3S9OA

The focal adhesion targeting (fat) domain of the focal adhesion kinase showing n-terminal interactions in cis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
141
structure length
141
Chain Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational dynamics of the focal adhesion targeting domain control specific functions of focal adhesion kinase in cells.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
total genus 58
structure length 141
sequence length 141
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03623 Focal_AT Focal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3s9oA01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3s9oA02
2PBEA 1JOGA 3AE4C 3AE9C 1OW6A 2JX0A 3JYYA 3B71A 3TULA 1ZP0C 3SFDC 1OW7A 2L6FA 3AE2C 2HSBA 2L6GA 3AEFC 2YWAA 3AJMA 3AE5C 4NQFA 3AE8C 3L8JA 3C18A 3AE7C 2KK1A 1K04A 3GM1A 2H89C 4XEFA 1WOLA 3BRJA 1K40A 3O10A 2LK4A 1WWPA 1V4AA 4XEKA 3GM2A 3MFNA 2G3AA 3SFEC 3AEAC 3L8IA 1KTMA 3K7DA 3AEBC 1YQ4C 5F28E 1KNYA 2L6HA 1OW8A 3RQGA 1PV3A 3AEEC 3U3FA 4EBJA 2FBWC 3GM3A 2JPUA 1ZOYC 4R32A 3ABVC 3C8GA 3AEDC 1YQ3C 1UFBA 3U0CA 3RQFA 2WQYC 1O3UA 1K05A 3AECC 1WTYA 3JZ0A 3AE1C 1ZZPA 3RQEA 2H88C 3S9OA 4YXDC 3C8GB 3AEGC 3AE3C 3AE6C 2Q00A 1QVXA 4YTPC 4XEVA 3C8GD 4EBKA
chains in the Genus database with same CATH superfamily
2Y0EA 1KFNA 2QJYB 3OA1A 3P32A 3IQ6A 4ER9A 3SXZA 2JX0A 1NO4A 5DVWA 3H1IE 1M57D 3NMJA 4JKVA 1BE3D 5CI8A 4F4BA 3DKAA 1NTMD 4YL0A 2XL8A 1G4US 3UNGC 3ZDLA 4U3FJ 1DH3A 3TK1A 2GUSA 1SQQJ 2R7QA 4RO0A 1JY2O 5KYWB 1H6GA 2HUJA 2J59M 1HMDA 3DI5A 3PLNA 4GEHA 2R25A 2V3CC 4KBLA 5A6AA 1NU1E 2IFNA 2KI7B 1HH0A 3W8HA 3NDBB 4YL3A 3EWKA 3MGNA 3C1LA 4OGQC 3MYFA 5KYXB 2WZGA 1SFCD 2Y39A 1YJ9P 1FZBA 2ICWG 1VK5A 3M0DA 4KT0J 1WOLA 3D6ZA 3M0AA 4BEJA 1LT9B 3B0VC 1S05A 1KFMA 2AXCA 4C7NB 1RKEA 5APUA 3BCCJ 4Q7CA 3QVYA 2Q3IA 5KKZB 3IEEA 3GEEA 3L37A 1SQPE 1KD1Q 3AEBC 1VQ6P 1Z23A 5DJTB 3JSZA 1A02F 1U6HA 4MVZA 4XE5B 1E83A 4E0HA 1R4TA 2VC9A 3U8PA 1SQBG 1NKNA 3RQGA 1PV3A 2LFFA 4H13C 1M2VB 2FBWC 4P6IC 1RF1C 2B9BA 1VMAA 1EDJA 3MYIA 1S3JA 2Q6QA 1EI7A 3DM5A 3NMKA 1NTME 3L75D 5A6JA 1ZHZA 3IN6A 1K05A 3G4SP 4EDFA 4N06A 3IHUA 3PJSK 1ZZPA 2E5YA 4PJNA 1X9VA 1QL2A 2WL8A 1KMIZ 1SR2A 2KOGA 2CK3H 2ZPAA 2BCCE 3RGUA 1H9TA 2P1AA 1NU1J 5KTBA 2Q3EA 2IXOA 4YK5A 2Y3HA 4FWVA 1GDTA 2IX7C 2NPSA 3CQZA 1ZHXA 4WY4C 4WY4B 3AE9C 1BGYJ 3GODA 3ATPA 4MS2A 1LT9C 4YXWH 5KLVJ 5L8RJ 2H8PD 2KSFA 3IF4A 3KMIA 3V5XA 1BR1A 1MNDA 3TGUJ 1D1AA 4G78A 1KILC 2PF4E 1RY3A 5B1BC 3K1IC 4RKUJ 5KAIH 2W27A 2J9VA 1PGOA 3RBZA 1Q0DA 2IYPA 2B87A 5L0GA 1IJDB 2YL0A 3CCRP 3MX3A 4YT2A 4PACA 1LI7A 3G50A 3JRMO 4NQFA 2R3SA 1PFIA 5CHXA 3Q5PA 4CSAA 3CD6P 2Q3TA 3VYWA 3PDMP 2XS8A 2H7VC 1S9KE 4CS9A 1BCCG 2YZSA 1ZRTE 2QEXP 2A0UA 4PK4A 2P0NA 3UMHA 3I5PA 1KN7A 2AVKA 3U2LA 5TJHA 4YJWA 5AW7B 3MFNA 3KZIH 4IOIH 4ASVA 2YLIA 4PJ0E 3V4WA 1SMYF 2V7QH 3JC22 4C3EA 3W68A 1M2OA 3A9CA 3CPWO 5TISE 3VM6A 4GT1A 1IW7F 1Q0GA 4W7ZA 1YQ4C 1RJ9A 1ZW2A 3GEHA 4IFDK 3OW2O 1ZHTA 1L4AD 1BGYE 1SYQA 4BJ5C 1AJYA 1FFHA 1VDFA 2LKMA 5CCHA 3V2PA 1E5WA 1OFCX 4I3MA 1GL2D 4J7YA 3ZQVA 2VCAA 4JTCB 1MZ9A 3SP1A 2I1KA 3JZ0A 2YLGA 4U5HA 1NAYA 3EZIA 4OIPF 2LFDA 2A45G 2VCBA 1NAFA 3CC2P 4MVMA 5TJ5E 4N3YB 3RK2D 2E76C 2HPCB 1LTGC 1H9GA 3C8GD 3TGUD 3V2QA 2OTLP 1YYJA 3NMIA 3I55P 2W45A 3EG9B 3WAQA 4YPCA 1JOGA 5C39A 1OW6A 5KYUA 4AL1A 4H0LD 2FFDB 4JQ0D 3KKBA 2ZXWC 2RMZA 1HWTC 1FFTC 2UUIA 1KYOH 2MYSA 2IOQA 5A6BA 3MUDC 4GYTA 4MQ9F 5AVQB 2YMKA 4MNDA 4EIJA 1FDIA 1R5ID 4PR9A 2XRHA 2QLAA 1LTSC 3AG2C 1L0NJ 1N7SB 1SFCB 2BEZF 3RKOF 1O87A 1BE3J 2HS5A 2XLWA 4O6NA 3DMDA 1JMWA 3LLIA 1GD2E 3B9QA 5AVYB 3RVYA 1K40A 5JRAA 1HUCA 1NWQA 2YEVA 3S4RA 3LS0A 3LESA 5L0FA 1OIPA 4BXLA 3TJ6A 4YWQA 1J1DC 2P58A 3JCUH 4R4LA 4GDOA 3OAKA 1ORYA 1AV1A 2AU5A 2A68F 3ABLC 2XDJA 4K7BA 5EGYA 3GF3A 2QNLA 3UGOA 1RE4C 1TQGA 3VF0A 2KNHA 3E1RA 4RBNA 1FJPA 5APSA 4MVUA 4MW8A 2KC3A 3S29A 1E86A 3CX5H 2OYHA 4MTOA 3M15A 1NKZB 3JTLO 4OVNF 1KB9I 4CS7A 1BSHA 5KYYB 4A7PA 4WY4A 3L72E 3I56P 4O6MA 1NU7D 3JRTA 3WHNA 2NZ2A 4RDAA 1FMWA 2Q7CA 3US6A 1TWGA 3F89A 5HSWA 3OWTA 2BASA 4KI2A 2POHA 2E87A 3O39A 3MHVA 2ZVOB 3T97B 1HGVA 3RK3C 3FXDA 4KHXA 4DT0A 3P8CE 1NTZK 2OKUA 3H1HG 2YIUB 1ZP0C 4E0IA 3NYJA 1PP9G 1E85A 4I44A 1OKKA 1S7ZA 4GOFA 1LWUC 1JY3O 3O6QA 4DOJA 2WSFJ 3L70J 2I15A 2QIWA 1VL2A 1GM5A 3MLGA 3M9HA 1N7SA 3FXHA 2A69F 2HFIA 1BE3E 3QWOC 5KJ7A 2P7VA 4K0DA 2J46A 2KGOA 2N9BA 2HMZA 1BCCE 3EFFK 2YVKA 2Q9AA 5AVWB 3SEOA 1YAUO 3L73J 2E42A 1LI5A 5EFWB 3M4CA 3ZVRA 3R2PA 2QRXA 2AEMA 3PTZA 2V26A 2HLOA 2E75B 2FYNC 1RKCA 2FYNB 2R05A 3TYYA 2EIMC 2J0WA 3PCVA 3HE4A 1WATA 3SXYA 4DJGA 2DB4A 2J9UA 4MTGA 1GQAA 1JY3N 1L0LD 2QE9A 2IBZE 4HKZH 1SQVE 4WWIA 5AVZB 1RF1B 3GM2A 3POVA 4RD9A 2G3KA 2NPUA 1Q90D 5CMZA 4JJGA 1OR3A 3EQ2A 4AL0A 3U9MA 3QZCA 4Y28J 3CC7P 1IZMA 2BC5A 4JURI 1G1IA 1VB5A 4CJOA 3CLQA 2HFED 2K37A 3K66A 1VQ9P 4EBJA 3W67A 3WU2E 1FZFA 4JZAA 2ITAA 2YO3A 5APTA 3C7JA 4JC7A 3PHLA 4Z9IA 1SQBK 2I1JA 1ORSC 2LD6A 1VPCA 1PPJE 2ZYGA 1ZHYA 1QGKB 5KJ7C 5H2FH 3TD7A 1L4AB 5CBOA 2C9LY 1NHLA 2MWQA 4PD4E 3QTHA 5EHHA 1VF5B 3B5NA 2GWWA 3QW1A 2Y3GA 2OJQA 1BCCJ 2J5UA 3CCQP 1YIJP 1EDLA 1J8YF 4IJJA 2ZT9D 4C46A 4IARA 5KJ7D 3E7KA 3EQLF 3DD7A 2FYUK 2HSQA 2M0BA 2CCYA 2OJED 2IXMA 2HJMA 1OW7A 1NU1D 2JO1A 3HTKA 3H25A 3ABKC 1HW1A 1FBMA 2GAQA 1OKKD 2DYSC 1HJ0A 3P8MC 4N6JA 2FAPB 3EGXB 1VOMA 1QLED 1X79B 3G4ZA 1Z6AA 3V2RA 5JT4A 3FWLA 3Q5RA 4O7GA 5AW8B 5KYWA 3WUTA 1A7VA 1Y47A 3TGUG 2BCCG 1LGHB 3EFOA 2KS1B 3G71P 1RCPA 1SP4A 1L0LJ 1WGWA 4DXWA 1Z7Qc 5L0IA 1NTKG 1LT9A 3EH1A 5A6BD 2NUPA 2OYIC 4H0LC 1FOSE 4N6HA 2CPSA 3L71D 2FXOA 1HBWA 2K88A 4EUKB 