3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
4NQFA 3AE3C 3AJMA 1ZOYC 3AE8C 3AEEC 2LK4A 3RQFA 1K05A 1OW7A 3SFEC 3C8GD 3JYYA 2H88C 2H89C 3AE2C 2JPUA 1ZP0C 1QVXA 1K40A 1V4AA 2YWAA 2L6GA 3O10A 3C18A 2WQYC 3AEBC 3AE1C 3AEAC 1YQ3C 2Q00A 3U0CA 1KNYA 2JX0A 3U3FA 4XEKA 1PV3A 2G3AA 1WOLA 3L8JA 3AE9C 1WTYA 3AE4C 3GM2A 3AEGC 2KK1A 1OW6A 3AE7C 4YXDC 4YTPC 3L8IA 3GM1A 1K04A 4EBJA 3RQEA 2L6FA 4XEVA 1KTMA 3ABVC 1WWPA 2HSBA 2L6HA 3SFDC 2FBWC 3BRJA 1OW8A 3GM3A 3C8GA 3C8GB 4R32A 1UFBA 3AEDC 3AECC 2PBEA 3MFNA 5F28E 3JZ0A 3B71A 3TULA 3AE5C 4XEFA 3RQGA 1ZZPA 1O3UA 3AE6C 1JOGA 1YQ4C 3K7DA 3S9OA 4EBKA 3AEFC
chains in the Genus database with same CATH superfamily
1MMGA 1YHQP 3NMIA 4NPFX 4JCZA 4CIPA 2XS1A 2RSEB 1L0LK 2QNLA 4I3MA 4J7TA 3SXYA 3CAXA 1T3UA 3I5QA 5CBOA 4UB6H 3IQCA 1M8OB 3H1ID 1Z23A 3ECSA 5AGFA 2VCBA 2XSEA 3H2UA 4WY4D 3JSVC 3ZC4A 2R7UA 2DB4A 1VPCA 1L0ND 3DXJF 2N9BA 1SZIA 3EGXA 3M0DA 2E74B 5L0IA 3Q5RA 3EWKA 2Q7CA 2BCCD 2FYUJ 1FDMA 3GMAA 3H1HE 3II6A 1KILB 2HS5A 2JP3A 2IZ1A 4IFFA 4PJMA 3H65A 3GHGC 1NFNA 2NPSB 2OYIC 2WSFJ 1X79B 1LP1A 1LTJB 3S27A 3AE4C 3V4WA 1KFMA 5HV9A 3RL0B 1FZFA 1EKYA 1KMIZ 3TGUE 3D6ZA 2E74C 1M2VB 3L72D 3EH1A 3W8IA 4LLCA 2WZFA 2CNWA 2Y0DA 2M3EA 2ZYAA 3MD0A 3MP7B 2QY9A 1P84H 3CCRP 3SWFA 3WU2H 2DGJA 5AW0B 4DBQA 3CPWO 4M3LA 4BJ5C 1ZR2A 3HLZA 3L37A 3F46A 3TJ6A 3EFFK 1ZRTD 1OWAA 3A3YB 1ZW2A 1FZGA 1ZXGA 3BRJA 3GODA 4ER9A 4LDQA 3HE5A 4OGQD 2MWQA 3EG9B 3W2VA 1S05A 1SQQE 1RKCA 3K66A 1IJDB 2LQGA 3M79A 2GA0A 5F28E 3EJNA 1BGYD 1LJ2A 3CMEP 1YZAA 3IQ6A 3F89A 2MJZA 1BCCJ 3ASOC 4UB6E 4PJ0E 3RQGA 3BASA 3B5NB 2YXRB 1OQCA 3TYYA 4CX9A 1YYXA 3H1KE 4H0LC 2WZGA 1ZYRF 2KP8A 4GOFA 4NQFA 2ZVOB 3AJMA 4H44C 4WWIA 2P58A 2FAPB 3EPVA 1QPUA 4MTGA 1LT9C 3RH3A 1S9KD 1KB9E 3P32A 4OIPF 2ETSA 2HMQA 4KBLA 1SQXJ 5AVYB 1N2DC 1M56C 1X8YA 1YTZT 1SP4A 1JO5A 3CL3D 2A06G 2A06E 4HEAJ 1P84D 4OVNF 3O8ZA 1SQPK 2Y3HA 2IBZE 4BJ6C 1GD2E 3CCUP 1ORSC 5H2FH 3V5BA 1RHZB 2A68F 1BCCG 1MFTA 1H89A 3DAGA 1K8AQ 5CCGD 3FDQA 2HSQA 2YO3A 2ZD9A 1SQVJ 4Z9JA 1HW2A 2BASA 3A0HH 3L35A 5BQHA 2WB7A 3RVYA 2OU6A 3EHMA 2FYNC 2KLUA 1RCPA 1JY3P 3Q6MA 3KMIA 1RE4C 5TISH 2BL2A 4B6IA 1YVIA 2P10A 3VRCA 3CCJP 1BE3D 4YXWH 2ZXEB 4XEVA 1KFNA 2A69F 1KTMA 1RJ9A 2P6VA 3RF3A 4AE4B 5C39A 1YITP 2KXPB 3VN0A 3LLKA 2W6JH 1KILA 4K0DA 3B0VC 3A0BH 2AXCA 2IZ0A 2W90A 3SFDC 5E79E 2GDCA 1IZMA 5GTIE 3H1HJ 1H6GA 2P1JA 2Q3IA 5KYWB 2Q6QA 2YMYA 2V4HA 1SQXK 1IFJA 1M1JC 1NTKE 4JZAA 3N24A 1VYKA 4BJ6A 3B0UX 2POHA 2ZJSE 3M9BA 1NTMG 4AQRD 2KNHA 2LD6A 2O01H 2NPSD 3KYIA 1OR2A 1HE9A 2G62A 4BJ1A 3PCVA 5APWA 4E0IA 1LWUB 3L74E 1LS4A 2B9BA 3CSKA 2B89A 1D0YA 3ASNC 5AVRB 2E87A 2ZPAA 1YQ4C 5JSLA 3GEEA 2P0NA 1U89A 2YQYA 1G4WR 2YEVA 1KILE 3K5BA 2HV6A 3BATA 3IPMO 4U9DA 3DWWA 3AE8C 2UUHA 5JT4A 3W67A 1CGNA 4O79A 4CDAA 4BJ5A 5EFWB 1FDOA 3JCUQ 2IBFA 2G8YA 3B0PA 1D1AA 2CW0F 4OGQC 1LT1A 4EUKB 1EZVD 1JOCA 1GL2B 3HTKC 1PPJE 2OKUA 2I1KA 2C9LY 1Q86Q 3EG9A 2EIMC 1BGYE 4JIOA 2OTKE 3DZAA 1YTZI 1NU7D 3SXMA 3VOPA 1LWUC 4JYBA 1URQA 2IBZI 2XLHA 2IBZD 2ZFCA 3MIWA 3CC4P 4CPGA 1E83A 1AV1A 3U8PA 2O1JA 1TFOB 5COMA 2JD3A 1SQXE 4L6RA 4YT5A 2LCHA 4NTAA 2OTJP 3V2PA 3MLGA 4W7YA 3I56P 2EPLX 3KZIH 4RBNA 3N7NA 3BVHA 4Y28J 1OCOC 1RKEA 3JCUE 1IFDA 4YXDC 2VCCA 3VP9A 3TGUG 3G9RA 4NPDA 2V7QH 3AGUA 5AVSB 2JR8A 3OW2O 2P7VA 1P84I 4C3BA 2IX7C 1SQBD 1KILD 4JJGA 1JMWA 2K1AA 3F5HA 2W4MA 3RIPA 1BBHA 4C7OA 5T3TA 2LKMA 5E79H 3SNHA 1T5OA 3VMXA 4ONSA 4JEBA 2QJKC 5DS4A 2HSBA 1ZN5A 3RK3E 5L0DA 2EPNA 4OD5A 3NRHA 1T6IA 5B66H 1CGME 4IL6H 3G4SP 3ZVRA 5L0FA 2Y9ZA 2CPSA 1JNMA 1JRAA 1DD4A 1NTKD 1GK4A 1LS1A 4JRZA 3EHNA 1G1IA 1LTGC 2RKLA 2LXBA 5AVXB 1JTHB 1RF1B 2XNXA 1KD1Q 1LKXA 2Z15A 3A0HE 3DE8A 3D71A 4OIOF 1YJNP 5APUA 2O3JA 3LW5J 1URQD 1T2KD 1OCCC 2KLVA 2VC9A 1URQC 2IFMA 1T2KC 2XXAB 2QEXP 2JO1A 1OXBA 4A4AA 4J32B 3VF0A 1IFNA 1N86A 3CWBJ 5B1AC 2HODB 4C7NA 3EFOB 3BRTB 1CI6B 2PX0A 3KPEA 1LP1B 2LFDA 2NSGA 3EGDA 3GHGB 4J7YA 5AW4B 1AVOB 5KAIH 3QH9A 3L73E 4MVOA 1LTJC 5AVZB 3ZIBA 3CC2P 3FOOA 5CI9A 4XTKA 2QM7A 5L8RJ 2W9YA 1BDJB 3TDKA 3MYIA 3L73D 2QE9A 2FFDB 2XM4A 1HJ0A 3H1HG 2QVAA 1GL2A 2WMMA 1E85A 4YL3A 4PD4H 1SQQD 5CCHD 1FZCC 2C0WA 1MMDA 1NU1K 1ORJA 3FX0A 3I55P 2C03A 3PMRA 2XNDH 2WSSH 2WITA 3RK3B 5A6BA 3T6GB 3ZDLA 3L8IA 1CSBA 3CX5E 1OKKA 2J0XA 2KQ9A 5AVQB 2DI3A 2WVNA 4H54A 1J1EB 1W2EA 3VYWA 3RL0D 1IC2A 3L74J 1SFCB 3D70A 2YHSA 1LPEA 3QW1A 2K37A 3L75G 1R8EA 2FYUK 2N1TD 2HPCA 4ZLCA 2Q3TA 3Q1MA 3MZWB 2H7BA 2WVQA 4JC7A 3G3ZA 3U59A 5DJTB 1EDKA 3RKOF 3B5NC 4UB8E 1Y4CA 1PP9E 1IO4A 1FZAA 1EC5A 1GU5A 3TNUB 3DM5A 4E17A 4NTFA 1N1CA 2CYDA 5E2QA 2CPBA 2AEFA 3MFNA 4MNDA 4N6HA 4XPYA 1E79H 3S0XA 3LS1A 1LT9B 3SZRA 4OH8B 1RKEB 1ZHZA 3B4SA 4C7NB 3EFOA 4TT3H 2E5TA 3DJUB 4XWJA 1N73C 3V5YA 1JOGA 2YO2A 1PL5A 1PGPA 2CCYA 4JBZA 5CCGC 3OA7A 3GW6A 1S72P 2HMZA 3AE3C 1H0TA 4YN0B 3FXHA 1EDJA 3H1KG 4WGZA 4DBRA 2KZIA 4D4XA 4IL6E 3AG2C 3PH0A 1BZ4A 3H1IG 2GFHA 2PF4E 5AW2B 1L0NE 2IYPA 4OIQF 1L4AC 3RL0g 2CDQA 2OG2A 3GHGA 1HY5A 5CCGA 1NBBA 1ZHXA 3AEBC 2CGEA 1LTBC 2WT7B 2QJPB 2OGUA 5HSWA 4DRHB 4NTBA 4PFPA 1JCCA 4GKGA 2R7TA 1AFOA 2I8DA 3H1LJ 1HTLC 1MUUA 2LFFA 1V74B 1V55C 2L9JA 1AA0A 1S5LE 5F5HA 3M9HA 3GM2A 2OYIA 5EGYA 2XLMA 2WZLA 3IAOA 1M57D 2P67A 3GM1A 2R7VA 1HMOA 3CX5D 5BVZA 2IYLD 2NRGA 5CBNA 1Z6AA 3QVZA 1S4XA 1Q0DA 4ASWA 2RMZA 3X1OA 1DEEG 3CXHD 1FS0E 1YYCA 1A7EA 3AQBA 2YKZA 1HE1A 2E75B 3KDPB 2YIUC 1TWGA 4AK9A 4MTOA 2BEZF 2JEEA 3H32A 3V4QA 3V5XA 1FMVA 2K9JA 1GU4A 4RD9A 1AUEA 2LXCB 3H1JE 3P8CE 3C8GA 4GDOA 3AEDC 5A6AA 2V26A 3L72J 1QL1A 4EBBA 1KORA 3FGAD 4FX5A 