3SBCA

Crystal structure of saccharomyces cerevisiae tsa1c47s mutant protein
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
195
Chain Sequence
VAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVSPTEIIAFSEAAKKFEEQGAQVLFASTDSEYSLLAWTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEGVALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATIKPTVEDSKEYFEAANK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin TSA1
publication title Disulfide biochemistry in 2-cys peroxiredoxin: requirement of Glu50 and Arg146 for the reduction of yeast Tsa1 by thioredoxin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 64
structure length 195
sequence length 195
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3sbcA00
2DJ0A 3Q18A 4IQ1A 2ON5A 3HA9A 1A2JA 2O87A 4X0XA 6GSYA 4DVCA 2IWTA 1U3IA 2CVDA 2VL3A 1Y6EA 2PBJA 2FWHA 2F9SA 3KMOA 4F2IA 2AB6A 3UMAA 3IC4A 3UBKA 1DBYA 2MBSA 4HS1A 3LG6A 3ME8A 1OC3A 2YOIA 1GSEA 4TRXA 5JCUA 4K7IA 5HFIA 1GTAA 2WRTA 5ECRB 2H71A 1AC1A 2TRXA 5ECLB 3UL3A 5CRWA 3VWUA 4OWYA 1GNWA 3I6AA 2P5QA 4PUAA 3QAWA 3D4TA 2MYGA 2YWMA 1MD3A 3DRNA 4IBPA 5D73A 4BWSA 4KDUA 1A2MA 1JHBA 2C0GA 4LLRA 2GZYA 2R3XA 4F0CA 1F3AA 1M7TA 4CDOA 3VURA 2HT9A 3M9KA 2GTUA 1FAAA 2BTOT 4OO4A 1VRSD 1PN9A 1XOBA 1TU8A 3KTBA 2L57A 5J5NA 1UVZA 1A0FA 4N0VA 3UOMA 4ML1A 1HNCA 4OFMA 2IMFA 1XZOA 4IELA 4WR5A 3KJYA 3GSSA 1CQHA 3D4MA 3DYRA 3O3TA 5G5EA 4I5QA 3RPNA 3A5WA 1S3CA 3ZFBA 4LMVA 22GSA 3HZ8A 1UC7A 3S9FA 1JZWA 2I4AA 3D5JA 4RI6A 4V1Ap 5CP1A 5CNWA 1R26A 1LJRA 2K6VA 4GSSA 1S3AA 4PQHA 2GGTA 1T4YA 2VCZA 1B9XC 1TI3A 4KNDA 5HR3A 2LTKA 1ILOA 2REMA 4NMUA 1E6BA 3UJ1A 2VCTA 4D73A 1FVKA 4V2LA 4KUNA 3F3RA 2GQMA 4G19A 2L6DA 5F05A 3HHVA 2B1KA 3UVTA 3BBYA 1T3BA 3N9JA 3QOUA 2ALBA 1EV9A 2FD3A 1SL0B 2NVLA 2MZCA 1X5DA 3IRAA 4MF6A 2VLTA 4K0NA 1GSSA 4YAPA 1HNAA 2RUEA 5DDLA 5D9TA 2EIRA 8GSSA 1N2AA 2OJLA 3GTUB 3LGCA 3GV1A 3IXRA 5CRDA 2B5XA 1EP7A 3GKMA 2N5BA 3GH9A 4RI7A 1K0NA 3GTUA 2HZEB 1SL1B 5ID2B 2TRCP 3HY2A 3FYGA 3L9UA 3GIXA 3LWAA 1FOVA 1EOGA 2YZHA 4L0WA 2HZEA 4ZB8A 5F07A 5ID2A 3DIEA 4JR4A 2HLSA 2IMKA 4I2UA 4AF2A 3GSTA 4MF5A 4Q5FA 2CVKA 5EY6A 2C1YA 1BQ7A 2LJAA 5ECIB 2WJUA 2XC2A 1GSYA 3R2QA 2FGXA 1PGTA 2CAIA 1ACVA 3KCMA 1GNEA 2HXKA 1EGRA 2ES7A 3BD2A 4NV2A 6GSTA 2H01A 2FHEA 2JZRA 3ED3A 3SWLA 5ECPB 2YV9A 2YV7A 3VWWA 5DAKB 3W8SA 1WWJA 2YP6A 4F9ZA 13GSA 1GULA 4MK3A 4I8BA 4K7NA 3C73A 1MDIA 1YDKA 2CAQA 5JCWA 3ZYWA 2H76A 3TKPA 1XVWA 1R5AA 4G2EA 4EO3A 3EMPA 1USBA 3EYTA 4GQFA 5B6NA 1GUMA 1M2DA 4WF5A 4BVYA 4KDYA 4XCSA 2DJ2A 3TRXA 1JLWA 3TGZA 1G0TA 3A3TA 2H1GA 1W89A 1BX9A 1Z7PA 2R37A 2YWNA 3TRQA 4MZCA 4O92A 2X8GA 3LEFA 4HOJA 11GSA 2L5OA 3HYPA 1TP9A 4WF4A 4KCEA 2D2ZA 1M0UA 3C1SA 3HKRA 3GFKA 3LXZA 1AQXA 4IKHA 3BJ5A 3KEBA 2OA7A 1PKWA 4OD7A 1B4QA 2MMOA 4TR3A 2GT5A 1X5CA 3GA4A 1XWCA 3KP8A 1X9SB 3TJFA 2IPAA 3TOTA 3UBLA 2PMTA 4HUAA 3TJGA 1Q4JA 4EXJA 1OVNA 3ZMKA 4EDYA 2GQLA 3GKXA 4FH8A 3L9VA 3IA1A 1M2BA 1OYJA 2QGVA 3FZ4A 3RAZA 3TB2A 1UN2A 4ML6A 1QXHA 1KEBA 1K0OA 2LQOA 1YF0A 3F4RA 4MJAA 1DE1A 2WB9A 1XW6A 2K18A 4IGJA 4IQAA 4IVFA 3H1NA 1JLVA 4ZL8A 2J9HA 5GSTA 1FO5A 4MF7A 4FYCA 3JCML 1TK5B 4JR6A 2AUVA 5KN2A 1SK1A 5ELAA 5GSSA 2H0HA 2OADA 4KA0A 1EZKA 3GKNA 4ZL9A 4PQIA 3UAPA 4ACSA 4XHMA 1VF1A 5J41A 1OC9A 1RW1A 4K2DA 3NOFA 5CREA 4PGTA 3G7IA 2V6KA 4EVMA 1R4WA 2M46A 2M72A 2ZNMA 3IK7A 1XWGA 3GMFA 3APQA 1GP1A 3CXGA 3KGKA 2CZ3A 3VPQA 4YH2A 3IHQA 3ZL5A 4KSMA 2C4JA 2VL9A 1T7PB 2B7KA 1F6MC 1HNBA 2I1UA 2DC5A 2LKUA 4HZ4A 1YKAA 1G6WA 5AIVA 2FWEA 3F9UA 2VLVA 1FB0A 4V1Ag 2R2JA 4PQ1A 1THXA 5INYA 3M9JA 3J7Yb 5DVBA 4KW6A 3HZ4A 2EIQA 3GHAA 1XFLA 2LUSA 2ZUPA 5IO2A 2HRNA 2MMAA 3VWXA 4ZL7A 2P31A 5CO3A 1F3BA 2PVOC 3F0IA 3KM6A 2JSYA 4KX4A 1TKDB 1EEMA 5HR1A 5H5QA 1VF4A 2M80A 1K0MA 2BJXA 4EF0A 2VAFA 1TK0B 2EIOA 1TDIA 4MJCA 3F4SA 4PNGA 3A2WA 1ZL9A 2VD0A 4MJBA 1V57A 3ZREA 2CT6A 2HZFA 2R4VA 2VIMA 2AHEA 2VL2A 3IAS2 3CRUA 3KTLA 1X0RA 3EINA 4N0ZA 4YAVA 5H5SA 1G7EA 4DSQA 5IM9A 4EUYA 4ZILA 1GTIA 4YQUA 14GSA 3L78A 3KXOA 3M8NA 1SKWB 3GRXA 3QFAC 2LS5A 4KGIA 4J56E 5KN0A 2MMZA 4HJ2A 1ABAA 2X8HA 3TKQA 5B8BA 4XRDA 2H19A 5DJLA 2HE3A 1GSFA 3VWVA 4GCIA 3N5OA 3P2AA 3DEXA 2DJ3A 4EL1A 3J7Yk 2LQQA 2OE3A 1Z9HA 3GX0A 2DJKA 3HVVA 4Q5RA 1LU4A 4DEJA 1LBKA 3V1WA 3EVIA 4KH7A 10GSA 2F8FA 1K3OA 1HQOA 4KCAA 1MEKA 5J9CA 4HZ2A 2O85A 2NDOA 3HJOA 4NV5A 3ZIJA 3BCKA 2GSRA 2DMLA 4LL1B 3D22A 4NHWA 1GSDA 1OKTA 1XWBA 4IN0A 1PA3A 5HR0A 3CSHA 3ZITA 2Z9SA 1PD21 1YKCA 1MDKA 5IMVA 3WGEA 4GXZA 2I3YA 2IFQB 1QMVA 1SU9A 2B5EA 2WFCA 2K8VA 4ISDA 4L5OA 4K9ZA 3KH9A 4N10A 4K0GA 3UEMA 2H6XA 2IFQA 2NBSA 1PKZA 4Q5NA 5KEJA 3H93A 1X9MB 1V40A 3DXBA 1XPVA 4I97A 3U5RE 3QD9A 1WE0A 4XS1A 3TRPA 2WGRA 1KTEA 2QKEA 1ERWA 3A2XA 4D73B 2GLRA 4NAXA 2H8LA 2A2RA 3QR6A 5ELGA 2IJYA 5C00A 1A0RP 2L4QA 3FR6A 4GWRA 2GSTA 4KDXA 3G9BA 4L8EA 1A2LA 4TXOB 1XIYA 3PGTA 5DQSA 1T00A 2KLXA 3UIWA 3LSZA 1ZCPA 2LNTA 4IJ3A 4TXOA 4YQVA 1TRUA 5A4VA 4GQCA 2K8SA 5IPHA 3FY7A 1NW2A 5COHA 1SJZA 3IPZA 3P8WA 5FWGA 3ZZXA 4TR0A 5CRHA 4YQMA 1I9DA 3QCPA 1ERUA 1ERVA 1ERTA 3FZ5A 3FK8A 2VLUA 2H1AA 