2Q7RA 4JYCA 1RE4A 2C03A 1KV4A 3EGXA 1P84D 1S9KD 1RXQA 3RK2C 4BWNA 3L73G 3CXHI 2L5GB 3RK3D 3S1KA 5GTHH 3NG1A 2L9JA 1YJWP 4KJMA 1PD1A 3K5BA 3L70G 3ZC4A 2ZJSE 5B66E 1LE2A 3AGUA 3W2VA 2YNYA 1OX3A 3B4SA 4R32A 2WVRA 4O79A 1ZR4A 4CIHA 3FDQA 1IFPA 3FOOA 3M1CB 1A7EA 4NTFA 3H1HE 3O55A 1WTYA 1LS1A 2OCCC 3S27A 2WWWA 1EZVE 4YXDC 2W6AA 2ZD9A 1ZN5A 2ZAEB 2ETSA 3H2VA 3MUDA 1FR0A 1M1JA 2KJGA 3FVYA 4XWJA 4BJ1A 3M0DC 1PP9E 5BQHA 2R3CA 3VOPA 1URQD 4W80A 1GGQA 3B71A 4CDYA 2WVNA 4NTAA 1SQXK 1TFKB 5H2FE 2XL6A 1R5SA 2EPLX 1E79H 5APQA 4PFPA 2OG2A 4PJJA 3R4YA 3B0PA 2HV6A 2KLVA 2O01H 4IAQA 3K1HA 1PZQA 1T6IA 2R7UA 3AQCA 3L71J 2JJLA 1RH5B 4K1OA 1KQLA 1CPRA 4NC3A 2O1JA 1SF8A 1S72P 1CW5A 1R8EA 1KQFB 1OR2A 2L81A 4U5FE 4WJ0A 2XLEA 3HRNA 5E2QA 3G9RA 4NCQA 5DQZA 3E9VA 4BJ6C 2ZT9B 3OA7A 2W4MA 2PP6A 3GLMA 3HE4B 2WZFA 3EG9A 4MW3A 4TLFA 2WT7A 2YXRB 1ZW3A 4OD5A 3L70D 4JVSA 2RSEB 2R03A 2WSCJ 3H32B 2J45A 3FGAD 4U3FD 2K9YA 1FTSA 1S5LE 3SSUA 3Q7LA 2ZXXA 1M6TA 4WBAA 4LDKA 3W4YA 2WITA 2GUVA 2L6HA 1EQ7A 1LTJC 1L2PA 1QZXA 2ZXPA 3L0IA 3NKDA 2Y9YA 1TWHA 4ULWA 3FXEA 2XNXA 5T3WA 1SQPG 1SQPK 2FFDC 4CJGA 3HNLA 1E84A 3VTPC 4OGQD 3LW5H 1GK6A 3B0UX 2E43A 3UMIA 5L3QA 1FAPB 5CJ4A 4QI0A 1BDDA 2XLDA 3L74E 3SXMA 4M63A 1LWUB 1WMKA 3H1HD 4H44B 4J7TA 2W4BA 3CEXA 4JPZB 1H0TA 2XM4A 1FAVA 4G7HF 4GKGA 5BU8B 3MD0A 3GWNA 1FZEA 3FWNA 1VQMP 1Z3IX 2WVOA 3DE8A 1CGME 5A69A 5TISH 1LP1A 2XZRA 2UWJE 4HEAJ 2OEVA 1P84I 4U5DE 1IK9A 5CCGA 1NSGB 1IZNB 1M90Q 4DJ9A 2DGJA 4G0HA 4N78D 4ZNCA 2QJKC 1Z63A 5BQIA 1DOVA 3V5ZA 1T9KA 2NUPB 4E17A 3GHGC 3HKKA 1ZR2A 2E5TA 3HD7D 1OXZA 3X1OA 5T1DB 1EA8A 4Z9HA 3C18A 3A2AA 2YQYA 3CSKA 1FZCC 1CGNA 4LERA 2WPSA 3I5CA 5AVSB 4RESB 5DJUB 3VP9A 3CCVP 1V4AA 3J06A 1A7DA 3DXJF 3AEAC 2KQ9A 1ZMEC 3L8IA 1T6AA 3KPHA 3V4QA 3L74J 4AX2A 3KYIA 3FAPB 4BG0A 4G7OF 2OTJP 2KSEA 2F22A 2GDCA 2FXPA 1AVOB 5FCLA 1NH4A 2W6JH 5CBNA 3EGDB 2P61A 1NTKD 4JEAA 3C9IA 3AEEC 3H1JE 3H1IG 2RN0A 2IYLD 2Y69C 1NLXA 1FZCA 3GWLA 2V4HA 1Q0KA 3L72D 4OH8B 3E70C 3BEHA 1XZQA 4DBQA 5KLVD 3LEOA 3AGTA 2R7OA 3ABMC 1RE3A 1N86A 1Q82Q 1YYXA 4HFFB 4Q4ZF 4CSAC 5KLVG 1QL1A 3H1LE 1YDIA 1BGYG 1KYOE 4QDLA 2JEEA 2H88C 1KYOI 2DI3A 4YT8A 3AEGC 3T4RA 3L34A 1O5HA 1H7IA 2QUPA 1QX8A 4WY4D 1NU1G 3RBXA 1UIXA 4YTPC 3DJUB 2H43A 3C8ZA 2A1DD 1L4AC 4BEMJ 2Q9IA 5CCGC 1PCXA 2E74C 3TOLA 3RK2B 4DOZA 4DVZA 5AC4A 1KILA 1KORA 2J9BA 2M3BA 4HFKB 3AE4C 1NTZJ 3O6XA 1AQ5A 1N1CA 4OGQB 4LLHA 1RE3C 1VTMP 2OYIB 1L0NK 4IFFA 2DYRC 3PP5A 2NPSC 2QTVA 2B0HA 1GL2B 5HV9A 3T9OA 2OYOA 5BU5A 4PV1D 1SQBJ 2YKPA 3AEFC 3LW5J 1SQVJ 2A06G 2YKQA 2D4UA 5FZTA 3G3ZA 2PFXA 2JP3A 5KKZC 1N7SD 2OGUA 1LTIC 3V5BA 4LDQA 3NMDA 4B86A 4AE4B 3IFMA 4CBEA 3N4XA 2EINC 1SLQA 1S5LX 3L75E 2M5AA 3D6YA 3LAYA 4U9DA 3C8VA 3BCCG 1LVKA 1S1CX 1A0BA 2GA1A 5AW9B 1G1JA 3BRTB 2YIUC 2QJYC 1SQXJ 3N7NA 2E75C 1NFOA 4KNWA 2XXAA 2A45I 3KZIE 4N4WA 3CX5I 4JBZA 1WASA 4W7YA 2CYDA 1Q2NA 4E7ZA 1DEBA 1SFCC 5APVA 1G2CB 1MMAA 3WMM0 4GODA 4P9TA 1JPJA 2CNWD 3P7KA 1GTWA 1HF9A 2J7PA 1HTLC 2OARA 1QLEC 1AUEA 1L0ND 2W8ZA 5E3CA 3BCCD 4LGDE 1M1JB 3L70E 3WG7C 2M4EA 4EKWA 3U3FA 2R02A 3GM3A 3RH3A 1NTZE 2KLUA 3CWBE 1P84H 5JS5A 1JY2P 4U5BE 2FY8A 1FJKA 4EOTA 2AWYA 2ZT9C 3NFQA 5KLIB 4EWCA 1Q0MA 1KILE 3C8GB 2R32A 2VB6A 1NGMB 4IWBA 2NSFA 3UIAA 5GPGB 4FESA 3JYHA 4EBKA 2P2UA 4HB1A 4H13D 4DBRA 1YA9A 2IBFA 4ZKPA 2FYZA 5KLVK 2M3EA 3VMZA 1YITP 4CDVA 2NPSD 3L72G 3AOUA 3U9JA 3U1CA 1PIXA 1NTKK 3EJNA 5K5GB 1ZHWA 1M7LA 4ULVA 1V74B 1EXIA 1G2CA 1ZVZA 1QPUA 2HMQA 3H1JJ 3L71G 4E7SA 3LEVA 1A02J 2ZXRA 2BEQD 5IY5C 3ZWIA 2YL1A 2XLVA 3CX5D 1CI6B 2N1TD 4EHPA 1PGPA 1LTBC 1Q0FA 3AJMA 3AE5C 1G8XA 4XFJA 1EZVD 4OINF 4JW1A 5DS5A 3L8JA 3M79A 2WSEH 2P10A 2AWCA 4JTAB 2LR2A 1LT1A 2FFDA 3LJBA 5KAFH 4UB6H 3TNUB 2Q4FA 3JSEO 2YKOA 2QM8A 5JVEA 2KP8A 1PL5A 1PGQA 1JPNA 3RIPA 4C3DA 3KYQA 1J2JB 1JTHB 4C7OB 2OQQA 3X2QC 1KYOD 3FMSA 1V55C 1D0XA 5KYNA 1KTMA 1SQVD 4NTBA 1OXBA 4H44C 1W2WA 3W2WA 2HV7A 2J7PD 2L91A 2ZFCA 1RMVA 4OIQF 2CNWA 3CI9A 1R5LA 1VQ7P 3DZAA 1SQVG 5B3SC 4PFOA 1M1KQ 1ZU5A 1H0TB 4AK9A 2AEJA 1K8AQ 1D1CA 3EZHA 5COGA 2Y0CA 1CSBA 3H1LG 3CCMP 2JPUA 5CJ0A 2FYUE 2Z15A 1FC2C 1A41A 2WPRA 2XS1A 3CCUP 4MVRA 4JTDB 2Z5IA 1BZ4A 1UFBA 3U0CA 4E18A 3S28A 2EPNA 2YKZA 3SXKA 4H44D 3OEOA 1EXJA 3B5NB 1LKXA 1DX7A 3E1IA 3NRHA 2G8YA 1D0ZA 2WSSH 2ZXEB 3S90A 1MQVA 1HE1A 2E75D 5CCGD 2OTKE 1Y4CA 2B0JA 1IO4A 5GTIH 3RL0B 2IXPA 2P7JA 3Q1MA 3ZTZA 5AW2B 1DD3A 3P8CD 4C3BA 3KH2A 3GG2A 1ZYRF 1SQPD 1OXKA 1HGZA 2W9YA 1URQA 3QW0A 3TULA 4UDVA 1KC8Q 5L3VA 2RKLA 3L73D 2N9YB 3SFDC 4L6RA 4A4AA 1USDA 3KPEA 2IZ0A 1UIIA 2IFMA 4PV1C 1NU1K 1K9MQ 3H1IJ 3H1KJ 3V2NA 1AA0A 2KK7A 1T2KD 1M1JC 3A0HE 2FYUD 5T3TA 1L0NE 2B87B 2IBZG 2KZJA 5F5FA 4WB4A 3WUVA 3EH2A 2PP4A 1NG1A 4CS8C 1YARO 5B5EH 1Q86Q 1GL2C 1XZPA 3AE8C 1DIPA 4DCKA 2KK1A 2NG1A 2XXAB 2M64A 3BRVB 1RF0C 4GQHA 3HUSB 4JJFA 1S2EA 2LQGA 2XM0A 4JRZA 2UUHA 4Z9JA 1CI6A 4PV1B 4LLCA 5JSLA 1SQBD 3A3YB 2KNCA 3LIDA 2G3AA 2OYIA 5GTIE 2GFHA 3DAFA 2ASRA 2P67A 1E2XA 3UGPA 1LTTC 4Z1MH 3B8EB 3IR9A 3DE9A 1YTZI 4PJMA 3ZIBA 1HMOA 1Y9BA 1QKRA 2NPSB 1L0LE 1OW8A 2K3RA 4H0LB 1HJBA 1Z5ZA 3TDKA 4DRIB 1SQXD 4O9BA 1VF5D 3EHMA 3U8VA 3L1MA 3ABVC 1SQXE 3HNIA 1O3UA 1USEA 4EI2A 1M56C 3CCEP 1NZEA 3RW0A 1MFTA 1OWAA 2O01J 2HKVA 2WPVB 2N1TC 1D1BA 2R5BA 3FAJA 4NPFX 3R7CA 1H88A 3CCSP 5CCHD 2PGDA 3MIWA 1IFNA 2R7TA 3HUSA 2G62A 2EIKC 1FE6A 3V6IA 3LS1A 1VQPP 2AEFA 3FOPA 1Q7YQ 4WABA 3ASOC 3SWKA 3USSA 4IL6H 3KL4A 3ASNC 3SYNA 3L35A 3SNHA 2L6FA 4YT4A 2W6BA 2PFDA 1NTMG 2YL7A 3AE2C 3EFOB 1EDKA 2R5DA 3CWBD 3RL0C 1NTZD 1GW4A 5DLJA 1N73C 5B1AC 3I5QA 1LTJA 1KQGB 4NPDA 1FS0E 3L73E 1HY5A 2YWAA 2G3VA 3HD7A 1GMJA 1PP9J 2XKMA 