3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
b'ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal adhesion kinase 1
publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
2PBEA 3U3FA 3U0CA 3AE2C 3C18A 3GM2A 2H88C 3JZ0A 4YXDC 2YWAA 1YQ4C 1V4AA 3ABVC 2KK1A 5F28E 2HSBA 1ZP0C 3MFNA 3O10A 1ZOYC 3RQGA 4R32A 2FBWC 3AECC 1KTMA 1YQ3C 2H89C 1OW6A 3AJMA 3AEGC 1K04A 3AEAC 4XEFA 3K7DA 4XEVA 3B71A 3TULA 3SFDC 3L8JA 1K40A 3AE1C 1JOGA 1KNYA 3C8GA 4EBJA 1PV3A 2Q00A 3RQFA 3L8IA 3AEDC 3C8GB 3JYYA 2JX0A 3S9OA 2JPUA 3AE3C 1OW7A 3GM3A 4EBKA 3C8GD 3AEEC 1K05A 2WQYC 3AE5C 4NQFA 2L6HA 2L6GA 2G3AA 3AE9C 3SFEC 1QVXA 1UFBA 3AEBC 1OW8A 3AE6C 1ZZPA 1O3UA 1WTYA 3GM1A 4YTPC 3AE4C 3RQEA 3AE8C 2LK4A 3BRJA 1WOLA 3AEFC 3AE7C 4XEKA 1WWPA 2L6FA
chains in the Genus database with same CATH superfamily
1VF5D 2D2CC 3USSA 1QVGO 3C62A 1WMKA 4DJGA 4NPDA 3LEVA 3SEOA 2KK7A 1KYOE 2W6JH 2H88C 2OEVA 2L5GB 2R03A 2KC3A 2OKUA 2WL8A 3W67A 3IHUA 4HEAJ 3BVHA 4GYTA 3WODF 1SQBK 3TOLA 4PV1C 4RD9A 3L75G 1KILB 1KYOI 2UUIA 1BDDA 3U3BA 2RD9A 2WSEJ 2FFDA 3W2WA 1KTMA 1U7JA 2IFMA 2LR2A 3N4XA 4H13C 1M6TA 2PX3A 2OCCC 1K04A 1NTZE 1BSNA 4A7PA 1EDJA 3AG1C 5E3AA 2Y3HA 2YO3A 1Q7YQ 3JSEO 2CCYA 1A7DA 1LWUA 3CD6P 1G4US 4XEVA 4XPXA 2NG1A 4H0LB 3L71D 3T9OA 3RK3B 1IZNB 2CPSA 5E33A 2XXAA 4I1OB 5CJ0A 2IZ1A 2K3RA 3S4RA 2BEQD 2BCCG 2IBZE 1N2DC 4GEHA 4JTAB 1RE4A 1SQBE 2VB6A 1SVFA 1HGVA 5AC5A 2AP3A 4PV1D 2J59M 2OYIC 3L74E 5AW6B 1D0YA 2Y9ZA 1YDIA 3Q7GA 4U9EA 3TJ6A 3VYIA 2WZFA 2QIWA 1FZCA 2ZT9C 2ZVOB 2N1TB 3HTKA 4KNWA 2O9XA 4B6IA 2IBZI 1PIXA 4H13D 2NUPB 1MV8A 4OIPF 4WVZA 4O7GA 5HSWA 2W45A 2AEFA 5DJTB 3TNUA 1Z7Qc 2K1AA 4IWBA 1W2WA 1WRGA 3V5ZA 1YJWP 2A45G 5GPGB 2QE7H 3L1MA 2O1KA 3ZWIA 4JC7A 3L4FA 3ITFA 1AFOA 4AL1A 1I5NA 1Q81Q 1IFPA 4AL0A 2QE9A 1HE1A 1HJBA 1FZEA 4XTKA 2LCHA 3H1JJ 3ZIBA 1TQGA 5APXA 4GDOA 5KYWA 1KILC 3H1LE 2NUTB 4QI2A 4U9DA 2P7VA 2DGJA 1YA7O 3E1IA 4OD5A 1BE3E 1FBMA 1PP9G 3N0TA 3X2QC 3JSVC 1XZQA 2KS1A 2BC5A 1H6GA 1GU5A 4H0LC 1OQCA 1ZHWA 4J32B 3RK3C 1OKKD 5F28E 2CK3H 2HV7A 3M9QA 3TK0A 4NPEA 256BA 1OZHA 2ZD9A 2VASA 3GMAA 2YL7A 2XRHA 3Q5PA 2C9NY 4NY3A 4U3FE 5DS6A 2JWDA 2I8DA 5APSA 1M7LA 2E87A 1SFCB 1GK4A 2NSFA 3R4YA 1ORJA 1KILD 3V7OA 3SFDC 2GM4A 2A68F 3A9CA 2N1TC 3SWKA 2Y3BA 5BQHA 2H7OA 3LUTB 2UUHA 2VH3A 3NYJA 1KNYA 1VK5A 1IFJA 1J8YF 1AUEA 1JY2N 1E2XA 3I5PA 3PDMP 3L72D 4RBNA 2P7JA 4PACA 2A69F 5KLVE 4H0LD 3F47A 1P84E 3L37A 2R7TA 2Q9CA 1SR2A 4MW3A 2M5AA 3ECSA 3LLIA 3TGUE 3MLGA 1NU1G 3D6YA 3RFYA 4O6MA 3ZSUA 1KN7A 4CS7A 2IX7C 4AYCA 1SQPE 5CHXA 1VQKP 1SQXE 3FXHA 3W4YA 1X79B 3AEEC 1IW7F 1K05A 2EPNA 3Q2YA 5JS5A 1S5LE 1P84I 4PK4A 3DI5A 3H1KG 3SZRA 3A7OA 1M2OA 1SQQD 4NCQA 4A2NB 1SQVK 2IYPA 3S90A 3SFEC 3ZDLA 5AW7B 1KB9H 2N1TD 3MUDC 3VP8A 1L0LK 3H32A 3HE5A 2HFED 1IFMA 3L71J 2J8WA 1SP4A 2V26A 5APUA 1DD3A 1ZW2A 4Z9IA 4MW8A 3RVYA 1SYQA 4EIYA 3LW5H 2YNYA 4IGGA 1S2EA 5B3SC 2OYHB 3MYIA 3J06A 3EH2A 1EDLA 3TD7A 5A6BD 1ZHXA 5AW3B 1Q90D 4BJ6C 4G78A 2OTJP 3VMZA 1H9GA 1SFCC 1FC2C 1VLSA 5AVTB 3DD7A 1JMBA 1NVOA 4YXDC 4M3LA 2YWAA 1LPEA 1VTMP 3V2QA 2QLAA 4MVSA 4WWIA 2XM4A 4HJGH 4YT8A 1DEBA 3V2PA 1LTJA 3QW0A 4DVYP 3VM6A 1O5HA 1OKKA 4P9TA 2LP4A 1MFZA 3WU2E 2L91A 4L73A 1OW6A 4GQHA 1U6HA 4C3BA 2XU6A 2CGEA 3CCMP 1T3JA 1RF1A 4A4AA 4GODA 1NAYA 2P0NA 1VQNP 1ZVZA 1Q0DA 2W27A 4BRYB 1L4AD 1JOGA 2R7VA 4CS9C 2P61A 4E7ZA 1SFCD 4MTGA 2GUSA 2JKVA 2R05A 3QTHA 3CCQP 4JE9A 1VQ7P 2ZYGA 2K88A 3P8CD 1TKNA 2MHRA 2B87A 4G7HF 2Z5HA 5B66E 5AVYB 1U89A 4B86A 3ABKC 4EBKA 2YRFA 4ULVA 2GUVA 3HUSB 3G4ZA 2M8RA 2X0CA 2OYHC 4OGQD 3RH3A 5APYA 2L6GA 4XLNF 1RF0A 3L73E 2ZXRA 3ASOC 4FAPB 1UFBA 3WG7C 1F1MA 2G3KA 3A0HH 2KW3C 5AVUB 1AVOA 1SQVD 5CCHC 3CAXA 3L70E 3ABLC 1J8MF 2IM8A 4K1OA 4PJNA 3V5XA 5JP7A 2A45H 1D7MA 1FZBA 2M3BA 1L0LD 3A0HE 5BU5A 3L72J 2KYHA 3LIEA 1YYCA 1QPUA 2R5DA 1GGQA 1ZU4A 1HBWA 2E43A 3MD0A 2JR8A 1VQ4P 3TJ5A 2OEXA 3GM2A 2WSFJ 2E74B 2GA0A 3O6XA 1YZCA 4Q4ZF 3I5CA 4LC1A 3TF5A 2B88A 2FXPA 1GTWA 2HSBA 3DAFA 1SQQJ 1SMYF 3L75D 3DMDA 1QLEC 1ZRTD 2LXCB 4BEMJ 5CCHD 1ZR4A 2Y3DA 4KT0J 4NTBA 2A6EF 1JCDA 3GLMA 3AJMA 3CXHI 2OOCA 2G3VA 2FFDB 5JVEA 3PCVA 3FXEA 1H88A 4J7TA 1QL2A 5KAIH 5A69A 1NTZG 1PZQA 4AUWA 4ZLCA 4M63A 3SP1A 1LWUB 3HUSC 2QVAA 2ZAEB 1NU1K 5CCGA 1JRAA 4MVOA 4IFFA 5K5GB 4DBRA 3CX5H 3EH1A 1E79H 2VRSA 1L4AA 4AK9A 2XXAB 3S84A 4U5FE 1KU2A 2HODA 3CCJP 1G5ZA 4MNDA 3CQZA 3M79A 3FMSA 2IBZG 1VOMA 1QLED 2XNDH 4HKZH 3MBGA 4DJ9A 2KOGA 4BG0A 3L74G 1VYIA 1FZCB 1T6QA 3FWNA 1Z5ZA 3EPVA 5M1BA 3HTKB 3K6BA 1U7MA 4BJ1A 4OH8B 3U1AA 2FGYA 1M57D 1JM0A 3L0IA 1R4TA 2OJED 3PMRA 1ZZPA 3CWBD 2A0BA 2E74C 4O79A 2YKQA 1N73A 4JJFA 2P10A 3JCUE 2PFXA 3D70A 3E70C 2Q7RA 4J30B 2R32A 4EDFA 5DJUB 1HWTC 2EINC 2J9BA 4JEAA 4D6TE 2R25A 2LQGA 5KKZB 1ZN5A 1ZHZA 4N6HA 3VYWA 1S1CX 5KYWB 3UMHA 1PP9D 3L36A 3CCSP 2H8AA 2HR3A 3H1LG 3R2PA 3U59A 3AG4C 1A7EA 2FFDC 1XWJA 3SXMA 3T6JA 3CL3D 1VF5B 1YQ4C 5E79H 3EG9B 1A02J 4TT3H 3TQOA 1BE3G 2XLWA 4YK5A 2KS1B 1LWUC 2YL1A 2KP8A 3IQCA 4WY4D 2E74D 4ZLDA 3Q3DA 3BCCE 3OA7A 1CGME 1IFDA 3UR3C 2QJYB 1SQVJ 1HW2A 4PJ0H 5EK0A 4RO0A 4U3FG 3CX5D 1GK6A 1RE4C 1L0LJ 2A06E 5AVVB 1PGJA 1V55C 3A5TA 1ZHTA 2O01J 3MX3A 2WTYA 1FZCC 3A3YB 3B0PA 4RJTA 4BXLA 3HTKC 2E5TA 3U1CA 1EZVD 4IFDK 3R7CA 3VRCA 2WZLA 5D92A 1HY5A 2I15A 5AVWB 1YA9A 4DOJA 3KKBA 1NTKD 2H8PD 3CC4P 2H7VC 4CDYA 4ONSA 4W7ZA 5KLVG 2AVKA 3GWNA 4UB8H 2V3CC 1Z23A 2YL0A 3L75J 2WPSA 3KPEA 4JTCB 3GM3A 2ETSA 2XL6A 1UIIA 3TGUG 4UB8E 3CI9A 1MFTA 4HYTB 3UIAA 2GAQA 2EPMX 2KNCA 3MTUE 1CGOA 4H54A 3C1LA 1SQPG 5KKZC 1SQXG 3LAYA 1QVFO 4L74A 3BRTB 4LDKA 2R02A 3KDPB 