2VM2A 3H8QA 2PUKC 5L71A 3HXSA 2RUFA 1DSBA 4G10A 1OC8A 4POLA 2YNXA 4GLTA 2KP2A 4BPYA 1QK8A 1SK2A 3A2VA 3ZMLA 2V32A 3GH6A 1EV4A 3FHKA 4MA9A 1A23A 3GNJA 3QAVA 4ILFA 2H70A 4WXTA 2JACA 5AN1A 4POKA 3LFLA 3EC3A 5IO0A 2VO4A 4DSSB 2HNLA 1KNGA 2A4VA 2IMEA 2XHFA 1F2EA 5B7CA 3MDKA 2F8AA 3H79A 2XBQA 2V2GA 5D8IA 1AIUA 4LMWA 4DSSA 2NPBA 3P90A 1THOA 2H6ZA 2HSHA 3D21A 3PINA 2YWOA 3C8EA 1PX7A 3D6IA 6GSWA 1H4OA 3MNGA 1SD8A 5IMAA 2GSSA 5IOXA 1Q98A 3DKSA 3HVXA 20GSA 4L0UA 5IMZA 1A8LA 2GSQA 1G7OA 3WYWA 5IMDA 2E0QA 2LJRA 4MABA 4MMMA 3E0UA 3FW2A 1BYEA 2FNOA 5ECQB 1T4ZA 3GKKA 1TI1A 1K0AA 3TKSC 1AXDA 2H74A 4HEA2 5F06A 3KIJA 4K7OA 4AJ7A 2K9FA 1FW1A 4TOPA 1JFUA 4ECBA 3NZNA 9GSSA 5D9VA 3L4NA 2JL4A 5AGYA 3MWHA 3MAKA 2WS2A 3FRCA 3F6FA 3TOUA 2IL3A 3CMIA 5GAPD 5LNKe 1Z5YE 1R7HA 2XPEA 5EVOA 1BAYA 2PN8A 5HFKA 2VCXA 2H0IA 1FHEA 2BMXA 1I5GA 1GTUA 4F0BA 5HFGA 1O6JA 4POBA 3SBCA 2P0GA 2V41A 2H73A 5A5KA 2R5GA 2AV4A 1GH2A 3GL5A 2I9HA 5G1KA 2X8CA 2PU9C 4CHSA 2C0DA 3ERWA 4X43A 3NIVA 4OCFA 2B3SA 6GSXA 1O8WA 2DSAA 3RPPA 4BL7A 3W6GA 1EOHA 5KN3A 4HJMA 4TW5A 2AYTA 3LXTA 5LD0A 1FVJA 1PL2A 3DWVA 4RQXA 2OACA 3TJJA 5ENUA 3DGQA 2C3NA 2EC4A 2FA4A 1BG5A 1GWCA 2VCVA 5IPGA 2F3MA 1OE8A 2VCQA 3ZVJA 5AISA 3ERGA 2CZ2A 3RDWA 6GSSA 1OC9B 1NHYA 2GZPA 2OBKA 1EGOA 1UA5A 2GVPA 2X64A 2HYXA 1ZGNA 4V2MA 3KZQA 1QFNA 1X9WB 2A2SA 3TKRA 1WP0A 4E8EA 5D93A 4IP1A 3IAM2 4F82A 4WBJA 4TVEA 5J4UA 3FEUA 1ZOFA 2JU5A 3RHCA 4KSOA 4K1FA 4O7HA 4MJEA 3APSA 3O6TA 2KHPA 1URMA 5C04A 4H86A 1PX6A 1CQGA 1IYHA 2WULA 4AJ6A 5DJMA 1SKSB 3LYKA 16GSA 3CBUA 5ECKB 4I6XA 4L5LA 3G7JA 4MLYA 5B8AA 3M0FA 2GQKA 2PPTA 3WD6A 3GX8A 1Z7RA 1RQMA 3CSJA 1HD2A 2TIRA 4GTUA 4Q5QA 1F37A 1RK4A 2JZTA 2L4CA 3RBTA 2O89A 5FHIA 3ZIVA 3HDCA 2H1DA 3ISOA 4HI7A 4GSTA 3QDNA 4TR1B 3ERFA 1EEJA 1NM3A 3EU3A 3U6VA 1ML6A 2NTOA 3TJKA 1PL1A 4K6XA 4HQZA 3EE2A 2H75A 4TR1A 4WETA 3TJBA 3ZVJD 3L9SA 5LCZA 1XVQA 2H6YA 3VI5A 2PERA 2FY6A 4K8MA 5F0GA 1TRSA 4BWQA 3HD5A 1BEDA 4ZBAA 4GRFA 3F4TA 5G31A 2YANA 3GN3A 2VOCA 1TRVA 1JZDA 5A4UA 2YWIA 5G2ZA 1GRXA 4MP4A 1JZRA 5G5FA 2L5LA 4HDEA 3ZLPA 4XIHA 5FT3A 1WMJA 4IJIA 1PQNA 2HRFA 2MBTA 2LEGA 1T1VA 1V2AA 2FA8A 3UARA 3CRTA 3CSIA 2GT6A 2C0FA 4HQSA 2DMMA 5ECSA 4J57E 4XS4B 5B6MA 4BVXA 4OFTA 4OFNA 3HJPA 2H30A 4GF0A 4FYUA 4XS4A 4PX1A 3GYKA 1ON4A 1TK8B 2XBIA 4EC0A 2WZ9A 5D9XA 1F9MA 2DJJA 1MTCA 4Z7XA 3LQ7A 1SYRA 3DD3A 2L59A 5F8BA 1V58A 2CX3A 4ECCA 4JU5A 3KH7A 3IDVA 1Z6NA 3KP9A 3PH9A 1HYUA 1R5PA 2LJKA 1NHOA 1XCCA 4PXOA 3ME7A 3VPTA 5G1LA 4ZB6A 5CAXA 1K0BA 2O8VB 2N5AA 3RHBA 3M1GA 4IHUA 3W8JA 4TKYA 2QSIA 4JEDA 5IQYA 3AY8A 4NHZA 1SJIA 3WGDA 2C3TA 3CYNA 1WJKA 1PSQA 1YEPA 4TR4A 2L6CA 1J0FA 2HFDA 2YJ7A 1A24A 1W4VA 3QFBC 4ECIA 4EKZA 3APOA 2OKAA 5DCHA 2J23A 1K3LA 3WGXA 3CTFA 1DUGA 4AGSA 1AUCA 1A8YA 3FR3A 1OKDA 2ON7A 3IK9A 4WEYA 1TU7A 2YPMA 2G2QA 5EPFA 1EWXA 5ECOB 3UVHA 3PR8A 1TXXA 2WCIA 2O7KA 3BOAA 2H1BA 1XXUA 1O85A 4PNFA 2FLSA 1BJXA 1FG4A 1QUWA 4XTSA 2JADA 3C1RA 3ZTLA 2RM6A 2E7PA 1XW9A 3FKFA 4CW9A 2AJQB 3VK9A 2ZCTA 3F8UA 1VF3A 2B1LA 2GZZA 5IMFA 1YZXA 1XW5A 2B5YA 2VUPA 1GUKA 5E4WA 1G6YA 3KMNA 1IYIA 2YZUA 3Q6OA 3IE3A 17GSA 1WPIA 1GSUA 3EWLA 1GUHA 4WR4A 2HI7A 3I43A 3Q74A 4XRAA 5J3RA 1YEXA 1AAZA 2LSTA 1OAZA 5JWOB 2V1MA 1TTZA 2CQ9A 4NXIA 3HCZA 1SJ6A 5DCGA 3I69A 1VF2A 1V9WA 2GDRA 2FWFA 4KE3A 1TJDA 1K0CA 5IOWA 1H75A 1JZOA 3LORA 2JZSA 4G9HA 4DSRA 2MMNA 2CA8A 3MSZA 5IIZA 3IBHA 2B6MA 1O81A 4LA1A 3HVSA 5CRGA 2IMIA 4NWYA 3WT2A 1SK0A 4ZXGA 1Z6MA 3CTGA 4ZB9A 1TOFA 4FIWA 3LJRA 5JWQB 2VD1A 2P5RA 4ULXA 4MZBA 2YJHA 3C7MA 1B4PA 4ID0A 3VFIA 3IV4A 1O7UA 7GSSA 4PUFC 4JZQA 5GZZB 1PRXA 3FZ9A 4AJ8A 4WBRD 4HU9A 1FB6A 4F03A 2GS3A 3D0ZA 2LRNA 5D96A 4E8HA 1AQWA 1GTBA 2IMDA 2IIYA 3FR9A 1ZYEA 6GSUA 5DAKA 2X99A 2PWJA 4EDZA 3IOSA 2PVQA 1B8XA 3WT1A 5KN1A 3ZFLA 3TDGA 1B9YC 1GSQA 4OMVA 5D9WA 2N5FA 3US3A 2C80A 1GLPA 4JBBA 4POMA 1EP8A 3TKSE 5J9BA 3QMXA 1WIKA 2G0FA 4ZIJA 3Q19A 2VCWA 1U87A 3DVWA 2XPDA 4XS6A 1ZMAA 3TCOA 2QC7A 2KP1A 3H4KA 5E59A 2C8UA 4EE0A 2FCHA 2C3QA 2DLXA 1WRYA 4RQRA 4PURA 1E2YA 4MPFA 5DQYA 4N30A 1MDJA 2H72A 3IR4A 4JE1A 1TRWA 1GLQA 4J2FA 12GSA 2H66A 3ZRDA 5DALB 2CVBA 4QL9A 2RIIA 5IMCA 4P3YB 1VGLA 5EL8A 2VM1A 5G30A 5DALA 1V98A 2PGTA 4N11A 2E2GA 3K8NA 3DMLA 3F6DA 1YQ1A 5ECNB 2WDUA 5DBQA 3QAGA 4O5RA 3EMXA 4OCEA 3L0HA 3GURA 2R6KA 3QPMA 5H5RA 5AIXA 4IW9A 1M9AA 4MH2A 3GL3A 1XWAA 2H0GA 5HQPA 1ZYQB 2I81A 3F63A 2FUG2 3LYPA 3GUSA 1S3DA 1MD4A 1XWKA 2LRTA 3HJMA 2VL2C 3EU4A 4IS0A 4IP6A 2F51A 4MH3A 3E9JB 4GSNA 1YJ6A 2V6OA 4V2NA 3BCIA 1O8XA 19GSA 4MZWA 4KB3A 2JSZA 4O32A 4TN8A 1U88A 4I2TA 4RUVA 4X1UA 4KAEA 4NPBA 2RM5A 2DIYA 3DVXA 2OBIA 2DIZA 1K3YA 2YCDA 3O76A 3TKSA 1U3AA 4FYBA 4LL4B 2DJ1A 2OE0A 1B48A 4ZBDA 1SD9A 5CYYA 1DE2A 4QL7A 1M2AA 1U6TA 1XBSA 3F3QA 1Y25A 1NSWA 4QQ7A 4JRRA 5JWRB 4TXVA 3VI7A 2LV3A 2IN3A 3E3EA 2YN1A 3VLNA 1KBNA 1YF1A 2C0EA 2FWGA 2OE1A 2CX4A 3M3MA 3EURA 5ECHB 1SKRB 1WOUA 4ZBBA 1K0DA 2KUCA 5GAND 5ECMB 3P7XA 3G7YA 3I9V2 1TW9A 3KD0A 18GSA 1M99A 1SYXA 1Z3EA 2KOKA 1C72A 1SENA 1J9BA 3FZAA 2CV4A 6GSVA 3C71A 4MPGA 4BA7A 3OR5A 4MDCA 4ECJA 1O73A 2AAWA 2RLIA 1N8JA 3TUEA 4OO5A 4HU7A 5HR2A 1M9BA 4FO5A 4WKWA 1ZZYA 1ST9A 1OE7A 5JCGA 1T8EB 2B7JA 1QGVA 2HSYA 1SL2B 1GL8A 1AQVA 1AW9A 2DBCA 2E2MA 1XOAA 4MCUA 2LNSA 1QQ2A 5A4WA 1PMTA 1YY7A 1J08A 5ABRA 2LRCA 1X5EA