1F1MA 4IGGA 3HJCA 3TSIA 3H1HJ 2JD3A 3W8IA 4UB6E 2XU6A 3AE7C 3L75G 2C0WA 1IFDA 2HODB 3KQGA 1ST6A 4N6CA 1BGYD 2H89C 1D0YA 3TQOA 3T6BA 1LM3B 2XSEA 4NY3A 2EPKX 3C62A 2J58A 4QI2A 3BRJA 2E74D 2OU6A 1BR2A 2VCCA 1M8OB 5AW4B 3CL3D 3H1ID 4EYYQ 3HD7B 3VAYA 3ZTMA 1HVVA 1VLSA 3IQCA 1GL2A 4I7ZC 3QVZA 3Q3DA 4U5GA 3I4UA 2KXPB 2VH3A 2IM8A 4CS8A 1U57A 2LIGA 2PX3A 2RD9A 1KNYA 2NRGA 1BBHA 4UB8H 1ZRTD 3M9QA 1WT6A 3B5NC 1MMDA 1RQUA 3AG4C 3N0TA 2OOCA 3KYJA 3Q7GA 5M1BA 3UMKA 3CZ6A 2MKVA 2D5RB 2O01N 1VQKP 1YBKA 1OCZC 4WGYA 1LWUA 2BCCD 4LACB 3AEDC 4LLEA 1T3JA 2PAJA 4AUWA 4IB4A 3RQFA 2WQYC 1JAFA 4IL6X 4QMAA 2LXBA 3V5YA 1KB9E 1HW2A 3GF7A 2KYVA 1W5CE 1QQ3A 2B89A 3U59A 1N7SC 2Q00A 1SQBE 4BJ5A 3JSVC 1WRGA 2Y9ZA 2NUTA 2VRSA 1GU5A 3EHNA 4L73A 3JCUE 2TMVP 3L74D 4KNVA 4OWFA 1OVVA 3ZDMA 3L75J 3JYYA 1UG7A 3CX5E 1L0NG 1Y6DA 2NSGA 3HD7C 3GHGA 3A7OA 2QY9A 1TU3F 1LTJB 1X0TA 3QH9A 3L36A 2WVQA 5DQTA 2HSBA 1YI2P 4ANJA 1VYIA 1MUUA 1CPQA 1YHQP 4IFMA 3AQBA 1ZU4A 1T6QA 1OZHA 1KZUB 2WT7B 1CGOA 3HTKC 1NTMJ 2GM4A 1L0LK 1DEEG 3DJNB 3TNUA 3UR3C 1L7CA 2HR3A 2XL4A 2ZVNB 2WZLA 4EBBA 5AW3B 1JOCA 4I1MA 2IYOA 1SQQK 4C7OA 4G7ZF 3IQTA 2K9JA 3H1KD 1NU9C 5L0DA 2QM7A 1K73Q 3BATA 3RL0D 1J1DB 1QVGO 3II6A 1T6UA 1AFOA 4MN4C 3WODF 3TJ5A 1DD4A 1NTKJ 2WTYA 5JLIA 3TF5A 4JE9A 1CZQA 3GHGB 4BJTA 1EKYA 1L0LG 2A45H 2IZ1A 2BCCJ 4D6TJ 4H54A 5F28E 4MVOA 4AQRD 1VF5C 2XV5A 2M8RA 4XPYA 1PD0A 3MBGA 2LP4A 2KW3C 1VQ4P 2H7OA 4J32B 1QEXA 5E33A 1JCCA 4R4MA 1YQ3C 1VLTA 4DVYP 1GK4A 3NYMA 4MTFA 2MHRA 2EILC 1U0BB 3S84A 5L0HA 1M56D 4BPMA 2W90A 2WSFH 2SPZA 4Y99C 4ZLCA 1SS1A 5APXA 1MMGA 2P1JA 2FGYA 4ZLDA 3IPMO 1OCCC 2YHSA 3BVHA 2I8BA 5BQGA 2PNOA 1FOSF 3LNMB 2QVAA 2PBEA 5EK0A 3LUTB 4O6YA 5BUOA 1N73B 4W8KA 3VN0A 5CIVA 1JEKA 1KQSO 3L4FA 4IRUA 1RHZB 4U7JA 2R7WA 1G4WR 2A6HF 1C02A 2Y3DA 1J8MF 2YMYA 2R7VA 3VRCA 1VYKA 4OD4A 1Q81Q 2IXNA 4I1LA 5AW5B 1OVUA 1LNQA 2HODA 3H1KG 5AGFA 2GA0A 3CCLP 4D6TG 1Y8AA 2KIKA 4D4XA 1IFMA 4PJ0H 3RK3E 4X0RA 4WVZA 2I8DA 1J1EC 1NFNA 2L7AA 4PJLA 2A06E 2QA4P 5KAIE 3MTUE 1EC5A 1I5NA 1KU2A 3GM1A 4XEFA 2KYHA 3IQ5A 5K0IA 1N73A 5KYXA 4XA4A 3N2ZB 4CS9C 1XTGB 1APCA 3EPVA 5AVUB 1T2KC 3H1LD 1IK7A 3SFEC 1KB9H 2B88A 3CXHE 2QSIA 5KLVE 4I2LC 2Q9CA 1LP1B 3LNRA 4JCHA 1YJGA 3ZQYA 2R9RB 4ASWA 2Q1KA 256BA 5B3IA 1SQQD 1W2BO 4CPGA 3H1JD 2FFHA 4GIFA 1DOWA 1YTZT 4P9FA 2ZYAA 1OCRC 3T97A 4XLNF 2LSEA 4BRYA 1U7JA 1WN0A 4MVSA 1ZOYC 3C8GA 4UB8E 3S0XA 2Y0DA 3HE5B 4JF7A 4K3AA 2JKVA 5AW1B 1OCOC 3V7OA 3RF3A 3U5SA 1N7LA 1T8ZA 2Z4EA 1JMMA 1EZVI 1LJ2A 3Q2YA 3ZG1A 3AE1C 3LIEA 4C7RA 4JIOA 4XQ1A 1MFZA 3PHF2 1EDIA 4WGZA 1PP9D 2H7HA 3AG1C 3JT1A 1S5LH 5JP7A 2HYNA 1T5OA 4XPXA 2KSJA 2EPOA 1FMVA 5KYYA 4JEBA 2YO2A 1V54C 1X22A 4DRHB 3DWWA 5BVZA 1I4ZA 4C7NA 1RKEB 5D92A 2K1AA 3GMAA 3SZRA 2IBZI 3Q6MA 4OIRF 3CC4P 1OMIA 4Y99B 3OJAB 4N78E 3TOMA 1OVRA 2Q5UA 1PGJA 4ONSA 5AVXB 3F5HA 3SWYA 4XLPF 1IC2A 4JYBA 1ZV8A 4HE8D 3JCUQ 4YL1A 1VQLP 2KZIA 3VMXA 3CMEP 2J0XA 1ORJA 1YZCA 2LCHA 3NXSA 1YJNP 2N1TB 4LDRA 2OEXA 4IL6E 5L0CA 5JUAA 2QJPC 3L72J 1VQNP 3HUSC 3ZSUA 4MVQA 4FAPB 2Z5HA 3TGUE 2XLMA 2KB7P 3O10A 4NPEA 2E74B 4B6IA 1JNMA 1NVOA 4YN0B 1JM0A 1BE3G 1JCDA 4YT5A 3H65A 3GW6A 3DM9B 3L71E 1BR4A 3H6PA 1N8RQ 3U2MA 2H8AA 3T6GB 2Y3BA 3K7DA 4U5CE 5E3AA 1C17M 2HJ3A 2DW3A 2KUBA 3Q6NA 3PH0A 2C9NY 3O6QB 1MNEA 1JY3P 5L0JA 5CCHC 1L3PA 2ZXOA 1Z56A 2NUTB 2P6VA 2R7XA 1ZW0A 2WSCH 1RJ9B 4J30B 4AYCA 2WZ7A 3MZWB 2JWDA 3HTKB 5DS6A 2VASA 3D71A 4CDAA 3BASA 3HNJA 4U3FE 5E79H 2D2CD 4ZKUA 4D6TD 4GOEA 4L74A 2FXMA 3GANA 5GTHE 1JY2N 3AE6C 3WUUA 1LE4A 1QVXA 1MKMA 4BRYB 3D70A 2E76B 4XEVA 1U7MA 3A11A 4K35A 2O9XA 2BL2A 1X8YA 1SQXG 2E76D 1AVOA 2R44A 1PPJD 2HZ8A 2JR8A 3N24A 4PD4D 3O8ZA 3RFYA 1LS4A 3A0BH 2FKWB 2D2CC 3AG3C 1KILD 2FYUJ 1BDCA 2WPQA 3EFGA 3ITKA 1YYCA 2CPBA 3VYIA 3GEIA 1FZCB 1I4YA 5B66H 3SWFA 4TT3H 1TWCA 3QMKA 1W2EA 3EGDA 5AW6B 3H2UA 1J1EB 5CI9A 4CX9A 1VQ8P 2O1KA 5F5HA 2L6GA 2QJKB 3BCCE 1TFOB 1JUNA 2N1TA 4U9EA 1G5ZA 2CW0F 5AVVB 3NYLA 2K9JB 1TWAA 1FZAA 1MMNA 1NBBA 1KB9D 1LIHA 3FX0A 1JMBA 5COMA 3CMAP 2M5AB 1K04A 3TK0A 1NTZG 2A6EF 5AW0B 2QG4A 1AQTA 2BE5F 2IBZD 3VP8A 1XWJA 3M9BA 1LTAC 2RH0A 2Q9BA 2LK4A 5E79E 1WWPA 4H4KC 3A0HH 1H8AA 4XEKA 3DAGA 5AC5A 4PD4I 2HPCA 4LC1A 3U1AA 1FDOA 1YLMA 4BJ6A 2OYHB 2OYHC 1N2DC 3VMAA 4U5EE 3KDPB 5COFA 2AXTH 3HE5A 5KYUB 2V7QJ 1BCCD 3T6JA 2C04A 3F46A 1XTCC 1U89A 3CWBJ 1C03A 4HYTB 4CIPA 1NTMK 3K1IA 1BDJB 1PPJG 1OQCA 3PRJA 1ZLLA 2WB7A 5D91A 3B5ND 3CWBG 3G4XA 3WU2H 4HJGH 1HE9A 3M06A 2C0XA 3G6EP 5APYA 4ZMDA 3AECC 2OQMA 4DRJB 3L74G 4PD4H 1JRAA 1M2VA 1GW3A 2EIJC 1GZLA 3ITFA 3RQEA 2QJPB 3S9OA 3AE3C 1JR8A 2YLDA 2HG5D 1EQ1A 2XNDH 3B29A 5KLIC 2PX0A 4JCZA 2AXTE 4HH2A 3CCJP 1YVIA 3H32A 2CDQA 5AVRB 2J9WA 2JDIH 1H89A 2O3JA 1JTHA 2R7RA 2CGEA 4DZOA 3RK3B 3F47A 1LPEA 3CXHD 1M57C 1EZVG 2X0CA 2YXQB 4D4NA 1SVFA 1S4XA 4FX5A 4A2NB 1RF1A 3H1LJ 3HNKA 3K6BA 2J8WA 1B68A 3LLKA 1NTKE 5DS4A 4M3LA 4Q5SF 3KHUA 2IDBA 3NTNA 1RF0A 1MV8A 1AEPA 3H1KE 1AVYA 5KAFE 3C63A 3KXDA 1RQVA 2A06D 4D6TE 1FNTc 4W8PA 1JB0J 4AE4A 5AVTB 3NKEA 4XPWA 2A0BA 4L76A 4L75A 3VMYA 4KC9A 1FDMA 2FYUG 2KS1A 1TKNA 1SQVK 4OIOF 3MP7B 4RJTA 4XTKA 1SQQE 1SZIA 1VQ5P 4H13B 3FHDA 3HLZA 3RL0g 2ZYDA 3K33A 2W83C 3IAOA 2XLHA 1URQB 1VQOP 1URQC 2YRFA 3M4BA 3ECSA 3Q5SA 1YZAA 1SFCA 1QSPA 1D7MA 3RVZA 2QE7H 3CAXA 3U3BA 5A6KA 4I6MC 1T3UA 2IPPA 1KILB 2X51A 5B5EE 1L4AA 3H1JG 1SQPJ 4EIYA 1FU1A 1GS9A 1SQQG 1GU4A 2R7SA 3M91A 3A5TA 2JWAA 4U3FG 2PRRA 2WMMA 1NOHA 4IAOA 3CXHH 1NJIQ 1JO5A 1T01A 2MJZA 2AP3A 3PMRA 2YL3A 2XLOA 2D2CB 1FZGA 2LXCB 1TR2A 4I7ZB 4I1OB 2EPMX 1YA7O 3A0BE 2KNCB 1ZXGA 5APWA 2H7BA 1BSNA 3GORA 1P84E 2WSEJ 1IFIA 1IFJA 3RYLA 1NYHA 1QVFO