4GIFA 3JYHA 2FXMA 2HSQA 1CPQA 2JP3A 1OVRA 1M56C 3Q7LA 1ZW3A 1YJGA 1U0BB 3H32B 1NTMG 1FE6A 4QMAA 4JTDB 1VF5C 1TU3F 3Q5RA 4IAOA 5CIVA 2PRRA 5CBNA 1WWPA 2PX0A 1FOSE 3VAYA 1EDIA 1ST6A 2KQ9A 4OIQF 4IOIH 4FX5A 4Z9JA 4DRHB 2ZFCA 4Z1MH 5L8RJ 2HS5A 5KTBA 3C18A 3M9HA 4XPYA 3H65A 1G1JA 1VQMP 2IBFA 3V4WA 3AQCA 1NHLA 3N2ZB 2R7UA 3GF3A 2EILC 5AVQB 1JNMA 1RE3A 1O87A 1G2CA 1ZV8A 4JCHA 1NTZK 3CWBJ 2PF4E 1LTJB 4WY4A 1KYOH 3GF7A 1CI6B 3P32A 4MQ9F 3AEGC 1L0NE 1CZQA 3HRNA 2FYUE 3TSIA 4AX2A 1KQSO 4U5DE 2I1JA 2MKVA 4R4MA 4EI2A 3NMKA 3L8JA 1Y9BA 1RF1B 4Q5SF 2G62A 2DYSC 3M0AA 3ZG1A 2O3JA 3FXDA 2Y39A 2JWAA 4EBJA 1PP9J 2Y3GA 1GS9A 3H1ID 4N3YB 3GEEA 2Q9BA 1BGYE 2V7QH 4G0HA 2XLHA 2YLDA 4BEJA 1H9TA 2JPUA 3W68A 3PTZA 3U2MA 1MMAA 4HH2A 4C7OA 5APQA 2B87B 1C03A 1APCA 2VC9A 5CI8A 1BR4A 4JZAA 3T6GB 2J58A 5APVA 1J1EB 2FY8A 1EXJA 4K0DA 2L6HA 2IOQA 3OEOA 1M1JA 2ZPAA 5DLJA 1T01A 3Q5SA 1QSPA 4OVNF 3L73G 3Q6NA 1PPJE 2PGDA 1Q82Q 2MJZA 4ZNCA 3RQEA 4U5BE 5JUAA 1MMGA 5KYXA 3AE7C 1AVOB 4XEKA 3QVYA 3L70G 2AEJA 1NTKJ 2XDJA 4MS2A 1LTJC 1KV4A 1AV1A 4IL6E 2YL3A 3M1CB 3U0CA 4JEBA 1OR2A 3ITKA 1AEPA 1BBHA 2HG5D 3G9RA 1JY3O 2A0UA 3X1OA 2GWWA 2OYOA 1NSGB 1N86A 1RF1C 2ICWG 4NTAA 1BCCJ 3P7KA 4YPCA 4CX9A 4DOZA 3L72E 3RQGA 3A2AA 1PCXA 3U9MA 1N1CA 3RK3E 1FZGA 2PAJA 3WMM0 3HNJA 1LTSC 4MVZA 4E18A 3BATA 1OIPA 2XLDA 2B89A 3K1HA 3HNLA 1NTZD 2BE5F 3EG9A 2C03A 5TJ5E 2MWQA 1T9KA 4KNVA 1SF8A 2W9YA 3G50A 4N6JA 1LS4A 1RH5B 2AXTH 3W8HA 5L0CA 1NAFA 1QL1A 5KLVK 3RBZA 1J1EC 1QKRA 1SQQE 1JAFA 2A1DD 2AXTE 4C7RA 1PL5A 2ZXXA 1S5LX 1JY3P 1RF0C 3PRJA 1FJPA 3RVZA 1L4AB 1SQBD 2E5YA 1SQPK 1SQXK 2HODB 4YXWH 3LESA 1JPNA 4Q7CA 1K9MQ 3L74D 4MTOA 2X51A 2IPPA 1YAUO 3RF3A 1S05A 2IXMA 1KQGB 1CGNA 2Q3TA 3IAOA 1NTMK 1C02A 1Q2NA 3EFFK 4W8KA 1NH4A 1GMJA 1P84H 1NG1A 3T97A 2BEZF 1YJNP 3AEBC 2J5UA 2RN0A 1JR8A 1YLMA 2GDCA 3RIPA 2YO2A 4BJTA 1RKEA 1I4ZA 2I1KA 4OGQB 1BR2A 2R7RA 4D4XA 2QEXP 1TWHA 1S9KD 3GEHA 4I1MA 2HFIA 1URQA 1S5LH 1RJ9A 2O1JA 1N73B 3NYLA 1LE2A 1EI7A 3I56P 4PJMA 3O8ZA 3H1IJ 1TFKB 4KI2A 4PR9A 3SWFA 2Q9AA 4H44B 2WWWA 1Z6AA 3ZC4A 2YHSA 3POVA 2XM0A 3H1LD 1OX3A 4D6TG 4RKUJ 2WB7A 3AE2C 1NTME 1XTCC 4I44A 1T5OA 2RMZA 1WT6A 1VQ5P 1JO5A 2WPQA 2XS8A 1BE3D 3DAGA 2Q1KA 2LFDA 3FDQA 3DE9A 4IRUA 3S28A 1HMDA 3II6A 2KJGA 1MZ9A 1MUUA 4F4BA 2BL2A 3MFNA 2OG2A 4YT2A 4CSAA 2OTKE 2QM8A 3AGTA 2TMVP 4ZKPA 1R5SA 1KORA 1M2VA 5CCGC 5JSLA 1KQFB 3N24A 4FWVA 2M0BA 1L4AC 1LI5A 1UIXA 2E76D 3BCCG 2Q9IA 2QNLA 4U5CE 1HE9A 1LT9A 5AW5B 4OINF 5EFWB 4YL1A 4P6IC 1AJYA 2A06G 1HMOA 3VMYA 3KHUA 2KI7B 5CJ4A 2DYRC 2ASRA 4MTFA 3C8GA 3ZTMA 3IN6A 1OFCX 1PV3A 3WU2H 1CI6A 3WUTA 1DOVA 5DS4A 1YITP 3DWWA 5DVWA 2AWCA 3KL4A 3JYYA 2EPKX 3CMAP 3M91A 3F5HA 3NDBB 5KLVD 1FMWA 3K5BA 4E0IA 1P84D 5AW4B 4OGQC 1RXQA 5BU8B 3TGUD 2KYVA 2HKVA 3SXZA 3NXSA 3JCUQ 5CCGD 1LT1A 1N73C 1NYHA 2Q3IA 4NTFA 4I1LA 4IB4A 2WQYC 1SQXD 1OCOC 3LEOA 4H4KC 3CZ6A 5L3VA 4R4LA 4H44C 4K3AA 1NTZJ 2KNCB 1EC5A 1O3UA 3KMIA 3DZAA 1FDOA 5B66H 4DZOA 2VCBA 1TR2A 5BQGA 1Q86Q 2QM7A 1YHQP 2OARA 1G8XA 1KB9D 1NFOA 4N4WA 1S4XA 2BASA 3JRMO 1FOSF 4DRIB 1NO4A 2LFFA 1H0TA 1SQBJ 3IR9A 3UGOA 4JF7A 2ZYDA 1OXKA 3DKAA 2V4HA 4XQ1A 3L74J 3M4CA 1LTAC 3H1HE 3RK2B 2XLVA 5AVRB 1GZLA 4H44D 5B3IA 3U5SA 1S3JA 2N9BA 3GHGA 2QG4A 1D0XA 2YLGA 4DBQA 4WABA 1ZP0C 5FCLA 3KYQA 3O10A 3ATPA 1ZOYC 2R3CA 1G2CB 3AECC 2O01N 1X8YA 1GQAA 1ZW0A 1YQ3C 2P1JA 2WSCH 5L0HA 3EZIA 3EGXA 3EQLF 3FHDA 4WY4B 4PD4E 4OIRF 3CXHH 3OWTA 1L0NG 1N7SB 2XZRA 3CMEP 3RYLA 3JTLO 2HV6A 2FYUG 3CXHE 5CBOA 1S72P 2WSSH 2YQYA 3T6BA 3H1LJ 3ABMC 4PD4I 4UDVA 4OIOF 2RKLA 3CWBE 5DS5A 4PFPA 4EWCA 3G6EP 1BE3J 5H2FH 1IFNA 2R7OA 1XTGB 3G71P 2B9BA 3RL0B 1BGYG 3AE3C 1M57C 5H2FE 4L75A 1RY3A 1Q0KA 1VQLP 1YIJP 1VQ9P 2A6HF 1AQTA 5AW8B 3VTPC 3H2UA 1MQVA 1CSBA 3IEEA 4C7OB 2MYSA 4L76A 1KFMA 2BCCD 2WSEH 2P6VA 3AE9C 4W8PA 2JJLA 3L73D 3O55A 2YIUB 2QTVA 1M1JB 1W2BO 1HUCA 5KYUB 1LNQA 2WPRA 3EWKA 3VN0A 2L81A 2HMQA 1ZYRF 4JRZA 1PPJG 5CMZA 1JB0J 5E2QA 1H7IA 2C9LY 4XLPF 5KYXB 5KLVJ 2K9YA 1RE3C 1JY2O 2D5RB 5AC4A 1J1DB 3S1KA 1LS1A 3RBXA 3D71A 4WJ0A 2NSGA 3TGUJ 3FAJA 4WY4C 4EUKB 3JCUH 1VYKA 3EFOA 1NU9C 4LDRA 3C7JA 1SQXJ 3A0BE 1OXZA 1N7SC 1YTZT 2ZXOA 2R3SA 1LM3B 1VQ8P 3EGDA 3FX0A 1EZVE 3I55P 3WAQA 3RK2D 1NKZB 2FYNB 1ZR2A 2GA1A 4ANJA 3L72G 3EZHA 4YL0A 1Z56A 2Z15A 5AVXB 3LLKA 3DE8A 3G4SP 1EZVI 3RL0C 3HLZA 1NLXA 3BASA 1X22A 4BWNA 2YVKA 1GL2A 1R5LA 3U8PA 1JY2P 3KYIA 4XWJA 4AQRD 3PHF2 1BCCE 4QI0A 3LW5J 3H1JE 4U7JA 4NC3A 1N7SD 4GT1A 1RQUA 1SQQG 2K37A 5AVSB 3S9OA 5L0IA 2YIUC 4LACB 3HD7A 1M1JC 5KYNA 2WT7A 1LP1B 2B0JA 1K73Q 1NU7D 1OVUA 2K9JA 4EYYQ 1DOWA 1DX7A 3SWYA 3SSUA 5GTIE 2R7QA 4U5HA 2WPVB 3LIDA 1VQPP 1B68A 5IY5C 3MGNA 1JMMA 3RL0D 1WATA 2G3AA 2PP6A 1J1DC 5F5FA 1QVXA 3PH0A 3NMJA 4LDQA 2HMZA 4QDLA 4E17A 2AU5A 3K66A 3FWLA 2W4MA 1NOHA 3B8EB 3T97B 1NU1D 5COFA 4N78E 3F46A 3FOOA 1IJDB 3SXKA 4ULWA 3B5NA 4O9BA 3IFMA 1RKEB 4W7YA 3C9IA 4O6NA 1JCCA 3H1KD 1Q0MA 4AE4A 1URQB 5COGA 2XLOA 1RJ9B 3V5BA 3MHVA 4X0RA 1YYJA 4D6TD 2D2CB 2FYNC 4GOFA 1NWQA 2YKZA 3E1RA 2P67A 1MKMA 1XZPA 3GORA 2YXRB 3AG2C 1T3UA 2H7HA 4C46A 4MVRA 1RCPA 3A11A 5APWA 1ZXGA 2BCCJ 1MNEA 3U2LA 1Y6DA 4WGYA 2IFNA 5A6KA 4YJWA 4W80A 5A6JA 4IFMA 1AQ5A 2J9UA 3CEXA 1L0NK 4U5EE 1E85A 2FYUK 2XLEA 2CNWD 1QEXA 1U57A 3BCCD 2QJYC 3V2RA 3B0VC 1M2VB 3LS0A 4WBAA 3B9QA 4C3EA 4PJLA 4U5GA 2Q5UA 3L71E 1I4YA 2A06D 2OU6A 3TULA 4O6YA 1FTSA 1CPRA 1A02F 3W8IA 1LT9B 4YN0B 4WGZA 3RGUA 3O6QA 1BDCA 4MVMA 2ZVNB 4KC9A 4MVUA 3UNGC 2R7XA 1HGZA 1OWAA 3C8GB 1M1KQ 2FYZA 2Y9YA 2J46A 4Y28J 4BJ5A 1LTBC 2D4UA 4ASWA 5KAFH 1N7SA 3KH2A 3M15A 