2IDBA 2WZ7A 1FR0A 2NPUA 1LM3B 4YL0A 5A6JA 3H1LG 3U9JA 1BGYG 5DJUB 4GIFA 4NPEA 4IWBA 1J1DC 2KSFA 5KAFE 2LIGA 1LGHB 3L70G 5BU5A 2JJLA 2WSCJ 1L2PA 1XTGB 1O3UA 2NUPB 3DJNB 4KNWA 3TSIA 3Q7LA 1LT9A 4HFFB 1KYOH 1SQQK 2HJ3A 1JMMA 3FWLA 5KTBA 1ZU5A 3T6JA 3LEOA 1K05A 1L0NK 5KJ7A 2QRXA 3SP1A 2J5UA 5L0GA 1OIPA 3CXHH 1WGWA 2R44A 3NYMA 2B88A 3OWTA 3Q3DA 3GANA 4DT0A 3MTUE 1JPNA 4PV1C 5KYWA 1W5CE 1KYOI 1Q7YQ 3P8MC 1IFMA 1NU1J 1VQKP 3CMAP 3BCCG 4G0HA 5KYXB 4RDAA 5B3IA 4BXLA 4O6NA 1M90Q 1BCCD 1OR3A 3PRJA 3K1HA 2Q9IA 3U1AA 1WTYA 3AG3C 3FOPA 1NU9C 1Q90D 2R5BA 5AW8B 2VH3A 1H0TB 1FTSA 5H2FE 3LW5H 4JTCB 2J0WA 3IFMA 2YNYA 2NZ2A 1OVVA 4MTFA 4XLPF 1SQPJ 4DVYP 2OYIB 2BCCE 3LIDA 3S1KA 2LP4A 2Y69C 3E7KA 3VMYA 1SS1A 5KAFH 3ZG1A 2ZXPA 1G4US 4NC3A 1FU1A 1N8RQ 3CXHE 2H7HA 5E3AA 3V2RA 1L0NJ 1KB9H 4AE4A 2ZVNB 4BPMA 4MVUA 2E76B 4I7ZB 1E86A 1U57A 3QWOC 2R05A 5KJ7D 4H4KC 1KYOE 3S90A 3I4UA 1U7JA 4RKUJ 2K9JB 4PV1D 1N7LA 2PBEA 3A9CA 1NTMD 2E75D 4BJTA 3LNRA 3FMSA 3JCUH 3T6BA 1F1MA 4CS8C 2DYRC 1Q82Q 4G7HF 4I6MC 5CCHC 2V3CC 2PNOA 1A41A 2NSFA 2OTLP 3AGTA 1TWHA 2PP6A 3HD7B 2ZXRA 2Q7RA 2WSEH 1Z7Qc 4IJJA 2E76C 4I7ZC 4EDFA 2M4EA 3RGUA 3K6BA 5L0HA 2L81A 5KYYB 4C7RA 4KI2A 4QI0A 5APSA 1HJBA 3W4YA 3IEEA 1EZVG 3CCSP 4Q7CA 4N6JA 1FAPB 1GM5A 3L4FA 1EDIA 2EPOA 4XLNF 2F22A 4GQHA 2H8AA 3M4CA 2KYVA 3RK3C 3GEIA 4XQ1A 5IY5C 3ABMC 2N1TC 3SWKA 2EIJC 3AE1C 2WL8A 2IBZG 2HFIA 3BCCE 1YAUO 4DOJA 3RL0C 2KUBA 4XA4A 1PD0A 1Q0GA 1FZBA 1PP9J 2XL4A 4NCQA 1SQVE 3L72E 3AE7C 3UMIA 1KN7A 4I44A 2KIKA 1KQLA 4O9BA 3TGUD 1D1CA 2I8BA 3NDBB 2N1TA 1RMVA 5CCHA 4RJTA 1I5NA 3L75E 4QDLA 2IM8A 4YT8A 4EIJA 1SQBG 5KJ7C 3Q5PA 2R03A 2OJED 5CHXA 2YL7A 3CEXA 3NMJA 3DAFA 3M9QA 1OKKD 3HD7D 2Q9CA 1SQBE 1DOWA 2MKVA 4L76A 4EWCA 2FYUG 4OINF 4LDRA 3B8EB 4I1LA 2PFXA 1S5LX 1VQ4P 2W6BA 2YRFA 3FWNA 2YIUB 1NTKG 5BQGA 3HNIA 1NU1G 4UB8H 2EINC 1PFIA 3HKKA 2R32A 4F4BA 4H0LB 3CX5I 4WJ0A 2R25A 3H1LE 1MV8A 2OJQA 1Z3IX 1JB0J 3SSUA 2RH0A 4MVMA 1XZPA 4JURI 2R5DA 3C62A 1SQVD 4N4WA 1HWTC 1NVOA 3S9OA 3EZIA 1VLTA 2AWYA 4IAQA 4O6YA 1GTWA 1NKNA 1WATA 2HR3A 2IPPA 2Q9AA 4U5HA 1USDA 5APTA 1VLSA 1OW7A 3V6IA 5KLVE 4PK4A 5A6KA 1CZQA 3H1JD 2K88A 1D0ZA 1ZVZA 3JRTA 4P9FA 3NYJA 1VQ6P 2YL1A 3O6XA 1VK5A 2X51A 2FYZA 2KOGA 1NTME 2A45I 3DKAA 3LLIA 1LTTC 1SLQA 3HNKA 3C63A 1AQTA 1BSHA 3H1HD 1Z56A 2XS8A 4AL0A 3EFGA 2RN0A 1JM0A 1FJKA 3IF4A 2W4BA 3C8ZA 1NTZJ 2R02A 4ZKPA 1SQQG 5KYUB 2WSCH 2HYNA 3GORA 5D91A 1GMJA 1A0BA 2JX0A 1L4AA 3EQLF 1J8YF 3HTKB 1VQOP 3L8JA 1NTZE 1BR1A 2E75C 3HUSC 2C04A 4GEHA 4EHPA 3H2VA 4YTPC 2VASA 2Z4EA 1PD1A 1ZHTA 3UNGC 4DRIB 1G5ZA 2BEQD 4DRJB 2M5AB 2OYHC 5EK0A 3RBZA 3V2NA 2L6FA 4XPXA 3WG7C 2VCAA 1LVKA 3KHUA 3L75D 2WPQA 4AL1A 1R5LA 1M1JB 1KB9D 3OJAB 3NMKA 5JP7A 2H7OA 3RFYA 1JMBA 2QIWA 2FBWC 1C02A 2G3VA 3C8GB 4CS9A 4PD4I 1RE3A 4AYCA 1P84E 1X9VA 2A6EF 3AOUA 2EPMX 1SQQJ 3LNMB 1X22A 3Q7GA 1YJGA 3L74D 1M57C 2QG4A 3ZWIA 3CCQP 3QMKA 3W8HA 4CDVA 2J9UA 2XKMA 2P2UA 1LE2A 3AE6C 2NUPA 4IFDK 3JTLO 2YZSA 1LIHA 1H8AA 1GS9A 3GG2A 4ZNCA 2A45H 1EXIA 1NG1A 5TJHA 3NYLA 1U0BB 5CJ0A 2B87B 1OCRC 3H1KD 1KZUB 1PPJD 2P7JA 2WWWA 5APYA 4U5BE 2IXMA 1Y6DA 1PP9D 2JPUA 2PGDA 2AU5A 2EPKX 4C3EA 4P9TA 1M6TA 3VMZA 1PGJA 3MUDA 2J9VA 3C1LA 2L6GA 2IOQA 3C18A 3IQ5A 3HE4A 3N4XA 3RK2B 1YYJA 4E18A 2OOCA 3L70E 4M63A 3PTZA 5E33A 3DD7A 3E1IA 1HBWA 1NTKJ 1KYOD 2ITAA 2XXAA 1KNYA 2M5AA 4H0LD 2IXPA 3QVYA 3U3FA 2N1TB 1NWQA 1APCA 1PV3A 5AW7B 2HODA 1QKRA 1SF8A 4HYTB 4IB4A 2DW3A 5KLVD 2FGYA 2ZYGA 3KKBA 1D0XA 1T6AA 1LTJA 5AW6B 4N78D 4WVZA 3OA1A 3S4RA 1X0TA 4IGGA 2KZJA 2I1JA 3B5NA 3CCLP 3T97B 2C9NY 1JTHA 4OWFA 5AW1B 2XL8A 1NLXA 1YJWP 2YVKA 2WVRA 1TWAA 3ABKC 1QGKB 1NO4A 1VDFA 4K35A 4K3AA 3M0DC 3L0IA 2J7PA 3O6QB 1YIJP 3X2QC 3PJSK 1MZ9A 1UIXA 1KV4A 5A6BD 3NKEA 3LJBA 5DQZA 3HD7C 4CJOA 4OD4A 1YI2P 3L71J 3H1LD 3KXDA 3SYNA 4P6IC 2GAQA 4IL6X 1QVGO 4R4LA 2QJPC 2OARA 1IFPA 4HKZH 3W2WA 2HFED 3L70D 1AVYA 1Q0KA 1G8XA 1YA7O 4YT2A 4EOTA 3CXHI 2E43A 5EHHA 1HW1A 2PAJA 5TISE 1NTZD 1EQ1A 5BQIA 3TOMA 4YT4A 1EXJA 3RQFA 2J9WA 3P7KA 3W68A 3JYYA 1D7MA 3H1IE 3NXSA 2W83C 5AW9B 2MYSA 3TNUA 1RQUA 2ZAEB 4U5CE 2AXTH 1ZHYA 3U9MA 1GW3A 3SXKA 1EZVI 3DM9B 1LE4A 3GWNA 3CD6P 3KPHA 2W27A 1N73B 4L74A 4WY4B 2Y3DA 1AJYA 1G2CA 3VMAA 3U2LA 4E0HA 1OXKA 1XZQA 4GOEA 2R7SA 3UMKA 5B1BC 1RE4A 5L0CA 2KB7P 3BCCD 5L0JA 3L71G 1W2BO 2GM4A 3L75J 3ATPA 2LR2A 5COFA 3FVYA 3AG4C 3LIEA 1LTIC 2XZRA 5KYNA 2KK7A 1FC2C 2R3SA 3K7DA 3RYLA 2QUPA 2XLWA 3DI5A 5BU8B 3HD7A 1T6UA 3A11A 3QZCA 3CX5H 4G7OF 3ITFA 3RVZA 4QMAA 1YLMA 4PD4D 4K1OA 1XTCC 1UIIA 4I2LC 2C0XA 2QSIA 3I5PA 3FXDA 3KQGA 4PJ0H 4DXWA 3IHUA 2AVKA 2OYHB 4KT0J 4C3DA 1DH3A 4Z9HA 1Q0FA 1EI7A 4LERA 5L3VA 3P8CD 1R4TA 4JJFA 1RY3A 3UMHA 2V7QJ 1W2WA 4PV1B 4I1OB 1L0LD 2E76D 1E84A 1KB9I 3WHNA 1G1JA 3M1CB 4O7GA 3KH2A 4L75A 4WGYA 4Q5SF 4JQ0D 4IOIH 4JYCA 5FZTA 1EQ7A 3WUUA 3USSA 1FOSF 1LWUA 4XFJA 4JTDB 3VP8A 4HJGH 5DS6A 3SFEC 4FWVA 1L4AB 4EKWA 4PR9A 2J9BA 4MVRA 1ZP0C 1NTZK 5KLVK 1NTMJ 3C8VA 2D2CD 1C03A 2YL3A 4FESA 2OEVA 1GL2D 4CSAA 2ZXXA 1IK7A 4J30B 3NTNA 1YZCA 4L73A 2ICWG 2H43A 1BDCA 5AC5A 3WU2E 3B29A 1L4AD 2XV5A 2CK3H 3N2ZB 3RK2D 4Y99B 3AEAC 1WASA 2D2CC 2E74D 3CC7P 2J46A 1BCCE 3OEOA 3QW0A 4MW8A 3CI9A 2BE5F 1KILC 2G3AA 1FZEA 1VQMP 1V54C 3C7JA 3EGDB 1PGOA 4H44D 5KLIB 1DEBA 2TMVP 2KSEA 2NPSC 1RF1A 1VQ7P 4BG0A 5DLJA 1USEA 1OCZC 4ANJA 3NG1A 4UDVA 3FHDA 4ZKUA 3O55A 5KYUA 4EI2A 3Q6NA 3RQEA 1YJ9P 3CWBG 4ASVA 4WB4A 3S29A 4MVSA 1SQVK 1LTSC 2QJYB 1TKNA 4JCHA 2WPVB 4D6TD 1HMDA 2XU6A 4A2NB 3RK3D 1KQFB 2FYUD 2E5YA 3HE5B 4BEMJ 5KLIC 3TGUJ 2KS1B 3MX3A 3FAJA 