chains in the Genus database with same CATH topology
2E76D 2E74C 2J5UA 2PBEA 1KORA 1DD3A 1JOGA 2D2CC 2ZT9D 3AE4C 1OW6A 3AE9C 2JX0A 4H0LD 3T97B 5L8RJ 3JYYA 3B71A 3TULA 4OGQB 3GMAA 1PIXA 1ZP0C 3SFDC 1OW7A 4TT3H 4U7JA 2L6FA 1OMIA 2JO1A 3R4YA 1TU3F 3H25A 1EXIA 4PV1C 3AE2C 2HSBA 3O6QA 2L6GA 1HJ0A 2WSFJ 4PV1D 2QJKC 2YMKA 2QIWA 1FDIA 3AEFC 3LW5J 1VL2A 4RKUJ 2BEQD 1KQGB 2IDBA 3Q5RA 2JP3A 5KKZC 1R8EA 2YWAA 1KQFB 3AJMA 3AE5C 1RQVA 1GMJA 4XFJA 3G9RA 4NQFA 1JB0J 2BEZF 3EWKA 3RK3E 2ZT9B 3Q5PA 1S5LX 3D6YA 4OGQC 3AE8C 1DIPA 3GLMA 3AE7C 3C8VA 2KK1A 3C18A 1S1CX 3L8JA 2P10A 2QJPC 1K04A 4H0LC 3GM1A 2H89C 4XEFA 2YIUC 4KT0J 1WOLA 2QJYC 3D6ZA 3BRJA 2E75B 2E74D 1ZRTE 2E75C 2FYNC 1K40A 4PV1B 1PL5A 4H13B 3O10A 2WSCJ 2LK4A 1WWPA 1V4AA 2E74B 4XEKA 3RL0g 1DD4A 3FGAD 3GM2A 3MFNA 1IK7A 2G3AA 2K9YA 3SFEC 3IAOA 2OQQA 3AEAC 1ZMEC 1Q90D 3L8IA 2QSIA 1KTMA 4R4LA 1FDOA 4I7ZC 3Q5SA 4Z1MH 3Q3DA 3K7DA 3AEBC 4GDOA 4H44C 1U57A 2FXPA 4Y28J 2V7QJ 1Y9BA 1HF9A 1YQ4C 3GF3A 1KNYA 2L6HA 5F28E 1OW8A 1VF5C 4H0LB 1RQUA 3RQGA 1PV3A 5M1BA 3AEEC 4H13C 1VF5D 3U3FA 1AJYA 2MKVA 2FBWC 4EBJA 3GM3A 2JPUA 1ZOYC 4R32A 3ABVC 3C8GA 4R4MA 3AEDC 1YQ3C 4OGQD 1UFBA 3U0CA 3D71A 3RQFA 2WQYC 1O3UA 3IN6A 1K05A 4H44D 3AECC 1WTYA 1EXJA 3Q2YA 3JZ0A 4IL6X 3AE1C 2D2CD 2D2CB 2ZT9C 4I7ZB 1ZZPA 3RQEA 2H88C 1KILE 3S9OA 4YXDC 3GF7A 1WMKA 3AEGC 2G8YA 3AE3C 2O01J 1KMIZ 4H44B 3C8GB 2WPVB 3AE6C 1NGMB 1UIXA 1QVXA 1MKMA 2E75D 4YTPC 2Q00A 2WSEJ 2E76C 3D70A 2E76B 5KLIC 2NZ2A 4XEVA 3C8GD 1NYHA 4EBKA 1VF5B 4H13D 3Q1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBE A;  1JOG A;  3AE4 C;  3AE9 C;  1OW6 A;  2JX0 A;  3JYY A;  3B71 A;  3TUL A;  1ZP0 C;  3SFD C;  1OW7 A;  2L6F A;  3AE2 C;  2HSB A;  2L6G A;  3AEF C;  2YWA A;  3AJM A;  3AE5 C;  4NQF A;  3AE8 C;  3L8J A;  3C18 A;  3AE7 C;  2KK1 A;  1K04 A;  3GM1 A;  2H89 C;  4XEF A;  1WOL A;  3BRJ A;  1K40 A;  3O10 A;  2LK4 A;  1WWP A;  1V4A A;  4XEK A;  3GM2 A;  3MFN A;  2G3A A;  3SFE C;  3AEA C;  3L8I A;  1KTM A;  3K7D A;  3AEB C;  1YQ4 C;  5F28 E;  1KNY A;  2L6H A;  1OW8 A;  3RQG A;  1PV3 A;  3AEE C;  3U3F A;  4EBJ A;  2FBW C;  3GM3 A;  2JPU A;  1ZOY C;  4R32 A;  3ABV C;  3C8G A;  3AED C;  1YQ3 C;  1UFB A;  3U0C A;  3RQF A;  2WQY C;  1O3U A;  1K05 A;  3AEC C;  1WTY A;  3JZ0 A;  3AE1 C;  1ZZP A;  3RQE A;  2H88 C;  3S9O A;  4YXD C;  3C8G B;  3AEG C;  3AE3 C;  3AE6 C;  2Q00 A;  1QVX A;  4YTP C;  4XEV A;  3C8G D;  4EBK A; 
#chains in the Genus database with same CATH topology
 2Y0E A;  1KFN A;  2QJY B;  3OA1 A;  3P32 A;  3IQ6 A;  4ER9 A;  3SXZ A;  2JX0 A;  1NO4 A;  5DVW A;  3H1I E;  1M57 D;  3NMJ A;  4JKV A;  1BE3 D;  5CI8 A;  4F4B A;  3DKA A;  1NTM D;  4YL0 A;  2XL8 A;  1G4U S;  3UNG C;  3ZDL A;  4U3F J;  1DH3 A;  3TK1 A;  2GUS A;  1SQQ J;  2R7Q A;  4RO0 A;  1JY2 O;  5KYW B;  1H6G A;  2HUJ A;  2J59 M;  1HMD A;  3DI5 A;  3PLN A;  4GEH A;  2R25 A;  2V3C C;  4KBL A;  5A6A A;  1NU1 E;  2IFN A;  2KI7 B;  1HH0 A;  3W8H A;  3NDB B;  4YL3 A;  3EWK A;  3MGN A;  3C1L A;  4OGQ C;  3MYF A;  5KYX B;  2WZG A;  1SFC D;  2Y39 A;  1YJ9 P;  1FZB A;  2ICW G;  1VK5 A;  3M0D A;  4KT0 J;  1WOL A;  3D6Z A;  3M0A A;  4BEJ A;  1LT9 B;  3B0V C;  1S05 A;  1KFM A;  2AXC A;  4C7N B;  1RKE A;  5APU A;  3BCC J;  4Q7C A;  3QVY A;  2Q3I A;  5KKZ B;  3IEE A;  3GEE A;  3L37 A;  1SQP E;  1KD1 Q;  3AEB C;  1VQ6 P;  1Z23 A;  5DJT B;  3JSZ A;  1A02 F;  1U6H A;  4MVZ A;  4XE5 B;  1E83 A;  4E0H A;  1R4T A;  2VC9 A;  3U8P A;  1SQB G;  1NKN A;  3RQG A;  1PV3 A;  2LFF A;  4H13 C;  1M2V B;  2FBW C;  4P6I C;  1RF1 C;  2B9B A;  1VMA A;  1EDJ A;  3MYI A;  1S3J A;  2Q6Q A;  1EI7 A;  3DM5 A;  3NMK A;  1NTM E;  3L75 D;  5A6J A;  1ZHZ A;  3IN6 A;  1K05 A;  3G4S P;  4EDF A;  4N06 A;  3IHU A;  3PJS K;  1ZZP A;  2E5Y A;  4PJN A;  1X9V A;  1QL2 A;  2WL8 A;  1KMI Z;  1SR2 A;  2KOG A;  2CK3 H;  2ZPA A;  2BCC E;  3RGU A;  1H9T A;  2P1A A;  1NU1 J;  5KTB A;  2Q3E A;  2IXO A;  4YK5 A;  2Y3H A;  4FWV A;  1GDT A;  2IX7 C;  2NPS A;  3CQZ A;  1ZHX A;  4WY4 C;  4WY4 B;  3AE9 C;  1BGY J;  3GOD A;  3ATP A;  4MS2 A;  1LT9 C;  4YXW H;  5KLV J;  5L8R J;  2H8P D;  2KSF A;  3IF4 A;  3KMI A;  3V5X A;  1BR1 A;  1MND A;  3TGU J;  1D1A A;  4G78 A;  1KIL C;  2PF4 E;  1RY3 A;  5B1B C;  3K1I C;  4RKU J;  5KAI H;  2W27 A;  2J9V A;  1PGO A;  3RBZ A;  1Q0D A;  2IYP A;  2B87 A;  5L0G A;  1IJD B;  2YL0 A;  3CCR P;  3MX3 A;  4YT2 A;  4PAC A;  1LI7 A;  3G50 A;  3JRM O;  4NQF A;  2R3S A;  1PFI A;  5CHX A;  3Q5P A;  4CSA A;  3CD6 P;  2Q3T A;  3VYW A;  3PDM P;  2XS8 A;  2H7V C;  1S9K E;  4CS9 A;  1BCC G;  2YZS A;  1ZRT E;  2QEX P;  2A0U A;  4PK4 A;  2P0N A;  3UMH A;  3I5P A;  1KN7 A;  2AVK A;  3U2L A;  5TJH A;  4YJW A;  5AW7 B;  3MFN A;  3KZI H;  4IOI H;  4ASV A;  2YLI A;  4PJ0 E;  3V4W A;  1SMY F;  2V7Q H;  3JC2 2;  4C3E A;  3W68 A;  1M2O A;  3A9C A;  3CPW O;  5TIS E;  3VM6 A;  4GT1 A;  1IW7 F;  1Q0G A;  4W7Z A;  1YQ4 C;  1RJ9 A;  1ZW2 A;  3GEH A;  4IFD K;  3OW2 O;  1ZHT A;  1L4A D;  1BGY E;  1SYQ A;  4BJ5 C;  1AJY A;  1FFH A;  1VDF A;  2LKM A;  5CCH A;  3V2P A;  1E5W A;  1OFC X;  4I3M A;  1GL2 D;  4J7Y A;  3ZQV A;  2VCA A;  4JTC B;  1MZ9 A;  3SP1 A;  2I1K A;  3JZ0 A;  2YLG A;  4U5H A;  1NAY A;  3EZI A;  4OIP F;  2LFD A;  2A45 G;  2VCB A;  1NAF A;  3CC2 P;  4MVM A;  5TJ5 E;  4N3Y B;  3RK2 D;  2E76 C;  2HPC B;  1LTG C;  1H9G A;  3C8G D;  3TGU D;  3V2Q A;  2OTL P;  1YYJ A;  3NMI A;  3I55 P;  2W45 A;  3EG9 B;  3WAQ A;  4YPC A;  1JOG A;  5C39 A;  1OW6 A;  5KYU A;  4AL1 A;  4H0L D;  2FFD B;  4JQ0 D;  3KKB A;  2ZXW C;  2RMZ A;  1HWT C;  1FFT C;  2UUI A;  1KYO