1CI6A 1RQVA 3TNUA 2OYIC 1FZCC 4DVZA 2IYPA 1G5ZA 2R05A 3AEDC 4BJTA 4H0LD 3JCUH 4BJ1A 5B1BC 1OVRA 1JTHB 2CNWD 4U5FE 3ZSUA 2Y3GA 3NKEA 5CI9A 5BU5A 3IQCA 2I1KA 3L75E 2QUPA 3U9JA 5APSA 3HNKA 5E79E 1X9VA 2YMYA 2LFDA 3RF3A 2B0HA 3JRMO 4I1LA 2A69F 1VQ9P 2K9JB 1TFOB 4LACB 4XEFA 2XS1A 1UFBA 4BEMJ 1SFCA 3O8ZA 2RSEB 4PJLA 1CPRA 1QVXA 5DQZA 5L0JA 3AE4C 5EK0A 4AX2A 2HR3A 3JT1A 2PX3A 1BE3J 1DD4A 2HUJA 4YPCA 2Q3TA 1TWHA 2NPSD 2R5DA 2V4HA 1V74B 2XLDA 4QI2A 1OCZC 4ASVA 1VPCA 3HE5B 1CW5A 4IGGA 2Y9YA 2FFHA 3PJSK 1JY3N 2A45I 4GKGA 2ZXWC 2B87A 3Q2YA 3DJUB 3WMM0 1HJ0A 5KAFH 5AC5A 5KLVE 4C7OA 2UUIA 3EFFK 2E75D 4I6MC 2YNYA 5CIVA 5L0CA 3L73J 3S27A 2WVRA 1KV4A 5FCLA 2KIKA 1OR2A 2W6AA 3ZVRA 3S84A 1MMDA 2Q5UA 2HMQA 1D1CA 1OKKA 1L2PA 1QVGO 2R7SA 4OINF 3N0TA 3H1LE 1X8YA 1NWQA 1M56D 1FDOA 4G7HF 3TULA 2RKLA 1JPNA 2BEQD 4QDLA 1VYKA 3R4YA 2WMMA 1JB0J 5L0FA 1FZCA 3POVA 3RBZA 3CAXA 1URQA 4CSAC 4WY4D 2OQMA 1TWCA 1BCCJ 3DJNB 2O9XA 5KLVG 3AE9C 3W2VA 4DBQA 1LWUA 2FYNB 2QJKB 3CCVP 1SQBD 4BG0A 4H44C 4RKUJ 1KU2A 4ZKPA 2G3VA 3EG9B 2WSEH 2HFIA 3AE5C 2YWAA 1ZP0C 3H1IJ 3KYQA 2X51A 2AEFA 1NVOA 1J1DB 1S2EA 1A0BA 1YVIA 1FZFA 1L0NE 3NMKA 1JM0A 1LGHB 2NUPB 3L72D 3NFQA 1M2OA 1ZZPA 4JIOA 1IK9A 1Y47A 1NAFA 2XNDH 3AGUA 3HTKB 3IFMA 5KYXB 3DMDA 2WT7A 2Q9BA 2Q7RA 2PP6A 5AW5B 2NPSA 1BBHA 1Z7Qc 3SYNA 2PAJA 3ZTZA 2MYSA 2WSFH 2HODA 2HKVA 3JZ0A 3U9MA 2N1TB 4ZLDA 2AVKA 2RN0A 2ZFCA 1RF1B 1NTKK 3IF4A 3RGUA 1E79H 3FVYA 1AEPA 5AW0B 2YKOA 3CPWO 1AA0A 3L73G 3PH0A 3RVZA 2QNLA 1B68A 4NTFA 1YQ4C 2P6VA 3VYIA 1SQBE 1FR0A 2CPBA 4W80A 1N7SB 3FXDA 2QSIA 2XDJA 3WUTA 1OW8A 1OCCC 2O01J 2M8RA 3CSKA 2WITA 4LLEA 2FYZA 2Z5HA 3MD0A 1PPJD 2IBZG 2YO3A 3EH1A 4C7RA 1N86A 1L0ND 4RBNA 4CSAA 2P1JA 3DWWA 2JX0A 3L72E 3AQBA 1RF1A 1LKXA 2LQGA 1DEEG 2WSCJ 1MNEA 3UMHA 3I56P 5DS4A 3EHNA 2OCCC 5AW6B 3L73E 2NZ2A 2KJGA 3H1HJ 3LS0A 3NDBB 1VQNP 1ZU5A 3P8CD 3SXZA 2L6HA 1EDIA 2FYUD 3GWLA 5JLIA 1BGYJ 3AGTA 3CXHD 2YEVA 2M5AB 3NYMA 1MNDA 3EJNA 3W2WA 3EGDA 3RW0A 1SQXE 1NKNA 2O01H 4Y99B 2YL7A 4LDQA 1NAYA 1S3JA 1MMGA 3C62A 1LWUC 2AWCA 3S90A 1G1JA 3L70G 3BVHA 1QGKB 4UB6H 3D71A 3VP9A 2P67A 1KYOD 4U5CE 4JJGA 3KDPB 2BASA 1L0LD 3H65A 4YXDC 3L34A 4CDVA 4OGQC 2JO1A 2LKMA 2P0NA 4I3MA 1VF5B 4DT0A 3QW1A 2KSEA 3CWBD 1KORA 1G2CB 2XU6A 1H88A 3KZIH 3ZIBA 4P9TA 1LM3B 2OTLP 1TKNA 1NHLA 1YZAA 3AG1C 2DYSC 2XZRA 1FS0E 1VLTA 3GEEA 1YBKA 1BE3E 3TGUD 1OMIA 4MQ9F 4C7NA 2QVAA 1SQPJ 3DM9B 3ITFA 3OA1A 4OIRF 4R4MA 4RJTA 1HVVA 5KYYB 2R7VA 2W9YA 2OYOA 4KHXA 2OYHB 1EDLA 3H1JG 4M3LA 4U3FD 5AW8B 5K5GB 2C0WA 2J9BA 3DD7A 1LT1A 2JWAA 2WZLA 4XPXA 2GUVA 1QL2A 4U5DE 1S72P 1KB9D 4A2NB 3G4SP 1GTWA 1KD1Q 1E5WA 1NU7D 4HH2A 4EIJA 2RD9A 1T3JA 4JEBA 5KYYA 2JJLA 4AL1A 1EA8A 3A0BE 3MUDA 1IO4A 3VP8A 1PGOA 1JRAA 2HJ3A 1BE3G 1VLSA 3M1CB 4OGQB 1JOGA 2B9BA 4R4LA 4NCQA 1YJWP 2IBZE 4U3FJ 3G9RA 3TQOA 1ZR4A 2E75B 2HV6A 4O6MA 3USSA 3O10A 1KILB 1Y9BA 2RH0A 1YIJP 4KJMA 1N7LA 1Z5ZA 3SXYA 1D0ZA 1TFKB 4TLFA 4AK9A 3TGUJ 2AEMA 5L8RJ 1SFCC 3V5YA 2Q3EA 4JF7A 2GDCA 2MHRA 1L0LJ 2BCCE 4XPYA 1BGYE 5L3QA 1SMYF 4XLPF 1KILE 5AW7B 1YYJA 1GM5A 5AVUB 1FTSA 3UNGC 2NG1A 2HYNA 1CSBA 3CWBJ 1N73A 3M79A 4ONSA 4IFDK 2YLDA 4X0RA 3ZWIA 2R3SA 4GOFA 3I5PA 1IFNA 1A02J 1PP9D 3TJ6A 1NTKJ 2YVKA 1FDMA 1PFIA 1PP9E 1JTHA 2VCBA 2R32A 3LW5J 3M06A 1EQ7A 2A0BA 1AV1A 1BR2A 5DVWA 2N1TC 1S05A 1IFJA 1JY2N 4MNDA 1WTYA 4LLCA 3O6XA 3HD7A 3MLGA 4H54A 3H1LG 1URQC 2Y0DA 2QA4P 1RH5B 3IAOA 5AVRB 3US6A 1URQB 4IL6X 3JCUQ 3O6QA 1KYOE 3W8HA 1W2EA 3VOPA 3C1LA 2PGDA 2N9YB 1Q86Q 3NMJA 2ZT9D 3F5HA 3KPEA 5DQTA 1FU1A 3L75G 2J8WA 2ZJSE 3WAQA 1YJ9P 1YDIA 4MTFA 3AG2C 4XE5B 2KS1A 4U3FG 5AVTB 2YZSA 3HNIA 4WY4A 1RKEA 1G1IA 5APXA 2ICWG 3CCEP 2VCCA 4E7ZA 3L74D 2C9NY 1XWJA 1YHQP 4BRYA 4EDFA 4YL1A 2IYLD 1DEBA 3H1JE 2FBWC 1AVOA 4GT1A 2Q4FA 4N6CA 3AE8C 2Y3BA 4OH8B 4XQ1A 3ZC4A 1OX3A 4N78D 1IZMA 3H2VA 2OEVA 1QSPA 3D6YA 5KJ7A 5KLIB 4D6TE 1T01A 1SLQA 2OYHA 2CDQA 5COGA 1KQGB 3RK3E 3RK2B 3U1AA 4XLNF 2WSEJ 3MGNA 1LT9C 2FKWB 1BR4A 3S29A 1SS1A 2IXMA 3T6BA 1KQSO 4BJ6C 1QKRA 4U3FE 1L0LK 1IK7A 2QM8A 1KZUB 2PX0A 1ZW3A 1VK5A 4J7TA 2A1DD 3T9OA 1RKEB 1ZOYC 1GD2E 2QTVA 5HSWA 1HF9A 2K9YA 3CL3D 4L74A 3MTUE 1KNYA 4AE4A 2FFDC 3TDKA 2J9UA 4Z1MH 2WZGA 4PR9A 1AQ5A 4PJMA 1XTCC 1L0LE 3WU2E 1SFCD 1ORYA 4K7BA 3BRVB 1IFIA 3L72J 1VQPP 2J0WA 5AW3B 3MYIA 4NTAA 5EHHA 3ZG1A 1P84E 5AVZB 1KILC 4CPGA 3RKOF 2YO2A 3NYLA 3H1JD 2WPQA 2KZJA 1VQ5P 1FAVA 1WOLA 3FGAD 3EGXA 3U8VA 1ORJA 1SQPG 2HPCA 1PP9J 1T3UA 4AYCA 2F22A 5F28E 4B6IA 4GDOA 5APQA 4ER9A 1NLXA 1RE3C 1RHZB 1H0TA 4HYTB 4PD4I 2H88C 1VF5D 3EFOB 3HJCA 4JVSA 3AECC 3GF7A 1WT6A 3L0IA 1CGME 3WUUA 2WL8A 2FYUK 1IJDB 4H4KC 3B5NA 3L71G 1NU9C 3M9HA 3LS1A 1OZHA 4CS7A 3H2UA 3P7KA 5E3AA 5DLJA 2WWWA 2EILC 1USDA 1BDCA 1XZQA 4N6HA 4OIOF 3B4SA 1GDTA 3RQEA 4D4XA 4HKZH 2ZXOA 3WODF 1SP4A 3JRTA 3QVZA 1M1JA 3EGXB 4O6NA 2L9JA 1YA9A 2QJYB 2OOCA 3C8GA 4JEAA 1OKKD 4LDRA 1BE3D 2AXTH 3VMZA 1SQVJ 1NTMJ 4MVRA 2WVNA 5DJUB 1VQLP 3AE3C 1YTZI 1EI7A 2Q9CA 4N6JA 3ZTMA 1NTZE 4DCKA 3RIPA 4O7GA 4EUKB 