chains in the Genus database with same CATH superfamily
3MIXA 2DJ0A 3Q18A 4IQ1A 2ON5A 3HA9A 1A2JA 2O87A 4X0XA 6GSYA 4DVCA 2IWTA 1U3IA 2CVDA 2VL3A 1Y6EA 2PBJA 2FWHA 2F9SA 3KMOA 4F2IA 2AB6A 3UMAA 3IC4A 3UBKA 1DBYA 2MBSA 4HS1A 3LG6A 3ME8A 1OC3A 2YOIA 1GSEA 4TRXA 5KOWA 5JCUA 4K7IA 5HFIA 1GTAA 2WRTA 5ECRB 2H71A 1AC1A 2TRXA 5ECLB 3UL3A 5CRWA 3VWUA 4OWYA 1GNWA 3I6AA 2P5QA 4PUAA 3QAWA 3D4TA 2MYGA 2YWMA 1MD3A 3DRNA 4IBPA 5D73A 4BWSA 4KDUA 1A2MA 1JHBA 2C0GA 4LLRA 2GZYA 2R3XA 4F0CA 1F3AA 1M7TA 4CDOA 3VURA 2HT9A 3M9KA 2GTUA 1FAAA 2BTOT 4OO4A 1VRSD 1PN9A 1XOBA 1TU8A 3KTBA 2L57A 5J5NA 1UVZA 1A0FA 4N0VA 3UOMA 4ML1A 1HNCA 3A5IA 4OFMA 2IMFA 1XZOA 4IELA 4WR5A 3KJYA 3GSSA 1CQHA 3D4MA 3DYRA 3O3TA 5G5EA 4I5QA 3RPNA 3A5WA 1S3CA 3ZFBA 4LMVA 22GSA 3HZ8A 1UC7A 3S9FA 1JZWA 2I4AA 3D5JA 4RI6A 4V1Ap 5CP1A 5CNWA 1R26A 1LJRA 2K6VA 4GSSA 1S3AA 4PQHA 2GGTA 1T4YA 2VCZA 4G0LA 1B9XC 1TI3A 4KNDA 5HR3A 2LTKA 1ILOA 2REMA 4NMUA 1E6BA 3UJ1A 2VCTA 4D73A 1FVKA 4V2LA 4KUNA 4G0KA 3F3RA 2GQMA 4G19A 2L6DA 4Z2UA 5F05A 3HHVA 2B1KA 2A4HA 3UVTA 3BBYA 1T3BA 3N9JA 3QOUA 2ALBA 1EV9A 2FD3A 3R3EA 2NVLA 1SL0B 2MZCA 1X5DA 3IRAA 4MF6A 2VLTA 4K0NA 1GSSA 4YAPA 1HNAA 2RUEA 4YKGA 5DDLA 5D9TA 4CY6A 2EIRA 8GSSA 1N2AA 2OJLA 3GTUB 3LGCA 3GV1A 3IXRA 5CRDA 2B5XA 1EP7A 3GKMA 2N5BA 3GH9A 4RI7A 1K0NA 3GTUA 2HZEB 1SL1B 5ID2B 2TRCP 3HY2A 3FYGA 3L9UA 3GIXA 3LWAA 1FOVA 1EOGA 2YZHA 4L0WA 2HZEA 4ZB8A 5F07A 5ID2A 3DIEA 4JR4A 2HLSA 2IMKA 4I2UA 4AF2A 3GSTA 4MF5A 4Q5FA 2CVKA 5EY6A 2C1YA 1BQ7A 2LJAA 5ECIB 2WJUA 2XC2A 1GSYA 3R2QA 2FGXA 1PGTA 2CAIA 1ACVA 3KCMA 1GNEA 2HXKA 1EGRA 2ES7A 3BD2A 4NV2A 6GSTA 1XG8A 2H01A 2FHEA 2JZRA 3ED3A 3SWLA 5ECPB 2YV9A 2YV7A 2DKIA 3VWWA 5DAKB 3W8SA 1WWJA 2YP6A 4F9ZA 13GSA 1GULA 4MK3A 4I8BA 4K7NA 3C73A 1MDIA 1YDKA 2CAQA 5JCWA 3ZYWA 2H76A 3TKPA 1XVWA 1R5AA 4G2EA 4EO3A 1PN0A 2A2PA 3EMPA 1USBA 3EYTA 4GQFA 5B6NA 1GUMA 1M2DA 4WF5A 4BVYA 4KDYA 4XCSA 2DJ2A 3TRXA 1JLWA 3TGZA 1G0TA 3A3TA 2H1GA 1W89A 1BX9A 1Z7PA 2R37A 2YWNA 3TRQA 4MZCA 4O92A 2X8GA 3LEFA 4HOJA 11GSA 2L5OA 3HYPA 1TP9A 4WF4A 4KCEA 2D2ZA 1M0UA 1M3IA 3C1SA 3HKRA 3GFKA 3LXZA 1AQXA 4IKHA 3BJ5A 3KEBA 2OA7A 1PKWA 4OD7A 1B4QA 2MMOA 4TR3A 2GT5A 1X5CA 3GA4A 1XWCA 3KP8A 1X9SB 3TJFA 2IPAA 3TOTA 3UBLA 2PMTA 4HUAA 3TJGA 1Q4JA 4EXJA 1OVNA 3ZMKA 4EDYA 2GQLA 3GKXA 4FH8A 3L9VA 3IA1A 1M2BA 1OYJA 2QGVA 3FZ4A 3RAZA 3TB2A 1UN2A 4ML6A 1QXHA 1KEBA 1K0OA 2LQOA 1YF0A 3F4RA 4MJAA 1DE1A 2WB9A 1XW6A 2K18A 4IGJA 4IQAA 4IVFA 3H1NA 1JLVA 4ZL8A 2J9HA 5GSTA 1FO5A 4MF7A 4FYCA 3JCML 1TK5B 4JR6A 2AUVA 5KN2A 1SK1A 5ELAA 5GSSA 2H0HA 2DKHA 2OADA 4KA0A 1EZKA 3GKNA 4ZL9A 4PQIA 3UAPA 4ACSA 4XHMA 1VF1A 5J41A 1OC9A 1RW1A 4K2DA 3NOFA 5CREA 4PGTA 3G7IA 2V6KA 4EVMA 1R4WA 2M46A 2M72A 2ZNMA 3IK7A 1XWGA 3GMFA 3APQA 1GP1A 3CXGA 3KGKA 2CZ3A 3VPQA 4YH2A 3IHQA 3ZL5A 4KSMA 2C4JA 2VL9A 1T7PB 2B7KA 1F6MC 1HNBA 2I1UA 2DC5A 2LKUA 4HZ4A 1YKAA 1G6WA 5AIVA 2FWEA 3F9UA 2VLVA 1FB0A 4V1Ag 2R2JA 4PQ1A 1THXA 5INYA 3M9JA 4MNNA 3J7Yb 5DVBA 4KW6A 3HZ4A 2EIQA 3GHAA 4ICYA 1XFLA 2LUSA 2ZUPA 5IO2A 2HRNA 2MMAA 3VWXA 4ZL7A 2P31A 5CO3A 1F3BA 2PVOC 3F0IA 3KM6A 2JSYA 4KX4A 1TKDB 1EEMA 5HR1A 5H5QA 1VF4A 2M80A 1K0MA 2BJXA 4EF0A 2VAFA 1TK0B 2EIOA 1TDIA 4MJCA 3F4SA 4PNGA 3A2WA 1ZL9A 2VD0A 4MJBA 1V57A 3ZREA 2CT6A 2HZFA 2R4VA 2VIMA 2AHEA 2VL2A 3IAS2 3CRUA 3KTLA 1X0RA 3EINA 4N0ZA 4YAVA 5H5SA 1G7EA 4DSQA 5IM9A 4EUYA 4ZILA 1GTIA 4YQUA 14GSA 3L78A 3KXOA 3M8NA 1SKWB 3GRXA 3QFAC 2LS5A 4KGIA 4J56E 5KN0A 2MMZA 4HJ2A 1ABAA 2X8HA 3TKQA 5B8BA 4XRDA 2H19A 5DJLA 2HE3A 1GSFA 3VWVA 4GCIA 3N5OA 2R0CA 3P2AA 3DEXA 2DJ3A 4EL1A 3J7Yk 2LQQA 2OE3A 1Z9HA 3GX0A 2DJKA 3HVVA 4Q5RA 1LU4A 4DEJA 1LBKA 3V1WA 3EVIA 4KH7A 10GSA 2F8FA 1K3OA 1HQOA 4KCAA 1MEKA 5J9CA 4HZ2A 4CY8A 2O85A 2NDOA 2X4AA 3HJOA 4NV5A 3ZIJA 3BCKA 2GSRA 2DMLA 4LL1B 3D22A 4NHWA 1GSDA 1OKTA 1XWBA 4IN0A 1PA3A 5HR0A 3CSHA 3ZITA 2R0GA 2Z9SA 1PD21 1YKCA 1MDKA 5IMVA 3WGEA 4GXZA 2I3YA 4USSA 2IFQB 1QMVA 1SU9A 2B5EA 2WFCA 2K8VA 4ISDA 4L5OA 4K9ZA 2QA2A 3KH9A 4N10A 4K0GA 3UEMA 2H6XA 2IFQA 2NBSA 1PKZA 2UZ8A 4Q5NA 5KEJA 3H93A 1X9MB 1V40A 3DXBA 1XPVA 4I97A 3U5RE 3QD9A 1WE0A 4XS1A 3TRPA 2WGRA 1KTEA 3PPUA 2QKEA 1ERWA 3A2XA 4D73B 2GLRA 4NAXA 2H8LA 2A2RA 3QR6A 5ELGA 2IJYA 5C00A 1A0RP 2L4QA 3FR6A 4GWRA 4EIPA 2GSTA 4KDXA 3G9BA 4L8EA 1A2LA 4TXOB 1XIYA 3PGTA 5DQSA 1T00A 2KLXA 3UIWA 3LSZA 1ZYNA 1ZCPA 2LNTA 4IJ3A 4TXOA 4YQVA 1TRUA 5A4VA 4GQCA 2K8SA 5IPHA 3FY7A 1NW2A 5COHA 1SJZA 3IPZA 3P8WA 5FWGA 3ZZXA 4TR0A 5CRHA 4YQMA 1I9DA 3QCPA 1ERUA 4PTSA 1ERVA 1ERTA 3FZ5A 3FK8A 2VLUA 2H1AA 2VM2A 3H8QA 2PUKC 5L71A 3HXSA 2RUFA 1DSBA 4G10A 1OC8A 4POLA 2YNXA 4GLTA 2KP2A 1FOHA 3CQFA 4BPYA 1QK8A 1SK2A 3A2VA 3ZMLA 2V32A 3GH6A 1EV4A 3FHKA 4MA9A 1A23A 3GNJA 3QAVA 4ILFA 2H70A 4WXTA 2JACA 5AN1A 4POKA 3LFLA 3EC3A 5IO0A 2VO4A 4KF9A 2HNLA 4DSSB 1KNGA 2A4VA 2IMEA 2XHFA 1F2EA 5B7CA 3MDKA 2F8AA 3H79A 2XBQA 2V2GA 