1AVYA 4YL3A 2LSEA 2ZT9B 3VF0A 2R7WA 5KAFE 1GD2E 4DVZA 2NPUA 1FDMA 1M8OB 1BDJB 2F22A 3LJBA 1H8AA 1TWAA 1URQC 4JQ0D 2WVRA 1OVVA 3LNRA 3C63A 1H89A 2GFHA 1ORSC 2JD3A 1NBBA 5BVZA 3QZCA 1WTYA 3TOMA 3PP5A 1D1BA 2NPSA 1LGHB 5APTA 2XKMA 1KD1Q 1IK9A 1PD0A 5JLIA 1X0TA 5T3WA 2HJMA 4IL6X 1HJ0A 1BSHA 4JW1A 2R9RB 3NMDA 3DXJF 2LK4A 1IFIA 2Y0DA 2HYNA 4LERA 2E75D 5COMA 2J0XA 2DI3A 1S7ZA 5KYUA 4CSAC 1H0TB 2HJ3A 3AGUA 4HB1A 2J9WA 1YJ9P 1URQD 1OXBA 4TLFA 5L0FA 2D2CD 1V4AA 4CIHA 3GEIA 2EIMC 2KK1A 1UG7A 3H1HG 3P8MC 1G4WR 1LT9C 1MMNA 3K1IA 3QVZA 3C8ZA 4I3MA 5KLIB 3QH9A 1RQVA 3GHGB 1JTHA 4IL6H 5TISH 1IO4A 5KYYA 1DH3A 4EOTA 3T4RA 4XE5B 2AEMA 4DCKA 1LTTC 1NU1J 2VCAA 2N9YB 5TISE 1BR1A 3AEAC 3GANA 2CNWA 3GW6A 1L0ND 1KILE 1FS0E 2OQMA 5DQTA 3EGXB 5F5HA 2FYUD 1SQQK 1KYOD 3H1KJ 3K7DA 3LNMB 1FNTc 1NGMB 4D6TJ 4BPMA 3UGPA 4I7ZB 3VOPA 4ZKUA 2E76B 2C04A 4CS8C 2WZ7A 1QZXA 1LI7A 4IJJA 4XFJA 5EHHA 4JCZA 5L0JA 2LXBA 5KJ7A 1EA8A 2ZJSE 2WSFH 2DB4A 5BUOA 1IC2A 1BGYD 2XL4A 4XPWA 5EGYA 3CWBG 1S9KE 5B5EH 3C8VA 3JT1A 3IQ5A 4I6MC 3KYJA 5B5EE 3C8GD 2W90A 3ZVRA 5L3QA 3CLQA 2J45A 3BCCJ 5TJHA 3NTNA 5L0GA 2KSFA 2ZT9D 2JDIH 3AE6C 2LD6A 1QQ3A 1LP1A 3GM1A 1PGQA 1FJKA 2IBZD 3IF4A 3HNIA 2R5BA 1ZLLA 2LIGA 1JOCA 2HPCB 1LKXA 1RMVA 1PPJD 4C7NB 4CDAA 2M64A 3EQ2A 1PD1A 3SXYA 2P58A 1GDTA 2L6FA 4K7BA 2W4BA 5KLIC 4C3DA 3GHGC 2E42A 3DM9B 2L9JA 4ER9A 2C0XA 3KPHA 3GG2A 3HNKA 4IAQA 3CCUP 3HKKA 1W5CE 2KSEA 1Q0FA 4MVQA 3Q6MA 3EFOB 3EHNA 1GW3A 4I7ZC 4K35A 3AG3C 3GWLA 2E76C 1LTGC 2NZ2A 1LE4A 2IYLD 2PP4A 4LGDE 2QJPB 2FBWC 5T1DB 3ZQYA 3EGDB 4LLEA 4JYBA 1EZVG 2I8BA 4JJGA 3RK3D 2YEVA 4HFFB 2POHA 3PJSK 5JRAA 1NTKG 4YWQA 1SLQA 3H2VA 4HE8D 1LIHA 1VB5A 3S0XA 1J2JB 1A7VA 4FESA 2LKMA 3MYFA 1D1AA 2FFHA 2QJKB 4Y99B 1YBKA 1HVVA 2KSJA 1EKYA 1V54C 1FR0A 1VMAA 3FVYA 3ZQVA 1GL2B 2ITAA 1OCCC 2EPOA 3L8IA 1R5ID 3CCEP 3P8CE 1BCCG 3V4QA 3MP7B 3MZWB 4U3FD 1GW4A 4UB6H 3H1JG 4JYCA 4OWFA 3S27A 3IQTA 2XNXA 1KB9E 4MN4C 3HD7B 1OW7A 4UB6E 5K0IA 2WT7B 1AA0A 2L7AA 2YXQB 2QSIA 2KUBA 2K9JB 4GOEA 1MNDA 1KB9I 4LLHA 1L0NJ 1N7LA 2OYIA 1A41A 2M4EA 2FYUJ 1T6IA 3VP9A 2KNHA 2VCCA 3NKDA 3VMAA 1KQLA 1SQVE 5D91A 2B0HA 2O01H 2KIKA 4Z9HA 5B1AC 1FMVA 1L0LE 3SYNA 1GU4A 2PFDA 1TWGA 3BRJA 3E7KA 5AW9B 4G7ZF 1Y47A 2UWJE 4CS8A 3W2VA 3E9VA 3QMKA 3U9JA 4EKWA 3B5NB 2J9VA 1SQPD 2IXNA 1VPCA 3TK1A 2QJPC 2Y69C 2FXOA 3M0DC 5AGFA 2QUPA 1BGYJ 3BRVB 3EHMA 4AE4B 3CC2P 3CCLP 1DEEG 1FZFA 1PFIA 2YZSA 3FAPB 4IARA 3U3FA 3HE4B 3AQBA 2V7QJ 5L0DA 1NTMD 1ORYA 1L3PA 4LLCA 3M9BA 2ZXEB 2QJKC 4Y99C 3L75E 1JMWA 1KILA 1PGOA 4WB4A 4JPZB 1ZRTE 1GL2C 3F89A 2W6AA 1WGWA 2Y0EA 2H89C 2XL8A 3H1IG 1DD4A 3M4BA 4E0HA 1ZHYA 1JEKA 1N8RQ 2P1AA 4XA4A 1KZUB 3HD7C 2QRXA 2WITA 3B71A 1JUNA 1ZU5A 1YTZI 1EQ7A 3CSKA 3AE1C 3IQ6A 1HTLC 1VL2A 2DW3A 3L71G 3AOUA 2BCCE 4OD4A 4RDAA 1WN0A 4CDVA 3MIWA 4EHPA 1USEA 1LTIC 2Q00A 3H6PA 3AEDC 4PD4H 3O6QB 2JX0A 2J7PD 1E83A 3FGAD 1YZAA 2HLOA 1YVIA 2N1TA 1GL2D 3O39A 1Z63A 1KFNA 1IK7A 3KXDA 2NUPA 4EBBA 4PJJA 3US6A 1T6AA 2WZGA 1K8AQ 1ZMEC 2FAPB 4N6CA 1E84A 3OA1A 3CC7P 3B5NC 1FZAA 3B4SA 2QY9A 4KBLA 3HD7D 4ASVA 2Q6QA 3N7NA 2XSEA 1R8EA 1Y4CA 5A6BA 4JURI 5A6AA 3RW0A 3AE4C 3EFGA 1RHZB 5CI9A 1V74B 3QW1A 2A45I 2KZJA 2NPSB 3PHLA 3DM5A 5BQIA 2ZYAA 4JIOA 4JVSA 2XLMA 2NUTA 2RH0A 2SPZA 4G7OF 4U3FJ 2JO1A 3MUDA 2HZ8A 3DJNB 2PBEA 1PP9E 2Q7CA 3G3ZA 2HPCA 1WASA 2ZXWC 1NFNA 4C7NA 3OJAB 3B5ND 1OCZC 3JZ0A 5FZTA 3Q1MA 1IZMA 3TYYA 2OTLP 3RK2C 2KGOA 3H1HD 2CDQA 3I4UA 3ABVC 4P9FA 3ZTZA 5AW2B 3UMKA 1NTKK 3L70D 5KAIE 1L2PA 2EIKC 2YLIA 3JC22 2EPLX 2YMYA 4R32A 4BJ6A 3ZDMA 3OW2O 1W2EA 4NPFX 1OR3A 1SFCA 2HUJA 1JTHB 4CJGA 3CX5E 5KYYB 1YARO 3KQGA 1VQOP 3A0BH 1FAVA 1SQBG 2Z5IA 3HJCA 4PD4D 3V6IA 2FKWB 4BJ5C 3RL0g 1SQPJ 1KC8Q 2CW0F 3ASNC 1K40A 1OCRC 3K33A 2EIJC 5AVZB 3M0DA 4CIPA 4EIJA 3CXHD 5E3CA 3WUUA 3CX5I 3WHNA 4N06A 4I2LC 3G4XA 4YT4A 3RQFA 4L6RA 1SS1A 2KLVA 1NTKE 1EXIA 1NTMJ 1NJIQ 1VDFA 3TNUB 1NU1E 1QGKB 2OJQA 1E5WA 2CYDA 1MMDA 4DXWA 2W6BA 1EQ1A 2H43A 2M3EA 2PNOA 2NRGA 1KMIZ 4DT0A 1JY3N 3RKOF 1CW5A 2J7PA 2KB7P 2NPSC 5GTHH 4CS9A 3H1KE 2Q4FA 2H7BA 3CPWO 1USDA 3NYMA 5T3TA 5GTHE 4NQFA 5AW1B 5C39A 4KHXA 4GKGA 1OW8A 2CPBA 3IPMO 2WVOA 4CPGA 2XS1A 3KZIH 2KLUA 1Z3IX 5JT4A 5GTIH 2QA4P 2WVQA 3KZIE 4CBEA 1GM5A 3V2NA 2OYHA 1WOLA 2Y0CA 1FAPB 1PGPA 3GODA 2J0WA 2WMMA 5E79E 3NMIA 4HFKB 4PFOA 3SNHA 3K1IC 3FOPA 1HF9A 3VMXA 2NPSD 3QWOC 3D6ZA 1NKNA 2WVNA 3JSZA 1FFTC 2IZ0A 2W83C 5CCHA 3LS1A 4DRJB 2E75B 1YI2P 3OAKA 4PJ0E 2YKPA 3NFQA 1FU1A 1L7CA 3DJUB 2YMKA 2IXPA 1HW1A 3HE4A 2C0WA 3NG1A 5AW0B 3U8VA 3B29A 1VLTA 3L34A 3M06A 5KJ7C 4J7YA 4XEFA 1LVKA 4BRYA 2M5AB 1X9VA 2IXOA 4JKVA 2AXCA 2G8YA 2P2UA 3WUVA 1JPJA 2OQQA 3PLNA 4D4NA 3NKEA 2IDBA 2IYOA 1RKCA 4PV1B 3UMIA 3L73J 3H1IE 1G1IA 1BCCD 1T2KC 1YYXA 1DIPA 2YKOA 4ZMDA 1FDIA 3H1JD 1E86A 4H13B 2W8ZA 3H1HJ 3L35A 1D1CA 1BZ4A 1OMIA 3HE5B 2RSEB 3L70J 3I5QA 3HUSA 2AWYA 1A0BA 2JEEA 1TFOB 1VQ6P 3B0UX 4E7SA 2KXPB 2KZIA 1SZIA 3AE5C 4JBZA 1NZEA 4KJMA 3S29A 5HV9A 1HH0A 5KJ7D 3TDKA 2Q3EA 1LJ2A 4YT5A 2ZXPA 5DQZA 3CCRP 3CCVP 1FFHA 3JRTA 4YTPC 2WSCJ 4CJOA 1D0ZA 4RESB 2E75C 2OYIB 2R44A 3V5YA 2R7SA 3AE8C 3H25A 3EJNA 4N78D 1T2KD 1EDKA 1C17M 1T6UA 1TWCA 1SQVG 2OGUA 1T8ZA 3AEFC 1Q0GA 1M56D 1QX8A 1Y8AA 3NRHA 2Z4EA 1L0LG 2XV5A 1M90Q 5B1BC 3BEHA
chains in the Genus database with same CATH topology