3JSEO 1AFOA 1A7EA 5BUOA 2H7HA 2LK4A 1AQTA 2OYIB 3N7NA 3VMYA 2WTYA 1BGYG 2CNWA 1ZXGA 5KJ7D 2ZD9A 1FMVA 2BCCJ 2Q9AA 3AOUA 3U3FA 5GTHH 4PJJA 1JPJA 2P7VA 2HG5D 1NU1K 2JDIH 3MIWA 3C8ZA 1R5SA 2AXTE 4JURI 1BZ4A 4Z9HA 1KILD 4L73A 3CC4P 3QZCA 5AVSB 5A6AA 3U0CA 3LLKA 3BCCE 3CWBE 5CBNA 1LT9A 1N7SD 3FXHA 2WPVB 1VB5A 1SQQK 5JP7A 2R44A 3HE4B 3OW2O 4I1MA 1ZHTA 1F1MA 1ZMEC 3LEVA 4YT2A 2DI3A 2KGOA 1MZ9A 2FYUE 3U8PA 4EOTA 3TK1A 2OTJP 4NTBA 2JD3A 4BPMA 2WPRA 1HY5A 4KI2A 3KXDA 2P7JA 2D4UA 3H32A 3L8JA 3HTKA 2EPOA 1L0LG 3CD6P 5AW2B 4GOEA 1OXBA 3L37A 1NTZD 4MW3A 1KQFB 2D2CC 1VQMP 3VM6A 2PRRA 4E18A 1QPUA 1KFMA 4AE4B 4WBAA 2LXBA 1RF0A 1RY3A 4PJ0H 3N4XA 4FWVA 3V5BA 4JQ0D 4FX5A 3K1IA 2V26A 3SNHA 1XTGB 4E0IA 4PV1C 1NTMD 1SQVD 1P84H 4JKVA 2XLVA 3AEBC 3MX3A 1U6HA 1KFNA 2O1JA 2XXAB 5F5HA 2EPLX 3L71E 3DAGA 1FZCB 1K73Q 3KKBA 4K0DA 3DAFA 1MFTA 5KYNA 3SZRA 1C02A 1QX8A 5T1DB 4CJOA 1GGQA 3M0AA 3H1HD 1JY2O 1WRGA 1LPEA 1SYQA 2IXPA 2XS8A 4CS8C 1C03A 5DS6A 4O6YA 2MKVA 5DS5A 3AG3C 4U5BE 4TT3H 3T6JA 4IOIH 1YLMA 3F46A 2XL6A 1GL2A 1M2VA 1ZRTE 2HSQA 2XLHA 2C0XA 5APTA 3CCRP 5JSLA 3GM2A 2WB7A 4Q4ZF 4LLHA 1MMAA 1K8AQ 1L0NJ 1R5LA 1Z56A 3Q5SA 2V3CC 4LC1A 4ZNCA 2HFED 3DKAA 4U7JA 5KLVJ 1M1JB 1R5ID 2FY8A 5TJ5E 4BJ6A 2Z4EA 2J59M 3B0UX 2IFMA 1GS9A 1ST6A 3ASNC 5E3CA 2J7PA 4BJ5C 2M3BA 3E7KA 4N06A 5TISH 3ZQYA 4CS9C 3V5XA 4D6TD 4UB8H 2HV7A 2E74D 2OU6A 2FAPB 2KK7A 3CWBG 1MV8A 3EQ2A 5B1AC 3C8VA 5APVA 1S9KD 2DGJA 4IJJA 3BCCJ 1FDIA 1NH4A 3S4RA 3MHVA 3L71D 3NKDA 3TD7A 2YKQA 1SR2A 2A45H 1KB9E 5KKZB 3Q6NA 2DW3A 3KHUA 1AVYA 2LD6A 3FOOA 1LTJC 1SFCB 1CPQA 3N2ZB 1G2CA 3C9IA 1XZPA 3ATPA 1PPJE 2GAQA 4C7OB 2R7UA 2Y9ZA 3GWNA 1NTME 1SQVE 3V2PA 4JJFA 1SF8A 2WSFJ 4EKWA 3NTNA 2ZXPA 1YJNP 3HUSA 3SWKA 4DRIB 3HE5A 2YLGA 2WPSA 3NMDA 1J1EB 2KLUA 4ULVA 5COFA 4C7NB 3KL4A 1T2KC 3GW6A 4JBZA 1RMVA 1IC2A 5T3WA 5COMA 4YT4A 1SQQD 3PRJA 5FZTA 1JR8A 2R7XA 3EPVA 1OFCX 1RE4C 4A7PA 2KP8A 3U3BA 2CPSA 3AE7C 4AQRD 4EIYA 1X79B 2H89C 1PZQA 2VCAA 2R7QA 1NYHA 3H1IE 1A7DA 3MP7B 3FXEA 3GEIA 1SQXJ 1KC8Q 1MUUA 1V55C 4IAOA 1VQ4P 2R5BA 2XV5A 3LJBA 3NG1A 2QG4A 2RMZA 2Y0CA 1D1BA 2NSGA 5L3VA 5TJHA 2D2CB 1RCPA 1SQBJ 2HMZA 1U0BB 1L3PA 5L0GA 3TJ5A 2IZ0A 2R7WA 4J7YA 2NSFA 1JY3P 1E83A 2I8BA 3Q1MA 1RF1C 1U89A 1ORSC 1IFDA 2V7QH 2NRGA 3IR9A 3GHGA 4I2LC 3M9BA 4DXWA 1EDKA 3FAPB 3L1MA 2W90A 4G7ZF 2MJZA 4Z9IA 1NO4A 4JTCB 4BWNA 4IL6H 1GMJA 1RJ9A 4PJ0E 2A06D 2LXCB 5DJTB 3TGUG 1EXJA 5JVEA 5L0IA 1KILA 4ZKUA 5L0DA 2ZVOB 2LIGA 3H1HE 3L70E 2NUTB 5L0HA 1BR1A 3JTLO 3V2NA 2I15A 3PHF2 4FAPB 3L72G 1TQGA 4U5HA 3ZDLA 2ZXXA 2R9RB 2XLWA 2XM4A 3SXMA 1YYCA 2SPZA 5KLVK 1M7LA 3RK2C 1VYIA 3N24A 2K88A 4UDVA 3PP5A 4GIFA 4W8PA 3FAJA 2OKUA 3RH3A 5CCGA 1G4WR 1EDJA 2J5UA 4DOJA 2ZVNB 1NJIQ 2XKMA 5F5FA 1SZIA 3HTKC 5AGFA 2Q00A 3BRJA 3AE2C 3PMRA 3B5NB 3M0DC 2H7VC 2OG2A 2G62A 1PPJG 3S1KA 3KQGA 2KZIA 3B5NC 3LIDA 4JTDB 2DB4A 3TYYA 3LEOA 2B88A 3A5TA 3CX5H 4DJGA 1H7IA 3KH2A 3GM3A 2QJPB 3Q5RA 3S28A 1HUCA 2FXOA 3O6QB 1K9MQ 1R4TA 2OGUA 4I1OB 1KYOH 4OIPF 4JRZA 1E2XA 1JNMA 2Y69C 3A9CA 3K7DA 2YMKA 2NPUA 1YQ3C 4KBLA 4HFKB 3S9OA 3TGUE 2E43A 5KAFE 2AU5A 1JOCA 3FDQA 4OIQF 5A69A 1KB9I 4XEVA 3M0DA 4JCZA 3CEXA 4YT8A 3ITKA 5APUA 3Q5PA 2YL0A 1URQD 1CGOA 3E1RA 3SXKA 3CMAP 1KYOI 3NXSA 3L75D 3VYWA 2K37A 2EIMC 2PF4E 3ABVC 1LTJA 2YIUB 1LIHA 2PP4A 1Z3IX 2QJYC 5GTIE 3B0VC 2FYNC 1W2WA 3Q3DA 4CJGA 2WSSH 2E76B 3IQ5A 3G3ZA 2XNXA 3HD7C 1NKZB 1SQBG 4EBKA 1LT9B 1N1CA 3C18A 1YA7O 3GEHA 4EBBA 4IRUA 1NTZG 3A7OA 1RQUA 1M57C 1LTGC 1HW2A 2KOGA 3F89A 5CCGD 3V2RA 1FZAA 3L35A 1S4XA 2C03A 4YT5A 1SQBK 2YL3A 3JSVC 4JYCA 3JC22 4PV1D 2EIJC 3PLNA 1LI7A 4KT0J 5BVZA 4MVUA 2W27A 3BRTB 1ZW0A 1VQKP 4YJWA 3A0HE 2IPPA 4XTKA 1BCCG 3DM5A 1M2VB 256BA 5B5EE 5CCHD 3RK3C 2L6FA 1JO5A 5EGYA 3MFNA 2NUTA 2VC9A 2KXPB 1FMWA 1D7MA 1Q2NA 5KYWA 3X2QC 1LTIC 2OTKE 4QMAA 4PK4A 2W6JH 3CQZA 4WVZA 1DOVA 4KC9A 5KLVD 3G6EP 2A0UA 3SP1A 3H25A 3EHMA 3H1KD 5CJ0A 2JPUA 1X22A 3GHGC 4MW8A 2IM8A 1ZYRF 2KNHA 4F4BA 3RFYA 4BJ5A 4MN4C 2W45A 4KNWA 2J46A 4D6TG 1AJYA 2PNOA 4GEHA 2ZYAA 1J1DC 1HJBA 2NUPA 3FX0A 2L6GA 3D6ZA 4C3EA 2QEXP 5E33A 2KYHA 2QE9A 1H89A 4ASWA 1QVFO 4CDAA 5AVYB 5B5EH 1YJGA 4WGYA 1GU5A 1PV3A 2HZ8A 1QEXA 1JCDA 4BEJA 3A2AA 3UMKA 4QI0A 3CXHE 2LFFA 5GPGB 1LTSC 3K33A 1GL2B 4LERA 1MKMA 1A41A 3CMEP 1FJKA 2XRHA 4PFOA 3EGDB 2LCHA 1EC5A 4DJ9A 2WVQA 2N1TA 3OEOA 2KK1A 1KQLA 4JCHA 1NTMG 1SQVG 5JS5A 2W4MA 3T6GB 1YAUO 1LTBC 2IXOA 3OA7A 4UB6E 1O87A 3H1JJ 1YYXA 3EH2A 3AEEC 3VAYA 1L0NK 4OD4A 2E74C 3TK0A 3CX5I 2N9BA 4J30B 3GANA 3VMAA 4AL0A 2YQYA 1SQQJ 2KQ9A 1NZEA 4JE9A 4DRJB 4K3AA 4H44D 1NTZK 4L75A 3NMIA 3KYIA 3M9QA 1L4AB 3GF3A 2ZPAA 4WB4A 1OW7A 3W68A 2Z15A 2PFDA 3P32A 3C7JA 5GTHE 3EZIA 3LIEA 3BCCD 1P84D 1ZVZA 1M57D 2VB6A 4NPFX 2XSEA 4NPDA 2GWWA 1KB9H 4IFMA 3IQ6A 3OJAB 2B87B 1MMNA 2JWDA 1S5LX 2HLOA 1DIPA 1ZN5A 3GHGB 2EINC 4NC3A 2JR8A 5BQIA 1T2KD 1HE1A 4EBJA 1R8EA 2WZ7A 3I5QA 3MZWB 5E79H 4PD4D 4I44A 2BL2A 4PACA 1ZRTD 4UB8E 4U5GA 1QL1A 3L36A 2Y3HA 2KC3A 1LWUB 1AVOB 5D92A 2O01N 3W4YA 3JYHA 