1NOHA 4U3FD 4CBEA 4RESB 1NU1D 2G3KA 1NAYA 1OFCX 1HGVA 1FDIA 2H7VC 2YLIA 2Y0CA 2GA1A 1TU3F 4U5EE 4H13C 4X0RA 2Y0EA 5GTHH 1H88A 2J45A 3DMDA 4XPWA 3VM6A 3U2MA 5K5GB 3CZ6A 1N7SA 2IFNA 4Z1MH 3IQTA 1SQVG 2QM8A 2NPSA 3AEFC 2YL0A 3GF3A 1M2OA 3BCCJ 5AW3B 1ZOYC 2R7RA 4H13D 2O01J 3C9IA 4EIYA 1D1BA 1QQ3A 3G4ZA 3LESA 1SQPD 4MVQA 3B9QA 3H1JG 1QX8A 1HF9A 1NTKK 5AVVB 4RO0A 3WAQA 1VF5C 1RF1C 1A02J 4JW1A 1NJIQ 2X0CA 2FY8A 4KHXA 3WUTA 1K9MQ 1OMIA 1KC8Q 2GUVA 3ITKA 3MBGA 1EA8A 1ORYA 1SVFA 3FXEA 1Y9BA 3CCMP 3A0BE 1YQ3C 3JRMO 1J8MF 5A69A 2O01N 4WY4C 3J06A 3U0CA 2J8WA 2A0BA 3JYHA 2B0JA 3E9VA 4YJWA 1HUCA 3H1JJ 1NHLA 4BEJA 5KAIE 2J59M 3SWYA 4YK5A 5KYYA 4A7PA 1SQXG 2MHRA 3AQCA 2AWCA 3K33A 1K04A 1Q2NA 1VF5B 1RH5B 3H25A 2SPZA 1AEPA 1HGZA 2D5RB 2O9XA 1JY3N 1N7SC 3H1IJ 2B0HA 3EZHA 2ZXWC 2L7AA 3U5SA 3RK2C 3S84A 1ZV8A 5JUAA 4ZMDA 3B5ND 1T6QA 1BR2A 3Q5SA 5AC4A 3U1CA 1NZEA 2BCCJ 2Q5UA 1B68A 4R32A 1VQLP 2WSEJ 2FYUE 4TLFA 4Z9IA 3GF7A 1N7SD 1M56D 3AG1C 3H6PA 2Z5HA 2JKVA 2FXOA 3L74G 3B71A 3WODF 3I5CA 1FZCA 3QTHA 1A02F 1EDLA 2PRRA 2YKQA 1H9GA 4PFOA 3IN6A 4JVSA 1DX7A 4EBKA 1YDIA 5CI8A 2LK4A 1OVUA 4IARA 4IFMA 1PPJG 1TQGA 1PP9G 2QTVA 1WN0A 3V7OA 4CSAC 5B5EE 3V2QA 3A5TA 1QVXA 3KZIE 2IXNA 5B3SC 1FJPA 1K40A 1L0NG 2KYHA 3TOLA 1QVFO 2Z5IA 1Q81Q 2WPSA 1N73A 4OIRF 1VOMA 4AUWA 2BCCG 4LACB 4WABA 1EZVE 3MHVA 1SFCA 3VTPC 1RJ9B 2FKWB 1K73Q 3H32B 4KJMA 5JS5A 1IW7F 1JPJA 4CS7A 3M0AA 3L34A 2ZT9D 2JDIH 2KI7B 1DIPA 5AVWB 1UG7A 1LNQA 1LI5A 4NY3A 1MKMA 1BGYJ 3WMM0 3E70C 4CDYA 2J58A 4Y99C 2PP4A 5CMZA 4E7SA 1U7MA 1IK9A 4U3FE 4DJ9A 3CLQA 3POVA 4MW3A 5KLVG 1GGQA 2Q1KA 4LLHA 1ZR4A 3T9OA 2K9YA 2OYOA 3L72G 2HLOA 3H1KJ 1FE6A 4D6TE 1S5LH 2YLDA 1RE3C 1H9TA 3G6EP 2O1KA 3ABVC 2KNCA 5TJ5E 2ZT9B 2WT7A 3WUVA 1MNEA 3OAKA 2VB6A 1CGOA 4HB1A 1NU1E 1O5HA 5CJ4A 1OW8A 2HUJA 3HUSA 1GQAA 1UFBA 2R7WA 3L36A 3GEHA 3O6QA 5GTIH 1T9KA 1ZW3A 2EIKC 1NH4A 1NGMB 4DOZA 1S7ZA 2GWWA 2XLEA 2OYHA 4LDKA 4CJGA 4C7OB 3R2PA 2OQQA 1JR8A 1WT6A 2VRSA 1VQ5P 4OGQB 1A7VA 5KLVJ 1NTMK 2FXPA 1XWJA 1BDDA 2QA4P 2HJMA 1S3JA 1MNDA 1WMKA 3E1RA 1NSGB 4GYTA 2ZT9C 1TWCA 2A0UA 3UR3C 5KKZB 2FXMA 1S1CX 1FFHA 1NTZG 3LS0A 3AEEC 1PGQA 3A2AA 2JWDA 2XM0A 3TQOA 2R7XA 1S2EA 1QL2A 3CQZA 1SFCD 3ZQVA 2W6AA 1HH0A 1MQVA 3G50A 5APQA 3US6A 2IYOA 1V4AA 1T8ZA 2YWAA 3F47A 1VF5D 2XDJA 1PCXA 2FFDA 2YLGA 4HE8D 2A06D 2R7OA 5L3QA 1BSNA 1R5SA 1BE3J 4WY4A 5AVTB 3M4BA 1JY2O 4N06A 1ST6A 1G2CB 3L1MA 2A1DD 2Y9YA 1I4YA 4GT1A 3L71D 3LAYA 3MGNA 3M06A 3A7OA 4C46A 2ASRA 1L0LE 1JUNA 1FAVA 3U3BA 4N3YB 3G4XA 3FAPB 1AVOA 2QJYC 3AE9C 1MFZA 3AEGC 2KK1A 1JEKA 5GTHE 2WPRA 3UIAA 4R4MA 1JAFA 1M2VA 5DVWA 2IXOA 1T3JA 2YMKA 1BE3G 4QI2A 3R7CA 4LC1A 1VL2A 3CWBE 1IZNB 3HRNA 1QZXA 1RQVA 3HE4B 1Q0MA 3M15A 2KW3C 1E5WA 5E3CA 4JPZB 1NFOA 2GUSA 1GW4A 2Y3GA 4PD4E 4U5DE 4H13B 1WWPA 1CW5A 2CNWD 1KQGB 5APXA 1M1JA 5KYXA 4G7ZF 4O6MA 4DJGA 1Z5ZA 1FBMA 1SFCC 3R4YA 4DCKA 2PX3A 4LGDE 3GM3A 1NKZB 2KS1A 2P61A 256BA 3L71E 2A45G 2B87A 1VMAA 1PZQA 3RBXA 1RF0A 3AECC 1VB5A 2WSFH 4MS2A 4PJNA 2XLVA 1L0LG 2HPCB 1VQNP 3NFQA 1GZLA 1ZZPA 3T97A 2HG5D 2M3BA 2ZXOA 5JRAA 4W7ZA 4BRYA 2QE7H 3V5ZA 1FNTc 1C17M 2FFHA 3EQ2A 2J7PD 1AQ5A 1BR4A 4JF7A 4YWQA 3RW0A 3C8GD 3MYFA 1BE3E 3TF5A 1CPRA 1SQBJ 2OEXA 2EILC 4FAPB 2H89C 3AE2C 1SMYF 2HV7A 1S9KE 2Q3EA 4DZOA 3SXZA 4B86A 3GLMA 1L0LJ 2NUTB 1R5ID 4HH2A 4Q4ZF 1VTMP 1NYHA 3NMDA 1DOVA 3T4RA 1YBKA 1LI7A 3MUDC 4N6CA 4U5FE 5B66E 4MN4C 1J1EC 2A6HF 4W80A 4U7JA 1I4ZA 2H8PD 2OCCC 1L3PA 3PP5A 2R9RB 5CIVA 5DS5A 4MQ9F 3TK1A 4EYYQ 1OZHA 2UUIA 2R7QA 3ZSUA 2LSEA 4XEKA 3Q2YA 1N7SB 1WOLA 2XRHA 3KYQA 1CPQA 2XLDA 1OW6A 3L70J 3UGPA 5AW5B 3GWLA 3JC22 3HJCA 3O39A 1FFTC 2L91A 4EBJA 1QLEC 4IAOA 3LEVA 1SR2A 3CWBD 2UWJE 3LUTB 3NKDA 3VYIA 3EH2A 2M8RA 4YPCA 2L5GB 4IRUA 2RD9A 3K1IC 4I1MA 1ZW0A 4D6TG 4KC9A 2FFDC 5JVEA 3PHF2 3KL4A 3UGOA 4E7ZA 5B5EH 2Y39A 2FYNB 2L6HA 2Y3BA 2R3CA 2AEMA 3PDMP 1LTAC 4DVZA 2K3RA 4AX2A 1TFKB 1A7DA 2Q4FA 4K7BA 4U3FG 3CCVP 3U8VA 4W8PA 1OX3A 4PACA 1KQSO 4JTAB 4CIHA 3TD7A 2HKVA 1Z63A 2M0BA 2WTYA 2D2CB 3HNLA 4H44B 5JLIA 3DE9A 5APVA 3ZTMA 2DYSC 4D6TJ 1VQ8P 3D6YA 1JCDA 2YXQB 4WBAA 1U6HA 3L73J 1M1KQ 2KGOA 1Y8AA 2D4UA 4ULWA 1J1DB 4U9EA 4N78E 5M1BA 1E2XA 3TK0A 3G71P 4U3FJ 2NG1A 3HNJA 3ZTZA 1QEXA 4JE9A 1SQPG 4KNVA 2H88C 5T3WA 1GDTA 5T1DB 2W8ZA 3SEOA 1JY2P 3JSZA 1MMNA 3ZQYA 4U5GA 2OQMA 3K1IA 4ZLDA 1YA9A 3CCEP 1SQPE 1DD3A 2AP3A 3JSEO 2AXTE 5K0IA 2BC5A 1L7CA 1TR2A 4GODA 1RXQA 2AEJA 2N9YB 1ZLLA 3KYJA 3O10A 2WQYC 2PFDA 3L73G 4MVZA 3ABLC 2QJKB 1ZU4A 5COGA 2JWAA 2NUTA 1ZRTE 1J2JB 4HFKB 2Q00A 2KJGA 3EGXB 4CS8A 2YKOA 1NAFA 1ZHWA 2HZ8A 1GL2C 4BRYB 1FOSE 1WRGA 1SQXD 3IR9A 2P1AA 3BRVB 2QLAA 1JY2N 1FMWA 3HTKA 2YKPA 1PIXA 1VQPP 3JT1A 1ZMEC 4XE5B 1Y47A 2I15A 1YARO 4LLEA 5GPGB 5BUOA 5F5FA 1URQB 3PHLA 4G78A 2M64A 2Q9BA 4PJJA 1QSPA 3VAYA 3M91A 2XLOA 3N0TA 1JY3O 1VQ9P 1GK6A 5DQTA 1T01A 1OXZA 1IFIA 3BEHA 4W8KA 2W45A 4YL1A 2XL6A 1O87A 2KC3A 3S28A 1RF0C 2WVOA 4ULVA 3HUSB 1OVRA 4BWNA 4PJLA 1SYQA 5KKZC 2E42A 2KSJA 4JKVA 3TJ5A 5D92A 3ZDMA 2KNCB 3JZ0A 5AVUB 4D4NA 1M7LA 3TULA 3AE5C 1H7IA 4XEFA 1CI6A 1HVVA 2ZYDA 1QLED 5FCLA 1MMAA 1FZCB 3PLNA 1KU2A 4JEAA 1SQBK 1VYIA 4CS9C
chains in the Genus database with same CATH topology