1VF5D 2FYNC 1S1CX 2D2CC 3D71A 3D6ZA 2PBEA 1WMKA 1Q90D 1MKMA 3U3FA 4Z1MH 4RKUJ 3U0CA 5L8RJ 3AE2C 3C18A 3GM2A 2V7QJ 2WSFJ 2E74B 2H88C 3JZ0A 2E75B 3Q1MA 3G9RA 4YXDC 2YWAA 4H44D 1VF5B 2D2CD 1YQ4C 4H0LC 1V4AA 3ABVC 4TT3H 2KK1A 2QJKC 2FXPA 3GF3A 5F28E 2HSBA 1ZP0C 4I7ZC 4PV1C 1ZRTE 3MFNA 2E76C 3O10A 3GMAA 1ZOYC 2E74D 2NZ2A 1RQVA 3RQGA 4R32A 2YMKA 3Q5PA 2FBWC 3RK3E 3AECC 3Q3DA 1KORA 4KT0J 2WSEJ 1KTMA 1YQ3C 2H89C 3GF7A 4H13C 3GLMA 1OW6A 1U57A 1KQFB 3AEGC 3AJMA 1K04A 1DD4A 3AEAC 2QJYC 1UIXA 2E76D 1KILE 3R4YA 4XEFA 2MKVA 3K7DA 3RL0g 4XEVA 3B71A 3TULA 4R4MA 4H0LB 3SFDC 2O01J 3L8JA 2G8YA 1Y9BA 1K40A 3AE1C 1NGMB 1AJYA 2OQQA 1VL2A 4I7ZB 2IDBA 1JOGA 4PV1B 1KNYA 2E76B 3C8GA 3O6QA 3IN6A 4EBJA 1PV3A 3LW5J 1PL5A 2Q00A 2BEQD 4U7JA 4XFJA 3L8IA 3RQFA 3AEDC 1DIPA 3C8GB 1EXIA 4H0LD 1RQUA 1FDIA 3JYYA 2JX0A 4H13B 3S9OA 1S5LX 2YIUC 4Y28J 3FGAD 4PV1D 2JPUA 3C8VA 4OGQC 1OMIA 1KMIZ 3AE3C 1IK7A 1OW7A 2QIWA 3D6YA 2ZT9B 2ZT9C 3GM3A 4EBKA 3C8GD 2QSIA 1NYHA 4H13D 1KQGB 1PIXA 3AEEC 1K05A 1ZMEC 3Q2YA 2WPVB 2WQYC 3AE5C 3IAOA 4NQFA 1EXJA 5M1BA 4OGQD 4R4LA 2L6HA 2L6GA 4H44C 5KKZC 2G3AA 1GMJA 3AE9C 3SFEC 2BEZF 1QVXA 2ZT9D 3AEBC 1UFBA 1OW8A 3AE6C 1ZZPA 1O3UA 2J5UA 1WTYA 3Q5SA 1FDOA 2JP3A 1R8EA 3GM1A 4YTPC 2WSCJ 3T97B 2E74C 3AE4C 2E75C 4OGQB 3RQEA 2P10A 3AE8C 3EWKA 4IL6X 1HJ0A 1VF5C 3H25A 1DD3A 1TU3F 2LK4A 3BRJA 3Q5RA 1WOLA 3AEFC 3D70A 3AE7C 4XEKA 1JB0J 1WWPA 2L6FA 5KLIC 2E75D 2QJPC 4GDOA 2K9YA 2JO1A 4H44B 1HF9A 2D2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  3U3F A;  3U0C A;  3AE2 C;  3C18 A;  3GM2 A;  2H88 C;  3JZ0 A;  4YXD C;  2YWA A;  1YQ4 C;  1V4A A;  3ABV C;  2KK1 A;  5F28 E;  2HSB A;  1ZP0 C;  3MFN A;  3O10 A;  1ZOY C;  3RQG A;  4R32 A;  2FBW C;  3AEC C;  1KTM A;  1YQ3 C;  2H89 C;  1OW6 A;  3AJM A;  3AEG C;  1K04 A;  3AEA C;  4XEF A;  3K7D A;  4XEV A;  3B71 A;  3TUL A;  3SFD C;  3L8J A;  1K40 A;  3AE1 C;  1JOG A;  1KNY A;  3C8G A;  4EBJ A;  1PV3 A;  2Q00 A;  3RQF A;  3L8I A;  3AED C;  3C8G B;  3JYY A;  2JX0 A;  3S9O A;  2JPU A;  3AE3 C;  1OW7 A;  3GM3 A;  4EBK A;  3C8G D;  3AEE C;  1K05 A;  2WQY C;  3AE5 C;  4NQF A;  2L6H A;  2L6G A;  2G3A A;  3AE9 C;  3SFE C;  1QVX A;  1UFB A;  3AEB C;  1OW8 A;  3AE6 C;  1ZZP A;  1O3U A;  1WTY A;  3GM1 A;  4YTP C;  3AE4 C;  3RQE A;  3AE8 C;  2LK4 A;  3BRJ A;  1WOL A;  3AEF C;  3AE7 C;  4XEK A;  1WWP A;  2L6F A; 
#chains in the Genus database with same CATH topology
 1VF5 D;  2D2C C;  3USS A;  1QVG O;  3C62 A;  1WMK A;  4DJG A;  4NPD A;  3LEV A;  3SEO A;  2KK7 A;  1KYO E;  2W6J H;  2H88 C;  2OEV A;  2L5G B;  2R03 A;  2KC3 A;  2OKU A;  2WL8 A;  3W67 A;  3IHU A;  4HEA J;  3BVH A;  4GYT A;  3WOD F;  1SQB K;  3TOL A;  4PV1 C;  4RD9 A;  3L75 G;  1KIL B;  1KYO I;  2UUI A;  1BDD A;  3U3B A;  2RD9 A;  2WSE J;  2FFD A;  3W2W A;  1KTM A;  1U7J A;  2IFM A;  2LR2 A;  3N4X A;  4H13 C;  1M6T A;  2PX3 A;  2OCC C;  1K04 A;  1NTZ E;  1BSN A;  4A7P A;  1EDJ A;  3AG1 C;  5E3A A;  2Y3H A;  2YO3 A;  1Q7Y Q;  3JSE O;  2CCY A;  1A7D A;  1LWU A;  3CD6 P;  1G4U S;  4XEV A;  4XPX A;  2NG1 A;  4H0L B;  3L71 D;  3T9O A;  3RK3 B;  1IZN B;  2CPS A;  5E33 A;  2XXA A;  4I1O B;  5CJ0 A;  2IZ1 A;  2K3R A;  3S4R A;  2BEQ D;  2BCC G;  2IBZ E;  1N2D C;  4GEH A;  4JTA B;  1RE4 A;  1SQB E;  2VB6 A;  1SVF A;  1HGV A;  5AC5 A;  2AP3 A;  4PV1 D;  2J59 M;  2OYI C;  3L74 E;  5AW6 B;  1D0Y A;  2Y9Z A;  1YDI A;  3Q7G A;  4U9E A;  3TJ6 A;  3VYI A;  2WZF A;  2QIW A;  1FZC A;  2ZT9 C;  2ZVO B;  2N1T B;  3HTK A;  4KNW A;  2O9X A;  4B6I A;  2IBZ I;  1PIX A;  4H13 D;  2NUP B;  1MV8 A;  4OIP F;  4WVZ A;  4O7G A;  5HSW A;  2W45 A;  2AEF A;  5DJT B;  3TNU A;  1Z7Q c;  2K1A A;  4IWB A;  1W2W A;  1WRG A;  3V5Z A;  1YJW P;  2A45 G;  5GPG B;  2QE7 H;  3L1M A;  2O1K A;  3ZWI A;  4JC7 A;  3L4F A;  3ITF A;  1AFO A;  4AL1 A;  1I5N A;  1Q81 Q;  1IFP A;  4AL0 A;  2QE9 A;  1HE1 A;  1HJB A;  1FZE A;  4XTK A;  2LCH A;  3H1J J;  3ZIB A;  1TQG A;  5APX A;  4GDO A;  5KYW A;  1KIL C;  3H1L E;  2NUT B;  4QI2 A;  4U9D A;  2P7V A;  2DGJ A;  1YA7 O;  3E1I A;  4OD5 A;  1BE3 E;  1FBM A;  1PP9 G;  3N0T A;  3X2Q C;  3JSV C;  1XZQ A;  2KS1 A;  2BC5 A;  1H6G A;  1GU5 A;  4H0L C;  1OQC A;  1ZHW A;  4J32 B;  3RK3 C;  1OKK D;  5F28 E;  2CK3 H;  2HV7 A;  3M9Q A;  3TK0 A;  4NPE A;  256B A;  1OZH A;  2ZD9 A;  2VAS A;  3GMA A;  2YL7 A;  2XRH A;  3Q5P A;  2C9N Y;  4NY3 A;  4U3F E;  5DS6 A;  2JWD A;  2I8D A;  5APS A;  1M7L A;  2E87 A;  1SFC B;  1GK4 A;  2NSF A;  3R4Y A;  1ORJ A;  1KIL D;  3V7O A;  3SFD C;  2GM4 A;  2A68 F;  3A9C A;  2N1T C;  3SWK A;  2Y3B A;  5BQH A;  2H7O A;  3LUT B;  2UUH A;  2VH3 A;  3NYJ A;  1KNY A;  1VK5 A;  1IFJ A;  1J8Y F;  1AUE A;  1JY2 N;  1E2X A;  3I5P A;  3PDM P;  3L72 D;  4RBN A;  2P7J A;  4PAC A;  2A69 F;  5KLV E;  4H0L D;  3F47 A;  1P84 E;  3L37 A;  2R7T A;  2Q9C A;  1SR2 A;  4MW3 A;  2M5A A;  3ECS A;  3LLI A;  3TGU E;  3MLG A;  1NU1 G;  3D6Y A;  3RFY A;  4O6M A;  3ZSU A;  1KN7 A;  4CS7 A;  2IX7 C;  4AYC A;  1SQP E;  5CHX A;  1VQK P;  1SQX E;  3FXH A;  3W4Y A;  1X79 B;  3AEE C;  1IW7 F;  1K05 A;  2EPN A;  3Q2Y A;  5JS5 A;  1S5L E;  1P84 I;  4PK4 A;  3DI5 A;  3H1K G;  3SZR A;  3A7O A;  1M2O A;  1SQQ D;  4NCQ A;  4A2N B;  1SQV K;  2IYP A;  3S90 A;  3SFE C;  3ZDL A;  5AW7 B;  1KB9 H;  2N1T D;  3MUD C;  3VP8 A;  1L0L K;  3H32 A;  3HE5 A;  2HFE D;  1IFM A;  3L71 J;  2J8W A;  1SP4 A;  2V26 A;  5APU A;  1DD3 A;  1ZW2 A;  4Z9I A;  4MW8 A;  3RVY A;  1SYQ A;  4EIY A;  3LW5 H;  2YNY A;  4IGG A;  1S2E A;  5B3S C;  2OYH B;  3MYI A;  3J06 A;  3EH2 A;  1EDL A;  3TD7 A;  5A6B D;  1ZHX A;  5AW3 B;  1Q90 D;  4BJ6 C;  4G78 A;  2OTJ P;  3VMZ A;  1H9G A;  1SFC C;  1FC2 C;  1VLS A;  5AVT B;  3DD7 A;  1JMB A;  1NVO A;  4YXD C;  4M3L A;  2YWA A;  1LPE A;  1VTM P;  3V2Q A;  2QLA