5D8IA 1AIUA 4LMWA 4DSSA 2NPBA 3P90A 1THOA 2H6ZA 2HSHA 3D21A 3PINA 2YWOA 3C8EA 1PX7A 4HSCX 3D6IA 6GSWA 1H4OA 3MNGA 1SD8A 5IMAA 2GSSA 4BVYB 5IOXA 1Q98A 3DKSA 3HVXA 20GSA 4L0UA 5IMZA 1A8LA 2GSQA 1G7OA 3WYWA 5IMDA 2E0QA 2LJRA 4MABA 4MMMA 3E0UA 3FW2A 1BYEA 2FNOA 5ECQB 1T4ZA 3GKKA 1TI1A 1K0AA 3TKSC 1AXDA 2H74A 4HEA2 5F06A 3KIJA 4K7OA 4AJ7A 2K9FA 1FW1A 4TOPA 1JFUA 4ECBA 2QA1A 3NZNA 9GSSA 5D9VA 3L4NA 2JL4A 4A5PA 5AGYA 3MWHA 3MAKA 2WS2A 3FRCA 3F6FA 3TOUA 2IL3A 3CMIA 5GAPD 5LNKe 1Z5YE 1R7HA 2XPEA 5EVOA 1BAYA 2PN8A 5HFKA 2VCXA 2H0IA 1FHEA 2BMXA 1I5GA 1GTUA 4F0BA 5HFGA 1O6JA 4POBA 3SBCA 2P0GA 2V41A 2H73A 5A5KA 5KOXA 2R5GA 2AV4A 1GH2A 3GL5A 2I9HA 5G1KA 2X8CA 2PU9C 4CHSA 2C0DA 3ERWA 4X43A 3NIVA 4OCFA 2B3SA 6GSXA 1O8WA 2DSAA 3RPPA 4BL7A 3W6GA 1EOHA 5KN3A 4HJMA 4TW5A 2AYTA 3LXTA 5LD0A 1FVJA 1PL2A 3DWVA 4RQXA 2OACA 3TJJA 5ENUA 3DGQA 1M3JA 2C3NA 2EC4A 3FMWA 2FA4A 1BG5A 1GWCA 2VCVA 5IPGA 2HRAA 2F3MA 1OE8A 2VCQA 3ZVJA 5AISA 3ERGA 2CZ2A 3RDWA 4EIQA 6GSSA 1OC9B 1NHYA 2GZPA 2OBKA 1EGOA 1UA5A 2GVPA 2X64A 2HYXA 4K2XA 1ZGNA 4V2MA 3KZQA 1QFNA 1X9WB 2A2SA 3TKRA 1WP0A 4E8EA 5D93A 4IP1A 3IAM2 4F82A 4WBJA 4TVEA 5J4UA 3FEUA 1ZOFA 2JU5A 3RHCA 4KSOA 4K1FA 4O7HA 4MJEA 3APSA 3O6TA 2KHPA 3EPTA 1URMA 5C04A 4H86A 1PX6A 1CQGA 1IYHA 2WULA 4AJ6A 5DJMA 1SKSB 3LYKA 16GSA 3CBUA 5ECKB 4I6XA 4L5LA 3G7JA 4MLYA 5B8AA 3M0FA 2GQKA 2PPTA 3WD6A 3GX8A 1Z7RA 1RQMA 3CSJA 4FQUA 1HD2A 2TIRA 4GTUA 4Q5QA 1F37A 1RK4A 2JZTA 2L4CA 3RBTA 2O89A 5FHIA 3ZIVA 3HDCA 2H1DA 3ISOA 4HI7A 4GSTA 3QDNA 4TR1B 3ERFA 1EEJA 4K5RA 1NM3A 3EU3A 3U6VA 4K5SA 1ML6A 5BMUA 2NTOA 3TJKA 1PL1A 4K6XA 4HQZA 3EE2A 4WETA 2H75A 1S3RA 4TR1A 3TJBA 3ZVJD 3L9SA 5LCZA 1XVQA 2H6YA 3VI5A 2PERA 2FY6A 4K8MA 5F0GA 1TRSA 4BWQA 3HD5A 1BEDA 4ZBAA 4GRFA 3F4TA 5G31A 2YANA 3GN3A 2VOCA 1TRVA 1JZDA 5A4UA 2YWIA 5G2ZA 1GRXA 4MP4A 1JZRA 5G5FA 2L5LA 4HDEA 3ZLPA 4XIHA 5FT3A 1WMJA 4IJIA 1PQNA 2HRFA 2MBTA 2LEGA 1T1VA 1V2AA 2FA8A 3UARA 4YKFA 3CRTA 3CSIA 4BVXB 2GT6A 2C0FA 4HQSA 2DMMA 5ECSA 4J57E 4XS4B 5B6MA 4BVXA 4OFTA 4OFNA 3HJPA 2H30A 3IC8A 4GF0A 4FYUA 4XS4A 4PX1A 3GYKA 1ON4A 1TK8B 2XBIA 4EC0A 2WZ9A 5D9XA 1F9MA 2DJJA 1MTCA 4Z7XA 3LQ7A 1SYRA 3DD3A 2L59A 5F8BA 1V58A 2CX3A 4ECCA 4JU5A 3KH7A 3IDVA 1Z6NA 3KP9A 3PH9A 1HYUA 1R5PA 2LJKA 1NHOA 1XCCA 4PXOA 3ME7A 3VPTA 5G1LA 4ZB6A 5CAXA 1K0BA 2O8VB 2N5AA 3RHBA 3M1GA 4IHUA 3W8JA 4TKYA 2QSIA 4JEDA 5IQYA 3AY8A 4NHZA 1SJIA 3WGDA 1PFOA 2C3TA 3CYNA 1WJKA 1PSQA 1YEPA 4TR4A 2L6CA 1J0FA 2HFDA 2YJ7A 1A24A 1W4VA 3QFBC 4ECIA 4EKZA 3APOA 2OKAA 5DCHA 2J23A 1K3LA 3WGXA 3CTFA 1DUGA 4AGSA 1AUCA 1A8YA 3FR3A 4BIKA 1OKDA 2ON7A 2HRKA 3IK9A 4WEYA 1TU7A 2YPMA 2G2QA 5EPFA 4Z2RA 1EWXA 5ECOB 3UVHA 3PR8A 1TXXA 2WCIA 2O7KA 3BOAA 2H1BA 1XXUA 1O85A 4PNFA 2FLSA 1BJXA 1FG4A 1QUWA 4XTSA 2JADA 3C1RA 3ZTLA 2RM6A 2E7PA 1XW9A 3FKFA 4CW9A 2AJQB 3VK9A 2ZCTA 3F8UA 1VF3A 2B1LA 2GZZA 5IMFA 1YZXA 1XW5A 2B5YA 2VUPA 1GUKA 5E4WA 1G6YA 3KMNA 1IYIA 2YZUA 3Q6OA 3IE3A 17GSA 1WPIA 1GSUA 3EWLA 1GUHA 4WR4A 2HI7A 3I43A 3Q74A 4XRAA 5J3RA 1YEXA 1AAZA 2LSTA 1OAZA 5JWOB 2V1MA 1TTZA 2CQ9A 4NXIA 3HCZA 1SJ6A 5DCGA 3I69A 1VF2A 1V9WA 2GDRA 2FWFA 4KE3A 1TJDA 1K0CA 5IOWA 1H75A 1JZOA 3LORA 2JZSA 4G9HA 4DSRA 2MMNA 2CA8A 3MSZA 5IIZA 3IBHA 2B6MA 1O81A 4LA1A 3HVSA 5CRGA 2IMIA 4NWYA 3WT2A 1SK0A 4ZXGA 1Z6MA 3CTGA 4ZB9A 1TOFA 4FIWA 3LJRA 5JWQB 2VD1A 2P5RA 4ULXA 4MZBA 2YJHA 3C7MA 1B4PA 3IHGA 4ID0A 3VFIA 3IV4A 1O7UA 7GSSA 4PUFC 4JZQA 5GZZB 1PRXA 3FZ9A 4AJ8A 4O5UA 4WBRD 4HU9A 1FB6A 4F03A 2GS3A 3D0ZA 2LRNA 5BRTA 5D96A 4E8HA 1AQWA 1GTBA 2IMDA 2IIYA 3FR9A 1ZYEA 6GSUA 5DAKA 2X99A 2PWJA 4EDZA 3IOSA 2PVQA 1B8XA 3WT1A 5KN1A 3ZFLA 3TDGA 1B9YC 1GSQA 4OMVA 2N5FA 5D9WA 3US3A 2C80A 1GLPA 4JBBA 4POMA 1EP8A 3TKSE 5J9BA 3QMXA 1WIKA 2G0FA 4ZIJA 3Q19A 2VCWA 1U87A 3DVWA 2XPDA 2X49A 4XS6A 1ZMAA 4O5QA 3TCOA 2QC7A 2KP1A 3H4KA 5E59A 2C8UA 4EE0A 2FCHA 2C3QA 2DLXA 1WRYA 4RQRA 4PURA 1E2YA 4MPFA 5DQYA 4N30A 2R0PA 1MDJA 2H72A 3IR4A 4JE1A 1TRWA 1GLQA 4J2FA 12GSA 4G0IA 2H66A 3ZRDA 5DALB 4BL7B 2CVBA 4QL9A 2RIIA 5IMCA 4P3YB 1VGLA 5EL8A 2VM1A 5G30A 5DALA 1V98A 2PGTA 4N11A 2E2GA 3K8NA 3DMLA 3F6DA 1YQ1A 5ECNB 2WDUA 5DBQA 3QAGA 4O5RA 3EMXA 4OCEA 3L0HA 3GURA 2R6KA 3QPMA 5H5RA 5AIXA 4IW9A 1M9AA 4MH2A 3LW9A 3GL3A 1XWAA 2H0GA 5HQPA 1ZYQB 2I81A 3F63A 2FUG2 3LYPA 3GUSA 1S3DA 1MD4A 1XWKA 2LRTA 3HJMA 2VL2C 3EU4A 4IS0A 4IP6A 2F51A 4MH3A 3E9JB 4GSNA 1YJ6A 2V6OA 4V2NA 3BCIA 1O8XA 19GSA 4MZWA 4KB3A 2JSZA 4O32A 4TN8A 1U88A 4I2TA 4RUVA 4X1UA 4KAEA 4NPBA 2RM5A 2DIYA 3DVXA 2OBIA 2DIZA 1K3YA 2YCDA 3O76A 3TKSA 1U3AA 4FYBA 4LL4B 2DJ1A 2OE0A 1B48A 4ZBDA 1SD9A 3HVNA 1ZYPA 5CYYA 1DE2A 4QL7A 1M2AA 1U6TA 1XBSA 3F3QA 1Y25A 1NSWA 2HSMA 4QQ7A 4JRRA 5JWRB 4Z2TA 4TXVA 3VI7A 2LV3A 2IN3A 4X4JA 3E3EA 2YN1A 3VLNA 1KBNA 1YF1A 2C0EA 2FWGA 2OE1A 2CX4A 3M3MA 3EURA 5ECHB 1SKRB 1WOUA 4ZBBA 1K0DA 2KUCA 5GAND 5ECMB 3P7XA 3G7YA 3I9V2 1TW9A 3MYDA 3KD0A 18GSA 1M99A 1SYXA 1Z3EA 2KOKA 1C72A 1SENA 1J9BA 3FZAA 2CV4A 6GSVA 3C71A 4MPGA 4BA7A 3OR5A 4MDCA 4ECJA 1O73A 2AAWA 2RLIA 1N8JA 3TUEA 4OO5A 4HU7A 5HR2A 1M9BA 4FO5A 4WKWA 1ZZYA 1ST9A 1OE7A 5JCGA 1T8EB 2B7JA 1QGVA 2HSYA 1SL2B 1GL8A 1AQVA 1AW9A 2DBCA 2E2MA 1XOAA 4MCUA 2LNSA 1QQ2A 5A4WA 1PMTA 1YY7A 1J08A 5ABRA 2LRCA 1X5EA