H;  2MYS A;  2IOQ A;  5A6B A;  3MUD C;  4GYT A;  4MQ9 F;  5AVQ B;  2YMK A;  4MND A;  4EIJ A;  1FDI A;  1R5I D;  4PR9 A;  2XRH A;  2QLA A;  1LTS C;  3AG2 C;  1L0N J;  1N7S B;  1SFC B;  2BEZ F;  3RKO F;  1O87 A;  1BE3 J;  2HS5 A;  2XLW A;  4O6N A;  3DMD A;  1JMW A;  3LLI A;  1GD2 E;  3B9Q A;  5AVY B;  3RVY A;  1K40 A;  5JRA A;  1HUC A;  1NWQ A;  2YEV A;  3S4R A;  3LS0 A;  3LES A;  5L0F A;  1OIP A;  4BXL A;  3TJ6 A;  4YWQ A;  1J1D C;  2P58 A;  3JCU H;  4R4L A;  4GDO A;  3OAK A;  1ORY A;  1AV1 A;  2AU5 A;  2A68 F;  3ABL C;  2XDJ A;  4K7B A;  5EGY A;  3GF3 A;  2QNL A;  3UGO A;  1RE4 C;  1TQG A;  3VF0 A;  2KNH A;  3E1R A;  4RBN A;  1FJP A;  5APS A;  4MVU A;  4MW8 A;  2KC3 A;  3S29 A;  1E86 A;  3CX5 H;  2OYH A;  4MTO A;  3M15 A;  1NKZ B;  3JTL O;  4OVN F;  1KB9 I;  4CS7 A;  1BSH A;  5KYY B;  4A7P A;  4WY4 A;  3L72 E;  3I56 P;  4O6M A;  1NU7 D;  3JRT A;  3WHN A;  2NZ2 A;  4RDA A;  1FMW A;  2Q7C A;  3US6 A;  1TWG A;  3F89 A;  5HSW A;  3OWT A;  2BAS A;  4KI2 A;  2POH A;  2E87 A;  3O39 A;  3MHV A;  2ZVO B;  3T97 B;  1HGV A;  3RK3 C;  3FXD A;  4KHX A;  4DT0 A;  3P8C E;  1NTZ K;  2OKU A;  3H1H G;  2YIU B;  1ZP0 C;  4E0I A;  3NYJ A;  1PP9 G;  1E85 A;  4I44 A;  1OKK A;  1S7Z A;  4GOF A;  1LWU C;  1JY3 O;  3O6Q A;  4DOJ A;  2WSF J;  3L70 J;  2I15 A;  2QIW A;  1VL2 A;  1GM5 A;  3MLG A;  3M9H A;  1N7S A;  3FXH A;  2A69 F;  2HFI A;  1BE3 E;  3QWO C;  5KJ7 A;  2P7V A;  4K0D A;  2J46 A;  2KGO A;  2N9B A;  2HMZ A;  1BCC E;  3EFF K;  2YVK A;  2Q9A A;  5AVW B;  3SEO A;  1YAU O;  3L73 J;  2E42 A;  1LI5 A;  5EFW B;  3M4C A;  3ZVR A;  3R2P A;  2QRX A;  2AEM A;  3PTZ A;  2V26 A;  2HLO A;  2E75 B;  2FYN C;  1RKC A;  2FYN B;  2R05 A;  3TYY A;  2EIM C;  2J0W A;  3PCV A;  3HE4 A;  1WAT A;  3SXY A;  4DJG A;  2DB4 A;  2J9U A;  4MTG A;  1GQA A;  1JY3 N;  1L0L D;  2QE9 A;  2IBZ E;  4HKZ H;  1SQV E;  4WWI A;  5AVZ B;  1RF1 B;  3GM2 A;  3POV A;  4RD9 A;  2G3K A;  2NPU A;  1Q90 D;  5CMZ A;  4JJG A;  1OR3 A;  3EQ2 A;  4AL0 A;  3U9M A;  3QZC A;  4Y28 J;  3CC7 P;  1IZM A;  2BC5 A;  4JUR I;  1G1I A;  1VB5 A;  4CJO A;  3CLQ A;  2HFE D;  2K37 A;  3K66 A;  1VQ9 P;  4EBJ A;  3W67 A;  3WU2 E;  1FZF A;  4JZA A;  2ITA A;  2YO3 A;  5APT A;  3C7J A;  4JC7 A;  3PHL A;  4Z9I A;  1SQB K;  2I1J A;  1ORS C;  2LD6 A;  1VPC A;  1PPJ E;  2ZYG A;  1ZHY A;  1QGK B;  5KJ7 C;  5H2F H;  3TD7 A;  1L4A B;  5CBO A;  2C9L Y;  1NHL A;  2MWQ A;  4PD4 E;  3QTH A;  5EHH A;  1VF5 B;  3B5N A;  2GWW A;  3QW1 A;  2Y3G A;  2OJQ A;  1BCC J;  2J5U A;  3CCQ P;  1YIJ P;  1EDL A;  1J8Y F;  4IJJ A;  2ZT9 D;  4C46 A;  4IAR A;  5KJ7 D;  3E7K A;  3EQL F;  3DD7 A;  2FYU K;  2HSQ A;  2M0B A;  2CCY A;  2OJE D;  2IXM A;  2HJM A;  1OW7 A;  1NU1 D;  2JO1 A;  3HTK A;  3H25 A;  3ABK C;  1HW1 A;  1FBM A;  2GAQ A;  1OKK D;  2DYS C;  1HJ0 A;  3P8M C;  4N6J A;  2FAP B;  3EGX B;  1VOM A;  1QLE D;  1X79 B;  3G4Z A;  1Z6A A;  3V2R A;  5JT4 A;  3FWL A;  3Q5R A;  4O7G A;  5AW8 B;  5KYW A;  3WUT A;  1A7V A;  1Y47 A;  3TGU G;  2BCC G;  1LGH B;  3EFO A;  2KS1 B;  3G71 P;  1RCP A;  1SP4 A;  1L0L J;  1WGW A;  4DXW A;  1Z7Q c;  5L0I A;  1NTK G;  1LT9 A;  3EH1 A;  5A6B D;  2NUP A;  2OYI C;  4H0L C;  1FOS E;  4N6H A;  2CPS A;  3L71 D;  2FXO A;  1HBW A;  2K88 A;  4EUK B;  2Q7R A;  4JYC A;  1RE4 A;  2C03 A;  1KV4 A;  3EGX A;  1P84 D;  1S9K D;  1RXQ A;  3RK2 C;  4BWN A;  3L73 G;  3CXH I;  2L5G B;  3RK3 D;  3S1K A;  5GTH H;  3NG1 A;  2L9J A;  1YJW P;  4KJM A;  1PD1 A;  3K5B A;  3L70 G;  3ZC4 A;  2ZJS E;  5B66 E;  1LE2 A;  3AGU A;  3W2V A;  2YNY A;  1OX3 A;  3B4S A;  4R32 A;  2WVR A;  4O79 A;  1ZR4 A;  4CIH A;  3FDQ A;  1IFP A;  3FOO A;  3M1C B;  1A7E A;  4NTF A;  3H1H E;  3O55 A;  1WTY A;  1LS1 A;  2OCC C;  3S27 A;  2WWW A;  1EZV E;  4YXD C;  2W6A A;  2ZD9 A;  1ZN5 A;  2ZAE B;  2ETS A;  3H2V A;  3MUD A;  1FR0 A;  1M1J A;  2KJG A;  3FVY A;  4XWJ A;  4BJ1 A;  3M0D C;  1PP9 E;  5BQH A;  2R3C A;  3VOP A;  1URQ D;  4W80 A;  1GGQ A;  3B71 A;  4CDY A;  2WVN A;  4NTA A;  1SQX K;  1TFK B;  5H2F E;  2XL6 A;  1R5S A;  2EPL X;  1E79 H;  5APQ A;  4PFP A;  2OG2 A;  4PJJ A;  3R4Y A;  3B0P A;  2HV6 A;  2KLV A;  2O01 H;  4IAQ A;  3K1H A;  1PZQ A;  1T6I A;  2R7U A;  3AQC A;  3L71 J;  2JJL A;  1RH5 B;  4K1O A;  1KQL A;  1CPR A;  4NC3 A;  2O1J A;  1SF8 A;  1S72 P;  1CW5 A;  1R8E A;  1KQF B;  1OR2 A;  2L81 A;  4U5F E;  4WJ0 A;  2XLE A;  3HRN A;  5E2Q A;  3G9R A;  4NCQ A;  5DQZ A;  3E9V A;  4BJ6 C;  2ZT9 B;  3OA7 A;  2W4M A;  2PP6 A;  3GLM A;  3HE4 B;  2WZF A;  3EG9 A;  4MW3 A;  4TLF A;  2WT7 A;  2YXR B;  1ZW3 A;  4OD5 A;  3L70 D;  4JVS A;  2RSE B;  2R03 A;  2WSC J;  3H32 B;  2J45 A;  3FGA D;  4U3F D;  2K9Y A;  1FTS A;  1S5L E;  3SSU A;  3Q7L A;  2ZXX A;  1M6T A;  4WBA A;  4LDK A;  3W4Y A;  2WIT A;  2GUV A;  2L6H A;  1EQ7 A;  1LTJ C;  1L2P A;  1QZX A;  2ZXP A;  3L0I A;  3NKD A;  2Y9Y A;  1TWH A;  4ULW A;  3FXE A;  2XNX A;  5T3W A;  1SQP G;  1SQP K;  2FFD C;  4CJG A;  3HNL A;  1E84 A;  3VTP C;  4OGQ D;  3LW5 H;  1GK6 A;  3B0U X;  2E43 A;  3UMI A;  5L3Q A;  1FAP B;  5CJ4 A;  4QI0 A;  1BDD A;  2XLD A;  3L74 E;  3SXM A;  4M63 A;  1LWU B;  1WMK A;  3H1H D;  4H44 B;  4J7T A;  2W4B A;  3CEX A;  4JPZ B;  1H0T A;  2XM4 A;  1FAV A;  4G7H F;  4GKG A;  5BU8 B;  3MD0 A;  3GWN A;  1FZE A;  3FWN A;  1VQM P;  1Z3I X;  2WVO A;  3DE8 A;  1CGM E;  5A69 A;  5TIS H;  1LP1 A;  2XZR A;  2UWJ E;  4HEA J;  2OEV A;  1P84 I;  4U5D E;  1IK9 A;  5CCG A;  1NSG B;  1IZN B;  1M90 Q;  4DJ9 A;  2DGJ A;  4G0H A;  4N78 D;  4ZNC A;  2QJK C;  1Z63 A;  5BQI A;  1DOV A;  3V5Z A;  1T9K A;  2NUP