A;  4MVS A;  4WWI A;  2XM4 A;  4HJG H;  4YT8 A;  1DEB A;  3V2P A;  1LTJ A;  3QW0 A;  4DVY P;  3VM6 A;  1O5H A;  1OKK A;  4P9T A;  2LP4 A;  1MFZ A;  3WU2 E;  2L91 A;  4L73 A;  1OW6 A;  4GQH A;  1U6H A;  4C3B A;  2XU6 A;  2CGE A;  3CCM P;  1T3J A;  1RF1 A;  4A4A A;  4GOD A;  1NAY A;  2P0N A;  1VQN P;  1ZVZ A;  1Q0D A;  2W27 A;  4BRY B;  1L4A D;  1JOG A;  2R7V A;  4CS9 C;  2P61 A;  4E7Z A;  1SFC D;  4MTG A;  2GUS A;  2JKV A;  2R05 A;  3QTH A;  3CCQ P;  4JE9 A;  1VQ7 P;  2ZYG A;  2K88 A;  3P8C D;  1TKN A;  2MHR A;  2B87 A;  4G7H F;  2Z5H A;  5B66 E;  5AVY B;  1U89 A;  4B86 A;  3ABK C;  4EBK A;  2YRF A;  4ULV A;  2GUV A;  3HUS B;  3G4Z A;  2M8R A;  2X0C A;  2OYH C;  4OGQ D;  3RH3 A;  5APY A;  2L6G A;  4XLN F;  1RF0 A;  3L73 E;  2ZXR A;  3ASO C;  4FAP B;  1UFB A;  3WG7 C;  1F1M A;  2G3K A;  3A0H H;  2KW3 C;  5AVU B;  1AVO A;  1SQV D;  5CCH C;  3CAX A;  3L70 E;  3ABL C;  1J8M F;  2IM8 A;  4K1O A;  4PJN A;  3V5X A;  5JP7 A;  2A45 H;  1D7M A;  1FZB A;  2M3B A;  1L0L D;  3A0H E;  5BU5 A;  3L72 J;  2KYH A;  3LIE A;  1YYC A;  1QPU A;  2R5D A;  1GGQ A;  1ZU4 A;  1HBW A;  2E43 A;  3MD0 A;  2JR8 A;  1VQ4 P;  3TJ5 A;  2OEX A;  3GM2 A;  2WSF J;  2E74 B;  2GA0 A;  3O6X A;  1YZC A;  4Q4Z F;  3I5C A;  4LC1 A;  3TF5 A;  2B88 A;  2FXP A;  1GTW A;  2HSB A;  3DAF A;  1SQQ J;  1SMY F;  3L75 D;  3DMD A;  1QLE C;  1ZRT D;  2LXC B;  4BEM J;  5CCH D;  1ZR4 A;  2Y3D A;  4KT0 J;  4NTB A;  2A6E F;  1JCD A;  3GLM A;  3AJM A;  3CXH I;  2OOC A;  2G3V A;  2FFD B;  5JVE A;  3PCV A;  3FXE A;  1H88 A;  4J7T A;  1QL2 A;  5KAI H;  5A69 A;  1NTZ G;  1PZQ A;  4AUW A;  4ZLC A;  4M63 A;  3SP1 A;  1LWU B;  3HUS C;  2QVA A;  2ZAE B;  1NU1 K;  5CCG A;  1JRA A;  4MVO A;  4IFF A;  5K5G B;  4DBR A;  3CX5 H;  3EH1 A;  1E79 H;  2VRS A;  1L4A A;  4AK9 A;  2XXA B;  3S84 A;  4U5F E;  1KU2 A;  2HOD A;  3CCJ P;  1G5Z A;  4MND A;  3CQZ A;  3M79 A;  3FMS A;  2IBZ G;  1VOM A;  1QLE D;  2XND H;  4HKZ H;  3MBG A;  4DJ9 A;  2KOG A;  4BG0 A;  3L74 G;  1VYI A;  1FZC B;  1T6Q A;  3FWN A;  1Z5Z A;  3EPV A;  5M1B A;  3HTK B;  3K6B A;  1U7M A;  4BJ1 A;  4OH8 B;  3U1A A;  2FGY A;  1M57 D;  1JM0 A;  3L0I A;  1R4T A;  2OJE D;  3PMR A;  1ZZP A;  3CWB D;  2A0B A;  2E74 C;  4O79 A;  2YKQ A;  1N73 A;  4JJF A;  2P10 A;  3JCU E;  2PFX A;  3D70 A;  3E70 C;  2Q7R A;  4J30 B;  2R32 A;  4EDF A;  5DJU B;  1HWT C;  2EIN C;  2J9B A;  4JEA A;  4D6T E;  2R25 A;  2LQG A;  5KKZ B;  1ZN5 A;  1ZHZ A;  4N6H A;  3VYW A;  1S1C X;  5KYW B;  3UMH A;  1PP9 D;  3L36 A;  3CCS P;  2H8A A;  2HR3 A;  3H1L G;  3R2P A;  3U59 A;  3AG4 C;  1A7E A;  2FFD C;  1XWJ A;  3SXM A;  3T6J A;  3CL3 D;  1VF5 B;  1YQ4 C;  5E79 H;  3EG9 B;  1A02 J;  4TT3 H;  3TQO A;  1BE3 G;  2XLW A;  4YK5 A;  2KS1 B;  1LWU C;  2YL1 A;  2KP8 A;  3IQC A;  4WY4 D;  2E74 D;  4ZLD A;  3Q3D A;  3BCC E;  3OA7 A;  1CGM E;  1IFD A;  3UR3 C;  2QJY B;  1SQV J;  1HW2 A;  4PJ0 H;  5EK0 A;  4RO0 A;  4U3F G;  3CX5 D;  1GK6 A;  1RE4 C;  1L0L J;  2A06 E;  5AVV B;  1PGJ A;  1V55 C;  3A5T A;  1ZHT A;  2O01 J;  3MX3 A;  2WTY A;  1FZC C;  3A3Y B;  3B0P A;  4RJT A;  4BXL A;  3HTK C;  2E5T A;  3U1C A;  1EZV D;  4IFD K;  3R7C A;  3VRC A;  2WZL A;  5D92 A;  1HY5 A;  2I15 A;  5AVW B;  1YA9 A;  4DOJ A;  3KKB A;  1NTK D;  2H8P D;  3CC4 P;  2H7V C;  4CDY A;  4ONS A;  4W7Z A;  5KLV G;  2AVK A;  3GWN A;  4UB8 H;  2V3C C;  1Z23 A;  2YL0 A;  3L75 J;  2WPS A;  3KPE A;  4JTC B;  3GM3 A;  2ETS A;  2XL6 A;  1UII A;  3TGU G;  4UB8 E;  3CI9 A;  1MFT A;  4HYT B;  3UIA A;  2GAQ A;  2EPM X;  2KNC A;  3MTU E;  1CGO A;  4H54 A;  3C1L A;  1SQP G;  5KKZ C;  1SQX G;  3LAY A;  1QVF O;  4L74 A;  3BRT B;  4LDK A;  2R02 A;  3KDP B;  4GIF A;  3JYH A;  2FXM A;  2HSQ A;  1CPQ A;  2JP3 A;  1OVR A;  1M56 C;  3Q7L A;  1ZW3 A;  1YJG A;  1U0B B;  3H32 B;  1NTM G;  1FE6 A;  4QMA A;  4JTD B;  1VF5 C;  1TU3 F;  3Q5R A;  4IAO A;  5CIV A;  2PRR A;  5CBN A;  1WWP A;  2PX0 A;  1FOS E;  3VAY A;  1EDI A;  1ST6 A;  2KQ9 A;  4OIQ F;  4IOI H;  4FX5 A;  4Z9J A;  4DRH B;  2ZFC A;  4Z1M H;  5L8R J;  2HS5 A;  5KTB A;  3C18 A;  3M9H A;  4XPY A;  3H65 A;  1G1J A;  1VQM P;  2IBF A;  3V4W A;  3AQC A;  1NHL A;  3N2Z B;  2R7U A;  3GF3 A;  2EIL C;  5AVQ B;  1JNM A;  1RE3 A;  1O87 A;  1G2C A;  1ZV8 A;  4JCH A;  1NTZ K;  3CWB J;  2PF4 E;  1LTJ B;  4WY4 A;  1KYO H;  3GF7 A;  1CI6 B;  3P32 A;  4MQ9 F;  3AEG C;  1L0N E;  1CZQ A;  3HRN A;  2FYU E;  3TSI A;  4AX2 A;  1KQS O;  4U5D E;  2I1J A;  2MKV A;  4R4M A;  4EI2 A;  3NMK A;  3L8J A;  1Y9B A;  1RF1 B;  4Q5S F;  2G62 A;  2DYS C;  3M0A A;  3ZG1 A;  2O3J A;  3FXD A;  2Y39 A;  2JWA A;  4EBJ A;  1PP9 J;  2Y3G A;  1GS9 A;  3H1I D;  4N3Y B;  3GEE A;  2Q9B A;  1BGY E;  2V7Q H;  4G0H A;  2XLH A;  2YLD A;  4BEJ A;  1H9T A;  2JPU A;  3W68 A;  3PTZ A;  3U2M A;  1MMA A;  4HH2 A;  4C7O A;  5APQ A;  2B87 B;  1C03 A;  1APC A;  2VC9 A;  5CI8 A;  1BR4 A;  4JZA A;  3T6G B;  2J58 A;  5APV A;  1J1E B;  2FY8 A;  1EXJ A;  4K0D A;  2L6H A;  2IOQ A;  3OEO A;  1M1J A;  2ZPA A;  5DLJ A;  1T01 A;  3Q5S A;  1QSP A;  4OVN F;  3L73 G;  3Q6N A;  1PPJ E;  2PGD A;  1Q82 Q;  2MJZ A;  4ZNC A;  3RQE A;  4U5B E;  5JUA A;  1MMG A;  5KYX A;  3AE7 C;  1AVO B;  4XEK A;  3QVY A;  3L70 G;  2AEJ A;  1NTK J;  2XDJ A;  4MS2 A;  1LTJ C;  1KV4 A;  1AV1 A;  4IL6 E;  2YL3 A;  3M1C B;  3U0C A;  4JEB A;  1OR2 A;  3ITK A;  1AEP A;  1BBH A;  2HG5 D;  3G9R A;  1JY3 O;  2A0U A;  3X1O A;  2GWW A;  2OYO A;  1NSG B;  1N86 A;  1RF1 C;  2ICW G;  4NTA A;  1BCC J;  3P7K A;  4YPC A;  4CX9 A;  