2JO1A 4NQFA 1S1CX 3GF3A 1EXIA 1KILE 3AE3C 4XFJA 3AJMA 1ZOYC 4H44C 3AE8C 3AEEC 4H13D 2O01J 5M1BA 1EXJA 2LK4A 3RQFA 2E76C 1K05A 4I7ZC 1OW7A 3SFEC 3C8GD 3JYYA 1FDOA 2H88C 2H89C 3AE2C 2JPUA 1ZP0C 1RQUA 2G8YA 1HF9A 2J5UA 1QVXA 3C8VA 2D2CD 1K40A 4OGQC 3GLMA 1VF5C 2E74B 1V4AA 3Q5RA 2YWAA 1DD3A 1IK7A 3EWKA 1OMIA 1NYHA 1VF5D 5L8RJ 3Q3DA 2L6GA 3RL0g 1AJYA 4PV1C 3C18A 3O10A 2WQYC 3GMAA 3AEBC 1HJ0A 1Y9BA 3AE1C 3AEAC 2JP3A 1YQ3C 2D2CC 1ZRTE 4U7JA 2Q00A 2E74D 3U0CA 2WSFJ 2ZT9D 1KNYA 1GMJA 4H0LD 1DIPA 2JX0A 3U3FA 4XEKA 1MKMA 1PV3A 2G3AA 3Q2YA 2QJYC 1WOLA 3AE9C 1WTYA 3L8JA 2E75C 4H44D 1Q90D 3AE4C 3GM2A 3AEGC 2KK1A 1OW6A 3AE7C 4Y28J 4YXDC 1KMIZ 2FYNC 3G9RA 3IAOA 4YTPC 4R4MA 3L8IA 3GM1A 2K9YA 1K04A 3D6ZA 1VF5B 2E74C 1PIXA 2BEQD 1ZMEC 2NZ2A 2P10A 4EBJA 2YMKA 3H25A 3RQEA 3Q5PA 1VL2A 2L6FA 4XEVA 3T97B 3D70A 1RQVA 2QSIA 1R8EA 1KTMA 2E75B 2WPVB 2MKVA 2YIUC 4H13B 3ABVC 2BEZF 2QJKC 2ZT9B 4KT0J 3Q1MA 1WWPA 2HSBA 1KQGB 1KQFB 3S9OA 3RK3E 2L6HA 2QIWA 3R4YA 1S5LX 3SFDC 3Q5SA 2FBWC 3BRJA 2E76B 1OW8A 4I7ZB 3GM3A 5KLIC 1U57A 3C8GA 3C8GB 4R32A 4GDOA 1UFBA 1UIXA 2WSEJ 3AEDC 5KKZC 4OGQD 3O6QA 2V7QJ 1DD4A 3GF7A 4PV1B 1KORA 3FGAD 4RKUJ 1NGMB 2IDBA 3AECC 1FDIA 4PV1D 2PBEA 3MFNA 4H0LB 5F28E 3JZ0A 3B71A 1TU3F 3TULA 2E75D 3AE5C 4IL6X 4XEFA 2D2CB 4H13C 4R4LA 2QJPC 1JB0J 2E76D 2OQQA 4H44B 4TT3H 3RQGA 4OGQB 3D71A 1ZZPA 2FXPA 2WSCJ 4Z1MH 3D6YA 1O3UA 3AE6C 3IN6A 3LW5J 1WMKA 1JOGA 4H0LC 1YQ4C 3K7DA 2ZT9C 1PL5A 4EBKA 3AEFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQF A;  3AE3 C;  3AJM A;  1ZOY C;  3AE8 C;  3AEE C;  2LK4 A;  3RQF A;  1K05 A;  1OW7 A;  3SFE C;  3C8G D;  3JYY A;  2H88 C;  2H89 C;  3AE2 C;  2JPU A;  1ZP0 C;  1QVX A;  1K40 A;  1V4A A;  2YWA A;  2L6G A;  3O10 A;  3C18 A;  2WQY C;  3AEB C;  3AE1 C;  3AEA C;  1YQ3 C;  2Q00 A;  3U0C A;  1KNY A;  2JX0 A;  3U3F A;  4XEK A;  1PV3 A;  2G3A A;  1WOL A;  3L8J A;  3AE9 C;  1WTY A;  3AE4 C;  3GM2 A;  3AEG C;  2KK1 A;  1OW6 A;  3AE7 C;  4YXD C;  4YTP C;  3L8I A;  3GM1 A;  1K04 A;  4EBJ A;  3RQE A;  2L6F A;  4XEV A;  1KTM A;  3ABV C;  1WWP A;  2HSB A;  2L6H A;  3SFD C;  2FBW C;  3BRJ A;  1OW8 A;  3GM3 A;  3C8G A;  3C8G B;  4R32 A;  1UFB A;  3AED C;  3AEC C;  2PBE A;  3MFN A;  5F28 E;  3JZ0 A;  3B71 A;  3TUL A;  3AE5 C;  4XEF A;  3RQG A;  1ZZP A;  1O3U A;  3AE6 C;  1JOG A;  1YQ4 C;  3K7D A;  3S9O A;  4EBK A;  3AEF C; 
#chains in the Genus database with same CATH topology
 1MMG A;  1YHQ P;  3NMI A;  4NPF X;  4JCZ A;  4CIP A;  2XS1 A;  2RSE B;  1L0L K;  2QNL A;  4I3M A;  4J7T A;  3SXY A;  3CAX A;  1T3U A;  3I5Q A;  5CBO A;  4UB6 H;  3IQC A;  1M8O B;  3H1I D;  1Z23 A;  3ECS A;  5AGF A;  2VCB A;  2XSE A;  3H2U A;  4WY4 D;  3JSV C;  3ZC4 A;  2R7U A;  2DB4 A;  1VPC A;  1L0N D;  3DXJ F;  2N9B A;  1SZI A;  3EGX A;  3M0D A;  2E74 B;  5L0I A;  3Q5R A;  3EWK A;  2Q7C A;  2BCC D;  2FYU J;  1FDM A;  3GMA A;  3H1H E;  3II6 A;  1KIL B;  2HS5 A;  2JP3 A;  2IZ1 A;  4IFF A;  4PJM A;  3H65 A;  3GHG C;  1NFN A;  2NPS B;  2OYI C;  2WSF J;  1X79 B;  1LP1 A;  1LTJ B;  3S27 A;  3AE4 C;  3V4W A;  1KFM A;  5HV9 A;  3RL0 B;  1FZF A;  1EKY A;  1KMI Z;  3TGU E;  3D6Z A;  2E74 C;  1M2V B;  3L72 D;  3EH1 A;  3W8I A;  4LLC A;  2WZF A;  2CNW A;  2Y0D A;  2M3E A;  2ZYA A;  3MD0 A;  3MP7 B;  2QY9 A;  1P84 H;  3CCR P;  3SWF A;  3WU2 H;  2DGJ A;  5AW0 B;  4DBQ A;  3CPW O;  4M3L A;  4BJ5 C;  1ZR2 A;  3HLZ A;  3L37 A;  3F46 A;  3TJ6 A;  3EFF K;  1ZRT D;  1OWA A;  3A3Y B;  1ZW2 A;  1FZG A;  1ZXG A;  3BRJ A;  3GOD A;  4ER9 A;  4LDQ A;  3HE5 A;  4OGQ D;  2MWQ A;  3EG9 B;  3W2V A;  1S05 A;  1SQQ E;  1RKC A;  3K66 A;  1IJD B;  2LQG A;  3M79 A;  2GA0 A;  5F28 E;  3EJN A;  1BGY D;  1LJ2 A;  3CME P;  1YZA A;  3IQ6 A;  3F89 A;  2MJZ A;  1BCC J;  3ASO C;  4UB6 E;  4PJ0 E;  3RQG A;  3BAS A;  3B5N B;  2YXR B;  1OQC A;  3TYY A;  4CX9 A;  1YYX A;  3H1K E;  4H0L C;  2WZG A;  1ZYR F;  2KP8 A;  4GOF A;  4NQF A;  2ZVO B;  3AJM A;  4H44 C;  4WWI A;  2P58 A;  2FAP B;  3EPV A;  1QPU A;  4MTG A;  1LT9 C;  3RH3 A;  1S9K D;  1KB9 E;  3P32 A;  4OIP F;  2ETS A;  2HMQ A;  4KBL A;  1SQX J;  5AVY B;  1N2D C;  1M56 C;  1X8Y A;  1YTZ T;  1SP4 A;  1JO5 A;  3CL3 D;  2A06 G;  2A06 E;  4HEA J;  1P84 D;  4OVN F;  3O8Z A;  1SQP K;  2Y3H A;  2IBZ E;  4BJ6 C;  1GD2 E;  3CCU P;  1ORS C;  5H2F H;  3V5B A;  1RHZ B;  2A68 F;  1BCC G;  1MFT A;  1H89 A;  3DAG A;  1K8A Q;  5CCG D;  3FDQ A;  2HSQ A;  2YO3 A;  2ZD9 A;  1SQV J;  4Z9J A;  1HW2 A;  2BAS A;  3A0H H;  3L35 A;  5BQH A;  2WB7 A;  3RVY A;  2OU6 A;  3EHM A;  2FYN C;  2KLU A;  1RCP A;  1JY3 P;  3Q6M A;  3KMI A;  1RE4 C;  5TIS H;  2BL2 A;  4B6I A;  1YVI A;  2P10 A;  3VRC A;  3CCJ P;  1BE3 D;  4YXW H;  2ZXE B;  4XEV A;  1KFN A;  2A69 F;  1KTM A;  1RJ9 A;  2P6V A;  3RF3 A;  4AE4 B;  5C39 A;  1YIT P;  2KXP B;  3VN0 A;  3LLK A;  2W6J H;  1KIL A;  4K0D A;  3B0V C;  3A0B H;  2AXC A;  2IZ0 A;  2W90 A;  3SFD C;  5E79 E;  2GDC A;  1IZM A;  5GTI E;  3H1H J;  1H6G A;  2P1J A;  2Q3I A;  5KYW B;  2Q6Q A;  2YMY A;  2V4H A;  1SQX K;  1IFJ A;  1M1J C;  1NTK E;  4JZA A;  3N24 A;  1VYK A;  4BJ6 A;  3B0U X;  2POH A;  2ZJS E;  3M9B A;  1NTM G;  4AQR D;  2KNH A;  2LD6 A;  2O01 H;  2NPS D;  3KYI A;  1OR2 A;  1HE9 A;  2G62 A;  4BJ1 A;  3PCV A;  5APW A;  4E0I A;  1LWU B;  3L74 E;  1LS4 A;  2B9B A;  3CSK A;  2B89 A;  1D0Y A;  3ASN C;  5AVR B;  2E87 A;  2ZPA A;  1YQ4 C;  5JSL A;  3GEE A;  2P0N A;  1U89 A;  2YQY A;  1G4W R;  2YEV A;  1KIL E;  3K5B A;  2HV6 A;  3BAT A;  3IPM O;  4U9D A;  3DWW A;  3AE8 C;  2UUH A;  5JT4 A;  3W67 A;  1CGN A;  4O79 A;  4CDA A;  4BJ5 A;  5EFW B;  1FDO A;  3JCU Q;  2IBF A;  2G8Y A;  3B0P A;  1D1A A;  2CW0 F;  4OGQ C;  1LT1 A;  4EUK B;  1EZV D;  1JOC A;  1GL2 B;  3HTK C;  1PPJ E;  2OKU A;  2I1K A;  2C9L Y;  1Q86 Q;  3EG9 A;  2EIM C;  1BGY E;  4JIO A;  2OTK E;  3DZA A;  1YTZ I;  1NU7 D;  3SXM A;  