B;  4E17 A;  3GHG C;  3HKK A;  1ZR2 A;  2E5T A;  3HD7 D;  1OXZ A;  3X1O A;  5T1D B;  1EA8 A;  4Z9H A;  3C18 A;  3A2A A;  2YQY A;  3CSK A;  1FZC C;  1CGN A;  4LER A;  2WPS A;  3I5C A;  5AVS B;  4RES B;  5DJU B;  3VP9 A;  3CCV P;  1V4A A;  3J06 A;  1A7D A;  3DXJ F;  3AEA C;  2KQ9 A;  1ZME C;  3L8I A;  1T6A A;  3KPH A;  3V4Q A;  3L74 J;  4AX2 A;  3KYI A;  3FAP B;  4BG0 A;  4G7O F;  2OTJ P;  2KSE A;  2F22 A;  2GDC A;  2FXP A;  1AVO B;  5FCL A;  1NH4 A;  2W6J H;  5CBN A;  3EGD B;  2P61 A;  1NTK D;  4JEA A;  3C9I A;  3AEE C;  3H1J E;  3H1I G;  2RN0 A;  2IYL D;  2Y69 C;  1NLX A;  1FZC A;  3GWL A;  2V4H A;  1Q0K A;  3L72 D;  4OH8 B;  3E70 C;  3BEH A;  1XZQ A;  4DBQ A;  5KLV D;  3LEO A;  3AGT A;  2R7O A;  3ABM C;  1RE3 A;  1N86 A;  1Q82 Q;  1YYX A;  4HFF B;  4Q4Z F;  4CSA C;  5KLV G;  1QL1 A;  3H1L E;  1YDI A;  1BGY G;  1KYO E;  4QDL A;  2JEE A;  2H88 C;  1KYO I;  2DI3 A;  4YT8 A;  3AEG C;  3T4R A;  3L34 A;  1O5H A;  1H7I A;  2QUP A;  1QX8 A;  4WY4 D;  1NU1 G;  3RBX A;  1UIX A;  4YTP C;  3DJU B;  2H43 A;  3C8Z A;  2A1D D;  1L4A C;  4BEM J;  2Q9I A;  5CCG C;  1PCX A;  2E74 C;  3TOL A;  3RK2 B;  4DOZ A;  4DVZ A;  5AC4 A;  1KIL A;  1KOR A;  2J9B A;  2M3B A;  4HFK B;  3AE4 C;  1NTZ J;  3O6X A;  1AQ5 A;  1N1C A;  4OGQ B;  4LLH A;  1RE3 C;  1VTM P;  2OYI B;  1L0N K;  4IFF A;  2DYR C;  3PP5 A;  2NPS C;  2QTV A;  2B0H A;  1GL2 B;  5HV9 A;  3T9O A;  2OYO A;  5BU5 A;  4PV1 D;  1SQB J;  2YKP A;  3AEF C;  3LW5 J;  1SQV J;  2A06 G;  2YKQ A;  2D4U A;  5FZT A;  3G3Z A;  2PFX A;  2JP3 A;  5KKZ C;  1N7S D;  2OGU A;  1LTI C;  3V5B A;  4LDQ A;  3NMD A;  4B86 A;  4AE4 B;  3IFM A;  4CBE A;  3N4X A;  2EIN C;  1SLQ A;  1S5L X;  3L75 E;  2M5A A;  3D6Y A;  3LAY A;  4U9D A;  3C8V A;  3BCC G;  1LVK A;  1S1C X;  1A0B A;  2GA1 A;  5AW9 B;  1G1J A;  3BRT B;  2YIU C;  2QJY C;  1SQX J;  3N7N A;  2E75 C;  1NFO A;  4KNW A;  2XXA A;  2A45 I;  3KZI E;  4N4W A;  3CX5 I;  4JBZ A;  1WAS A;  4W7Y A;  2CYD A;  1Q2N A;  4E7Z A;  1DEB A;  1SFC C;  5APV A;  1G2C B;  1MMA A;  3WMM 0;  4GOD A;  4P9T A;  1JPJ A;  2CNW D;  3P7K A;  1GTW A;  1HF9 A;  2J7P A;  1HTL C;  2OAR A;  1QLE C;  1AUE A;  1L0N D;  2W8Z A;  5E3C A;  3BCC D;  4LGD E;  1M1J B;  3L70 E;  3WG7 C;  2M4E A;  4EKW A;  3U3F A;  2R02 A;  3GM3 A;  3RH3 A;  1NTZ E;  2KLU A;  3CWB E;  1P84 H;  5JS5 A;  1JY2 P;  4U5B E;  2FY8 A;  1FJK A;  4EOT A;  2AWY A;  2ZT9 C;  3NFQ A;  5KLI B;  4EWC A;  1Q0M A;  1KIL E;  3C8G B;  2R32 A;  2VB6 A;  1NGM B;  4IWB A;  2NSF A;  3UIA A;  5GPG B;  4FES A;  3JYH A;  4EBK A;  2P2U A;  4HB1 A;  4H13 D;  4DBR A;  1YA9 A;  2IBF A;  4ZKP A;  2FYZ A;  5KLV K;  2M3E A;  3VMZ A;  1YIT P;  4CDV A;  2NPS D;  3L72 G;  3AOU A;  3U9J A;  3U1C A;  1PIX A;  1NTK K;  3EJN A;  5K5G B;  1ZHW A;  1M7L A;  4ULV A;  1V74 B;  1EXI A;  1G2C A;  1ZVZ A;  1QPU A;  2HMQ A;  3H1J J;  3L71 G;  4E7S A;  3LEV A;  1A02 J;  2ZXR A;  2BEQ D;  5IY5 C;  3ZWI A;  2YL1 A;  2XLV A;  3CX5 D;  1CI6 B;  2N1T D;  4EHP A;  1PGP A;  1LTB C;  1Q0F A;  3AJM A;  3AE5 C;  1G8X A;  4XFJ A;  1EZV D;  4OIN F;  4JW1 A;  5DS5 A;  3L8J A;  3M79 A;  2WSE H;  2P10 A;  2AWC A;  4JTA B;  2LR2 A;  1LT1 A;  2FFD A;  3LJB A;  5KAF H;  4UB6 H;  3TNU B;  2Q4F A;  3JSE O;  2YKO A;  2QM8 A;  5JVE A;  2KP8 A;  1PL5 A;  1PGQ A;  1JPN A;  3RIP A;  4C3D A;  3KYQ A;  1J2J B;  1JTH B;  4C7O B;  2OQQ A;  3X2Q C;  1KYO D;  3FMS A;  1V55 C;  1D0X A;  5KYN A;  1KTM A;  1SQV D;  4NTB A;  1OXB A;  4H44 C;  1W2W A;  3W2W A;  2HV7 A;  2J7P D;  2L91 A;  2ZFC A;  1RMV A;  4OIQ F;  2CNW A;  3CI9 A;  1R5L A;  1VQ7 P;  3DZA A;  1SQV G;  5B3S C;  4PFO A;  1M1K Q;  1ZU5 A;  1H0T B;  4AK9 A;  2AEJ A;  1K8A Q;  1D1C A;  3EZH A;  5COG A;  2Y0C A;  1CSB A;  3H1L G;  3CCM P;  2JPU A;  5CJ0 A;  2FYU E;  2Z15 A;  1FC2 C;  1A41 A;  2WPR A;  2XS1 A;  3CCU P;  4MVR A;  4JTD B;  2Z5I A;  1BZ4 A;  1UFB A;  3U0C A;  4E18 A;  3S28 A;  2EPN A;  2YKZ A;  3SXK A;  4H44 D;  3OEO A;  1EXJ A;  3B5N B;  1LKX A;  1DX7 A;  3E1I A;  3NRH A;  2G8Y A;  1D0Z A;  2WSS H;  2ZXE B;  3S90 A;  1MQV A;  1HE1 A;  2E75 D;  5CCG D;  2OTK E;  1Y4C A;  2B0J A;  1IO4 A;  5GTI H;  3RL0 B;  2IXP A;  2P7J A;  3Q1M A;  3ZTZ A;  5AW2 B;  1DD3 A;  3P8C D;  4C3B A;  3KH2 A;  3GG2 A;  1ZYR F;  1SQP D;  1OXK A;  1HGZ A;  2W9Y A;  1URQ A;  3QW0 A;  3TUL A;  4UDV A;  1KC8 Q;  5L3V A;  2RKL A;  3L73 D;  2N9Y B;  3SFD C;  4L6R A;  4A4A A;  1USD A;  3KPE A;  2IZ0 A;  1UII A;  2IFM A;  4PV1 C;  1NU1 K;  1K9M Q;  3H1I J;  3H1K J;  3V2N A;  1AA0 A;  2KK7 A;  1T2K D;  1M1J C;  3A0H E;  2FYU D;  5T3T A;  1L0N E;  2B87 B;  2IBZ G;  2KZJ A;  5F5F A;  4WB4 A;  3WUV A;  3EH2 A;  2PP4 A;  1NG1 A;  4CS8 C;  1YAR O;  5B5E H;  1Q86 Q;  1GL2 C;  1XZP A;  3AE8 C;  1DIP A;  4DCK A;  2KK1 A;  2NG1 A;  2XXA B;  2M64 A;  3BRV B;  1RF0 C;  4GQH A;  3HUS B;  4JJF A;  1S2E A;  2LQG A;  2XM0 A;  4JRZ A;  2UUH A;  4Z9J A;  1CI6 A;  4PV1 B;  4LLC A;  5JSL A;  1SQB D;  3A3Y B;  2KNC A;  3LID A;  2G3A A;  2OYI A;  5GTI E;  2GFH A;  3DAF A;  2ASR A;  2P67 A;  1E2X A;  3UGP A;  1LTT C;  4Z1M H;  3B8E B;  3IR9 A;  3DE9 A;  1YTZ I;  4PJM A;  3ZIB A;  1HMO A;  1Y9B A;  1QKR A;  2NPS B;  1L0L E;  1OW8 A;  2K3R A;  4H0L B;  1HJB A;  1Z5Z A;  3TDK A;  4DRI B;  1SQX D;  4O9B A;  1VF5 D;  3EHM A;  3U8V A;  3L1M A;  3ABV C;  1SQX E;  3HNI A;  1O3U A;  1USE A;  4EI2 A;  1M56 C;  3CCE P;  1NZE A;  3RW0 A;  1MFT A;  1OWA A;  2O01 J;  2HKV A;  2WPV B;  2N1T C;  1D1B A;  2R5B A;  3FAJ A;  4NPF X;  3R7C A;  1H88 A;  3CCS P;  5CCH D;  2PGD A;  3MIW A;  1IFN A;  2R7T