3GODA 1PGJA 3U2MA 2QM7A 4BRYB 3Q7GA 4PJNA 1L4AA 3RL0g 4CBEA 4DOZA 3BEHA 2E74B 3IN6A 2FGYA 4G7OF 1X0TA 5B66E 2KNCB 1NG1A 1EZVI 1ZHXA 2FFDB 2E42A 3BATA 3FWNA 5APWA 3VRCA 3UIAA 4XPWA 5KYUA 4JTAB 1PP9G 4L76A 2J7PD 1DD3A 3B0PA 3G71P 4YL0A 2YLIA 1OWAA 3AEAC 3W8IA 3CCJP 3V7OA 1WN0A 2A6EF 3V5ZA 3IQTA 1YTZT 1SQXK 1NU1G 1WASA 1BDDA 1LP1A 1OW6A 5CJ4A 1I4YA 2XXAA 2POHA 2CYDA 2Q6QA 1M56C 4DBRA 1M8OB 1VL2A 1N73B 4HE8D 4Q5SF 2HODB 1LE2A 3VMXA 3GM1A 4IAQA 5KTBA 4ANJA 3A11A 2R02A 1JCCA 1ZHZA 2A6HF 5AW4B 2H43A 5KYUB 1NTKD 2N1TD 1J8MF 2Q9IA 4U5EE 1YARO 1RXQA 1JAFA 2YKPA 1L0NG 1W5CE 1BCCE 4K1OA 4H13D 1RE3A 4G78A 3FHDA 3LNMB 4EYYQ 4I7ZC 2WZFA 2XLMA 4N4WA 2P1AA 3HNJA 3VF0A 2IX7C 4LGDE 4U9EA 4H0LB 1H9TA 2ASRA 1KMIZ 2ZXRA 2ZT9C 3SWYA 2BCCG 2YXQB 2V7QJ 3CLQA 1T6QA 4PV1B 3TF5A 1D1AA 2D2CD 1NGMB 2A06G 3FMSA 3G4XA 1FNTc 3WUVA 3T4RA 2AP3A 2O3JA 4DVYP 1VDFA 2QIWA 3O55A 3GLMA 2GM4A 3KPHA 1YZCA 4C3DA 1HW1A 1PD0A 4E0HA 2R7TA 1BSNA 3H6PA 3IPMO 4CS9A 3HNLA 1VQ7P 2BCCD 1OVVA 1K40A 3LAYA 2BC5A 2D5RB 1UG7A 4IWBA 4U9DA 4Y28J 1V54C 1HBWA 4HB1A 4BXLA 2J9WA 3J06A 3SEOA 2NPSC 1TWGA 2X0CA 2L81A 2EIKC 4EI2A 2W4BA 4R32A 4HJGH 4YL3A 3VTPC 3ZQVA 1HMOA 4W8KA 2XL4A 4MTGA 1FZEA 4XFJA 2J9VA 3K66A 3QVYA 2ETSA 1U7JA 4CDYA 5EFWB 1LNQA 4MVSA 2Y0EA 3MBGA 1FOSE 1J2JB 3C8GD 1Q0MA 2PFXA 4JPZB 3HD7B 2OYIA 3IHUA 1J8YF 5B3SC 3GG2A 1SQPE 1K05A 4G0HA 3WG7C 3JYYA 4MVQA 2A45G 1H8AA 1SQPD 3LNRA 2VH3A 3QW0A 1AUEA 1GK6A 4D4NA 1RE4A 1NBBA 4Y99C 2OJQA 3RL0B 2QJPC 2HJMA 4B86A 3B5ND 2PBEA 3L71J 2JP3A 2LP4A 3JSZA 1NU1D 1UIXA 3V6IA 3P8MC 1LVKA 5C39A 1FFTC 1LTTC 3RBXA 2Z5IA 1LTJB 2Y3DA 2R7RA 2OQQA 2KNCA 4RESB 5KKZC 1WGWA 1FFHA 3CCMP 4I7ZB 1DH3A 1Q0GA 1EZVD 3RK3B 1IW7F 3H1LD 1GW3A 1DOWA 4JYBA 3A3YB 1ZW2A 2OEXA 1KTMA 1S5LE 4XEKA 5IY5C 2M5AA 1T9KA 3B9QA 1J1EC 1N7SA 4O79A 2E75C 3PCVA 3H32B 1JY3O 1GZLA
chains in the Genus database with same CATH topology
4PV1B 2YIUC 2WQYC 1ZRTE 2D2CD 2JPUA 1ZOYC 1NGMB 3K7DA 1HF9A 4OGQC 1K04A 2K9YA 2JO1A 2YMKA 4EBJA 1R8EA 1YQ3C 1VF5B 1KNYA 3GM2A 3U3FA 3AE6C 1UFBA 1QVXA 4Z1MH 3S9OA 3JZ0A 1KORA 2QIWA 2G8YA 3AE4C 3GLMA 4H0LC 3Q5SA 1DD4A 1AJYA 2D2CB 4U7JA 4XEVA 2L6GA 3D6ZA 5KLIC 4YXDC 3U0CA 3LW5J 3Q5PA 2E76C 3RL0g 3Q1MA 1K40A 1TU3F 2E74B 3RQFA 3IN6A 2WPVB 4Y28J 2BEZF 1YQ4C 1WWPA 1PV3A 1WTYA 3D70A 1OMIA 1S1CX 3Q2YA 2E76D 3ABVC 1HJ0A 1ZMEC 1EXIA 4R4MA 3SFDC 2E74D 4R32A 2E75D 2QJYC 3IAOA 1DD3A 2QSIA 1WOLA 2FYNC 1GMJA 1MKMA 3FGAD 1OW8A 3GMAA 2O01J 4IL6X 3C8VA 3Q3DA 3C8GB 1Q90D 2E76B 4XFJA 3AEAC 3O6QA 1EXJA 5F28E 1FDIA 4GDOA 3L8JA 3AJMA 3L8IA 4EBKA 2ZT9D 2JX0A 2H88C 2KK1A 1VF5D 3C18A 3AECC 3GF7A 3C8GD 3AEFC 4NQFA 3SFEC 2WSCJ 1FDOA 1RQUA 3TULA 1V4AA 3AE1C 1OW6A 2BEQD 2P10A 1KQFB 1K05A 3R4YA 2D2CC 3JYYA 1JB0J 3AEEC 4YTPC 3RQGA 2E74C 4H44B 2NZ2A 3T97B 2G3AA 2ZT9B 1VL2A 4PV1D 2FXPA 4KT0J 2QJKC 3EWKA 3RQEA 1WMKA 3GM1A 2QJPC 4H13B 4OGQB 1JOGA 4R4LA 4H13C 2J5UA 2L6HA 2PBEA 2WSFJ 1PL5A 2JP3A 3AE9C 4H44D 3G9RA 4PV1C 2FBWC 1UIXA 1O3UA 3C8GA 2E75B 3AE8C 2HSBA 2Q00A 3BRJA 4H44C 3AE2C 4RKUJ 1PIXA 3AEGC 1RQVA 3O10A 1Y9BA 4OGQD 3GF3A 3AEBC 3AEDC 1OW7A 3AE5C 2YWAA 3D6YA 1ZP0C 2OQQA 4H0LD 4H13D 5KKZC 2L6FA 1KQGB 3RK3E 3AE3C 2IDBA 4I7ZB 2WSEJ 4I7ZC 5L8RJ 3D71A 3MFNA 4XEKA 1KTMA 3GM3A 3AE7C 3Q5RA 1IK7A 2H89C 2MKVA 5M1BA 1ZZPA 2LK4A 1NYHA 4H0LB 1S5LX 1KILE 4TT3H 1KMIZ 2ZT9C 4XEFA 2E75C 1VF5C 3B71A 3H25A 2V7QJ 1U57A 1DIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQY C;  2JPU A;  1ZOY C;  3K7D A;  1K04 A;  4EBJ A;  1YQ3 C;  1KNY A;  3GM2 A;  3U3F A;  3AE6 C;  1QVX A;  3JZ0 A;  3S9O A;  3AE4 C;  4XEV A;  2L6G A;  3U0C A;  1K40 A;  3RQF A;  1YQ4 C;  1WWP A;  1WTY A;  1PV3 A;  3ABV C;  3SFD C;  4R32 A;  1WOL A;  1OW8 A;  3C8G B;  3AEA C;  5F28 E;  3L8J A;  3AJM A;  3L8I A;  4EBK A;  2JX0 A;  2KK1 A;  2H88 C;  3C18 A;  3AEC C;  3C8G D;  3AEF C;  4NQF A;  3SFE C;  3TUL A;  1V4A A;  3AE1 C;  1OW6 A;  1K05 A;  3JYY A;  3AEE C;  4YTP C;  3RQG A;  2G3A A;  3RQE A;  3GM1 A;  1JOG A;  2PBE A;  2L6H A;  3AE9 C;  2FBW C;  1O3U A;  3C8G A;  3AE8 C;  2HSB A;  2Q00 A;  3BRJ A;  3AE2 C;  3AEG C;  3O10 A;  3AEB C;  3AED C;  1OW7 A;  3AE5 C;  2YWA A;  1ZP0 C;  2L6F A;  3AE3 C;  3MFN A;  4XEK A;  1KTM A;  3GM3 A;  3AE7 C;  2H89 C;  1ZZP A;  2LK4 A;  4XEF A;  3B71 A;  1UFB A;  4YXD C; 
#chains in the Genus database with same CATH topology