3VOP A;  1LWU C;  4JYB A;  1URQ A;  2IBZ I;  2XLH A;  2IBZ D;  2ZFC A;  3MIW A;  3CC4 P;  4CPG A;  1E83 A;  1AV1 A;  3U8P A;  2O1J A;  1TFO B;  5COM A;  2JD3 A;  1SQX E;  4L6R A;  4YT5 A;  2LCH A;  4NTA A;  2OTJ P;  3V2P A;  3MLG A;  4W7Y A;  3I56 P;  2EPL X;  3KZI H;  4RBN A;  3N7N A;  3BVH A;  4Y28 J;  1OCO C;  1RKE A;  3JCU E;  1IFD A;  4YXD C;  2VCC A;  3VP9 A;  3TGU G;  3G9R A;  4NPD A;  2V7Q H;  3AGU A;  5AVS B;  2JR8 A;  3OW2 O;  2P7V A;  1P84 I;  4C3B A;  2IX7 C;  1SQB D;  1KIL D;  4JJG A;  1JMW A;  2K1A A;  3F5H A;  2W4M A;  3RIP A;  1BBH A;  4C7O A;  5T3T A;  2LKM A;  5E79 H;  3SNH A;  1T5O A;  3VMX A;  4ONS A;  4JEB A;  2QJK C;  5DS4 A;  2HSB A;  1ZN5 A;  3RK3 E;  5L0D A;  2EPN A;  4OD5 A;  3NRH A;  1T6I A;  5B66 H;  1CGM E;  4IL6 H;  3G4S P;  3ZVR A;  5L0F A;  2Y9Z A;  2CPS A;  1JNM A;  1JRA A;  1DD4 A;  1NTK D;  1GK4 A;  1LS1 A;  4JRZ A;  3EHN A;  1G1I A;  1LTG C;  2RKL A;  2LXB A;  5AVX B;  1JTH B;  1RF1 B;  2XNX A;  1KD1 Q;  1LKX A;  2Z15 A;  3A0H E;  3DE8 A;  3D71 A;  4OIO F;  1YJN P;  5APU A;  2O3J A;  3LW5 J;  1URQ D;  1T2K D;  1OCC C;  2KLV A;  2VC9 A;  1URQ C;  2IFM A;  1T2K C;  2XXA B;  2QEX P;  2JO1 A;  1OXB A;  4A4A A;  4J32 B;  3VF0 A;  1IFN A;  1N86 A;  3CWB J;  5B1A C;  2HOD B;  4C7N A;  3EFO B;  3BRT B;  1CI6 B;  2PX0 A;  3KPE A;  1LP1 B;  2LFD A;  2NSG A;  3EGD A;  3GHG B;  4J7Y A;  5AW4 B;  1AVO B;  5KAI H;  3QH9 A;  3L73 E;  4MVO A;  1LTJ C;  5AVZ B;  3ZIB A;  3CC2 P;  3FOO A;  5CI9 A;  4XTK A;  2QM7 A;  5L8R J;  2W9Y A;  1BDJ B;  3TDK A;  3MYI A;  3L73 D;  2QE9 A;  2FFD B;  2XM4 A;  1HJ0 A;  3H1H G;  2QVA A;  1GL2 A;  2WMM A;  1E85 A;  4YL3 A;  4PD4 H;  1SQQ D;  5CCH D;  1FZC C;  2C0W A;  1MMD A;  1NU1 K;  1ORJ A;  3FX0 A;  3I55 P;  2C03 A;  3PMR A;  2XND H;  2WSS H;  2WIT A;  3RK3 B;  5A6B A;  3T6G B;  3ZDL A;  3L8I A;  1CSB A;  3CX5 E;  1OKK A;  2J0X A;  2KQ9 A;  5AVQ B;  2DI3 A;  2WVN A;  4H54 A;  1J1E B;  1W2E A;  3VYW A;  3RL0 D;  1IC2 A;  3L74 J;  1SFC B;  3D70 A;  2YHS A;  1LPE A;  3QW1 A;  2K37 A;  3L75 G;  1R8E A;  2FYU K;  2N1T D;  2HPC A;  4ZLC A;  2Q3T A;  3Q1M A;  3MZW B;  2H7B A;  2WVQ A;  4JC7 A;  3G3Z A;  3U59 A;  5DJT B;  1EDK A;  3RKO F;  3B5N C;  4UB8 E;  1Y4C A;  1PP9 E;  1IO4 A;  1FZA A;  1EC5 A;  1GU5 A;  3TNU B;  3DM5 A;  4E17 A;  4NTF A;  1N1C A;  2CYD A;  5E2Q A;  2CPB A;  2AEF A;  3MFN A;  4MND A;  4N6H A;  4XPY A;  1E79 H;  3S0X A;  3LS1 A;  1LT9 B;  3SZR A;  4OH8 B;  1RKE B;  1ZHZ A;  3B4S A;  4C7N B;  3EFO A;  4TT3 H;  2E5T A;  3DJU B;  4XWJ A;  1N73 C;  3V5Y A;  1JOG A;  2YO2 A;  1PL5 A;  1PGP A;  2CCY A;  4JBZ A;  5CCG C;  3OA7 A;  3GW6 A;  1S72 P;  2HMZ A;  3AE3 C;  1H0T A;  4YN0 B;  3FXH A;  1EDJ A;  3H1K G;  4WGZ A;  4DBR A;  2KZI A;  4D4X A;  4IL6 E;  3AG2 C;  3PH0 A;  1BZ4 A;  3H1I G;  2GFH A;  2PF4 E;  5AW2 B;  1L0N E;  2IYP A;  4OIQ F;  1L4A C;  3RL0 g;  2CDQ A;  2OG2 A;  3GHG A;  1HY5 A;  5CCG A;  1NBB A;  1ZHX A;  3AEB C;  2CGE A;  1LTB C;  2WT7 B;  2QJP B;  2OGU A;  5HSW A;  4DRH B;  4NTB A;  4PFP A;  1JCC A;  4GKG A;  2R7T A;  1AFO A;  2I8D A;  3H1L J;  1HTL C;  1MUU A;  2LFF A;  1V74 B;  1V55 C;  2L9J A;  1AA0 A;  1S5L E;  5F5H A;  3M9H A;  3GM2 A;  2OYI A;  5EGY A;  2XLM A;  2WZL A;  3IAO A;  1M57 D;  2P67 A;  3GM1 A;  2R7V A;  1HMO A;  3CX5 D;  5BVZ A;  2IYL D;  2NRG A;  5CBN A;  1Z6A A;  3QVZ A;  1S4X A;  1Q0D A;  4ASW A;  2RMZ A;  3X1O A;  1DEE G;  3CXH D;  1FS0 E;  1YYC A;  1A7E A;  3AQB A;  2YKZ A;  1HE1 A;  2E75 B;  3KDP B;  2YIU C;  1TWG A;  4AK9 A;  4MTO A;  2BEZ F;  2JEE A;  3H32 A;  3V4Q A;  3V5X A;  1FMV A;  2K9J A;  1GU4 A;  4RD9 A;  1AUE A;  2LXC B;  3H1J E;  3P8C E;  3C8G A;  4GDO A;  3AED C;  5A6A A;  2V26 A;  3L72 J;  1QL1 A;  4EBB A;  1KOR A;  3FGA D;  4FX5 A;  2IDB A;  2WZ7 A;  1FR0 A;  2NPU A;  1LM3 B;  4YL0 A;  5A6J A;  3H1L G;  3U9J A;  1BGY G;  5DJU B;  4GIF A;  4NPE A;  4IWB A;  1J1D C;  2KSF A;  5KAF E;  2LIG A;  1LGH B;  3L70 G;  5BU5 A;  2JJL A;  2WSC J;  1L2P A;  1XTG B;  1O3U A;  2NUP B;  3DJN B;  4KNW A;  3TSI A;  3Q7L A;  1LT9 A;  4HFF B;  1KYO H;  1SQQ K;  2HJ3 A;  1JMM A;  3FWL A;  5KTB A;  1ZU5 A;  3T6J A;  3LEO A;  1K05 A;  1L0N K;  5KJ7 A;  2QRX A;  3SP1 A;  2J5U A;  5L0G A;  1OIP A;  3CXH H;  1WGW A;  2R44 A;  3NYM A;  2B88 A;  3OWT A;  3Q3D A;  3GAN A;  4DT0 A;  3MTU E;  1JPN A;  4PV1 C;  5KYW A;  1W5C E;  1KYO I;  1Q7Y Q;  3P8M C;  1IFM A;  1NU1 J;  1VQK P;  3CMA P;  3BCC G;  4G0H A;  5KYX B;  4RDA A;  5B3I A;  4BXL A;  4O6N A;  1M90 Q;  1BCC D;  1OR3 A;  3PRJ A;  3K1H A;  2Q9I A;  3U1A A;  1WTY A;  3AG3 C;  3FOP A;  1NU9 C;  1Q90 D;  2R5B A;  5AW8 B;  2VH3 A;  1H0T B;  1FTS A;  5H2F E;  3LW5 H;  4JTC B;  2J0W A;  3IFM A;  2YNY A;  2NZ2 A;  1OVV A;  4MTF A;  4XLP F;  1SQP J;  4DVY P;  2OYI B;  2BCC E;  3LID A;  3S1K A;  2LP4 A;  2Y69 C;  3E7K A;  3VMY A;  1SS1 A;  5KAF H;  3ZG1 A;  2ZXP A;  1G4U S;  4NC3 A;  1FU1 A;  1N8R Q;  3CXH E;  2H7H A;  5E3A A;  3V2R A;  1L0N J;  1KB9 H;  4AE4 A;  2ZVN B;  4BPM A;  4MVU A;  2E76 B;  4I7Z B;  1E86 A;  1U57 A;  3QWO C;  2R05 A;  5KJ7 D;  4H4K C;  1KYO E;  3S90 A;  3I4U A;  1U7J A;  4RKU J;  2K9J B;  4PV1 D;  1N7L A;  2PBE A;  3A9C A;  1NTM D;  2E75 D;  4BJT A;  3LNR A;  3FMS A;  3JCU H;  3T6B A;  1F1M A;  4CS8 C;  2DYR C;  1Q82 Q;  4G7H F;  4I6M C;  5CCH C;  2V3C C;  2PNO A;  1A41 A;  2NSF A;  2OTL P;  3AGT A;  1TWH A;  2PP6 A;  3HD7 B;  2ZXR A;  2Q7R A;  2WSE H;  1Z7Q c;  4IJJ A;  2E76 C;  4I7Z