A;  3HUS A;  2G62 A;  2EIK C;  1FE6 A;  3V6I A;  3LS1 A;  1VQP P;  2AEF A;  3FOP A;  1Q7Y Q;  4WAB A;  3ASO C;  3SWK A;  3USS A;  4IL6 H;  3KL4 A;  3ASN C;  3SYN A;  3L35 A;  3SNH A;  2L6F A;  4YT4 A;  2W6B A;  2PFD A;  1NTM G;  2YL7 A;  3AE2 C;  3EFO B;  1EDK A;  2R5D A;  3CWB D;  3RL0 C;  1NTZ D;  1GW4 A;  5DLJ A;  1N73 C;  5B1A C;  3I5Q A;  1LTJ A;  1KQG B;  4NPD A;  1FS0 E;  3L73 E;  1HY5 A;  2YWA A;  2G3V A;  3HD7 A;  1GMJ A;  1PP9 J;  2XKM A;  1F1M A;  4IGG A;  3HJC A;  3TSI A;  3H1H J;  2JD3 A;  3W8I A;  4UB6 E;  2XU6 A;  3AE7 C;  3L75 G;  2C0W A;  1IFD A;  2HOD B;  3KQG A;  1ST6 A;  4N6C A;  1BGY D;  2H89 C;  1D0Y A;  3TQO A;  3T6B A;  1LM3 B;  2XSE A;  4NY3 A;  2EPK X;  3C62 A;  2J58 A;  4QI2 A;  3BRJ A;  2E74 D;  2OU6 A;  1BR2 A;  2VCC A;  1M8O B;  5AW4 B;  3CL3 D;  3H1I D;  4EYY Q;  3HD7 B;  3VAY A;  3ZTM A;  1HVV A;  1VLS A;  3IQC A;  1GL2 A;  4I7Z C;  3QVZ A;  3Q3D A;  4U5G A;  3I4U A;  2KXP B;  2VH3 A;  2IM8 A;  4CS8 A;  1U57 A;  2LIG A;  2PX3 A;  2RD9 A;  1KNY A;  2NRG A;  1BBH A;  4UB8 H;  1ZRT D;  3M9Q A;  1WT6 A;  3B5N C;  1MMD A;  1RQU A;  3AG4 C;  3N0T A;  2OOC A;  3KYJ A;  3Q7G A;  5M1B A;  3UMK A;  3CZ6 A;  2MKV A;  2D5R B;  2O01 N;  1VQK P;  1YBK A;  1OCZ C;  4WGY A;  1LWU A;  2BCC D;  4LAC B;  3AED C;  4LLE A;  1T3J A;  2PAJ A;  4AUW A;  4IB4 A;  3RQF A;  2WQY C;  1JAF A;  4IL6 X;  4QMA A;  2LXB A;  3V5Y A;  1KB9 E;  1HW2 A;  3GF7 A;  2KYV A;  1W5C E;  1QQ3 A;  2B89 A;  3U59 A;  1N7S C;  2Q00 A;  1SQB E;  4BJ5 A;  3JSV C;  1WRG A;  2Y9Z A;  2NUT A;  2VRS A;  1GU5 A;  3EHN A;  4L73 A;  3JCU E;  2TMV P;  3L74 D;  4KNV A;  4OWF A;  1OVV A;  3ZDM A;  3L75 J;  3JYY A;  1UG7 A;  3CX5 E;  1L0N G;  1Y6D A;  2NSG A;  3HD7 C;  3GHG A;  3A7O A;  2QY9 A;  1TU3 F;  1LTJ B;  1X0T A;  3QH9 A;  3L36 A;  2WVQ A;  5DQT A;  2HSB A;  1YI2 P;  4ANJ A;  1VYI A;  1MUU A;  1CPQ A;  1YHQ P;  4IFM A;  3AQB A;  1ZU4 A;  1T6Q A;  1OZH A;  1KZU B;  2WT7 B;  1CGO A;  3HTK C;  1NTM J;  2GM4 A;  1L0L K;  1DEE G;  3DJN B;  3TNU A;  3UR3 C;  1L7C A;  2HR3 A;  2XL4 A;  2ZVN B;  2WZL A;  4EBB A;  5AW3 B;  1JOC A;  4I1M A;  2IYO A;  1SQQ K;  4C7O A;  4G7Z F;  3IQT A;  2K9J A;  3H1K D;  1NU9 C;  5L0D A;  2QM7 A;  1K73 Q;  3BAT A;  3RL0 D;  1J1D B;  1QVG O;  3II6 A;  1T6U A;  1AFO A;  4MN4 C;  3WOD F;  3TJ5 A;  1DD4 A;  1NTK J;  2WTY A;  5JLI A;  3TF5 A;  4JE9 A;  1CZQ A;  3GHG B;  4BJT A;  1EKY A;  1L0L G;  2A45 H;  2IZ1 A;  2BCC J;  4D6T J;  4H54 A;  5F28 E;  4MVO A;  4AQR D;  1VF5 C;  2XV5 A;  2M8R A;  4XPY A;  1PD0 A;  3MBG A;  2LP4 A;  2KW3 C;  1VQ4 P;  2H7O A;  4J32 B;  1QEX A;  5E33 A;  1JCC A;  4R4M A;  1YQ3 C;  1VLT A;  4DVY P;  1GK4 A;  3NYM A;  4MTF A;  2MHR A;  2EIL C;  1U0B B;  3S84 A;  5L0H A;  1M56 D;  4BPM A;  2W90 A;  2WSF H;  2SPZ A;  4Y99 C;  4ZLC A;  1SS1 A;  5APX A;  1MMG A;  2P1J A;  2FGY A;  4ZLD A;  3IPM O;  1OCC C;  2YHS A;  3BVH A;  2I8B A;  5BQG A;  2PNO A;  1FOS F;  3LNM B;  2QVA A;  2PBE A;  5EK0 A;  3LUT B;  4O6Y A;  5BUO A;  1N73 B;  4W8K A;  3VN0 A;  5CIV A;  1JEK A;  1KQS O;  3L4F A;  4IRU A;  1RHZ B;  4U7J A;  2R7W A;  1G4W R;  2A6H F;  1C02 A;  2Y3D A;  1J8M F;  2YMY A;  2R7V A;  3VRC A;  1VYK A;  4OD4 A;  1Q81 Q;  2IXN A;  4I1L A;  5AW5 B;  1OVU A;  1LNQ A;  2HOD A;  3H1K G;  5AGF A;  2GA0 A;  3CCL P;  4D6T G;  1Y8A A;  2KIK A;  4D4X A;  1IFM A;  4PJ0 H;  3RK3 E;  4X0R A;  4WVZ A;  2I8D A;  1J1E C;  1NFN A;  2L7A A;  4PJL A;  2A06 E;  2QA4 P;  5KAI E;  3MTU E;  1EC5 A;  1I5N A;  1KU2 A;  3GM1 A;  4XEF A;  2KYH A;  3IQ5 A;  5K0I A;  1N73 A;  5KYX A;  4XA4 A;  3N2Z B;  4CS9 C;  1XTG B;  1APC A;  3EPV A;  5AVU B;  1T2K C;  3H1L D;  1IK7 A;  3SFE C;  1KB9 H;  2B88 A;  3CXH E;  2QSI A;  5KLV E;  4I2L C;  2Q9C A;  1LP1 B;  3LNR A;  4JCH A;  1YJG A;  3ZQY A;  2R9R B;  4ASW A;  2Q1K A;  256B A;  5B3I A;  1SQQ D;  1W2B O;  4CPG A;  3H1J D;  2FFH A;  4GIF A;  1DOW A;  1YTZ T;  4P9F A;  2ZYA A;  1OCR C;  3T97 A;  4XLN F;  2LSE A;  4BRY A;  1U7J A;  1WN0 A;  4MVS A;  1ZOY C;  3C8G A;  4UB8 E;  3S0X A;  2Y0D A;  3HE5 B;  4JF7 A;  4K3A A;  2JKV A;  5AW1 B;  1OCO C;  3V7O A;  3RF3 A;  3U5S A;  1N7L A;  1T8Z A;  2Z4E A;  1JMM A;  1EZV I;  1LJ2 A;  3Q2Y A;  3ZG1 A;  3AE1 C;  3LIE A;  4C7R A;  4JIO A;  4XQ1 A;  1MFZ A;  3PHF 2;  1EDI A;  4WGZ A;  1PP9 D;  2H7H A;  3AG1 C;  3JT1 A;  1S5L H;  5JP7 A;  2HYN A;  1T5O A;  4XPX A;  2KSJ A;  2EPO A;  1FMV A;  5KYY A;  4JEB A;  2YO2 A;  1V54 C;  1X22 A;  4DRH B;  3DWW A;  5BVZ A;  1I4Z A;  4C7N A;  1RKE B;  5D92 A;  2K1A A;  3GMA A;  3SZR A;  2IBZ I;  3Q6M A;  4OIR F;  3CC4 P;  1OMI A;  4Y99 B;  3OJA B;  4N78 E;  3TOM A;  1OVR A;  2Q5U A;  1PGJ A;  4ONS A;  5AVX B;  3F5H A;  3SWY A;  4XLP F;  1IC2 A;  4JYB A;  1ZV8 A;  4HE8 D;  3JCU Q;  4YL1 A;  1VQL P;  2KZI A;  3VMX A;  3CME P;  2J0X A;  1ORJ A;  1YZC A;  2LCH A;  3NXS A;  1YJN P;  2N1T B;  4LDR A;  2OEX A;  4IL6 E;  5L0C A;  5JUA A;  2QJP C;  3L72 J;  1VQN P;  3HUS C;  3ZSU A;  4MVQ A;  4FAP B;  2Z5H A;  3TGU E;  2XLM A;  2KB7 P;  3O10 A;  4NPE A;  2E74 B;  4B6I A;  1JNM A;  1NVO A;  4YN0 B;  1JM0 A;  1BE3 G;  1JCD A;  4YT5 A;  3H65 A;  3GW6 A;  3DM9 B;  3L71 E;  1BR4 A;  3H6P A;  1N8R Q;  3U2M A;  2H8A A;  3T6G B;  2Y3B A;  3K7D A;  4U5C E;  5E3A A;  1C17 M;  2HJ3 A;  2DW3 A;  2KUB A;  3Q6N A;  3PH0 A;  2C9N Y;  3O6Q B;  1MNE A;  1JY3 P;  5L0J A;  5CCH C;  1L3P A;  2ZXO A;  1Z56 A;  2NUT B;  2P6V A;  2R7X A;  1ZW0 A;  2WSC H;  1RJ9 B;  4J30 B;  4AYC A;  2WZ7 A;  3MZW B;  2JWD A;  3HTK B;  5DS6 A;  2VAS A;  3D71 A;  4CDA