4DOZ A;  3L72 E;  3RQG A;  3A2A A;  1PCX A;  3U9M A;  1N1C A;  3RK3 E;  1FZG A;  2PAJ A;  3WMM 0;  3HNJ A;  1LTS C;  4MVZ A;  4E18 A;  3BAT A;  1OIP A;  2XLD A;  2B89 A;  3K1H A;  3HNL A;  1NTZ D;  2BE5 F;  3EG9 A;  2C03 A;  5TJ5 E;  2MWQ A;  1T9K A;  4KNV A;  1SF8 A;  2W9Y A;  3G50 A;  4N6J A;  1LS4 A;  1RH5 B;  2AXT H;  3W8H A;  5L0C A;  1NAF A;  1QL1 A;  5KLV K;  3RBZ A;  1J1E C;  1QKR A;  1SQQ E;  1JAF A;  2A1D D;  2AXT E;  4C7R A;  1PL5 A;  2ZXX A;  1S5L X;  1JY3 P;  1RF0 C;  3PRJ A;  1FJP A;  3RVZ A;  1L4A B;  1SQB D;  2E5Y A;  1SQP K;  1SQX K;  2HOD B;  4YXW H;  3LES A;  1JPN A;  4Q7C A;  1K9M Q;  3L74 D;  4MTO A;  2X51 A;  2IPP A;  1YAU O;  3RF3 A;  1S05 A;  2IXM A;  1KQG B;  1CGN A;  2Q3T A;  3IAO A;  1NTM K;  1C02 A;  1Q2N A;  3EFF K;  4W8K A;  1NH4 A;  1GMJ A;  1P84 H;  1NG1 A;  3T97 A;  2BEZ F;  1YJN P;  3AEB C;  2J5U A;  2RN0 A;  1JR8 A;  1YLM A;  2GDC A;  3RIP A;  2YO2 A;  4BJT A;  1RKE A;  1I4Z A;  2I1K A;  4OGQ B;  1BR2 A;  2R7R A;  4D4X A;  2QEX P;  1TWH A;  1S9K D;  3GEH A;  4I1M A;  2HFI A;  1URQ A;  1S5L H;  1RJ9 A;  2O1J A;  1N73 B;  3NYL A;  1LE2 A;  1EI7 A;  3I56 P;  4PJM A;  3O8Z A;  3H1I J;  1TFK B;  4KI2 A;  4PR9 A;  3SWF A;  2Q9A A;  4H44 B;  2WWW A;  1Z6A A;  3ZC4 A;  2YHS A;  3POV A;  2XM0 A;  3H1L D;  1OX3 A;  4D6T G;  4RKU J;  2WB7 A;  3AE2 C;  1NTM E;  1XTC C;  4I44 A;  1T5O A;  2RMZ A;  1WT6 A;  1VQ5 P;  1JO5 A;  2WPQ A;  2XS8 A;  1BE3 D;  3DAG A;  2Q1K A;  2LFD A;  3FDQ A;  3DE9 A;  4IRU A;  3S28 A;  1HMD A;  3II6 A;  2KJG A;  1MZ9 A;  1MUU A;  4F4B A;  2BL2 A;  3MFN A;  2OG2 A;  4YT2 A;  4CSA A;  2OTK E;  2QM8 A;  3AGT A;  2TMV P;  4ZKP A;  1R5S A;  1KOR A;  1M2V A;  5CCG C;  5JSL A;  1KQF B;  3N24 A;  4FWV A;  2M0B A;  1L4A C;  1LI5 A;  1UIX A;  2E76 D;  3BCC G;  2Q9I A;  2QNL A;  4U5C E;  1HE9 A;  1LT9 A;  5AW5 B;  4OIN F;  5EFW B;  4YL1 A;  4P6I C;  1AJY A;  2A06 G;  1HMO A;  3VMY A;  3KHU A;  2KI7 B;  5CJ4 A;  2DYR C;  2ASR A;  4MTF A;  3C8G A;  3ZTM A;  3IN6 A;  1OFC X;  1PV3 A;  3WU2 H;  1CI6 A;  3WUT A;  1DOV A;  5DS4 A;  1YIT P;  3DWW A;  5DVW A;  2AWC A;  3KL4 A;  3JYY A;  2EPK X;  3CMA P;  3M91 A;  3F5H A;  3NDB B;  5KLV D;  1FMW A;  3K5B A;  4E0I A;  1P84 D;  5AW4 B;  4OGQ C;  1RXQ A;  5BU8 B;  3TGU D;  2KYV A;  2HKV A;  3SXZ A;  3NXS A;  3JCU Q;  5CCG D;  1LT1 A;  1N73 C;  1NYH A;  2Q3I A;  4NTF A;  4I1L A;  4IB4 A;  2WQY C;  1SQX D;  1OCO C;  3LEO A;  4H4K C;  3CZ6 A;  5L3V A;  4R4L A;  4H44 C;  4K3A A;  1NTZ J;  2KNC B;  1EC5 A;  1O3U A;  3KMI A;  3DZA A;  1FDO A;  5B66 H;  4DZO A;  2VCB A;  1TR2 A;  5BQG A;  1Q86 Q;  2QM7 A;  1YHQ P;  2OAR A;  1G8X A;  1KB9 D;  1NFO A;  4N4W A;  1S4X A;  2BAS A;  3JRM O;  1FOS F;  4DRI B;  1NO4 A;  2LFF A;  1H0T A;  1SQB J;  3IR9 A;  3UGO A;  4JF7 A;  2ZYD A;  1OXK A;  3DKA A;  2V4H A;  4XQ1 A;  3L74 J;  3M4C A;  1LTA C;  3H1H E;  3RK2 B;  2XLV A;  5AVR B;  1GZL A;  4H44 D;  5B3I A;  3U5S A;  1S3J A;  2N9B A;  3GHG A;  2QG4 A;  1D0X A;  2YLG A;  4DBQ A;  4WAB A;  1ZP0 C;  5FCL A;  3KYQ A;  3O10 A;  3ATP A;  1ZOY C;  2R3C A;  1G2C B;  3AEC C;  2O01 N;  1X8Y A;  1GQA A;  1ZW0 A;  1YQ3 C;  2P1J A;  2WSC H;  5L0H A;  3EZI A;  3EGX A;  3EQL F;  3FHD A;  4WY4 B;  4PD4 E;  4OIR F;  3CXH H;  3OWT A;  1L0N G;  1N7S B;  2XZR A;  3CME P;  3RYL A;  3JTL O;  2HV6 A;  2FYU G;  3CXH E;  5CBO A;  1S72 P;  2WSS H;  2YQY A;  3T6B A;  3H1L J;  3ABM C;  4PD4 I;  4UDV A;  4OIO F;  2RKL A;  3CWB E;  5DS5 A;  4PFP A;  4EWC A;  3G6E P;  1BE3 J;  5H2F H;  1IFN A;  2R7O A;  1XTG B;  3G71 P;  2B9B A;  3RL0 B;  1BGY G;  3AE3 C;  1M57 C;  5H2F E;  4L75 A;  1RY3 A;  1Q0K A;  1VQL P;  1YIJ P;  1VQ9 P;  2A6H F;  1AQT A;  5AW8 B;  3VTP C;  3H2U A;  1MQV A;  1CSB A;  3IEE A;  4C7O B;  2MYS A;  4L76 A;  1KFM A;  2BCC D;  2WSE H;  2P6V A;  3AE9 C;  4W8P A;  2JJL A;  3L73 D;  3O55 A;  2YIU B;  2QTV A;  1M1J B;  1W2B O;  1HUC A;  5KYU B;  1LNQ A;  2WPR A;  3EWK A;  3VN0 A;  2L81 A;  2HMQ A;  1ZYR F;  4JRZ A;  1PPJ G;  5CMZ A;  1JB0 J;  5E2Q A;  1H7I A;  2C9L Y;  4XLP F;  5KYX B;  5KLV J;  2K9Y A;  1RE3 C;  1JY2 O;  2D5R B;  5AC4 A;  1J1D B;  3S1K A;  1LS1 A;  3RBX A;  3D71 A;  4WJ0 A;  2NSG A;  3TGU J;  3FAJ A;  4WY4 C;  4EUK B;  3JCU H;  1VYK A;  3EFO A;  1NU9 C;  4LDR A;  3C7J A;  1SQX J;  3A0B E;  1OXZ A;  1N7S C;  1YTZ T;  2ZXO A;  2R3S A;  1LM3 B;  1VQ8 P;  3EGD A;  3FX0 A;  1EZV E;  3I55 P;  3WAQ A;  3RK2 D;  1NKZ B;  2FYN B;  1ZR2 A;  2GA1 A;  4ANJ A;  3L72 G;  3EZH A;  4YL0 A;  1Z56 A;  2Z15 A;  5AVX B;  3LLK A;  3DE8 A;  3G4S P;  1EZV I;  3RL0 C;  3HLZ A;  1NLX A;  3BAS A;  1X22 A;  4BWN A;  2YVK A;  1GL2 A;  1R5L A;  3U8P A;  1JY2 P;  3KYI A;  4XWJ A;  4AQR D;  3PHF 2;  1BCC E;  4QI0 A;  3LW5 J;  3H1J E;  4U7J A;  4NC3 A;  1N7S D;  4GT1 A;  1RQU A;  1SQQ G;  2K37 A;  5AVS B;  3S9O A;  5L0I A;  2YIU C;  4LAC B;  3HD7 A;  1M1J C;  5KYN A;  2WT7 A;  1LP1 B;  2B0J A;  1K73 Q;  1NU7 D;  1OVU A;  2K9J A;  4EYY Q;  1DOW A;  1DX7 A;  3SWY A;  3SSU A;  5GTI E;  2R7Q A;  4U5H A;  2WPV B;  3LID A;  1VQP P;  1B68 A;  5IY5 C;  3MGN A;  1JMM A;  3RL0 D;  1WAT A;  2G3A A;  2PP6 A;  1J1D C;  5F5F A;  1QVX A;  3PH0 A;  3NMJ A;  4LDQ A;  2HMZ A;  4QDL A;  4E17 A;  2AU5 A;  3K66 A;  3FWL A;  2W4M A;  1NOH A;  3B8E B;  3T97 B;  1NU1 D;  5COF A;  4N78 E;  3F46 A;  3FOO A;  1IJD B;  3SXK A;  4ULW A;  3B5N A;  4O9B A;  3IFM A;  1RKE B;  4W7Y A;  3C9I A;  4O6N A;  1JCC A;  3H1K D;  1Q0M A;  4AE4 A;  1URQ B;  5COG A;  2XLO A;  