C;  4EDF A;  2M4E A;  3RGU A;  3K6B A;  5L0H A;  2L81 A;  5KYY B;  4C7R A;  4KI2 A;  4QI0 A;  5APS A;  1HJB A;  3W4Y A;  3IEE A;  1EZV G;  3CCS P;  4Q7C A;  4N6J A;  1FAP B;  1GM5 A;  3L4F A;  1EDI A;  2EPO A;  4XLN F;  2F22 A;  4GQH A;  2H8A A;  3M4C A;  2KYV A;  3RK3 C;  3GEI A;  4XQ1 A;  5IY5 C;  3ABM C;  2N1T C;  3SWK A;  2EIJ C;  3AE1 C;  2WL8 A;  2IBZ G;  2HFI A;  3BCC E;  1YAU O;  4DOJ A;  3RL0 C;  2KUB A;  4XA4 A;  1PD0 A;  1Q0G A;  1FZB A;  1PP9 J;  2XL4 A;  4NCQ A;  1SQV E;  3L72 E;  3AE7 C;  3UMI A;  1KN7 A;  4I44 A;  2KIK A;  1KQL A;  4O9B A;  3TGU D;  1D1C A;  2I8B A;  3NDB B;  2N1T A;  1RMV A;  5CCH A;  4RJT A;  1I5N A;  3L75 E;  4QDL A;  2IM8 A;  4YT8 A;  4EIJ A;  1SQB G;  5KJ7 C;  3Q5P A;  2R03 A;  2OJE D;  5CHX A;  2YL7 A;  3CEX A;  3NMJ A;  3DAF A;  3M9Q A;  1OKK D;  3HD7 D;  2Q9C A;  1SQB E;  1DOW A;  2MKV A;  4L76 A;  4EWC A;  2FYU G;  4OIN F;  4LDR A;  3B8E B;  4I1L A;  2PFX A;  1S5L X;  1VQ4 P;  2W6B A;  2YRF A;  3FWN A;  2YIU B;  1NTK G;  5BQG A;  3HNI A;  1NU1 G;  4UB8 H;  2EIN C;  1PFI A;  3HKK A;  2R32 A;  4F4B A;  4H0L B;  3CX5 I;  4WJ0 A;  2R25 A;  3H1L E;  1MV8 A;  2OJQ A;  1Z3I X;  1JB0 J;  3SSU A;  2RH0 A;  4MVM A;  1XZP A;  4JUR I;  2R5D A;  3C62 A;  1SQV D;  4N4W A;  1HWT C;  1NVO A;  3S9O A;  3EZI A;  1VLT A;  2AWY A;  4IAQ A;  4O6Y A;  1GTW A;  1NKN A;  1WAT A;  2HR3 A;  2IPP A;  2Q9A A;  4U5H A;  1USD A;  5APT A;  1VLS A;  1OW7 A;  3V6I A;  5KLV E;  4PK4 A;  5A6K A;  1CZQ A;  3H1J D;  2K88 A;  1D0Z A;  1ZVZ A;  3JRT A;  4P9F A;  3NYJ A;  1VQ6 P;  2YL1 A;  3O6X A;  1VK5 A;  2X51 A;  2FYZ A;  2KOG A;  1NTM E;  2A45 I;  3DKA A;  3LLI A;  1LTT C;  1SLQ A;  3HNK A;  3C63 A;  1AQT A;  1BSH A;  3H1H D;  1Z56 A;  2XS8 A;  4AL0 A;  3EFG A;  2RN0 A;  1JM0 A;  1FJK A;  3IF4 A;  2W4B A;  3C8Z A;  1NTZ J;  2R02 A;  4ZKP A;  1SQQ G;  5KYU B;  2WSC H;  2HYN A;  3GOR A;  5D91 A;  1GMJ A;  1A0B A;  2JX0 A;  1L4A A;  3EQL F;  1J8Y F;  3HTK B;  1VQO P;  3L8J A;  1NTZ E;  1BR1 A;  2E75 C;  3HUS C;  2C04 A;  4GEH A;  4EHP A;  3H2V A;  4YTP C;  2VAS A;  2Z4E A;  1PD1 A;  1ZHT A;  3UNG C;  4DRI B;  1G5Z A;  2BEQ D;  4DRJ B;  2M5A B;  2OYH C;  5EK0 A;  3RBZ A;  3V2N A;  2L6F A;  4XPX A;  3WG7 C;  2VCA A;  1LVK A;  3KHU A;  3L75 D;  2WPQ A;  4AL1 A;  1R5L A;  1M1J B;  1KB9 D;  3OJA B;  3NMK A;  5JP7 A;  2H7O A;  3RFY A;  1JMB A;  2QIW A;  2FBW C;  1C02 A;  2G3V A;  3C8G B;  4CS9 A;  4PD4 I;  1RE3 A;  4AYC A;  1P84 E;  1X9V A;  2A6E F;  3AOU A;  2EPM X;  1SQQ J;  3LNM B;  1X22 A;  3Q7G A;  1YJG A;  3L74 D;  1M57 C;  2QG4 A;  3ZWI A;  3CCQ P;  3QMK A;  3W8H A;  4CDV A;  2J9U A;  2XKM A;  2P2U A;  1LE2 A;  3AE6 C;  2NUP A;  4IFD K;  3JTL O;  2YZS A;  1LIH A;  1H8A A;  1GS9 A;  3GG2 A;  4ZNC A;  2A45 H;  1EXI A;  1NG1 A;  5TJH A;  3NYL A;  1U0B B;  5CJ0 A;  2B87 B;  1OCR C;  3H1K D;  1KZU B;  1PPJ D;  2P7J A;  2WWW A;  5APY A;  4U5B E;  2IXM A;  1Y6D A;  1PP9 D;  2JPU A;  2PGD A;  2AU5 A;  2EPK X;  4C3E A;  4P9T A;  1M6T A;  3VMZ A;  1PGJ A;  3MUD A;  2J9V A;  3C1L A;  2L6G A;  2IOQ A;  3C18 A;  3IQ5 A;  3HE4 A;  3N4X A;  3RK2 B;  1YYJ A;  4E18 A;  2OOC A;  3L70 E;  4M63 A;  3PTZ A;  5E33 A;  3DD7 A;  3E1I A;  1HBW A;  1NTK J;  1KYO D;  2ITA A;  2XXA A;  1KNY A;  2M5A A;  4H0L D;  2IXP A;  3QVY A;  3U3F A;  2N1T B;  1NWQ A;  1APC A;  1PV3 A;  5AW7 B;  2HOD A;  1QKR A;  1SF8 A;  4HYT B;  4IB4 A;  2DW3 A;  5KLV D;  2FGY A;  2ZYG A;  3KKB A;  1D0X A;  1T6A A;  1LTJ A;  5AW6 B;  4N78 D;  4WVZ A;  3OA1 A;  3S4R A;  1X0T A;  4IGG A;  2KZJ A;  2I1J A;  3B5N A;  3CCL P;  3T97 B;  2C9N Y;  1JTH A;  4OWF A;  5AW1 B;  2XL8 A;  1NLX A;  1YJW P;  2YVK A;  2WVR A;  1TWA A;  3ABK C;  1QGK B;  1NO4 A;  1VDF A;  4K35 A;  4K3A A;  3M0D C;  3L0I A;  2J7P A;  3O6Q B;  1YIJ P;  3X2Q C;  3PJS K;  1MZ9 A;  1UIX A;  1KV4 A;  5A6B D;  3NKE A;  3LJB A;  5DQZ A;  3HD7 C;  4CJO A;  4OD4 A;  1YI2 P;  3L71 J;  3H1L D;  3KXD A;  3SYN A;  4P6I C;  2GAQ A;  4IL6 X;  1QVG O;  4R4L A;  2QJP C;  2OAR A;  1IFP A;  4HKZ H;  3W2W A;  2HFE D;  3L70 D;  1AVY A;  1Q0K A;  1G8X A;  1YA7 O;  4YT2 A;  4EOT A;  3CXH I;  2E43 A;  5EHH A;  1HW1 A;  2PAJ A;  5TIS E;  1NTZ D;  1EQ1 A;  5BQI A;  3TOM A;  4YT4 A;  1EXJ A;  3RQF A;  2J9W A;  3P7K A;  3W68 A;  3JYY A;  1D7M A;  3H1I E;  3NXS A;  2W83 C;  5AW9 B;  2MYS A;  3TNU A;  1RQU A;  2ZAE B;  4U5C E;  2AXT H;  1ZHY A;  3U9M A;  1GW3 A;  3SXK A;  1EZV I;  3DM9 B;  1LE4 A;  3GWN A;  3CD6 P;  3KPH A;  2W27 A;  1N73 B;  4L74 A;  4WY4 B;  2Y3D A;  1AJY A;  1G2C A;  3VMA A;  3U2L A;  4E0H A;  1OXK A;  1XZQ A;  4GOE A;  2R7S A;  3UMK A;  5B1B C;  1RE4 A;  5L0C A;  2KB7 P;  3BCC D;  5L0J A;  3L71 G;  1W2B O;  2GM4 A;  3L75 J;  3ATP A;  2LR2 A;  5COF A;  3FVY A;  3AG4 C;  3LIE A;  1LTI C;  2XZR A;  5KYN A;  2KK7 A;  1FC2 C;  2R3S A;  3K7D A;  3RYL A;  2QUP A;  2XLW A;  3DI5 A;  5BU8 B;  3HD7 A;  1T6U A;  3A11 A;  3QZC A;  3CX5 H;  4G7O F;  3ITF A;  3RVZ A;  4QMA A;  1YLM A;  4PD4 D;  4K1O A;  1XTC C;  1UII A;  4I2L C;  2C0X A;  2QSI A;  3I5P A;  3FXD A;  3KQG A;  4PJ0 H;  4DXW A;  3IHU A;  2AVK A;  2OYH B;  4KT0 J;  4C3D A;  1DH3 A;  4Z9H A;  1Q0F A;  1EI7 A;  4LER A;  5L3V A;  3P8C D;  1R4T A;  4JJF A;  1RY3 A;  3UMH A;  2V7Q J;  1W2W A;  4PV1 B;  4I1O B;  1L0L D;  2E76 D;  1E84 A;  1KB9 I;  3WHN A;  1G1J A;  3M1C B;  4O7G A;  3KH2 A;  4L75 A;  4WGY A;  4Q5S F;  4JQ0 D;  4IOI H;  4JYC A;  5FZT A;  1EQ7 A;  3WUU A;  3USS A;  1FOS F;  1LWU A;  