 1ZR2 A;  2YIU C;  1H0T B;  2WQY C;  5HV9 A;  5B3I A;  3FWL A;  3II6 A;  3AQC A;  5KJ7 C;  3TOL A;  1H6G A;  1ZV8 A;  4MVZ A;  4DRH B;  2G3K A;  2XL8 A;  3I5C A;  1UII A;  2KLV A;  3H1K J;  4OWF A;  4E7S A;  2WSC H;  4CS8 A;  2IZ1 A;  4CIP A;  3UGP A;  5KLI C;  4ZMD A;  4LDK A;  1O5H A;  3HRN A;  1QQ3 A;  1BGY D;  4RDA A;  3OWT A;  1Q7Y Q;  1NFO A;  2M0B A;  2KSF A;  2L5G B;  2P2U A;  3V2Q A;  3MUD C;  4CX9 A;  1Z6A A;  1I5N A;  3A0H H;  2R03 A;  2E76 D;  2YKZ A;  1G4U S;  2A68 F;  3U59 A;  1FBM A;  3L74 G;  1YI2 P;  3KZI E;  3BCC G;  2YRF A;  4IFF A;  1LS4 A;  1NTK E;  1SQP K;  4IB4 A;  1ZU4 A;  3SSU A;  3P8C E;  5CCH A;  1DX7 A;  5H2F H;  4A4A A;  1LE4 A;  2I8D A;  3L8I A;  1U7M A;  4CIH A;  1A02 F;  1SQX G;  3HKK A;  2J45 A;  5CHX A;  5BU8 B;  1FOS F;  4NQF A;  3V4Q A;  1EZV E;  2QY9 A;  3SFE C;  2FYU G;  2J0X A;  1GU4 A;  3CCQ P;  1T6A A;  4XWJ A;  3RYL A;  2P10 A;  3KMI A;  2L7A A;  1NFN A;  2GA1 A;  2IBZ D;  5AW9 B;  3M4B A;  1FAP B;  2Q1K A;  2FXP A;  1MQV A;  1SVF A;  5CCH C;  1E84 A;  5B66 H;  4YK5 A;  4XA4 A;  1N8R Q;  2KI7 B;  1YIT P;  1NSG B;  2JKV A;  4AUW A;  3PHL A;  1FZG A;  1QZX A;  3TOM A;  3V4W A;  1HE9 A;  4OD5 A;  1N73 C;  2W6B A;  3K1I C;  2EPK X;  2IDB A;  1D0Y A;  4FES A;  4WJ0 A;  1L4A C;  3CC2 P;  1T6I A;  5JUA A;  4JC7 A;  2QLA A;  2M4E A;  5K0I A;  5AW1 B;  5D91 A;  2R7O A;  2KB7 P;  1M90 Q;  3X1O A;  2FXM A;  2P61 A;  3H1I D;  1GW4 A;  3AE6 C;  5JRA A;  4NY3 A;  2HS5 A;  1T5O A;  4WGZ A;  1HH0 A;  3CX5 E;  4W7Z A;  1N2D C;  4GYT A;  1IZN B;  2ZAE B;  1Z23 A;  1W2B O;  1OQC A;  1LP1 B;  4PD4 E;  3CCL P;  5TIS E;  3DI5 A;  2IYO A;  2BEZ F;  3EQL F;  3D70 A;  3ASO C;  2XLO A;  1S1C X;  3AG4 C;  1RKC A;  3L70 J;  3DZA A;  2K9J A;  1NU1 E;  2M3E A;  3C63 A;  1GL2 C;  3H1I G;  3LLI A;  4WY4 C;  1GQA A;  4MS2 A;  1Q90 D;  2KSJ A;  1BDJ B;  3I4U A;  4JW1 A;  2ITA A;  2GA0 A;  1E85 A;  1VQ8 P;  1HGZ A;  5A6K A;  5AVW B;  3AJM A;  2OJE D;  2K1A A;  3LW5 H;  1Y6D A;  4WAB A;  3RK2 D;  5CI8 A;  1APC A;  1EKY A;  1CGN A;  1V4A A;  3L73 D;  5CMZ A;  1JMB A;  3L70 D;  2CK3 H;  2TMV P;  4H44 B;  4C46 A;  3CCS P;  3T97 B;  1PCX A;  4N78 E;  3R7C A;  4ZLC A;  2OAR A;  2QJK C;  4J32 B;  5CBO A;  1WMK A;  5KYW B;  1Q0K A;  3LES A;  3PTZ A;  1RJ9 B;  2I1J A;  2XM0 A;  1S9K E;  4L6R A;  2P58 A;  3WU2 H;  2EPN A;  2H8A A;  3W67 A;  1OXK A;  2IOQ A;  4Q7C A;  2NPS B;  5A6B D;  1OVU A;  1OCO C;  1EZV G;  3EFG A;  2C04 A;  1M1J C;  3CI9 A;  2ZXE B;  3Q6M A;  3QMK A;  1G8X A;  1HGV A;  2K3R A;  3UGO A;  2AXC A;  1S7Z A;  2KW3 C;  4OVN F;  1OIP A;  1RF0 C;  3K1H A;  3UMI A;  1T8Z A;  3HD7 D;  5KAI H;  3O39 A;  5M1B A;  2DYR C;  1KN7 A;  4W7Y A;  4EHP A;  3G50 A;  1ZLL A;  3DE9 A;  1ZHW A;  1U57 A;  3EZH A;  3L75 J;  1T6U A;  1Y8A A;  5CCG C;  3S0X A;  2QRX A;  1K04 A;  1BSH A;  3RL0 D;  1VOM A;  3ABK C;  4IAR A;  1IFM A;  4JZA A;  1CI6 B;  1CZQ A;  2G8Y A;  3TNU B;  4H0L C;  3WHN A;  1Q0D A;  1PGQ A;  5AVX B;  4MTO A;  2IBF A;  5GTI H;  5BQG A;  3K6B A;  1FE6 A;  2KYV A;  2W83 C;  5AVV B;  1GL2 D;  2H7B A;  4PD4 H;  1TU3 F;  4P6I C;  1TR2 A;  2UUH A;  3M91 A;  2VAS A;  4Z9J A;  3RVY A;  4WY4 B;  2ZYG A;  3R2P A;  3B29 A;  3H1K E;  2GUS A;  3U5S A;  3ABL C;  1M6T A;  4HFF B;  3RK3 D;  1HTL C;  1EXI A;  3BAS A;  3M4C A;  3SFD C;  3U1C A;  2Q3I A;  4C3B A;  4PFP A;  3HUS C;  1OR3 A;  2E5Y A;  2GFH A;  3HUS B;  4ULW A;  1VMA A;  3L74 E;  3VN0 A;  1PD1 A;  4GQH A;  3I55 P;  2AEJ A;  5AVQ B;  1NTK G;  4MVM A;  1Q82 Q;  3HLZ A;  1JUN A;  2B89 A;  1FC2 C;  5APY A;  1Q0F A;  1BCC D;  2AWY A;  3ABM C;  4MVO A;  3QH9 A;  3AEF C;  3KYJ A;  1JMW A;  2W8Z A;  2ZYD A;  3AE1 C;  1LI5 A;  3E1I A;  1VQO P;  4YTP C;  4D6T J;  1A7V A;  3RQG A;  2FYU J;  3E70 C;  2G3A A;  2ZT9 B;  2KUB A;  1L4A D;  3H1L J;  4E17 A;  1D0X A;  3EWK A;  2XLE A;  2OYH C;  1TWA A;  4H13 C;  2E87 A;  3SWF A;  3JCU E;  2IFN A;  3HE4 A;  3MYF A;  2WVO A;  2E5T A;  3CC7 P;  3CZ6 A;  3GOR A;  1O3U A;  3E9V A;  1EQ1 A;  3F47 A;  2IXN A;  2C9L Y;  2UWJ E;  3AEG C;  1VQ6 P;  4OGQ D;  5E2Q A;  1QLE C;  2FFD A;  5A6B A;  1OCR C;  3L4F A;  5JT4 A;  1PGP A;  3NRH A;  3QTH A;  1C17 M;  4YWQ A;  2B0J A;  1NTM K;  1SQV K;  2KS1 B;  3ZDM A;  2MWQ A;  1USE A;  5A6J A;  2H8P D;  2IBZ I;  1IFP A;  3IEE A;  2JEE A;  1VF5 C;  3B71 A;  5H2F E;  2CCY A;  3M15 A;  4RD9 A;  5BQH A;  1L7C A;  1M1K Q;  3G4Z A;  1H9G A;  5KAI E;  2CW0 F;  5T3T A;  1LTA C;  5AC4 A;  3T97 A;  3CXH H;  3PDM P;  1Y4C A;  3Q7L A;  1OXZ A;  1GK4 A;  4RO0 A;  3EFO A;  3LUT B;  3B8E B;  1HWT C;  1SQQ G;  4IL6 E;  3U2L A;  2BE5 F;  3ECS A;  3CCU P;  1E86 A;  1NU1 J;  1ZHY A;  4WWI A;  2E76 C;  3EG9 A;  1JY2 P;  3UR3 C;  2YL1 A;  3RQF A;  2VRS A;  3CX5 D;  1WWP A;  4DZO A;  1SQX D;  3OAK A;  1JEK A;  2Q7C A;  2M64 A;  3K5B A;  2R25 A;  5KYX A;  3CXH I;  3QWO C;  2QE7 H;  2WT7 B;  2R3C A;  2LR2 A;  4YXW H;  3GMA A;  2CGE A;  3C8G B;  3A0B H;  3RL0 C;  1Q81 Q;  4P9F A;  1HMD A;  4M63 A;  1NOH A;  3H1K G;  3DE8 A;  2O1K A;  2EPM X;  4YN0 B;  4HEA J;  3TSI A;  1P84 I;  2L91 A;  1S5L H;  4O9B A;  1JMM A;  2J58 A;  1LS1 A;  3H1H G;  1MFZ A;  1FJP A;  1SQQ E;  4K35 A;  2LSE A;  1FZB A;  1VTM P;  4KNV A;  1Z63 A;  1WAT A;  1I4Z A;  1LJ2 A;  1NTZ J;  3L74 J;  2YHS A;  1QLE D;  4NPE A;  3DXJ F;  4EWC A;  4H13 B;  3NYJ A;  3FOP A;  1PL5 A;  4GOD A;  4N3Y B;  2YXR B;  2HPC B;  2HSB A;  2Y39 A;  1N7S C;  2H7O A;  1PIX A;  2A06 E;  1CI6 A;  1RQV A;  3TNU A;  2OYI C;  1FZC C;  4DVZ A;  2IYP A;  1G5Z A;  2R05 A;  3AED C;  4BJT A;  4H0L