1RJ9 B;  3V5B A;  3MHV A;  4X0R A;  1YYJ A;  4D6T D;  2D2C B;  2FYN C;  4GOF A;  1NWQ A;  2YKZ A;  3E1R A;  2P67 A;  1MKM A;  1XZP A;  3GOR A;  2YXR B;  3AG2 C;  1T3U A;  2H7H A;  4C46 A;  4MVR A;  1RCP A;  3A11 A;  5APW A;  1ZXG A;  2BCC J;  1MNE A;  3U2L A;  1Y6D A;  4WGY A;  2IFN A;  5A6K A;  4YJW A;  4W80 A;  5A6J A;  4IFM A;  1AQ5 A;  2J9U A;  3CEX A;  1L0N K;  4U5E E;  1E85 A;  2FYU K;  2XLE A;  2CNW D;  1QEX A;  1U57 A;  3BCC D;  2QJY C;  3V2R A;  3B0V C;  1M2V B;  3LS0 A;  4WBA A;  3B9Q A;  4C3E A;  4PJL A;  4U5G A;  2Q5U A;  3L71 E;  1I4Y A;  2A06 D;  2OU6 A;  3TUL A;  4O6Y A;  1FTS A;  1CPR A;  1A02 F;  3W8I A;  1LT9 B;  4YN0 B;  4WGZ A;  3RGU A;  3O6Q A;  1BDC A;  4MVM A;  2ZVN B;  4KC9 A;  4MVU A;  3UNG C;  2R7X A;  1HGZ A;  1OWA A;  3C8G B;  1M1K Q;  2FYZ A;  2Y9Y A;  2J46 A;  4Y28 J;  4BJ5 A;  1LTB C;  2D4U A;  4ASW A;  5KAF H;  1N7S A;  3KH2 A;  3M15 A;  1AVY A;  4YL3 A;  2LSE A;  2ZT9 B;  3VF0 A;  2R7W A;  5KAF E;  1GD2 E;  4DVZ A;  2NPU A;  1FDM A;  1M8O B;  1BDJ B;  2F22 A;  3LJB A;  1H8A A;  1TWA A;  1URQ C;  4JQ0 D;  2WVR A;  1OVV A;  3LNR A;  3C63 A;  1H89 A;  2GFH A;  1ORS C;  2JD3 A;  1NBB A;  5BVZ A;  3QZC A;  1WTY A;  3TOM A;  3PP5 A;  1D1B A;  2NPS A;  1LGH B;  5APT A;  2XKM A;  1KD1 Q;  1IK9 A;  1PD0 A;  5JLI A;  1X0T A;  5T3W A;  2HJM A;  4IL6 X;  1HJ0 A;  1BSH A;  4JW1 A;  2R9R B;  3NMD A;  3DXJ F;  2LK4 A;  1IFI A;  2Y0D A;  2HYN A;  4LER A;  2E75 D;  5COM A;  2J0X A;  2DI3 A;  1S7Z A;  5KYU A;  4CSA C;  1H0T B;  2HJ3 A;  3AGU A;  4HB1 A;  2J9W A;  1YJ9 P;  1URQ D;  1OXB A;  4TLF A;  5L0F A;  2D2C D;  1V4A A;  4CIH A;  3GEI A;  2EIM C;  2KK1 A;  1UG7 A;  3H1H G;  3P8M C;  1G4W R;  1LT9 C;  1MMN A;  3K1I A;  3QVZ A;  3C8Z A;  4I3M A;  5KLI B;  3QH9 A;  1RQV A;  3GHG B;  1JTH A;  4IL6 H;  5TIS H;  1IO4 A;  5KYY A;  1DH3 A;  4EOT A;  3T4R A;  4XE5 B;  2AEM A;  4DCK A;  1LTT C;  1NU1 J;  2VCA A;  2N9Y B;  5TIS E;  1BR1 A;  3AEA C;  3GAN A;  2CNW A;  3GW6 A;  1L0N D;  1KIL E;  1FS0 E;  2OQM A;  5DQT A;  3EGX B;  5F5H A;  2FYU D;  1SQQ K;  1KYO D;  3H1K J;  3K7D A;  3LNM B;  1FNT c;  1NGM B;  4D6T J;  4BPM A;  3UGP A;  4I7Z B;  3VOP A;  4ZKU A;  2E76 B;  2C04 A;  4CS8 C;  2WZ7 A;  1QZX A;  1LI7 A;  4IJJ A;  4XFJ A;  5EHH A;  4JCZ A;  5L0J A;  2LXB A;  5KJ7 A;  1EA8 A;  2ZJS E;  2WSF H;  2DB4 A;  5BUO A;  1IC2 A;  1BGY D;  2XL4 A;  4XPW A;  5EGY A;  3CWB G;  1S9K E;  5B5E H;  3C8V A;  3JT1 A;  3IQ5 A;  4I6M C;  3KYJ A;  5B5E E;  3C8G D;  2W90 A;  3ZVR A;  5L3Q A;  3CLQ A;  2J45 A;  3BCC J;  5TJH A;  3NTN A;  5L0G A;  2KSF A;  2ZT9 D;  2JDI H;  3AE6 C;  2LD6 A;  1QQ3 A;  1LP1 A;  3GM1 A;  1PGQ A;  1FJK A;  2IBZ D;  3IF4 A;  3HNI A;  2R5B A;  1ZLL A;  2LIG A;  1JOC A;  2HPC B;  1LKX A;  1RMV A;  1PPJ D;  4C7N B;  4CDA A;  2M64 A;  3EQ2 A;  1PD1 A;  3SXY A;  2P58 A;  1GDT A;  2L6F A;  4K7B A;  2W4B A;  5KLI C;  4C3D A;  3GHG C;  2E42 A;  3DM9 B;  2L9J A;  4ER9 A;  2C0X A;  3KPH A;  3GG2 A;  3HNK A;  4IAQ A;  3CCU P;  3HKK A;  1W5C E;  2KSE A;  1Q0F A;  4MVQ A;  3Q6M A;  3EFO B;  3EHN A;  1GW3 A;  4I7Z C;  4K35 A;  3AG3 C;  3GWL A;  2E76 C;  1LTG C;  2NZ2 A;  1LE4 A;  2IYL D;  2PP4 A;  4LGD E;  2QJP B;  2FBW C;  5T1D B;  3ZQY A;  3EGD B;  4LLE A;  4JYB A;  1EZV G;  2I8B A;  4JJG A;  3RK3 D;  2YEV A;  4HFF B;  2POH A;  3PJS K;  5JRA A;  1NTK G;  4YWQ A;  1SLQ A;  3H2V A;  4HE8 D;  1LIH A;  1VB5 A;  3S0X A;  1J2J B;  1A7V A;  4FES A;  2LKM A;  3MYF A;  1D1A A;  2FFH A;  2QJK B;  4Y99 B;  1YBK A;  1HVV A;  2KSJ A;  1EKY A;  1V54 C;  1FR0 A;  1VMA A;  3FVY A;  3ZQV A;  1GL2 B;  2ITA A;  1OCC C;  2EPO A;  3L8I A;  1R5I D;  3CCE P;  3P8C E;  1BCC G;  3V4Q A;  3MP7 B;  3MZW B;  4U3F D;  1GW4 A;  4UB6 H;  3H1J G;  4JYC A;  4OWF A;  3S27 A;  3IQT A;  2XNX A;  1KB9 E;  4MN4 C;  3HD7 B;  1OW7 A;  4UB6 E;  5K0I A;  2WT7 B;  1AA0 A;  2L7A A;  2YXQ B;  2QSI A;  2KUB A;  2K9J B;  4GOE A;  1MND A;  1KB9 I;  4LLH A;  1L0N J;  1N7L A;  2OYI A;  1A41 A;  2M4E A;  2FYU J;  1T6I A;  3VP9 A;  2KNH A;  2VCC A;  3NKD A;  3VMA A;  1KQL A;  1SQV E;  5D91 A;  2B0H A;  2O01 H;  2KIK A;  4Z9H A;  5B1A C;  1FMV A;  1L0L E;  3SYN A;  1GU4 A;  2PFD A;  1TWG A;  3BRJ A;  3E7K A;  5AW9 B;  4G7Z F;  1Y47 A;  2UWJ E;  4CS8 A;  3W2V A;  3E9V A;  3QMK A;  3U9J A;  4EKW A;  3B5N B;  2J9V A;  1SQP D;  2IXN A;  1VPC A;  3TK1 A;  2QJP C;  2Y69 C;  2FXO A;  3M0D C;  5AGF A;  2QUP A;  1BGY J;  3BRV B;  3EHM A;  4AE4 B;  3CC2 P;  3CCL P;  1DEE G;  1FZF A;  1PFI A;  2YZS A;  3FAP B;  4IAR A;  3U3F A;  3HE4 B;  3AQB A;  2V7Q J;  5L0D A;  1NTM D;  1ORY A;  1L3P A;  4LLC A;  3M9B A;  2ZXE B;  2QJK C;  4Y99 C;  3L75 E;  1JMW A;  1KIL A;  1PGO A;  4WB4 A;  4JPZ B;  1ZRT E;  1GL2 C;  3F89 A;  2W6A A;  1WGW A;  2Y0E A;  2H89 C;  2XL8 A;  3H1I G;  1DD4 A;  3M4B A;  4E0H A;  1ZHY A;  1JEK A;  1N8R Q;  2P1A A;  4XA4 A;  1KZU B;  3HD7 C;  2QRX A;  2WIT A;  3B71 A;  1JUN A;  1ZU5 A;  1YTZ I;  1EQ7 A;  3CSK A;  3AE1 C;  3IQ6 A;  1HTL C;  1VL2 A;  2DW3 A;  3L71 G;  3AOU A;  2BCC E;  4OD4 A;  4RDA A;  1WN0 A;  4CDV A;  3MIW A;  4EHP A;  1USE A;  1LTI C;  2Q00 A;  3H6P A;  3AED C;  4PD4 H;  3O6Q B;  2JX0 A;  2J7P D;  1E83 A;  3FGA D;  1YZA A;  2HLO A;  1YVI A;  2N1T A;  1GL2 D;  3O39 A;  1Z63 A;  1KFN A;  1IK7 A;  3KXD A;  2NUP A;  4EBB A;  4PJJ A;  3US6 A;  1T6A A;  2WZG A;  1K8A Q;  1ZME C;  2FAP B;  4N6C A;  1E84 A;  3OA1 A;  3CC7 P;  3B5N C;  1FZA A;  3B4S A;  2QY9 A;  4KBL A;  3HD7 D;  4ASV A;  2Q6Q