4XFJ A;  4JTD B;  3VP8 A;  4HJG H;  5DS6 A;  3SFE C;  4FWV A;  1L4A B;  4EKW A;  4PR9 A;  2J9B A;  4MVR A;  1ZP0 C;  1NTZ K;  5KLV K;  1NTM J;  3C8V A;  2D2C D;  1C03 A;  2YL3 A;  4FES A;  2OEV A;  1GL2 D;  4CSA A;  2ZXX A;  1IK7 A;  4J30 B;  3NTN A;  1YZC A;  4L73 A;  2ICW G;  2H43 A;  1BDC A;  5AC5 A;  3WU2 E;  3B29 A;  1L4A D;  2XV5 A;  2CK3 H;  3N2Z B;  3RK2 D;  4Y99 B;  3AEA C;  1WAS A;  2D2C C;  2E74 D;  3CC7 P;  2J46 A;  1BCC E;  3OEO A;  3QW0 A;  4MW8 A;  3CI9 A;  2BE5 F;  1KIL C;  2G3A A;  1FZE A;  1VQM P;  1V54 C;  3C7J A;  3EGD B;  1PGO A;  4H44 D;  5KLI B;  1DEB A;  2TMV P;  2KSE A;  2NPS C;  1RF1 A;  1VQ7 P;  4BG0 A;  5DLJ A;  1USE A;  1OCZ C;  4ANJ A;  3NG1 A;  4UDV A;  3FHD A;  4ZKU A;  3O55 A;  5KYU A;  4EI2 A;  3Q6N A;  3RQE A;  1YJ9 P;  3CWB G;  4ASV A;  4WB4 A;  3S29 A;  4MVS A;  1SQV K;  1LTS C;  2QJY B;  1TKN A;  4JCH A;  2WPV B;  4D6T D;  1HMD A;  2XU6 A;  4A2N B;  3RK3 D;  1KQF B;  2FYU D;  2E5Y A;  3HE5 B;  4BEM J;  5KLI C;  3TGU J;  2KS1 B;  3MX3 A;  3FAJ A;  1NOH A;  4U3F D;  4CBE A;  4RES B;  1NU1 D;  2G3K A;  1NAY A;  1OFC X;  1HGV A;  1FDI A;  2H7V C;  2YLI A;  2Y0C A;  2GA1 A;  1TU3 F;  4U5E E;  4H13 C;  4X0R A;  2Y0E A;  5GTH H;  1H88 A;  2J45 A;  3DMD A;  4XPW A;  3VM6 A;  3U2M A;  5K5G B;  3CZ6 A;  1N7S A;  2IFN A;  4Z1M H;  3IQT A;  1SQV G;  2QM8 A;  2NPS A;  3AEF C;  2YL0 A;  3GF3 A;  1M2O A;  3BCC J;  5AW3 B;  1ZOY C;  2R7R A;  4H13 D;  2O01 J;  3C9I A;  4EIY A;  1D1B A;  1QQ3 A;  3G4Z A;  3LES A;  1SQP D;  4MVQ A;  3B9Q A;  3H1J G;  1QX8 A;  1HF9 A;  1NTK K;  5AVV B;  4RO0 A;  3WAQ A;  1VF5 C;  1RF1 C;  1A02 J;  4JW1 A;  1NJI Q;  2X0C A;  2FY8 A;  4KHX A;  3WUT A;  1K9M Q;  1OMI A;  1KC8 Q;  2GUV A;  3ITK A;  3MBG A;  1EA8 A;  1ORY A;  1SVF A;  3FXE A;  1Y9B A;  3CCM P;  3A0B E;  1YQ3 C;  3JRM O;  1J8M F;  5A69 A;  2O01 N;  4WY4 C;  3J06 A;  3U0C A;  2J8W A;  2A0B A;  3JYH A;  2B0J A;  3E9V A;  4YJW A;  1HUC A;  3H1J J;  1NHL A;  4BEJ A;  5KAI E;  2J59 M;  3SWY A;  4YK5 A;  5KYY A;  4A7P A;  1SQX G;  2MHR A;  3AQC A;  2AWC A;  3K33 A;  1K04 A;  1Q2N A;  1VF5 B;  1RH5 B;  3H25 A;  2SPZ A;  1AEP A;  1HGZ A;  2D5R B;  2O9X A;  1JY3 N;  1N7S C;  3H1I J;  2B0H A;  3EZH A;  2ZXW C;  2L7A A;  3U5S A;  3RK2 C;  3S84 A;  1ZV8 A;  5JUA A;  4ZMD A;  3B5N D;  1T6Q A;  1BR2 A;  3Q5S A;  5AC4 A;  3U1C A;  1NZE A;  2BCC J;  2Q5U A;  1B68 A;  4R32 A;  1VQL P;  2WSE J;  2FYU E;  4TLF A;  4Z9I A;  3GF7 A;  1N7S D;  1M56 D;  3AG1 C;  3H6P A;  2Z5H A;  2JKV A;  2FXO A;  3L74 G;  3B71 A;  3WOD F;  3I5C A;  1FZC A;  3QTH A;  1A02 F;  1EDL A;  2PRR A;  2YKQ A;  1H9G A;  4PFO A;  3IN6 A;  4JVS A;  1DX7 A;  4EBK A;  1YDI A;  5CI8 A;  2LK4 A;  1OVU A;  4IAR A;  4IFM A;  1PPJ G;  1TQG A;  1PP9 G;  2QTV A;  1WN0 A;  3V7O A;  4CSA C;  5B5E E;  3V2Q A;  3A5T A;  1QVX A;  3KZI E;  2IXN A;  5B3S C;  1FJP A;  1K40 A;  1L0N G;  2KYH A;  3TOL A;  1QVF O;  2Z5I A;  1Q81 Q;  2WPS A;  1N73 A;  4OIR F;  1VOM A;  4AUW A;  2BCC G;  4LAC B;  4WAB A;  1EZV E;  3MHV A;  1SFC A;  3VTP C;  1RJ9 B;  2FKW B;  1K73 Q;  3H32 B;  4KJM A;  5JS5 A;  1IW7 F;  1JPJ A;  4CS7 A;  3M0A A;  3L34 A;  2ZT9 D;  2JDI H;  2KI7 B;  1DIP A;  5AVW B;  1UG7 A;  1LNQ A;  1LI5 A;  4NY3 A;  1MKM A;  1BGY J;  3WMM 0;  3E70 C;  4CDY A;  2J58 A;  4Y99 C;  2PP4 A;  5CMZ A;  4E7S A;  1U7M A;  1IK9 A;  4U3F E;  4DJ9 A;  3CLQ A;  3POV A;  4MW3 A;  5KLV G;  1GGQ A;  2Q1K A;  4LLH A;  1ZR4 A;  3T9O A;  2K9Y A;  2OYO A;  3L72 G;  2HLO A;  3H1K J;  1FE6 A;  4D6T E;  1S5L H;  2YLD A;  1RE3 C;  1H9T A;  3G6E P;  2O1K A;  3ABV C;  2KNC A;  5TJ5 E;  2ZT9 B;  2WT7 A;  3WUV A;  1MNE A;  3OAK A;  2VB6 A;  1CGO A;  4HB1 A;  1NU1 E;  1O5H A;  5CJ4 A;  1OW8 A;  2HUJ A;  3HUS A;  1GQA A;  1UFB A;  2R7W A;  3L36 A;  3GEH A;  3O6Q A;  5GTI H;  1T9K A;  1ZW3 A;  2EIK C;  1NH4 A;  1NGM B;  4DOZ A;  1S7Z A;  2GWW A;  2XLE A;  2OYH A;  4LDK A;  4CJG A;  4C7O B;  3R2P A;  2OQQ A;  1JR8 A;  1WT6 A;  2VRS A;  1VQ5 P;  4OGQ B;  1A7V A;  5KLV J;  1NTM K;  2FXP A;  1XWJ A;  1BDD A;  2QA4 P;  2HJM A;  1S3J A;  1MND A;  1WMK A;  3E1R A;  1NSG B;  4GYT A;  2ZT9 C;  1TWC A;  2A0U A;  3UR3 C;  5KKZ B;  2FXM A;  1S1C X;  1FFH A;  1NTZ G;  3LS0 A;  3AEE C;  1PGQ A;  3A2A A;  2JWD A;  2XM0 A;  3TQO A;  2R7X A;  1S2E A;  1QL2 A;  3CQZ A;  1SFC D;  3ZQV A;  2W6A A;  1HH0 A;  1MQV A;  3G50 A;  5APQ A;  3US6 A;  2IYO A;  1V4A A;  1T8Z A;  2YWA A;  3F47 A;  1VF5 D;  2XDJ A;  1PCX A;  2FFD A;  2YLG A;  4HE8 D;  2A06 D;  2R7O A;  5L3Q A;  1BSN A;  1R5S A;  1BE3 J;  4WY4 A;  5AVT B;  3M4B A;  1JY2 O;  4N06 A;  1ST6 A;  1G2C B;  3L1M A;  2A1D D;  2Y9Y A;  1I4Y A;  4GT1 A;  3L71 D;  3LAY A;  3MGN A;  3M06 A;  3A7O A;  4C46 A;  2ASR A;  1L0L E;  1JUN A;  1FAV A;  3U3B A;  4N3Y B;  3G4X A;  3FAP B;  1AVO A;  2QJY C;  3AE9 C;  1MFZ A;  3AEG C;  2KK1 A;  1JEK A;  5GTH E;  2WPR A;  3UIA A;  4R4M A;  1JAF A;  1M2V A;  5DVW A;  2IXO A;  1T3J A;  2YMK A;  1BE3 G;  4QI2 A;  3R7C A;  4LC1 A;  1VL2 A;  3CWB E;  1IZN B;  3HRN A;  1QZX A;  1RQV A;  3HE4 B;  1Q0M A;  3M15 A;  2KW3 C;  1E5W A;  5E3C A;  4JPZ B;  1NFO A;  2GUS A;  1GW4 A;  2Y3G A;  4PD4 E;  4U5D E;  4H13 B;  1WWP A;  1CW5 A;  2CNW D;  1KQG B;  5APX A;  1M1J A;  5KYX A;  4G7Z F;  4O6M A;  4DJG A;  1Z5Z A;  1FBM A;  1SFC C;  3R4Y A;  4DCK A;  2PX3 A;  4LGD E;  3GM3 A;  1NKZ B;  2KS1 A;  2P61 A;  256B A;  3L71 E;  2A45 G;  2B87 A;  1VMA A;  1PZQ A;  3RBX A;  1RF0 A;  3AEC C;  1VB5 