D;  3JCU H;  4BJ1 A;  5B1B C;  1OVR A;  1JTH B;  2CNW D;  4U5F E;  3ZSU A;  2Y3G A;  3NKE A;  5CI9 A;  5BU5 A;  3IQC A;  2I1K A;  3L75 E;  2QUP A;  3U9J A;  5APS A;  3HNK A;  5E79 E;  1X9V A;  2YMY A;  2LFD A;  3RF3 A;  2B0H A;  3JRM O;  4I1L A;  2A69 F;  1VQ9 P;  2K9J B;  1TFO B;  4LAC B;  4XEF A;  2XS1 A;  1UFB A;  4BEM J;  1SFC A;  3O8Z A;  2RSE B;  4PJL A;  1CPR A;  1QVX A;  5DQZ A;  5L0J A;  3AE4 C;  5EK0 A;  4AX2 A;  2HR3 A;  3JT1 A;  2PX3 A;  1BE3 J;  1DD4 A;  2HUJ A;  4YPC A;  2Q3T A;  1TWH A;  2NPS D;  2R5D A;  2V4H A;  1V74 B;  2XLD A;  4QI2 A;  1OCZ C;  4ASV A;  1VPC A;  3HE5 B;  1CW5 A;  4IGG A;  2Y9Y A;  2FFH A;  3PJS K;  1JY3 N;  2A45 I;  4GKG A;  2ZXW C;  2B87 A;  3Q2Y A;  3DJU B;  3WMM 0;  1HJ0 A;  5KAF H;  5AC5 A;  5KLV E;  4C7O A;  2UUI A;  3EFF K;  2E75 D;  4I6M C;  2YNY A;  5CIV A;  5L0C A;  3L73 J;  3S27 A;  2WVR A;  1KV4 A;  5FCL A;  2KIK A;  1OR2 A;  2W6A A;  3ZVR A;  3S84 A;  1MMD A;  2Q5U A;  2HMQ A;  1D1C A;  1OKK A;  1L2P A;  1QVG O;  2R7S A;  4OIN F;  3N0T A;  3H1L E;  1X8Y A;  1NWQ A;  1M56 D;  1FDO A;  4G7H F;  3TUL A;  2RKL A;  1JPN A;  2BEQ D;  4QDL A;  1VYK A;  3R4Y A;  2WMM A;  1JB0 J;  5L0F A;  1FZC A;  3POV A;  3RBZ A;  3CAX A;  1URQ A;  4CSA C;  4WY4 D;  2OQM A;  1TWC A;  1BCC J;  3DJN B;  2O9X A;  5KLV G;  3AE9 C;  3W2V A;  4DBQ A;  1LWU A;  2FYN B;  2QJK B;  3CCV P;  1SQB D;  4BG0 A;  4H44 C;  4RKU J;  1KU2 A;  4ZKP A;  2G3V A;  3EG9 B;  2WSE H;  2HFI A;  3AE5 C;  2YWA A;  1ZP0 C;  3H1I J;  3KYQ A;  2X51 A;  2AEF A;  1NVO A;  1J1D B;  1S2E A;  1A0B A;  1YVI A;  1FZF A;  1L0N E;  3NMK A;  1JM0 A;  1LGH B;  2NUP B;  3L72 D;  3NFQ A;  1M2O A;  1ZZP A;  4JIO A;  1IK9 A;  1Y47 A;  1NAF A;  2XND H;  3AGU A;  3HTK B;  3IFM A;  5KYX B;  3DMD A;  2WT7 A;  2Q9B A;  2Q7R A;  2PP6 A;  5AW5 B;  2NPS A;  1BBH A;  1Z7Q c;  3SYN A;  2PAJ A;  3ZTZ A;  2MYS A;  2WSF H;  2HOD A;  2HKV A;  3JZ0 A;  3U9M A;  2N1T B;  4ZLD A;  2AVK A;  2RN0 A;  2ZFC A;  1RF1 B;  1NTK K;  3IF4 A;  3RGU A;  1E79 H;  3FVY A;  1AEP A;  5AW0 B;  2YKO A;  3CPW O;  1AA0 A;  3L73 G;  3PH0 A;  3RVZ A;  2QNL A;  1B68 A;  4NTF A;  1YQ4 C;  2P6V A;  3VYI A;  1SQB E;  1FR0 A;  2CPB A;  4W80 A;  1N7S B;  3FXD A;  2QSI A;  2XDJ A;  3WUT A;  1OW8 A;  1OCC C;  2O01 J;  2M8R A;  3CSK A;  2WIT A;  4LLE A;  2FYZ A;  2Z5H A;  3MD0 A;  1PPJ D;  2IBZ G;  2YO3 A;  3EH1 A;  4C7R A;  1N86 A;  1L0N D;  4RBN A;  4CSA A;  2P1J A;  3DWW A;  2JX0 A;  3L72 E;  3AQB A;  1RF1 A;  1LKX A;  2LQG A;  1DEE G;  2WSC J;  1MNE A;  3UMH A;  3I56 P;  5DS4 A;  3EHN A;  2OCC C;  5AW6 B;  3L73 E;  2NZ2 A;  2KJG A;  3H1H J;  3LS0 A;  3NDB B;  1VQN P;  1ZU5 A;  3P8C D;  3SXZ A;  2L6H A;  1EDI A;  2FYU D;  3GWL A;  5JLI A;  1BGY J;  3AGT A;  3CXH D;  2YEV A;  2M5A B;  3NYM A;  1MND A;  3EJN A;  3W2W A;  3EGD A;  3RW0 A;  1SQX E;  1NKN A;  2O01 H;  4Y99 B;  2YL7 A;  4LDQ A;  1NAY A;  1S3J A;  1MMG A;  3C62 A;  1LWU C;  2AWC A;  3S90 A;  1G1J A;  3L70 G;  3BVH A;  1QGK B;  4UB6 H;  3D71 A;  3VP9 A;  2P67 A;  1KYO D;  4U5C E;  4JJG A;  3KDP B;  2BAS A;  1L0L D;  3H65 A;  4YXD C;  3L34 A;  4CDV A;  4OGQ C;  2JO1 A;  2LKM A;  2P0N A;  4I3M A;  1VF5 B;  4DT0 A;  3QW1 A;  2KSE A;  3CWB D;  1KOR A;  1G2C B;  2XU6 A;  1H88 A;  3KZI H;  3ZIB A;  4P9T A;  1LM3 B;  2OTL P;  1TKN A;  1NHL A;  1YZA A;  3AG1 C;  2DYS C;  2XZR A;  1FS0 E;  1VLT A;  3GEE A;  1YBK A;  1BE3 E;  3TGU D;  1OMI A;  4MQ9 F;  4C7N A;  2QVA A;  1SQP J;  3DM9 B;  3ITF A;  3OA1 A;  4OIR F;  4R4M A;  4RJT A;  1HVV A;  5KYY B;  2R7V A;  2W9Y A;  2OYO A;  4KHX A;  2OYH B;  1EDL A;  3H1J G;  4M3L A;  4U3F D;  5AW8 B;  5K5G B;  2C0W A;  2J9B A;  3DD7 A;  1LT1 A;  2JWA A;  2WZL A;  4XPX A;  2GUV A;  1QL2 A;  4U5D E;  1S72 P;  1KB9 D;  4A2N B;  3G4S P;  1GTW A;  1KD1 Q;  1E5W A;  1NU7 D;  4HH2 A;  4EIJ A;  2RD9 A;  1T3J A;  4JEB A;  5KYY A;  2JJL A;  4AL1 A;  1EA8 A;  3A0B E;  3MUD A;  1IO4 A;  3VP8 A;  1PGO A;  1JRA A;  2HJ3 A;  1BE3 G;  1VLS A;  3M1C B;  4OGQ B;  1JOG A;  2B9B A;  4R4L A;  4NCQ A;  1YJW P;  2IBZ E;  4U3F J;  3G9R A;  3TQO A;  1ZR4 A;  2E75 B;  2HV6 A;  4O6M A;  3USS A;  3O10 A;  1KIL B;  1Y9B A;  2RH0 A;  1YIJ P;  4KJM A;  1N7L A;  1Z5Z A;  3SXY A;  1D0Z A;  1TFK B;  4TLF A;  4AK9 A;  3TGU J;  2AEM A;  5L8R J;  1SFC C;  3V5Y A;  2Q3E A;  4JF7 A;  2GDC A;  2MHR A;  1L0L J;  2BCC E;  4XPY A;  1BGY E;  5L3Q A;  1SMY F;  4XLP F;  1KIL E;  5AW7 B;  1YYJ A;  1GM5 A;  5AVU B;  1FTS A;  3UNG C;  2NG1 A;  2HYN A;  1CSB A;  3CWB J;  1N73 A;  3M79 A;  4ONS A;  4IFD K;  2YLD A;  4X0R A;  3ZWI A;  2R3S A;  4GOF A;  3I5P A;  1IFN A;  1A02 J;  1PP9 D;  3TJ6 A;  1NTK J;  2YVK A;  1FDM A;  1PFI A;  1PP9 E;  1JTH A;  2VCB A;  2R32 A;  3LW5 J;  3M06 A;  1EQ7 A;  2A0B A;  1AV1 A;  1BR2 A;  5DVW A;  2N1T C;  1S05 A;  1IFJ A;  1JY2 N;  4MND A;  1WTY A;  4LLC A;  3O6X A;  3HD7 A;  3MLG A;  4H54 A;  3H1L G;  1URQ C;  2Y0D A;  2QA4 P;  1RH5 