A;  3N7N A;  2XSE A;  1R8E A;  1Y4C A;  5A6B A;  4JUR I;  5A6A A;  3RW0 A;  3AE4 C;  3EFG A;  1RHZ B;  5CI9 A;  1V74 B;  3QW1 A;  2A45 I;  2KZJ A;  2NPS B;  3PHL A;  3DM5 A;  5BQI A;  2ZYA A;  4JIO A;  4JVS A;  2XLM A;  2NUT A;  2RH0 A;  2SPZ A;  4G7O F;  4U3F J;  2JO1 A;  3MUD A;  2HZ8 A;  3DJN B;  2PBE A;  1PP9 E;  2Q7C A;  3G3Z A;  2HPC A;  1WAS A;  2ZXW C;  1NFN A;  4C7N A;  3OJA B;  3B5N D;  1OCZ C;  3JZ0 A;  5FZT A;  3Q1M A;  1IZM A;  3TYY A;  2OTL P;  3RK2 C;  2KGO A;  3H1H D;  2CDQ A;  3I4U A;  3ABV C;  4P9F A;  3ZTZ A;  5AW2 B;  3UMK A;  1NTK K;  3L70 D;  5KAI E;  1L2P A;  2EIK C;  2YLI A;  3JC2 2;  2EPL X;  2YMY A;  4R32 A;  4BJ6 A;  3ZDM A;  3OW2 O;  1W2E A;  4NPF X;  1OR3 A;  1SFC A;  2HUJ A;  1JTH B;  4CJG A;  3CX5 E;  5KYY B;  1YAR O;  3KQG A;  1VQO P;  3A0B H;  1FAV A;  1SQB G;  2Z5I A;  3HJC A;  4PD4 D;  3V6I A;  2FKW B;  4BJ5 C;  3RL0 g;  1SQP J;  1KC8 Q;  2CW0 F;  3ASN C;  1K40 A;  1OCR C;  3K33 A;  2EIJ C;  5AVZ B;  3M0D A;  4CIP A;  4EIJ A;  3CXH D;  5E3C A;  3WUU A;  3CX5 I;  3WHN A;  4N06 A;  4I2L C;  3G4X A;  4YT4 A;  3RQF A;  4L6R A;  1SS1 A;  2KLV A;  1NTK E;  1EXI A;  1NTM J;  1NJI Q;  1VDF A;  3TNU B;  1NU1 E;  1QGK B;  2OJQ A;  1E5W A;  2CYD A;  1MMD A;  4DXW A;  2W6B A;  1EQ1 A;  2H43 A;  2M3E A;  2PNO A;  2NRG A;  1KMI Z;  4DT0 A;  1JY3 N;  3RKO F;  1CW5 A;  2J7P A;  2KB7 P;  2NPS C;  5GTH H;  4CS9 A;  3H1K E;  2Q4F A;  2H7B A;  3CPW O;  1USD A;  3NYM A;  5T3T A;  5GTH E;  4NQF A;  5AW1 B;  5C39 A;  4KHX A;  4GKG A;  1OW8 A;  2CPB A;  3IPM O;  2WVO A;  4CPG A;  2XS1 A;  3KZI H;  2KLU A;  1Z3I X;  5JT4 A;  5GTI H;  2QA4 P;  2WVQ A;  3KZI E;  4CBE A;  1GM5 A;  3V2N A;  2OYH A;  1WOL A;  2Y0C A;  1FAP B;  1PGP A;  3GOD A;  2J0W A;  2WMM A;  5E79 E;  3NMI A;  4HFK B;  4PFO A;  3SNH A;  3K1I C;  3FOP A;  1HF9 A;  3VMX A;  2NPS D;  3QWO C;  3D6Z A;  1NKN A;  2WVN A;  3JSZ A;  1FFT C;  2IZ0 A;  2W83 C;  5CCH A;  3LS1 A;  4DRJ B;  2E75 B;  1YI2 P;  3OAK A;  4PJ0 E;  2YKP A;  3NFQ A;  1FU1 A;  1L7C A;  3DJU B;  2YMK A;  2IXP A;  1HW1 A;  3HE4 A;  2C0W A;  3NG1 A;  5AW0 B;  3U8V A;  3B29 A;  1VLT A;  3L34 A;  3M06 A;  5KJ7 C;  4J7Y A;  4XEF A;  1LVK A;  4BRY A;  2M5A B;  1X9V A;  2IXO A;  4JKV A;  2AXC A;  2G8Y A;  2P2U A;  3WUV A;  1JPJ A;  2OQQ A;  3PLN A;  4D4N A;  3NKE A;  2IDB A;  2IYO A;  1RKC A;  4PV1 B;  3UMI A;  3L73 J;  3H1I E;  1G1I A;  1BCC D;  1T2K C;  1YYX A;  1DIP A;  2YKO A;  4ZMD A;  1FDI A;  3H1J D;  1E86 A;  4H13 B;  2W8Z A;  3H1H J;  3L35 A;  1D1C A;  1BZ4 A;  1OMI A;  3HE5 B;  2RSE B;  3L70 J;  3I5Q A;  3HUS A;  2AWY A;  1A0B A;  2JEE A;  1TFO B;  1VQ6 P;  3B0U X;  4E7S A;  2KXP B;  2KZI A;  1SZI A;  3AE5 C;  4JBZ A;  1NZE A;  4KJM A;  3S29 A;  5HV9 A;  1HH0 A;  5KJ7 D;  3TDK A;  2Q3E A;  1LJ2 A;  4YT5 A;  2ZXP A;  5DQZ A;  3CCR P;  3CCV P;  1FFH A;  3JRT A;  4YTP C;  2WSC J;  4CJO A;  1D0Z A;  4RES B;  2E75 C;  2OYI B;  2R44 A;  3V5Y A;  2R7S A;  3AE8 C;  3H25 A;  3EJN A;  4N78 D;  1T2K D;  1EDK A;  1C17 M;  1T6U A;  1TWC A;  1SQV G;  2OGU A;  1T8Z A;  3AEF C;  1Q0G A;  1M56 D;  1QX8 A;  1Y8A A;  3NRH A;  2Z4E A;  1L0L G;  2XV5 A;  1M90 Q;  5B1B C;  3BEH A; 
#chains in the Genus database with same CATH homology
 1VF5 D;  2FYN C;  1S1C X;  2D2C C;  3D71 A;  3D6Z A;  2PBE A;  1WMK A;  1Q90 D;  1MKM A;  3U3F A;  4Z1M H;  4RKU J;  3U0C A;  5L8R J;  3AE2 C;  3C18 A;  3GM2 A;  2V7Q J;  2WSF J;  2E74 B;  2H88 C;  3JZ0 A;  2E75 B;  3Q1M A;  3G9R A;  4YXD C;  2YWA A;  4H44 D;  1VF5 B;  2D2C D;  1YQ4 C;  4H0L C;  1V4A A;  3ABV C;  4TT3 H;  2KK1 A;  2QJK C;  2FXP A;  3GF3 A;  5F28 E;  2HSB A;  1ZP0 C;  4I7Z C;  4PV1 C;  1ZRT E;  3MFN A;  2E76 C;  3O10 A;  3GMA A;  1ZOY C;  2E74 D;  2NZ2 A;  1RQV A;  3RQG A;  4R32 A;  2YMK A;  3Q5P A;  2FBW C;  3RK3 E;  3AEC C;  3Q3D A;  1KOR A;  4KT0 J;  2WSE J;  1KTM A;  1YQ3 C;  2H89 C;  3GF7 A;  4H13 C;  3GLM A;  1OW6 A;  1U57 A;  1KQF B;  3AEG C;  3AJM A;  1K04 A;  1DD4 A;  3AEA C;  2QJY C;  1UIX A;  2E76 D;  1KIL E;  3R4Y A;  4XEF A;  2MKV A;  3K7D A;  3RL0 g;  4XEV A;  3B71 A;  3TUL A;  4R4M A;  4H0L B;  3SFD C;  2O01 J;  3L8J A;  2G8Y A;  1Y9B A;  1K40 A;  3AE1 C;  1NGM B;  1AJY A;  2OQQ A;  1VL2 A;  4I7Z B;  2IDB A;  1JOG A;  4PV1 B;  1KNY A;  2E76 B;  3C8G A;  3O6Q A;  3IN6 A;  4EBJ A;  1PV3 A;  3LW5 J;  1PL5 A;  2Q00 A;  2BEQ D;  4U7J A;  4XFJ A;  3L8I A;  3RQF A;  3AED C;  1DIP A;  3C8G B;  1EXI A;  4H0L D;  1RQU A;  1FDI A;  3JYY A;  2JX0 A;  4H13 B;  3S9O A;  1S5L X;  2YIU C;  4Y28 J;  3FGA D;  4PV1 D;  2JPU A;  3C8V A;  4OGQ C;  1OMI A;  1KMI Z;  3AE3 C;  1IK7 A;  1OW7 A;  2QIW A;  3D6Y A;  2ZT9 B;  2ZT9 C;  3GM3 A;  4EBK A;  3C8G D;  2QSI A;  1NYH A;  4H13 D;  1KQG B;  1PIX A;  3AEE C;  1K05 A;  1ZME C;  3Q2Y A;  2WPV B;  2WQY C;  3AE5 C;  3IAO A;  4NQF A;  1EXJ A;  5M1B A;  4OGQ D;  4R4L A;  2L6H A;  2L6G A;  4H44 C;  5KKZ C;  2G3A A;  1GMJ A;  3AE9 C;  3SFE C;  2BEZ F;  1QVX A;  2ZT9 D;  3AEB C;  1UFB A;  1OW8 A;  3AE6 C;  1ZZP A;  1O3U A;  2J5U A;  1WTY A;  3Q5S A;  1FDO A;  2JP3 A;  1R8E A;  3GM1 A;  4YTP C;  2WSC J;  3T97 B;  2E74 C;  3AE4 C;  2E75 C;  4OGQ B;  3RQE A;  2P10 A;  3AE8 C;  3EWK A;  4IL6 X;  1HJ0 A;  1VF5 C;  3H25 A;  1DD3 A;  1TU3 F;  2LK4 A;  3BRJ A;  3Q5R A;  1WOL A;  3AEF C;  3D70 A;  3AE7 C;  4XEK A;  1JB0 J;  1WWP A;  2L6F A;  5KLI C;  2E75 D;  2QJP C;  4GDO A;  2K9Y A;  2JO1 A;  4H44 B;  1HF9 A;  2D2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...