chains in the Genus database with same CATH topology
3MIXA 2DJ0A 3Q18A 4IQ1A 2ON5A 3HA9A 1A2JA 2O87A 4X0XA 6GSYA 4DVCA 2IWTA 1U3IA 2CVDA 2VL3A 1Y6EA 2PBJA 2FWHA 2F9SA 3KMOA 4F2IA 2AB6A 3UMAA 3IC4A 3UBKA 1DBYA 2MBSA 4HS1A 3LG6A 3ME8A 1OC3A 2YOIA 1GSEA 4TRXA 5KOWA 5JCUA 4K7IA 5HFIA 1GTAA 2WRTA 5ECRB 2H71A 1AC1A 2TRXA 5ECLB 3UL3A 5CRWA 3VWUA 4OWYA 1GNWA 3I6AA 2P5QA 4PUAA 3QAWA 3D4TA 2MYGA 2YWMA 1MD3A 3DRNA 4IBPA 5D73A 4BWSA 4KDUA 1A2MA 1JHBA 2C0GA 4LLRA 2GZYA 2R3XA 4F0CA 1F3AA 1M7TA 4CDOA 3VURA 2HT9A 3M9KA 2GTUA 1FAAA 2BTOT 4OO4A 1VRSD 1PN9A 1XOBA 1TU8A 3KTBA 2L57A 5J5NA 1UVZA 1A0FA 4N0VA 3UOMA 4ML1A 1HNCA 3A5IA 4OFMA 2IMFA 1XZOA 4IELA 4WR5A 3KJYA 3GSSA 1CQHA 3D4MA 3DYRA 3O3TA 5G5EA 4I5QA 3RPNA 3A5WA 1S3CA 3ZFBA 4LMVA 22GSA 3HZ8A 1UC7A 3S9FA 1JZWA 2I4AA 3D5JA 4RI6A 4V1Ap 5CP1A 5CNWA 1R26A 1LJRA 2K6VA 4GSSA 1S3AA 4PQHA 2GGTA 1T4YA 2VCZA 4G0LA 1B9XC 1TI3A 4KNDA 5HR3A 2LTKA 1ILOA 2REMA 4NMUA 1E6BA 3UJ1A 2VCTA 4D73A 1FVKA 4V2LA 4KUNA 4G0KA 3F3RA 2GQMA 4G19A 2L6DA 4Z2UA 5F05A 3HHVA 2B1KA 2A4HA 3UVTA 3BBYA 1T3BA 3N9JA 3QOUA 2ALBA 1EV9A 2FD3A 3R3EA 2NVLA 1SL0B 2MZCA 1X5DA 3IRAA 4MF6A 2VLTA 4K0NA 1GSSA 4YAPA 1HNAA 2RUEA 4YKGA 5DDLA 5D9TA 4CY6A 2EIRA 8GSSA 1N2AA 2OJLA 3GTUB 3LGCA 3GV1A 3IXRA 5CRDA 2B5XA 1EP7A 3GKMA 2N5BA 3GH9A 4RI7A 1K0NA 3GTUA 2HZEB 1SL1B 5ID2B 2TRCP 3HY2A 3FYGA 3L9UA 3GIXA 3LWAA 1FOVA 1EOGA 2YZHA 4L0WA 2HZEA 4ZB8A 5F07A 5ID2A 3DIEA 4JR4A 2HLSA 2IMKA 4I2UA 4AF2A 3GSTA 4MF5A 4Q5FA 2CVKA 5EY6A 2C1YA 1BQ7A 2LJAA 5ECIB 2WJUA 2XC2A 1GSYA 3R2QA 2FGXA 1PGTA 2CAIA 1ACVA 3KCMA 1GNEA 2HXKA 1EGRA 2ES7A 3BD2A 4NV2A 6GSTA 2H01A 2FHEA 2JZRA 3ED3A 3SWLA 5ECPB 2YV9A 2YV7A 2DKIA 3VWWA 5DAKB 3W8SA 1WWJA 2YP6A 4F9ZA 13GSA 1GULA 4MK3A 4I8BA 4K7NA 3C73A 1MDIA 1YDKA 2CAQA 5JCWA 3ZYWA 2H76A 3TKPA 1XVWA 1R5AA 4G2EA 4EO3A 1PN0A 2A2PA 3EMPA 1USBA 3EYTA 4GQFA 5B6NA 1GUMA 1M2DA 4WF5A 4BVYA 4KDYA 4XCSA 2DJ2A 3TRXA 1JLWA 3TGZA 1G0TA 3A3TA 2H1GA 1W89A 1BX9A 1Z7PA 2R37A 2YWNA 3TRQA 4MZCA 4O92A 2X8GA 3LEFA 4HOJA 11GSA 2L5OA 3HYPA 1TP9A 4WF4A 4KCEA 2D2ZA 1M0UA 3C1SA 3HKRA 3GFKA 3LXZA 1AQXA 4IKHA 3BJ5A 3KEBA 2OA7A 1PKWA 4OD7A 1B4QA 2MMOA 4TR3A 2GT5A 1X5CA 3GA4A 1XWCA 3KP8A 1X9SB 3TJFA 2IPAA 3TOTA 3UBLA 2PMTA 4HUAA 3TJGA 1Q4JA 4EXJA 1OVNA 3ZMKA 4EDYA 2GQLA 3GKXA 4FH8A 3L9VA 3IA1A 1M2BA 1OYJA 2QGVA 3FZ4A 3RAZA 3TB2A 1UN2A 4ML6A 1QXHA 1KEBA 1K0OA 2LQOA 1YF0A 3F4RA 4MJAA 1DE1A 2WB9A 1XW6A 2K18A 4IGJA 4IQAA 4IVFA 3H1NA 1JLVA 4ZL8A 2J9HA 5GSTA 1FO5A 4MF7A 4FYCA 3JCML 1TK5B 4JR6A 2AUVA 5KN2A 1SK1A 5ELAA 5GSSA 2H0HA 2DKHA 2OADA 4KA0A 1EZKA 3GKNA 4ZL9A 4PQIA 3UAPA 4ACSA 4XHMA 1VF1A 5J41A 1OC9A 1RW1A 4K2DA 3NOFA 5CREA 4PGTA 3G7IA 2V6KA 4EVMA 1R4WA 2M46A 2M72A 2ZNMA 3IK7A 1XWGA 3GMFA 3APQA 1GP1A 3CXGA 3KGKA 2CZ3A 3VPQA 4YH2A 3IHQA 3ZL5A 4KSMA 2C4JA 2VL9A 1T7PB 2B7KA 1F6MC 1HNBA 2I1UA 2DC5A 2LKUA 4HZ4A 1YKAA 1G6WA 5AIVA 2FWEA 3F9UA 2VLVA 1FB0A 4V1Ag 2R2JA 4PQ1A 1THXA 5INYA 3M9JA 4MNNA 3J7Yb 5DVBA 4KW6A 3HZ4A 2EIQA 3GHAA 4ICYA 1XFLA 2LUSA 2ZUPA 5IO2A 2HRNA 2MMAA 3VWXA 4ZL7A 2P31A 5CO3A 1F3BA 2PVOC 3F0IA 3KM6A 2JSYA 4KX4A 1TKDB 1EEMA 5HR1A 5H5QA 1VF4A 2M80A 1K0MA 2BJXA 4EF0A 2VAFA 1TK0B 2EIOA 1TDIA 4MJCA 3F4SA 4PNGA 3A2WA 1ZL9A 2VD0A 4MJBA 1V57A 3ZREA 2CT6A 2HZFA 2R4VA 2VIMA 2AHEA 2VL2A 3IAS2 3CRUA 3KTLA 1X0RA 3EINA 4N0ZA 4YAVA 5H5SA 1G7EA 4DSQA 5IM9A 4EUYA 4ZILA 1GTIA 4YQUA 14GSA 3L78A 3KXOA 3M8NA 1SKWB 3GRXA 3QFAC 2LS5A 4KGIA 4J56E 5KN0A 2MMZA 4HJ2A 1ABAA 2X8HA 3TKQA 5B8BA 4XRDA 2H19A 5DJLA 2HE3A 1GSFA 3VWVA 4GCIA 3N5OA 2R0CA 3P2AA 3DEXA 2DJ3A 4EL1A 3J7Yk 2LQQA 2OE3A 1Z9HA 3GX0A 2DJKA 3HVVA 4Q5RA 1LU4A 4DEJA 1LBKA 3V1WA 3EVIA 4KH7A 10GSA 2F8FA 1K3OA 1HQOA 4KCAA 1MEKA 5J9CA 4HZ2A 4CY8A 2O85A 2NDOA 2X4AA 3HJOA 4NV5A 3ZIJA 3BCKA 2GSRA 2DMLA 4LL1B 3D22A 4NHWA 1GSDA 1OKTA 1XWBA 4IN0A 1PA3A 5HR0A 3CSHA 3ZITA 2R0GA 2Z9SA 1PD21 1YKCA 1MDKA 5IMVA 3WGEA 4GXZA 2I3YA 4USSA 2IFQB 1QMVA 1SU9A 2B5EA 2WFCA 2K8VA 4ISDA 4L5OA 4K9ZA 2QA2A 3KH9A 4N10A 4K0GA 3UEMA 2H6XA 2IFQA 2NBSA 1PKZA 2UZ8A 4Q5NA 5KEJA 3H93A 1X9MB 1V40A 3DXBA 1XPVA 4I97A 3U5RE 3QD9A 1WE0A 4XS1A 3TRPA 2WGRA 1KTEA 3PPUA 2QKEA 1ERWA 3A2XA 4D73B 2GLRA 4NAXA 2H8LA 2A2RA 3QR6A 5ELGA 2IJYA 5C00A 1A0RP 2L4QA 3FR6A 4GWRA 4EIPA 2GSTA 4KDXA 3G9BA 4L8EA 1A2LA 4TXOB 1XIYA 3PGTA 5DQSA 1T00A 2KLXA 3UIWA 3LSZA 1ZYNA 1ZCPA 2LNTA 4IJ3A 4TXOA 4YQVA 1TRUA 5A4VA 4GQCA 2K8SA 5IPHA 3FY7A 1NW2A 5COHA 1SJZA 3IPZA 3P8WA 5FWGA 3ZZXA 4TR0A 5CRHA 4YQMA 1I9DA 3QCPA 1ERUA 4PTSA 1ERVA 1ERTA 3FZ5A 3FK8A 2VLUA 2H1AA 2VM2A 3H8QA 2PUKC 5L71A 3HXSA 2RUFA 1DSBA 4G10A 1OC8A 4POLA 2YNXA 4GLTA 2KP2A 1FOHA 4BPYA 1QK8A 1SK2A 3A2VA 3ZMLA 2V32A 3GH6A 1EV4A 3FHKA 4MA9A 1A23A 3GNJA 3QAVA 4ILFA 2H70A 4WXTA 2JACA 5AN1A 4POKA 3LFLA 3EC3A 5IO0A 2VO4A 4KF9A 2HNLA 4DSSB 1KNGA 2A4VA 2IMEA 2XHFA 1F2EA 5B7CA 3MDKA 2F8AA 3H79A 2XBQA 2V2GA 5D8IA 1AIUA 4LMWA 4DSSA 2NPBA 3P90A 1THOA 2H6ZA 2HSHA 3D21A 3PINA 2YWOA 3C8EA 1PX7A 3D6IA 