A;  3BAS A;  3HNJ A;  4U3F E;  5E79 H;  2D2C D;  4ZKU A;  4D6T D;  4GOE A;  4L74 A;  2FXM A;  3GAN A;  5GTH E;  1JY2 N;  3AE6 C;  3WUU A;  1LE4 A;  1QVX A;  1MKM A;  4BRY B;  3D70 A;  2E76 B;  4XEV A;  1U7M A;  3A11 A;  4K35 A;  2O9X A;  2BL2 A;  1X8Y A;  1SQX G;  2E76 D;  1AVO A;  2R44 A;  1PPJ D;  2HZ8 A;  2JR8 A;  3N24 A;  4PD4 D;  3O8Z A;  3RFY A;  1LS4 A;  3A0B H;  2FKW B;  2D2C C;  3AG3 C;  1KIL D;  2FYU J;  1BDC A;  2WPQ A;  3EFG A;  3ITK A;  1YYC A;  2CPB A;  3VYI A;  3GEI A;  1FZC B;  1I4Y A;  5B66 H;  3SWF A;  4TT3 H;  1TWC A;  3QMK A;  1W2E A;  3EGD A;  5AW6 B;  3H2U A;  1J1E B;  5CI9 A;  4CX9 A;  1VQ8 P;  2O1K A;  5F5H A;  2L6G A;  2QJK B;  3BCC E;  1TFO B;  1JUN A;  2N1T A;  4U9E A;  1G5Z A;  2CW0 F;  5AVV B;  3NYL A;  2K9J B;  1TWA A;  1FZA A;  1MMN A;  1NBB A;  1KB9 D;  1LIH A;  3FX0 A;  1JMB A;  5COM A;  3CMA P;  2M5A B;  1K04 A;  3TK0 A;  1NTZ G;  2A6E F;  5AW0 B;  2QG4 A;  1AQT A;  2BE5 F;  2IBZ D;  3VP8 A;  1XWJ A;  3M9B A;  1LTA C;  2RH0 A;  2Q9B A;  2LK4 A;  5E79 E;  1WWP A;  4H4K C;  3A0H H;  1H8A A;  4XEK A;  3DAG A;  5AC5 A;  4PD4 I;  2HPC A;  4LC1 A;  3U1A A;  1FDO A;  1YLM A;  4BJ6 A;  2OYH B;  2OYH C;  1N2D C;  3VMA A;  4U5E E;  3KDP B;  5COF A;  2AXT H;  3HE5 A;  5KYU B;  2V7Q J;  1BCC D;  3T6J A;  2C04 A;  3F46 A;  1XTC C;  1U89 A;  3CWB J;  1C03 A;  4HYT B;  4CIP A;  1NTM K;  3K1I A;  1BDJ B;  1PPJ G;  1OQC A;  3PRJ A;  1ZLL A;  2WB7 A;  5D91 A;  3B5N D;  3CWB G;  3G4X A;  3WU2 H;  4HJG H;  1HE9 A;  3M06 A;  2C0X A;  3G6E P;  5APY A;  4ZMD A;  3AEC C;  2OQM A;  4DRJ B;  3L74 G;  4PD4 H;  1JRA A;  1M2V A;  1GW3 A;  2EIJ C;  1GZL A;  3ITF A;  3RQE A;  2QJP B;  3S9O A;  3AE3 C;  1JR8 A;  2YLD A;  2HG5 D;  1EQ1 A;  2XND H;  3B29 A;  5KLI C;  2PX0 A;  4JCZ A;  2AXT E;  4HH2 A;  3CCJ P;  1YVI A;  3H32 A;  2CDQ A;  5AVR B;  2J9W A;  2JDI H;  1H89 A;  2O3J A;  1JTH A;  2R7R A;  2CGE A;  4DZO A;  3RK3 B;  3F47 A;  1LPE A;  3CXH D;  1M57 C;  1EZV G;  2X0C A;  2YXQ B;  4D4N A;  1SVF A;  1S4X A;  4FX5 A;  4A2N B;  1RF1 A;  3H1L J;  3HNK A;  3K6B A;  2J8W A;  1B68 A;  3LLK A;  1NTK E;  5DS4 A;  4M3L A;  4Q5S F;  3KHU A;  2IDB A;  3NTN A;  1RF0 A;  1MV8 A;  1AEP A;  3H1K E;  1AVY A;  5KAF E;  3C63 A;  3KXD A;  1RQV A;  2A06 D;  4D6T E;  1FNT c;  4W8P A;  1JB0 J;  4AE4 A;  5AVT B;  3NKE A;  4XPW A;  2A0B A;  4L76 A;  4L75 A;  3VMY A;  4KC9 A;  1FDM A;  2FYU G;  2KS1 A;  1TKN A;  1SQV K;  4OIO F;  3MP7 B;  4RJT A;  4XTK A;  1SQQ E;  1SZI A;  1VQ5 P;  4H13 B;  3FHD A;  3HLZ A;  3RL0 g;  2ZYD A;  3K33 A;  2W83 C;  3IAO A;  2XLH A;  1URQ B;  1VQO P;  1URQ C;  2YRF A;  3M4B A;  3ECS A;  3Q5S A;  1YZA A;  1SFC A;  1QSP A;  1D7M A;  3RVZ A;  2QE7 H;  3CAX A;  3U3B A;  5A6K A;  4I6M C;  1T3U A;  2IPP A;  1KIL B;  2X51 A;  5B5E E;  1L4A A;  3H1J G;  1SQP J;  4EIY A;  1FU1 A;  1GS9 A;  1SQQ G;  1GU4 A;  2R7S A;  3M91 A;  3A5T A;  2JWA A;  4U3F G;  2PRR A;  2WMM A;  1NOH A;  4IAO A;  3CXH H;  1NJI Q;  1JO5 A;  1T01 A;  2MJZ A;  2AP3 A;  3PMR A;  2YL3 A;  2XLO A;  2D2C B;  1FZG A;  2LXC B;  1TR2 A;  4I7Z B;  4I1O B;  2EPM X;  1YA7 O;  3A0B E;  2KNC B;  1ZXG A;  5APW A;  2H7B A;  1BSN A;  3GOR A;  1P84 E;  2WSE J;  1IFI A;  1IFJ A;  3RYL A;  1NYH A;  1QVF O; 
#chains in the Genus database with same CATH homology
 2E76 D;  2E74 C;  2J5U A;  2PBE A;  1KOR A;  1DD3 A;  1JOG A;  2D2C C;  2ZT9 D;  3AE4 C;  1OW6 A;  3AE9 C;  2JX0 A;  4H0L D;  3T97 B;  5L8R J;  3JYY A;  3B71 A;  3TUL A;  4OGQ B;  3GMA A;  1PIX A;  1ZP0 C;  3SFD C;  1OW7 A;  4TT3 H;  4U7J A;  2L6F A;  1OMI A;  2JO1 A;  3R4Y A;  1TU3 F;  3H25 A;  1EXI A;  4PV1 C;  3AE2 C;  2HSB A;  3O6Q A;  2L6G A;  1HJ0 A;  2WSF J;  4PV1 D;  2QJK C;  2YMK A;  2QIW A;  1FDI A;  3AEF C;  3LW5 J;  1VL2 A;  4RKU J;  2BEQ D;  1KQG B;  2IDB A;  3Q5R A;  2JP3 A;  5KKZ C;  1R8E A;  2YWA A;  1KQF B;  3AJM A;  3AE5 C;  1RQV A;  1GMJ A;  4XFJ A;  3G9R A;  4NQF A;  1JB0 J;  2BEZ F;  3EWK A;  3RK3 E;  2ZT9 B;  3Q5P A;  1S5L X;  3D6Y A;  4OGQ C;  3AE8 C;  1DIP A;  3GLM A;  3AE7 C;  3C8V A;  2KK1 A;  3C18 A;  1S1C X;  3L8J A;  2P10 A;  2QJP C;  1K04 A;  4H0L C;  3GM1 A;  2H89 C;  4XEF A;  2YIU C;  4KT0 J;  1WOL A;  2QJY C;  3D6Z A;  3BRJ A;  2E75 B;  2E74 D;  1ZRT E;  2E75 C;  2FYN C;  1K40 A;  4PV1 B;  1PL5 A;  4H13 B;  3O10 A;  2WSC J;  2LK4 A;  1WWP A;  1V4A A;  2E74 B;  4XEK A;  3RL0 g;  1DD4 A;  3FGA D;  3GM2 A;  3MFN A;  1IK7 A;  2G3A A;  2K9Y A;  3SFE C;  3IAO A;  2OQQ A;  3AEA C;  1ZME C;  1Q90 D;  3L8I A;  2QSI A;  1KTM A;  4R4L A;  1FDO A;  4I7Z C;  3Q5S A;  4Z1M H;  3Q3D A;  3K7D A;  3AEB C;  4GDO A;  4H44 C;  1U57 A;  2FXP A;  4Y28 J;  2V7Q J;  1Y9B A;  1HF9 A;  1YQ4 C;  3GF3 A;  1KNY A;  2L6H A;  5F28 E;  1OW8 A;  1VF5 C;  4H0L B;  1RQU A;  3RQG A;  1PV3 A;  5M1B A;  3AEE C;  4H13 C;  1VF5 D;  3U3F A;  1AJY A;  2MKV A;  2FBW C;  4EBJ A;  3GM3 A;  2JPU A;  1ZOY C;  4R32 A;  3ABV C;  3C8G A;  4R4M A;  3AED C;  1YQ3 C;  4OGQ D;  1UFB A;  3U0C A;  3D71 A;  3RQF A;  2WQY C;  1O3U A;  3IN6 A;  1K05 A;  4H44 D;  3AEC C;  1WTY A;  1EXJ A;  3Q2Y A;  3JZ0 A;  4IL6 X;  3AE1 C;  2D2C D;  2D2C B;  2ZT9 C;  4I7Z B;  1ZZP A;  3RQE A;  2H88 C;  1KIL E;  3S9O A;  4YXD C;  3GF7 A;  1WMK A;  3AEG C;  2G8Y A;  3AE3 C;  2O01 J;  1KMI Z;  4H44 B;  3C8G B;  2WPV B;  3AE6 C;  1NGM B;  1UIX A;  1QVX A;  1MKM A;  2E75 D;  4YTP C;  2Q00 A;  2WSE J;  2E76 C;  3D70 A;  2E76 B;  5KLI C;  2NZ2 A;  4XEV A;  3C8G D;  1NYH A;  4EBK A;  1VF5 B;  4H13 D;  3Q1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...