B;  3IAO A;  5AVR B;  3US6 A;  1URQ B;  4IL6 X;  3JCU Q;  3O6Q A;  1KYO E;  3W8H A;  1W2E A;  3VOP A;  3C1L A;  2PGD A;  2N9Y B;  1Q86 Q;  3NMJ A;  2ZT9 D;  3F5H A;  3KPE A;  5DQT A;  1FU1 A;  3L75 G;  2J8W A;  2ZJS E;  3WAQ A;  1YJ9 P;  1YDI A;  4MTF A;  3AG2 C;  4XE5 B;  2KS1 A;  4U3F G;  5AVT B;  2YZS A;  3HNI A;  4WY4 A;  1RKE A;  1G1I A;  5APX A;  2ICW G;  3CCE P;  2VCC A;  4E7Z A;  3L74 D;  2C9N Y;  1XWJ A;  1YHQ P;  4BRY A;  4EDF A;  4YL1 A;  2IYL D;  1DEB A;  3H1J E;  2FBW C;  1AVO A;  4GT1 A;  2Q4F A;  4N6C A;  3AE8 C;  2Y3B A;  4OH8 B;  4XQ1 A;  3ZC4 A;  1OX3 A;  4N78 D;  1IZM A;  3H2V A;  2OEV A;  1QSP A;  3D6Y A;  5KJ7 A;  5KLI B;  4D6T E;  1T01 A;  1SLQ A;  2OYH A;  2CDQ A;  5COG A;  1KQG B;  3RK3 E;  3RK2 B;  3U1A A;  4XLN F;  2WSE J;  3MGN A;  1LT9 C;  2FKW B;  1BR4 A;  3S29 A;  1SS1 A;  2IXM A;  3T6B A;  1KQS O;  4BJ6 C;  1QKR A;  4U3F E;  1L0L K;  1IK7 A;  2QM8 A;  1KZU B;  2PX0 A;  1ZW3 A;  1VK5 A;  4J7T A;  2A1D D;  3T9O A;  1RKE B;  1ZOY C;  1GD2 E;  2QTV A;  5HSW A;  1HF9 A;  2K9Y A;  3CL3 D;  4L74 A;  3MTU E;  1KNY A;  4AE4 A;  2FFD C;  3TDK A;  2J9U A;  4Z1M H;  2WZG A;  4PR9 A;  1AQ5 A;  4PJM A;  1XTC C;  1L0L E;  3WU2 E;  1SFC D;  1ORY A;  4K7B A;  3BRV B;  1IFI A;  3L72 J;  1VQP P;  2J0W A;  5AW3 B;  3MYI A;  4NTA A;  5EHH A;  3ZG1 A;  1P84 E;  5AVZ B;  1KIL C;  4CPG A;  3RKO F;  2YO2 A;  3NYL A;  3H1J D;  2WPQ A;  2KZJ A;  1VQ5 P;  1FAV A;  1WOL A;  3FGA D;  3EGX A;  3U8V A;  1ORJ A;  1SQP G;  2HPC A;  1PP9 J;  1T3U A;  4AYC A;  2F22 A;  5F28 E;  4B6I A;  4GDO A;  5APQ A;  4ER9 A;  1NLX A;  1RE3 C;  1RHZ B;  1H0T A;  4HYT B;  4PD4 I;  2H88 C;  1VF5 D;  3EFO B;  3HJC A;  4JVS A;  3AEC C;  3GF7 A;  1WT6 A;  3L0I A;  1CGM E;  3WUU A;  2WL8 A;  2FYU K;  1IJD B;  4H4K C;  3B5N A;  3L71 G;  1NU9 C;  3M9H A;  3LS1 A;  1OZH A;  4CS7 A;  3H2U A;  3P7K A;  5E3A A;  5DLJ A;  2WWW A;  2EIL C;  1USD A;  1BDC A;  1XZQ A;  4N6H A;  4OIO F;  3B4S A;  1GDT A;  3RQE A;  4D4X A;  4HKZ H;  2ZXO A;  3WOD F;  1SP4 A;  3JRT A;  3QVZ A;  1M1J A;  3EGX B;  4O6N A;  2L9J A;  1YA9 A;  2QJY B;  2OOC A;  3C8G A;  4JEA A;  1OKK D;  4LDR A;  1BE3 D;  2AXT H;  3VMZ A;  1SQV J;  1NTM J;  4MVR A;  2WVN A;  5DJU B;  1VQL P;  3AE3 C;  1YTZ I;  1EI7 A;  2Q9C A;  4N6J A;  3ZTM A;  1NTZ E;  4DCK A;  3RIP A;  4O7G A;  4EUK B;  3JSE O;  1AFO A;  1A7E A;  5BUO A;  2H7H A;  2LK4 A;  1AQT A;  2OYI B;  3N7N A;  3VMY A;  2WTY A;  1BGY G;  2CNW A;  1ZXG A;  5KJ7 D;  2ZD9 A;  1FMV A;  2BCC J;  2Q9A A;  3AOU A;  3U3F A;  5GTH H;  4PJJ A;  1JPJ A;  2P7V A;  2HG5 D;  1NU1 K;  2JDI H;  3MIW A;  3C8Z A;  1R5S A;  2AXT E;  4JUR I;  1BZ4 A;  4Z9H A;  1KIL D;  4L73 A;  3CC4 P;  3QZC A;  5AVS B;  5A6A A;  3U0C A;  3LLK A;  3BCC E;  3CWB E;  5CBN A;  1LT9 A;  1N7S D;  3FXH A;  2WPV B;  1VB5 A;  1SQQ K;  5JP7 A;  2R44 A;  3HE4 B;  3OW2 O;  4I1M A;  1ZHT A;  1F1M A;  1ZME C;  3LEV A;  4YT2 A;  2DI3 A;  2KGO A;  1MZ9 A;  2FYU E;  3U8P A;  4EOT A;  3TK1 A;  2OTJ P;  4NTB A;  2JD3 A;  4BPM A;  2WPR A;  1HY5 A;  4KI2 A;  3KXD A;  2P7J A;  2D4U A;  3H32 A;  3L8J A;  3HTK A;  2EPO A;  1L0L G;  3CD6 P;  5AW2 B;  4GOE A;  1OXB A;  3L37 A;  1NTZ D;  4MW3 A;  1KQF B;  2D2C C;  1VQM P;  3VM6 A;  2PRR A;  4E18 A;  1QPU A;  1KFM A;  4AE4 B;  4WBA A;  2LXB A;  1RF0 A;  1RY3 A;  4PJ0 H;  3N4X A;  4FWV A;  3V5B A;  4JQ0 D;  4FX5 A;  3K1I A;  2V26 A;  3SNH A;  1XTG B;  4E0I A;  4PV1 C;  1NTM D;  1SQV D;  1P84 H;  4JKV A;  2XLV A;  3AEB C;  3MX3 A;  1U6H A;  1KFN A;  2O1J A;  2XXA B;  5F5H A;  2EPL X;  3L71 E;  3DAG A;  1FZC B;  1K73 Q;  3KKB A;  4K0D A;  3DAF A;  1MFT A;  5KYN A;  3SZR A;  1C02 A;  1QX8 A;  5T1D B;  4CJO A;  1GGQ A;  3M0A A;  3H1H D;  1JY2 O;  1WRG A;  1LPE A;  1SYQ A;  2IXP A;  2XS8 A;  4CS8 C;  1C03 A;  5DS6 A;  4O6Y A;  2MKV A;  5DS5 A;  3AG3 C;  4U5B E;  4TT3 H;  3T6J A;  4IOI H;  1YLM A;  3F46 A;  2XL6 A;  1GL2 A;  1M2V A;  1ZRT E;  2HSQ A;  2XLH A;  2C0X A;  5APT A;  3CCR P;  5JSL A;  3GM2 A;  2WB7 A;  4Q4Z F;  4LLH A;  1MMA A;  1K8A Q;  1L0N J;  1R5L A;  1Z56 A;  3Q5S A;  2V3C C;  4LC1 A;  4ZNC A;  2HFE D;  3DKA A;  4U7J A;  5KLV J;  1M1J B;  1R5I D;  2FY8 A;  5TJ5 E;  4BJ6 A;  2Z4E A;  2J59 M;  3B0U X;  2IFM A;  1GS9 A;  1ST6 A;  3ASN C;  5E3C A;  2J7P A;  4BJ5 C;  2M3B A;  3E7K A;  4N06 A;  5TIS H;  3ZQY A;  4CS9 C;  3V5X A;  4D6T D;  4UB8 H;  2HV7 A;  2E74 D;  2OU6 A;  2FAP B;  2KK7 A;  3CWB G;  1MV8 A;  3EQ2 A;  5B1A C;  3C8V A;  5APV A;  1S9K D;  2DGJ A;  4IJJ A;  3BCC J;  1FDI A;  1NH4 A;  3S4R A;  3MHV A;  3L71 D;  3NKD A;  3TD7 A;  2YKQ A;  1SR2 A;  2A45 H;  1KB9 E;  5KKZ B;  3Q6N A;  2DW3 A;  3KHU A;  1AVY A;  2LD6 A;  3FOO A;  1LTJ C;  1SFC B;  1CPQ A;  3N2Z B;  1G2C A;  3C9I A;  1XZP A;  3ATP A;  1PPJ E;  2GAQ A;  4C7O B;  2R7U A;  2Y9Z A;  3GWN A;  1NTM E;  1SQV E;  3V2P A;  4JJF A;  1SF8 A;  2WSF J;  4EKW A;  3NTN A;  2ZXP A;  1YJN P;  3HUS A;  3SWK