6GSWA 1H4OA 3MNGA 1SD8A 5IMAA 2GSSA 4BVYB 5IOXA 1Q98A 3DKSA 3HVXA 20GSA 4L0UA 5IMZA 1A8LA 2GSQA 1G7OA 3WYWA 5IMDA 2E0QA 2LJRA 4MABA 4MMMA 3E0UA 3FW2A 1BYEA 2FNOA 5ECQB 1T4ZA 3GKKA 1TI1A 1K0AA 3TKSC 1AXDA 2H74A 4HEA2 5F06A 3KIJA 4K7OA 4AJ7A 2K9FA 1FW1A 4TOPA 1JFUA 4ECBA 2QA1A 3NZNA 9GSSA 5D9VA 3L4NA 2JL4A 4A5PA 5AGYA 3MWHA 3MAKA 2WS2A 3FRCA 3F6FA 3TOUA 2IL3A 3CMIA 5GAPD 5LNKe 1Z5YE 1R7HA 2XPEA 5EVOA 1BAYA 2PN8A 5HFKA 2VCXA 2H0IA 1FHEA 2BMXA 1I5GA 1GTUA 4F0BA 5HFGA 1O6JA 4POBA 3SBCA 2P0GA 2V41A 2H73A 5A5KA 5KOXA 2R5GA 2AV4A 1GH2A 3GL5A 2I9HA 5G1KA 2X8CA 2PU9C 4CHSA 2C0DA 3ERWA 4X43A 3NIVA 4OCFA 2B3SA 6GSXA 1O8WA 2DSAA 3RPPA 4BL7A 3W6GA 1EOHA 5KN3A 4HJMA 4TW5A 2AYTA 3LXTA 5LD0A 1FVJA 1PL2A 3DWVA 4RQXA 2OACA 3TJJA 5ENUA 3DGQA 2C3NA 2EC4A 3FMWA 2FA4A 1BG5A 1GWCA 2VCVA 5IPGA 2HRAA 2F3MA 1OE8A 2VCQA 3ZVJA 5AISA 3ERGA 2CZ2A 3RDWA 4EIQA 6GSSA 1OC9B 1NHYA 2GZPA 2OBKA 1EGOA 1UA5A 2GVPA 2X64A 2HYXA 4K2XA 1ZGNA 4V2MA 3KZQA 1QFNA 1X9WB 2A2SA 3TKRA 1WP0A 4E8EA 5D93A 4IP1A 3IAM2 4F82A 4WBJA 4TVEA 5J4UA 3FEUA 1ZOFA 2JU5A 3RHCA 4KSOA 4K1FA 4O7HA 4MJEA 3APSA 3O6TA 2KHPA 3EPTA 1URMA 5C04A 4H86A 1PX6A 1CQGA 1IYHA 2WULA 4AJ6A 5DJMA 1SKSB 3LYKA 16GSA 3CBUA 5ECKB 4I6XA 4L5LA 3G7JA 4MLYA 5B8AA 3M0FA 2GQKA 2PPTA 3WD6A 3GX8A 1Z7RA 1RQMA 3CSJA 4FQUA 1HD2A 2TIRA 4GTUA 4Q5QA 1F37A 1RK4A 2JZTA 2L4CA 3RBTA 2O89A 5FHIA 3ZIVA 3HDCA 2H1DA 3ISOA 4HI7A 4GSTA 3QDNA 4TR1B 3ERFA 1EEJA 4K5RA 1NM3A 3EU3A 3U6VA 4K5SA 1ML6A 5BMUA 2NTOA 3TJKA 1PL1A 4K6XA 4HQZA 3EE2A 2H75A 4TR1A 4WETA 3TJBA 3ZVJD 3L9SA 5LCZA 1XVQA 2H6YA 3VI5A 2PERA 2FY6A 4K8MA 5F0GA 1TRSA 4BWQA 3HD5A 1BEDA 4ZBAA 4GRFA 3F4TA 5G31A 2YANA 3GN3A 2VOCA 1TRVA 1JZDA 5A4UA 2YWIA 5G2ZA 1GRXA 4MP4A 1JZRA 5G5FA 2L5LA 4HDEA 3ZLPA 4XIHA 5FT3A 1WMJA 4IJIA 1PQNA 2HRFA 2MBTA 2LEGA 1T1VA 1V2AA 2FA8A 3UARA 4YKFA 3CRTA 3CSIA 4BVXB 2GT6A 2C0FA 4HQSA 2DMMA 5ECSA 4J57E 4XS4B 5B6MA 4BVXA 4OFTA 4OFNA 3HJPA 2H30A 3IC8A 4GF0A 4FYUA 4XS4A 4PX1A 3GYKA 1ON4A 1TK8B 2XBIA 4EC0A 2WZ9A 5D9XA 1F9MA 2DJJA 1MTCA 4Z7XA 3LQ7A 1SYRA 3DD3A 2L59A 5F8BA 1V58A 2CX3A 4ECCA 4JU5A 3KH7A 3IDVA 1Z6NA 3KP9A 3PH9A 1HYUA 1R5PA 2LJKA 1NHOA 1XCCA 4PXOA 3ME7A 3VPTA 5G1LA 4ZB6A 5CAXA 1K0BA 2O8VB 2N5AA 3RHBA 3M1GA 4IHUA 3W8JA 4TKYA 2QSIA 4JEDA 5IQYA 3AY8A 4NHZA 1SJIA 3WGDA 2C3TA 3CYNA 1WJKA 1PSQA 1YEPA 4TR4A 2L6CA 1J0FA 2HFDA 2YJ7A 1A24A 1W4VA 3QFBC 4ECIA 4EKZA 3APOA 2OKAA 5DCHA 2J23A 1K3LA 3WGXA 3CTFA 1DUGA 4AGSA 1AUCA 1A8YA 3FR3A 1OKDA 2ON7A 2HRKA 3IK9A 4WEYA 1TU7A 2YPMA 2G2QA 5EPFA 4Z2RA 1EWXA 5ECOB 3UVHA 3PR8A 1TXXA 2WCIA 2O7KA 3BOAA 2H1BA 1XXUA 1O85A 4PNFA 2FLSA 1BJXA 1FG4A 1QUWA 4XTSA 2JADA 3C1RA 3ZTLA 2RM6A 2E7PA 1XW9A 3FKFA 4CW9A 2AJQB 3VK9A 2ZCTA 3F8UA 1VF3A 2B1LA 2GZZA 5IMFA 1YZXA 1XW5A 2B5YA 2VUPA 1GUKA 5E4WA 1G6YA 3KMNA 1IYIA 2YZUA 3Q6OA 3IE3A 17GSA 1WPIA 1GSUA 3EWLA 1GUHA 4WR4A 2HI7A 3I43A 3Q74A 4XRAA 5J3RA 1YEXA 1AAZA 2LSTA 1OAZA 5JWOB 2V1MA 1TTZA 2CQ9A 4NXIA 3HCZA 1SJ6A 5DCGA 3I69A 1VF2A 1V9WA 2GDRA 2FWFA 4KE3A 1TJDA 1K0CA 5IOWA 1H75A 1JZOA 3LORA 2JZSA 4G9HA 4DSRA 2MMNA 2CA8A 3MSZA 5IIZA 3IBHA 2B6MA 1O81A 4LA1A 3HVSA 5CRGA 2IMIA 4NWYA 3WT2A 1SK0A 4ZXGA 1Z6MA 3CTGA 4ZB9A 1TOFA 4FIWA 3LJRA 5JWQB 2VD1A 2P5RA 4ULXA 4MZBA 2YJHA 3C7MA 1B4PA 3IHGA 4ID0A 3VFIA 3IV4A 1O7UA 7GSSA 4PUFC 4JZQA 5GZZB 1PRXA 3FZ9A 4AJ8A 4O5UA 4WBRD 4HU9A 1FB6A 4F03A 2GS3A 3D0ZA 2LRNA 5BRTA 5D96A 4E8HA 1AQWA 1GTBA 2IMDA 2IIYA 3FR9A 1ZYEA 6GSUA 5DAKA 2X99A 2PWJA 4EDZA 3IOSA 2PVQA 1B8XA 3WT1A 5KN1A 3ZFLA 3TDGA 1B9YC 1GSQA 4OMVA 2N5FA 5D9WA 3US3A 2C80A 1GLPA 4JBBA 4POMA 1EP8A 3TKSE 5J9BA 3QMXA 1WIKA 2G0FA 4ZIJA 3Q19A 2VCWA 1U87A 3DVWA 2XPDA 2X49A 4XS6A 1ZMAA 4O5QA 3TCOA 2QC7A 2KP1A 3H4KA 5E59A 2C8UA 4EE0A 2FCHA 2C3QA 2DLXA 1WRYA 4RQRA 4PURA 1E2YA 4MPFA 5DQYA 4N30A 2R0PA 1MDJA 2H72A 3IR4A 4JE1A 1TRWA 1GLQA 4J2FA 12GSA 4G0IA 2H66A 3ZRDA 5DALB 4BL7B 2CVBA 4QL9A 2RIIA 5IMCA 4P3YB 1VGLA 5EL8A 2VM1A 5G30A 5DALA 1V98A 2PGTA 4N11A 2E2GA 3K8NA 3DMLA 3F6DA 1YQ1A 5ECNB 2WDUA 5DBQA 3QAGA 4O5RA 3EMXA 4OCEA 3L0HA 3GURA 2R6KA 3QPMA 5H5RA 5AIXA 4IW9A 1M9AA 4MH2A 3LW9A 3GL3A 1XWAA 2H0GA 5HQPA 1ZYQB 2I81A 3F63A 2FUG2 3LYPA 3GUSA 1S3DA 1MD4A 1XWKA 2LRTA 3HJMA 2VL2C 3EU4A 4IS0A 4IP6A 2F51A 4MH3A 3E9JB 4GSNA 1YJ6A 2V6OA 4V2NA 3BCIA 1O8XA 19GSA 4MZWA 4KB3A 2JSZA 4O32A 4TN8A 1U88A 4I2TA 4RUVA 4X1UA 4KAEA 4NPBA 2RM5A 2DIYA 3DVXA 2OBIA 2DIZA 1K3YA 2YCDA 3O76A 3TKSA 1U3AA 4FYBA 4LL4B 2DJ1A 2OE0A 1B48A 4ZBDA 1SD9A 1ZYPA 5CYYA 1DE2A 4QL7A 1M2AA 1U6TA 1XBSA 3F3QA 1Y25A 1NSWA 2HSMA 4QQ7A 4JRRA 5JWRB 4Z2TA 4TXVA 3VI7A 2LV3A 2IN3A 4X4JA 3E3EA 2YN1A 3VLNA 1KBNA 1YF1A 2C0EA 2FWGA 2OE1A 2CX4A 3M3MA 3EURA 5ECHB 1SKRB 1WOUA 4ZBBA 1K0DA 2KUCA 5GAND 5ECMB 3P7XA 3G7YA 3I9V2 1TW9A 3MYDA 3KD0A 18GSA 1M99A 1SYXA 1Z3EA 2KOKA 1C72A 1SENA 1J9BA 3FZAA 2CV4A 6GSVA 3C71A 4MPGA 4BA7A 3OR5A 4MDCA 4ECJA 1O73A 2AAWA 2RLIA 1N8JA 3TUEA 4OO5A 4HU7A 5HR2A 1M9BA 4FO5A 4WKWA 1ZZYA 1ST9A 1OE7A 5JCGA 1T8EB 2B7JA 1QGVA 2HSYA 1SL2B 1GL8A 1AQVA 1AW9A 2DBCA 2E2MA 1XOAA 4MCUA 2LNSA 1QQ2A 5A4WA 1PMTA 1YY7A 1J08A 5ABRA 2LRCA 