A;  2WSF H;  4MS2 A;  4PJN A;  2XLV A;  1L0L G;  2HPC B;  1VQN P;  3NFQ A;  1GZL A;  1ZZP A;  3T97 A;  2HG5 D;  2M3B A;  2ZXO A;  5JRA A;  4W7Z A;  4BRY A;  2QE7 H;  3V5Z A;  1FNT c;  1C17 M;  2FFH A;  3EQ2 A;  2J7P D;  1AQ5 A;  1BR4 A;  4JF7 A;  4YWQ A;  3RW0 A;  3C8G D;  3MYF A;  1BE3 E;  3TF5 A;  1CPR A;  1SQB J;  2OEX A;  2EIL C;  4FAP B;  2H89 C;  3AE2 C;  1SMY F;  2HV7 A;  1S9K E;  2Q3E A;  4DZO A;  3SXZ A;  4B86 A;  3GLM A;  1L0L J;  2NUT B;  1R5I D;  4HH2 A;  4Q4Z F;  1VTM P;  1NYH A;  3NMD A;  1DOV A;  3T4R A;  1YBK A;  1LI7 A;  3MUD C;  4N6C A;  4U5F E;  5B66 E;  4MN4 C;  1J1E C;  2A6H F;  4W80 A;  4U7J A;  1I4Z A;  2H8P D;  2OCC C;  1L3P A;  3PP5 A;  2R9R B;  5CIV A;  5DS5 A;  4MQ9 F;  3TK1 A;  4EYY Q;  1OZH A;  2UUI A;  2R7Q A;  3ZSU A;  2LSE A;  4XEK A;  3Q2Y A;  1N7S B;  1WOL A;  2XRH A;  3KYQ A;  1CPQ A;  2XLD A;  1OW6 A;  3L70 J;  3UGP A;  5AW5 B;  3GWL A;  3JC2 2;  3HJC A;  3O39 A;  1FFT C;  2L91 A;  4EBJ A;  1QLE C;  4IAO A;  3LEV A;  1SR2 A;  3CWB D;  2UWJ E;  3LUT B;  3NKD A;  3VYI A;  3EH2 A;  2M8R A;  4YPC A;  2L5G B;  4IRU A;  2RD9 A;  3K1I C;  4I1M A;  1ZW0 A;  4D6T G;  4KC9 A;  2FFD C;  5JVE A;  3PHF 2;  3KL4 A;  3UGO A;  4E7Z A;  5B5E H;  2Y39 A;  2FYN B;  2L6H A;  2Y3B A;  2R3C A;  2AEM A;  3PDM P;  1LTA C;  4DVZ A;  2K3R A;  4AX2 A;  1TFK B;  1A7D A;  2Q4F A;  4K7B A;  4U3F G;  3CCV P;  3U8V A;  4W8P A;  1OX3 A;  4PAC A;  1KQS O;  4JTA B;  4CIH A;  3TD7 A;  2HKV A;  1Z63 A;  2M0B A;  2WTY A;  2D2C B;  3HNL A;  4H44 B;  5JLI A;  3DE9 A;  5APV A;  3ZTM A;  2DYS C;  4D6T J;  1VQ8 P;  3D6Y A;  1JCD A;  2YXQ B;  4WBA A;  1U6H A;  3L73 J;  1M1K Q;  2KGO A;  1Y8A A;  2D4U A;  4ULW A;  1J1D B;  4U9E A;  4N78 E;  5M1B A;  1E2X A;  3TK0 A;  3G71 P;  4U3F J;  2NG1 A;  3HNJ A;  3ZTZ A;  1QEX A;  4JE9 A;  1SQP G;  4KNV A;  2H88 C;  5T3W A;  1GDT A;  5T1D B;  2W8Z A;  3SEO A;  1JY2 P;  3JSZ A;  1MMN A;  3ZQY A;  4U5G A;  2OQM A;  3K1I A;  4ZLD A;  1YA9 A;  3CCE P;  1SQP E;  1DD3 A;  2AP3 A;  3JSE O;  2AXT E;  5K0I A;  2BC5 A;  1L7C A;  1TR2 A;  4GOD A;  1RXQ A;  2AEJ A;  2N9Y B;  1ZLL A;  3KYJ A;  3O10 A;  2WQY C;  2PFD A;  3L73 G;  4MVZ A;  3ABL C;  2QJK B;  1ZU4 A;  5COG A;  2JWA A;  2NUT A;  1ZRT E;  1J2J B;  4HFK B;  2Q00 A;  2KJG A;  3EGX B;  4CS8 A;  2YKO A;  1NAF A;  1ZHW A;  2HZ8 A;  1GL2 C;  4BRY B;  1FOS E;  1WRG A;  1SQX D;  3IR9 A;  2P1A A;  3BRV B;  2QLA A;  1JY2 N;  1FMW A;  3HTK A;  2YKP A;  1PIX A;  1VQP P;  3JT1 A;  1ZME C;  4XE5 B;  1Y47 A;  2I15 A;  1YAR O;  4LLE A;  5GPG B;  5BUO A;  5F5F A;  1URQ B;  3PHL A;  4G78 A;  2M64 A;  2Q9B A;  4PJJ A;  1QSP A;  3VAY A;  3M91 A;  2XLO A;  3N0T A;  1JY3 O;  1VQ9 P;  1GK6 A;  5DQT A;  1T01 A;  1OXZ A;  1IFI A;  3BEH A;  4W8K A;  2W45 A;  4YL1 A;  2XL6 A;  1O87 A;  2KC3 A;  3S28 A;  1RF0 C;  2WVO A;  4ULV A;  3HUS B;  1OVR A;  4BWN A;  4PJL A;  1SYQ A;  5KKZ C;  2E42 A;  2KSJ A;  4JKV A;  3TJ5 A;  5D92 A;  3ZDM A;  2KNC B;  3JZ0 A;  5AVU B;  4D4N A;  1M7L A;  3TUL A;  3AE5 C;  1H7I A;  4XEF A;  1CI6 A;  1HVV A;  2ZYD A;  1QLE D;  5FCL A;  1MMA A;  1FZC B;  3PLN A;  1KU2 A;  4JEA A;  1SQB K;  1VYI A;  4CS9 C; 
#chains in the Genus database with same CATH homology
 2JO1 A;  4NQF A;  1S1C X;  3GF3 A;  1EXI A;  1KIL E;  3AE3 C;  4XFJ A;  3AJM A;  1ZOY C;  4H44 C;  3AE8 C;  3AEE C;  4H13 D;  2O01 J;  5M1B A;  1EXJ A;  2LK4 A;  3RQF A;  2E76 C;  1K05 A;  4I7Z C;  1OW7 A;  3SFE C;  3C8G D;  3JYY A;  1FDO A;  2H88 C;  2H89 C;  3AE2 C;  2JPU A;  1ZP0 C;  1RQU A;  2G8Y A;  1HF9 A;  2J5U A;  1QVX A;  3C8V A;  2D2C D;  1K40 A;  4OGQ C;  3GLM A;  1VF5 C;  2E74 B;  1V4A A;  3Q5R A;  2YWA A;  1DD3 A;  1IK7 A;  3EWK A;  1OMI A;  1NYH A;  1VF5 D;  5L8R J;  3Q3D A;  2L6G A;  3RL0 g;  1AJY A;  4PV1 C;  3C18 A;  3O10 A;  2WQY C;  3GMA A;  3AEB C;  1HJ0 A;  1Y9B A;  3AE1 C;  3AEA C;  2JP3 A;  1YQ3 C;  2D2C C;  1ZRT E;  4U7J A;  2Q00 A;  2E74 D;  3U0C A;  2WSF J;  2ZT9 D;  1KNY A;  1GMJ A;  4H0L D;  1DIP A;  2JX0 A;  3U3F A;  4XEK A;  1MKM A;  1PV3 A;  2G3A A;  3Q2Y A;  2QJY C;  1WOL A;  3AE9 C;  1WTY A;  3L8J A;  2E75 C;  4H44 D;  1Q90 D;  3AE4 C;  3GM2 A;  3AEG C;  2KK1 A;  1OW6 A;  3AE7 C;  4Y28 J;  4YXD C;  1KMI Z;  2FYN C;  3G9R A;  3IAO A;  4YTP C;  4R4M A;  3L8I A;  3GM1 A;  2K9Y A;  1K04 A;  3D6Z A;  1VF5 B;  2E74 C;  1PIX A;  2BEQ D;  1ZME C;  2NZ2 A;  2P10 A;  4EBJ A;  2YMK A;  3H25 A;  3RQE A;  3Q5P A;  1VL2 A;  2L6F A;  4XEV A;  3T97 B;  3D70 A;  1RQV A;  2QSI A;  1R8E A;  1KTM A;  2E75 B;  2WPV B;  2MKV A;  2YIU C;  4H13 B;  3ABV C;  2BEZ F;  2QJK C;  2ZT9 B;  4KT0 J;  3Q1M A;  1WWP A;  2HSB A;  1KQG B;  1KQF B;  3S9O A;  3RK3 E;  2L6H A;  2QIW A;  3R4Y A;  1S5L X;  3SFD C;  3Q5S A;  2FBW C;  3BRJ A;  2E76 B;  1OW8 A;  4I7Z B;  3GM3 A;  5KLI C;  1U57 A;  3C8G A;  3C8G B;  4R32 A;  4GDO A;  1UFB A;  1UIX A;  2WSE J;  3AED C;  5KKZ C;  4OGQ D;  3O6Q A;  2V7Q J;  1DD4 A;  3GF7 A;  4PV1 B;  1KOR A;  3FGA D;  4RKU J;  1NGM B;  2IDB A;  3AEC C;  1FDI A;  4PV1 D;  2PBE A;  3MFN A;  4H0L B;  5F28 E;  3JZ0 A;  3B71 A;  1TU3 F;  3TUL A;  2E75 D;  3AE5 C;  4IL6 X;  4XEF A;  2D2C B;  4H13 C;  4R4L A;  2QJP C;  1JB0 J;  2E76 D;  2OQQ A;  4H44 B;  4TT3 H;  3RQG A;  4OGQ B;  3D71 A;  1ZZP A;  2FXP A;  2WSC J;  4Z1M H;  3D6Y A;  1O3U A;  3AE6 C;  3IN6 A;  3LW5 J;  1WMK A;  1JOG A;  4H0L C;  1YQ4 C;  3K7D A;  2ZT9 C;  1PL5 A;  4EBK A;  3AEF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...