A;  4DRI B;  3HE5 A;  2YLG A;  2WPS A;  3NMD A;  1J1E B;  2KLU A;  4ULV A;  5COF A;  4C7N B;  3KL4 A;  1T2K C;  3GW6 A;  4JBZ A;  1RMV A;  1IC2 A;  5T3W A;  5COM A;  4YT4 A;  1SQQ D;  3PRJ A;  5FZT A;  1JR8 A;  2R7X A;  3EPV A;  1OFC X;  1RE4 C;  4A7P A;  2KP8 A;  3U3B A;  2CPS A;  3AE7 C;  4AQR D;  4EIY A;  1X79 B;  2H89 C;  1PZQ A;  2VCA A;  2R7Q A;  1NYH A;  3H1I E;  1A7D A;  3MP7 B;  3FXE A;  3GEI A;  1SQX J;  1KC8 Q;  1MUU A;  1V55 C;  4IAO A;  1VQ4 P;  2R5B A;  2XV5 A;  3LJB A;  3NG1 A;  2QG4 A;  2RMZ A;  2Y0C A;  1D1B A;  2NSG A;  5L3V A;  5TJH A;  2D2C B;  1RCP A;  1SQB J;  2HMZ A;  1U0B B;  1L3P A;  5L0G A;  3TJ5 A;  2IZ0 A;  2R7W A;  4J7Y A;  2NSF A;  1JY3 P;  1E83 A;  2I8B A;  3Q1M A;  1RF1 C;  1U89 A;  1ORS C;  1IFD A;  2V7Q H;  2NRG A;  3IR9 A;  3GHG A;  4I2L C;  3M9B A;  4DXW A;  1EDK A;  3FAP B;  3L1M A;  2W90 A;  4G7Z F;  2MJZ A;  4Z9I A;  1NO4 A;  4JTC B;  4BWN A;  4IL6 H;  1GMJ A;  1RJ9 A;  4PJ0 E;  2A06 D;  2LXC B;  5DJT B;  3TGU G;  1EXJ A;  5JVE A;  5L0I A;  1KIL A;  4ZKU A;  5L0D A;  2ZVO B;  2LIG A;  3H1H E;  3L70 E;  2NUT B;  5L0H A;  1BR1 A;  3JTL O;  3V2N A;  2I15 A;  3PHF 2;  4FAP B;  3L72 G;  1TQG A;  4U5H A;  3ZDL A;  2ZXX A;  2R9R B;  2XLW A;  2XM4 A;  3SXM A;  1YYC A;  2SPZ A;  5KLV K;  1M7L A;  3RK2 C;  1VYI A;  3N24 A;  2K88 A;  4UDV A;  3PP5 A;  4GIF A;  4W8P A;  3FAJ A;  2OKU A;  3RH3 A;  5CCG A;  1G4W R;  1EDJ A;  2J5U A;  4DOJ A;  2ZVN B;  1NJI Q;  2XKM A;  5F5F A;  1SZI A;  3HTK C;  5AGF A;  2Q00 A;  3BRJ A;  3AE2 C;  3PMR A;  3B5N B;  3M0D C;  2H7V C;  2OG2 A;  2G62 A;  1PPJ G;  3S1K A;  3KQG A;  2KZI A;  3B5N C;  3LID A;  4JTD B;  2DB4 A;  3TYY A;  3LEO A;  2B88 A;  3A5T A;  3CX5 H;  4DJG A;  1H7I A;  3KH2 A;  3GM3 A;  2QJP B;  3Q5R A;  3S28 A;  1HUC A;  2FXO A;  3O6Q B;  1K9M Q;  1R4T A;  2OGU A;  4I1O B;  1KYO H;  4OIP F;  4JRZ A;  1E2X A;  1JNM A;  2Y69 C;  3A9C A;  3K7D A;  2YMK A;  2NPU A;  1YQ3 C;  4KBL A;  4HFK B;  3S9O A;  3TGU E;  2E43 A;  5KAF E;  2AU5 A;  1JOC A;  3FDQ A;  4OIQ F;  5A69 A;  1KB9 I;  4XEV A;  3M0D A;  4JCZ A;  3CEX A;  4YT8 A;  3ITK A;  5APU A;  3Q5P A;  2YL0 A;  1URQ D;  1CGO A;  3E1R A;  3SXK A;  3CMA P;  1KYO I;  3NXS A;  3L75 D;  3VYW A;  2K37 A;  2EIM C;  2PF4 E;  3ABV C;  1LTJ A;  2YIU B;  1LIH A;  2PP4 A;  1Z3I X;  2QJY C;  5GTI E;  3B0V C;  2FYN C;  1W2W A;  3Q3D A;  4CJG A;  2WSS H;  2E76 B;  3IQ5 A;  3G3Z A;  2XNX A;  3HD7 C;  1NKZ B;  1SQB G;  4EBK A;  1LT9 B;  1N1C A;  3C18 A;  1YA7 O;  3GEH A;  4EBB A;  4IRU A;  1NTZ G;  3A7O A;  1RQU A;  1M57 C;  1LTG C;  1HW2 A;  2KOG A;  3F89 A;  5CCG D;  3V2R A;  1FZA A;  3L35 A;  1S4X A;  2C03 A;  4YT5 A;  1SQB K;  2YL3 A;  3JSV C;  4JYC A;  3JC2 2;  4PV1 D;  2EIJ C;  3PLN A;  1LI7 A;  4KT0 J;  5BVZ A;  4MVU A;  2W27 A;  3BRT B;  1ZW0 A;  1VQK P;  4YJW A;  3A0H E;  2IPP A;  4XTK A;  1BCC G;  3DM5 A;  1M2V B;  256B A;  5B5E E;  5CCH D;  3RK3 C;  2L6F A;  1JO5 A;  5EGY A;  3MFN A;  2NUT A;  2VC9 A;  2KXP B;  1FMW A;  1D7M A;  1Q2N A;  5KYW A;  3X2Q C;  1LTI C;  2OTK E;  4QMA A;  4PK4 A;  2W6J H;  3CQZ A;  4WVZ A;  1DOV A;  4KC9 A;  5KLV D;  3G6E P;  2A0U A;  3SP1 A;  3H25 A;  3EHM A;  3H1K D;  5CJ0 A;  2JPU A;  1X22 A;  3GHG C;  4MW8 A;  2IM8 A;  1ZYR F;  2KNH A;  4F4B A;  3RFY A;  4BJ5 A;  4MN4 C;  2W45 A;  4KNW A;  2J46 A;  4D6T G;  1AJY A;  2PNO A;  4GEH A;  2ZYA A;  1J1D C;  1HJB A;  2NUP A;  3FX0 A;  2L6G A;  3D6Z A;  4C3E A;  2QEX P;  5E33 A;  2KYH A;  2QE9 A;  1H89 A;  4ASW A;  1QVF O;  4CDA A;  5AVY B;  5B5E H;  1YJG A;  4WGY A;  1GU5 A;  1PV3 A;  2HZ8 A;  1QEX A;  1JCD A;  4BEJ A;  3A2A A;  3UMK A;  4QI0 A;  3CXH E;  2LFF A;  5GPG B;  1LTS C;  3K33 A;  1GL2 B;  4LER A;  1MKM A;  1A41 A;  3CME P;  1FJK A;  2XRH A;  4PFO A;  3EGD B;  2LCH A;  1EC5 A;  4DJ9 A;  2WVQ A;  2N1T A;  3OEO A;  2KK1 A;  1KQL A;  4JCH A;  1NTM G;  1SQV G;  5JS5 A;  2W4M A;  3T6G B;  1YAU O;  1LTB C;  2IXO A;  3OA7 A;  4UB6 E;  1O87 A;  3H1J J;  1YYX A;  3EH2 A;  3AEE C;  3VAY A;  1L0N K;  4OD4 A;  2E74 C;  3TK0 A;  3CX5 I;  2N9B A;  4J30 B;  3GAN A;  3VMA A;  4AL0 A;  2YQY A;  1SQQ J;  2KQ9 A;  1NZE A;  4JE9 A;  4DRJ B;  4K3A A;  4H44 D;  1NTZ K;  4L75 A;  3NMI A;  3KYI A;  3M9Q A;  1L4A B;  3GF3 A;  2ZPA A;  4WB4 A;  1OW7 A;  3W68 A;  2Z15 A;  2PFD A;  3P32 A;  3C7J A;  5GTH E;  3EZI A;  3LIE A;  3BCC D;  1P84 D;  1ZVZ A;  1M57 D;  2VB6 A;  4NPF X;  2XSE A;  4NPD A;  2GWW A;  1KB9 H;  4IFM A;  3IQ6 A;  3OJA B;  2B87 B;  1MMN A;  2JWD A;  1S5L X;  2HLO A;  1DIP A;  1ZN5 A;  3GHG B;  2EIN C;  4NC3 A;  2JR8 A;  5BQI A;  1T2K D;  1HE1 A;  4EBJ A;  1R8E A;  2WZ7 A;  3I5Q A;  3MZW B;  5E79 H;  4PD4 D;  4I44 A;  2BL2 A;  4PAC A;  1ZRT D;  4UB8 E;  4U5G A;  1QL1 A;  3L36 A;  2Y3H A;  2KC3 A;  1LWU B;  1AVO B;  5D92 A;  2O01 N;  3W4Y A;  3JYH A;  3GOD A;  1PGJ A;  3U2M A;  2QM7 A;  4BRY B;  3Q7G A;  4PJN A;  1L4A A;  3RL0 g;  4CBE A;  4DOZ A;  3BEH