1X5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DJ0 A;  3Q18 A;  4IQ1 A;  2ON5 A;  3HA9 A;  1A2J A;  2O87 A;  4X0X A;  6GSY A;  4DVC A;  2IWT A;  1U3I A;  2CVD A;  2VL3 A;  1Y6E A;  2PBJ A;  2FWH A;  2F9S A;  3KMO A;  4F2I A;  2AB6 A;  3UMA A;  3IC4 A;  3UBK A;  1DBY A;  2MBS A;  4HS1 A;  3LG6 A;  3ME8 A;  1OC3 A;  2YOI A;  1GSE A;  4TRX A;  5JCU A;  4K7I A;  5HFI A;  1GTA A;  2WRT A;  5ECR B;  2H71 A;  1AC1 A;  2TRX A;  5ECL B;  3UL3 A;  5CRW A;  3VWU A;  4OWY A;  1GNW A;  3I6A A;  2P5Q A;  4PUA A;  3QAW A;  3D4T A;  2MYG A;  2YWM A;  1MD3 A;  3DRN A;  4IBP A;  5D73 A;  4BWS A;  4KDU A;  1A2M A;  1JHB A;  2C0G A;  4LLR A;  2GZY A;  2R3X A;  4F0C A;  1F3A A;  1M7T A;  4CDO A;  3VUR A;  2HT9 A;  3M9K A;  2GTU A;  1FAA A;  2BTO T;  4OO4 A;  1VRS D;  1PN9 A;  1XOB A;  1TU8 A;  3KTB A;  2L57 A;  5J5N A;  1UVZ A;  1A0F A;  4N0V A;  3UOM A;  4ML1 A;  1HNC A;  4OFM A;  2IMF A;  1XZO A;  4IEL A;  4WR5 A;  3KJY A;  3GSS A;  1CQH A;  3D4M A;  3DYR A;  3O3T A;  5G5E A;  4I5Q A;  3RPN A;  3A5W A;  1S3C A;  3ZFB A;  4LMV A;  22GS A;  3HZ8 A;  1UC7 A;  3S9F A;  1JZW A;  2I4A A;  3D5J A;  4RI6 A;  4V1A p;  5CP1 A;  5CNW A;  1R26 A;  1LJR A;  2K6V A;  4GSS A;  1S3A A;  4PQH A;  2GGT A;  1T4Y A;  2VCZ A;  1B9X C;  1TI3 A;  4KND A;  5HR3 A;  2LTK A;  1ILO A;  2REM A;  4NMU A;  1E6B A;  3UJ1 A;  2VCT A;  4D73 A;  1FVK A;  4V2L A;  4KUN A;  3F3R A;  2GQM A;  4G19 A;  2L6D A;  5F05 A;  3HHV A;  2B1K A;  3UVT A;  3BBY A;  1T3B A;  3N9J A;  3QOU A;  2ALB A;  1EV9 A;  2FD3 A;  1SL0 B;  2NVL A;  2MZC A;  1X5D A;  3IRA A;  4MF6 A;  2VLT A;  4K0N A;  1GSS A;  4YAP A;  1HNA A;  2RUE A;  5DDL A;  5D9T A;  2EIR A;  8GSS A;  1N2A A;  2OJL A;  3GTU B;  3LGC A;  3GV1 A;  3IXR A;  5CRD A;  2B5X A;  1EP7 A;  3GKM A;  2N5B A;  3GH9 A;  4RI7 A;  1K0N A;  3GTU A;  2HZE B;  1SL1 B;  5ID2 B;  2TRC P;  3HY2 A;  3FYG A;  3L9U A;  3GIX A;  3LWA A;  1FOV A;  1EOG A;  2YZH A;  4L0W A;  2HZE A;  4ZB8 A;  5F07 A;  5ID2 A;  3DIE A;  4JR4 A;  2HLS A;  2IMK A;  4I2U A;  4AF2 A;  3GST A;  4MF5 A;  4Q5F A;  2CVK A;  5EY6 A;  2C1Y A;  1BQ7 A;  2LJA A;  5ECI B;  2WJU A;  2XC2 A;  1GSY A;  3R2Q A;  2FGX A;  1PGT A;  2CAI A;  1ACV A;  3KCM A;  1GNE A;  2HXK A;  1EGR A;  2ES7 A;  3BD2 A;  4NV2 A;  6GST A;  2H01 A;  2FHE A;  2JZR A;  3ED3 A;  3SWL A;  5ECP B;  2YV9 A;  2YV7 A;  3VWW A;  5DAK B;  3W8S A;  1WWJ A;  2YP6 A;  4F9Z A;  13GS A;  1GUL A;  4MK3 A;  4I8B A;  4K7N A;  3C73 A;  1MDI A;  1YDK A;  2CAQ A;  5JCW A;  3ZYW A;  2H76 A;  3TKP A;  1XVW A;  1R5A A;  4G2E A;  4EO3 A;  3EMP A;  1USB A;  3EYT A;  4GQF A;  5B6N A;  1GUM A;  1M2D A;  4WF5 A;  4BVY A;  4KDY A;  4XCS A;  2DJ2 A;  3TRX A;  1JLW A;  3TGZ A;  1G0T A;  3A3T A;  2H1G A;  1W89 A;  1BX9 A;  1Z7P A;  2R37 A;  2YWN A;  3TRQ A;  4MZC A;  4O92 A;  2X8G A;  3LEF A;  4HOJ A;  11GS A;  2L5O A;  3HYP A;  1TP9 A;  4WF4 A;  4KCE A;  2D2Z A;  1M0U A;  3C1S A;  3HKR A;  3GFK A;  3LXZ A;  1AQX A;  4IKH A;  3BJ5 A;  3KEB A;  2OA7 A;  1PKW A;  4OD7 A;  1B4Q A;  2MMO A;  4TR3 A;  2GT5 A;  1X5C A;  3GA4 A;  1XWC A;  3KP8 A;  1X9S B;  3TJF A;  2IPA A;  3TOT A;  3UBL A;  2PMT A;  4HUA A;  3TJG A;  1Q4J A;  4EXJ A;  1OVN A;  3ZMK A;  4EDY A;  2GQL A;  3GKX A;  4FH8 A;  3L9V A;  3IA1 A;  1M2B A;  1OYJ A;  2QGV A;  3FZ4 A;  3RAZ A;  3TB2 A;  1UN2 A;  4ML6 A;  1QXH A;  1KEB A;  1K0O A;  2LQO A;  1YF0 A;  3F4R A;  4MJA A;  1DE1 A;  2WB9 A;  1XW6 A;  2K18 A;  4IGJ A;  4IQA A;  4IVF A;  3H1N A;  1JLV A;  4ZL8 A;  2J9H A;  5GST A;  1FO5 A;  4MF7 A;  4FYC A;  3JCM L;  1TK5 B;  4JR6 A;  2AUV A;  5KN2 A;  1SK1 A;  5ELA A;  5GSS A;  2H0H A;  2OAD A;  4KA0 A;  1EZK A;  3GKN A;  4ZL9 A;  4PQI A;  3UAP A;  4ACS A;  4XHM A;  1VF1 A;  5J41 A;  1OC9 A;  1RW1 A;  4K2D A;  3NOF A;  5CRE A;  4PGT A;  3G7I A;  2V6K A;  4EVM A;  1R4W A;  2M46 A;  2M72 A;  2ZNM A;  3IK7 A;  1XWG A;  3GMF A;  3APQ A;  1GP1 A;  3CXG A;  3KGK A;  2CZ3 A;  3VPQ A;  4YH2 A;  3IHQ A;  3ZL5 A;  4KSM A;  2C4J A;  2VL9 A;  1T7P B;  2B7K A;  1F6M C;  1HNB A;  2I1U A;  2DC5 A;  2LKU A;  4HZ4 A;  1YKA A;  1G6W A;  5AIV A;  2FWE A;  3F9U A;  2VLV A;  1FB0 A;  4V1A g;  2R2J A;  4PQ1 A;  1THX A;  5INY A;  3M9J A;  3J7Y b;  5DVB A;  4KW6 A;  3HZ4 A;  2EIQ A;  3GHA A;  1XFL A;  2LUS A;  2ZUP A;  5IO2 A;  2HRN A;  2MMA A;  3VWX A;  4ZL7 A;  2P31 A;  5CO3 A;  1F3B A;  2PVO C;  3F0I A;  3KM6 A;  2JSY A;  4KX4 A;  1TKD B;  1EEM A;  5HR1 A;  5H5Q A;  1VF4 A;  2M80 A;  1K0M A;  2BJX A;  4EF0 A;  2VAF A;  1TK0 B;  2EIO A;  1TDI A;  4MJC A;  3F4S A;  4PNG A;  3A2W A;  1ZL9 A;  2VD0 A;  4MJB A;  1V57 A;  3ZRE A;  2CT6 A;  2HZF A;  2R4V A;  2VIM A;  2AHE A;  2VL2 A;  3IAS 2;  3CRU A;  3KTL A;  1X0R A;  3EIN A;  4N0Z A;  4YAV A;  5H5S A;  1G7E A;  4DSQ A;  5IM9 A;  4EUY A;  4ZIL A;  1GTI A;  4YQU A;  14GS A;  3L78 A;  3KXO A;  3M8N A;  1SKW B;  3GRX A;  3QFA C;  2LS5 A;  4KGI A;  4J56 E;  5KN0 A;  2MMZ A;  4HJ2 A;  1ABA A;  2X8H A;  3TKQ A;  5B8B A;  4XRD A;  2H19 A;  5DJL