A;  2E74 B;  3IN6 A;  2FGY A;  4G7O F;  1X0T A;  5B66 E;  2KNC B;  1NG1 A;  1EZV I;  1ZHX A;  2FFD B;  2E42 A;  3BAT A;  3FWN A;  5APW A;  3VRC A;  3UIA A;  4XPW A;  5KYU A;  4JTA B;  1PP9 G;  4L76 A;  2J7P D;  1DD3 A;  3B0P A;  3G71 P;  4YL0 A;  2YLI A;  1OWA A;  3AEA C;  3W8I A;  3CCJ P;  3V7O A;  1WN0 A;  2A6E F;  3V5Z A;  3IQT A;  1YTZ T;  1SQX K;  1NU1 G;  1WAS A;  1BDD A;  1LP1 A;  1OW6 A;  5CJ4 A;  1I4Y A;  2XXA A;  2POH A;  2CYD A;  2Q6Q A;  1M56 C;  4DBR A;  1M8O B;  1VL2 A;  1N73 B;  4HE8 D;  4Q5S F;  2HOD B;  1LE2 A;  3VMX A;  3GM1 A;  4IAQ A;  5KTB A;  4ANJ A;  3A11 A;  2R02 A;  1JCC A;  1ZHZ A;  2A6H F;  5AW4 B;  2H43 A;  5KYU B;  1NTK D;  2N1T D;  1J8M F;  2Q9I A;  4U5E E;  1YAR O;  1RXQ A;  1JAF A;  2YKP A;  1L0N G;  1W5C E;  1BCC E;  4K1O A;  4H13 D;  1RE3 A;  4G78 A;  3FHD A;  3LNM B;  4EYY Q;  4I7Z C;  2WZF A;  2XLM A;  4N4W A;  2P1A A;  3HNJ A;  3VF0 A;  2IX7 C;  4LGD E;  4U9E A;  4H0L B;  1H9T A;  2ASR A;  1KMI Z;  2ZXR A;  2ZT9 C;  3SWY A;  2BCC G;  2YXQ B;  2V7Q J;  3CLQ A;  1T6Q A;  4PV1 B;  3TF5 A;  1D1A A;  2D2C D;  1NGM B;  2A06 G;  3FMS A;  3G4X A;  1FNT c;  3WUV A;  3T4R A;  2AP3 A;  2O3J A;  4DVY P;  1VDF A;  2QIW A;  3O55 A;  3GLM A;  2GM4 A;  3KPH A;  1YZC A;  4C3D A;  1HW1 A;  1PD0 A;  4E0H A;  2R7T A;  1BSN A;  3H6P A;  3IPM O;  4CS9 A;  3HNL A;  1VQ7 P;  2BCC D;  1OVV A;  1K40 A;  3LAY A;  2BC5 A;  2D5R B;  1UG7 A;  4IWB A;  4U9D A;  4Y28 J;  1V54 C;  1HBW A;  4HB1 A;  4BXL A;  2J9W A;  3J06 A;  3SEO A;  2NPS C;  1TWG A;  2X0C A;  2L81 A;  2EIK C;  4EI2 A;  2W4B A;  4R32 A;  4HJG H;  4YL3 A;  3VTP C;  3ZQV A;  1HMO A;  4W8K A;  2XL4 A;  4MTG A;  1FZE A;  4XFJ A;  2J9V A;  3K66 A;  3QVY A;  2ETS A;  1U7J A;  4CDY A;  5EFW B;  1LNQ A;  4MVS A;  2Y0E A;  3MBG A;  1FOS E;  1J2J B;  3C8G D;  1Q0M A;  2PFX A;  4JPZ B;  3HD7 B;  2OYI A;  3IHU A;  1J8Y F;  5B3S C;  3GG2 A;  1SQP E;  1K05 A;  4G0H A;  3WG7 C;  3JYY A;  4MVQ A;  2A45 G;  1H8A A;  1SQP D;  3LNR A;  2VH3 A;  3QW0 A;  1AUE A;  1GK6 A;  4D4N A;  1RE4 A;  1NBB A;  4Y99 C;  2OJQ A;  3RL0 B;  2QJP C;  2HJM A;  4B86 A;  3B5N D;  2PBE A;  3L71 J;  2JP3 A;  2LP4 A;  3JSZ A;  1NU1 D;  1UIX A;  3V6I A;  3P8M C;  1LVK A;  5C39 A;  1FFT C;  1LTT C;  3RBX A;  2Z5I A;  1LTJ B;  2Y3D A;  2R7R A;  2OQQ A;  2KNC A;  4RES B;  5KKZ C;  1WGW A;  1FFH A;  3CCM P;  4I7Z B;  1DH3 A;  1Q0G A;  1EZV D;  3RK3 B;  1IW7 F;  3H1L D;  1GW3 A;  1DOW A;  4JYB A;  3A3Y B;  1ZW2 A;  2OEX A;  1KTM A;  1S5L E;  4XEK A;  5IY5 C;  2M5A A;  1T9K A;  3B9Q A;  1J1E C;  1N7S A;  4O79 A;  2E75 C;  3PCV A;  3H32 B;  1JY3 O;  1GZL A; 
#chains in the Genus database with same CATH homology
 4PV1 B;  2YIU C;  2WQY C;  1ZRT E;  2D2C D;  2JPU A;  1ZOY C;  1NGM B;  3K7D A;  1HF9 A;  4OGQ C;  1K04 A;  2K9Y A;  2JO1 A;  2YMK A;  4EBJ A;  1R8E A;  1YQ3 C;  1VF5 B;  1KNY A;  3GM2 A;  3U3F A;  3AE6 C;  1UFB A;  1QVX A;  4Z1M H;  3S9O A;  3JZ0 A;  1KOR A;  2QIW A;  2G8Y A;  3AE4 C;  3GLM A;  4H0L C;  3Q5S A;  1DD4 A;  1AJY A;  2D2C B;  4U7J A;  4XEV A;  2L6G A;  3D6Z A;  5KLI C;  4YXD C;  3U0C A;  3LW5 J;  3Q5P A;  2E76 C;  3RL0 g;  3Q1M A;  1K40 A;  1TU3 F;  2E74 B;  3RQF A;  3IN6 A;  2WPV B;  4Y28 J;  2BEZ F;  1YQ4 C;  1WWP A;  1PV3 A;  1WTY A;  3D70 A;  1OMI A;  1S1C X;  3Q2Y A;  2E76 D;  3ABV C;  1HJ0 A;  1ZME C;  1EXI A;  4R4M A;  3SFD C;  2E74 D;  4R32 A;  2E75 D;  2QJY C;  3IAO A;  1DD3 A;  2QSI A;  1WOL A;  2FYN C;  1GMJ A;  1MKM A;  3FGA D;  1OW8 A;  3GMA A;  2O01 J;  4IL6 X;  3C8V A;  3Q3D A;  3C8G B;  1Q90 D;  2E76 B;  4XFJ A;  3AEA C;  3O6Q A;  1EXJ A;  5F28 E;  1FDI A;  4GDO A;  3L8J A;  3AJM A;  3L8I A;  4EBK A;  2ZT9 D;  2JX0 A;  2H88 C;  2KK1 A;  1VF5 D;  3C18 A;  3AEC C;  3GF7 A;  3C8G D;  3AEF C;  4NQF A;  3SFE C;  2WSC J;  1FDO A;  1RQU A;  3TUL A;  1V4A A;  3AE1 C;  1OW6 A;  2BEQ D;  2P10 A;  1KQF B;  1K05 A;  3R4Y A;  2D2C C;  3JYY A;  1JB0 J;  3AEE C;  4YTP C;  3RQG A;  2E74 C;  4H44 B;  2NZ2 A;  3T97 B;  2G3A A;  2ZT9 B;  1VL2 A;  4PV1 D;  2FXP A;  4KT0 J;  2QJK C;  3EWK A;  3RQE A;  1WMK A;  3GM1 A;  2QJP C;  4H13 B;  4OGQ B;  1JOG A;  4R4L A;  4H13 C;  2J5U A;  2L6H A;  2PBE A;  2WSF J;  1PL5 A;  2JP3 A;  3AE9 C;  4H44 D;  3G9R A;  4PV1 C;  2FBW C;  1UIX A;  1O3U A;  3C8G A;  2E75 B;  3AE8 C;  2HSB A;  2Q00 A;  3BRJ A;  4H44 C;  3AE2 C;  4RKU J;  1PIX A;  3AEG C;  1RQV A;  3O10 A;  1Y9B A;  4OGQ D;  3GF3 A;  3AEB C;  3AED C;  1OW7 A;  3AE5 C;  2YWA A;  3D6Y A;  1ZP0 C;  2OQQ A;  4H0L D;  4H13 D;  5KKZ C;  2L6F A;  1KQG B;  3RK3 E;  3AE3 C;  2IDB A;  4I7Z B;  2WSE J;  4I7Z C;  5L8R J;  3D71 A;  3MFN A;  4XEK A;  1KTM A;  3GM3 A;  3AE7 C;  3Q5R A;  1IK7 A;  2H89 C;  2MKV A;  5M1B A;  1ZZP A;  2LK4 A;  1NYH A;  4H0L B;  1S5L X;  1KIL E;  4TT3 H;  1KMI Z;  2ZT9 C;  4XEF A;  2E75 C;  1VF5 C;  3B71 A;  3H25 A;  2V7Q J;  1U57 A;  1DIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...