A;  2HE3 A;  1GSF A;  3VWV A;  4GCI A;  3N5O A;  3P2A A;  3DEX A;  2DJ3 A;  4EL1 A;  3J7Y k;  2LQQ A;  2OE3 A;  1Z9H A;  3GX0 A;  2DJK A;  3HVV A;  4Q5R A;  1LU4 A;  4DEJ A;  1LBK A;  3V1W A;  3EVI A;  4KH7 A;  10GS A;  2F8F A;  1K3O A;  1HQO A;  4KCA A;  1MEK A;  5J9C A;  4HZ2 A;  2O85 A;  2NDO A;  3HJO A;  4NV5 A;  3ZIJ A;  3BCK A;  2GSR A;  2DML A;  4LL1 B;  3D22 A;  4NHW A;  1GSD A;  1OKT A;  1XWB A;  4IN0 A;  1PA3 A;  5HR0 A;  3CSH A;  3ZIT A;  2Z9S A;  1PD2 1;  1YKC A;  1MDK A;  5IMV A;  3WGE A;  4GXZ A;  2I3Y A;  2IFQ B;  1QMV A;  1SU9 A;  2B5E A;  2WFC A;  2K8V A;  4ISD A;  4L5O A;  4K9Z A;  3KH9 A;  4N10 A;  4K0G A;  3UEM A;  2H6X A;  2IFQ A;  2NBS A;  1PKZ A;  4Q5N A;  5KEJ A;  3H93 A;  1X9M B;  1V40 A;  3DXB A;  1XPV A;  4I97 A;  3U5R E;  3QD9 A;  1WE0 A;  4XS1 A;  3TRP A;  2WGR A;  1KTE A;  2QKE A;  1ERW A;  3A2X A;  4D73 B;  2GLR A;  4NAX A;  2H8L A;  2A2R A;  3QR6 A;  5ELG A;  2IJY A;  5C00 A;  1A0R P;  2L4Q A;  3FR6 A;  4GWR A;  2GST A;  4KDX A;  3G9B A;  4L8E A;  1A2L A;  4TXO B;  1XIY A;  3PGT A;  5DQS A;  1T00 A;  2KLX A;  3UIW A;  3LSZ A;  1ZCP A;  2LNT A;  4IJ3 A;  4TXO A;  4YQV A;  1TRU A;  5A4V A;  4GQC A;  2K8S A;  5IPH A;  3FY7 A;  1NW2 A;  5COH A;  1SJZ A;  3IPZ A;  3P8W A;  5FWG A;  3ZZX A;  4TR0 A;  5CRH A;  4YQM A;  1I9D A;  3QCP A;  1ERU A;  1ERV A;  1ERT A;  3FZ5 A;  3FK8 A;  2VLU A;  2H1A A;  2VM2 A;  3H8Q A;  2PUK C;  5L71 A;  3HXS A;  2RUF A;  1DSB A;  4G10 A;  1OC8 A;  4POL A;  2YNX A;  4GLT A;  2KP2 A;  4BPY A;  1QK8 A;  1SK2 A;  3A2V A;  3ZML A;  2V32 A;  3GH6 A;  1EV4 A;  3FHK A;  4MA9 A;  1A23 A;  3GNJ A;  3QAV A;  4ILF A;  2H70 A;  4WXT A;  2JAC A;  5AN1 A;  4POK A;  3LFL A;  3EC3 A;  5IO0 A;  2VO4 A;  4DSS B;  2HNL A;  1KNG A;  2A4V A;  2IME A;  2XHF A;  1F2E A;  5B7C A;  3MDK A;  2F8A A;  3H79 A;  2XBQ A;  2V2G A;  5D8I A;  1AIU A;  4LMW A;  4DSS A;  2NPB A;  3P90 A;  1THO A;  2H6Z A;  2HSH A;  3D21 A;  3PIN A;  2YWO A;  3C8E A;  1PX7 A;  3D6I A;  6GSW A;  1H4O A;  3MNG A;  1SD8 A;  5IMA A;  2GSS A;  5IOX A;  1Q98 A;  3DKS A;  3HVX A;  20GS A;  4L0U A;  5IMZ A;  1A8L A;  2GSQ A;  1G7O A;  3WYW A;  5IMD A;  2E0Q A;  2LJR A;  4MAB A;  4MMM A;  3E0U A;  3FW2 A;  1BYE A;  2FNO A;  5ECQ B;  1T4Z A;  3GKK A;  1TI1 A;  1K0A A;  3TKS C;  1AXD A;  2H74 A;  4HEA 2;  5F06 A;  3KIJ A;  4K7O A;  4AJ7 A;  2K9F A;  1FW1 A;  4TOP A;  1JFU A;  4ECB A;  3NZN A;  9GSS A;  5D9V A;  3L4N A;  2JL4 A;  5AGY A;  3MWH A;  3MAK A;  2WS2 A;  3FRC A;  3F6F A;  3TOU A;  2IL3 A;  3CMI A;  5GAP D;  5LNK e;  1Z5Y E;  1R7H A;  2XPE A;  5EVO A;  1BAY A;  2PN8 A;  5HFK A;  2VCX A;  2H0I A;  1FHE A;  2BMX A;  1I5G A;  1GTU A;  4F0B A;  5HFG A;  1O6J A;  4POB A;  3SBC A;  2P0G A;  2V41 A;  2H73 A;  5A5K A;  2R5G A;  2AV4 A;  1GH2 A;  3GL5 A;  2I9H A;  5G1K A;  2X8C A;  2PU9 C;  4CHS A;  2C0D A;  3ERW A;  4X43 A;  3NIV A;  4OCF A;  2B3S A;  6GSX A;  1O8W A;  2DSA A;  3RPP A;  4BL7 A;  3W6G A;  1EOH A;  5KN3 A;  4HJM A;  4TW5 A;  2AYT A;  3LXT A;  5LD0 A;  1FVJ A;  1PL2 A;  3DWV A;  4RQX A;  2OAC A;  3TJJ A;  5ENU A;  3DGQ A;  2C3N A;  2EC4 A;  2FA4 A;  1BG5 A;  1GWC A;  2VCV A;  5IPG A;  2F3M A;  1OE8 A;  2VCQ A;  3ZVJ A;  5AIS A;  3ERG A;  2CZ2 A;  3RDW A;  6GSS A;  1OC9 B;  1NHY A;  2GZP A;  2OBK A;  1EGO A;  1UA5 A;  2GVP A;  2X64 A;  2HYX A;  1ZGN A;  4V2M A;  3KZQ A;  1QFN A;  1X9W B;  2A2S A;  3TKR A;  1WP0 A;  4E8E A;  5D93 A;  4IP1 A;  3IAM 2;  4F82 A;  4WBJ A;  4TVE A;  5J4U A;  3FEU A;  1ZOF A;  2JU5 A;  3RHC A;  4KSO A;  4K1F A;  4O7H A;  4MJE A;  3APS A;  3O6T A;  2KHP A;  1URM A;  5C04 A;  4H86 A;  1PX6 A;  1CQG A;  1IYH A;  2WUL A;  4AJ6 A;  5DJM A;  1SKS B;  3LYK A;  16GS A;  3CBU A;  5ECK B;  4I6X A;  4L5L A;  3G7J A;  4MLY A;  5B8A A;  3M0F A;  2GQK A;  2PPT A;  3WD6 A;  3GX8 A;  1Z7R A;  1RQM A;  3CSJ A;  1HD2 A;  2TIR A;  4GTU A;  4Q5Q A;  1F37 A;  1RK4 A;  2JZT A;  2L4C A;  3RBT A;  2O89 A;  5FHI A;  3ZIV A;  3HDC A;  2H1D A;  3ISO A;  4HI7 A;  4GST A;  3QDN A;  4TR1 B;  3ERF A;  1EEJ A;  1NM3 A;  3EU3 A;  3U6V A;  1ML6 A;  2NTO A;  3TJK A;  1PL1 A;  4K6X A;  4HQZ A;  3EE2 A;  2H75 A;  4TR1 A;  4WET A;  3TJB A;  3ZVJ D;  3L9S A;  5LCZ A;  1XVQ A;  2H6Y A;  3VI5 A;  2PER A;  2FY6 A;  4K8M A;  5F0G A;  1TRS A;  4BWQ A;  3HD5 A;  1BED A;  4ZBA A;  4GRF A;  3F4T A;  5G31 A;  2YAN A;  3GN3 A;  2VOC A;  1TRV A;  1JZD A;  5A4U A;  2YWI A;  5G2Z A;  1GRX A;  4MP4 A;  1JZR A;  5G5F A;  2L5L A;  4HDE A;  3ZLP A;  4XIH A;  5FT3 A;  1WMJ A;  4IJI A;  1PQN A;  2HRF A;  2MBT A;  2LEG A;  1T1V A;  1V2A A;  2FA8 A;  3UAR A;  3CRT A;  3CSI A;  2GT6 A;  2C0F A;  4HQS A;  2DMM A;  5ECS A;  4J57 E;  4XS4 B;  5B6M A;  4BVX A;  4OFT A;  4OFN A;  3HJP A;  2H30 A;  4GF0 A;  4FYU A;  4XS4 A;  4PX1 A;  3GYK A;  1ON4 A;  1TK8 B;  2XBI A;  4EC0 A;  2WZ9 A;  5D9X A;  1F9M A;  2DJJ A;  1MTC A;  4Z7X A;  3LQ7 A;  1SYR A;  3DD3 A;  2L59 A;  5F8B A;  1V58 A;  2CX3 A;  4ECC A;  4JU5 A;  3KH7 A;  3IDV A;  1Z6N A;  3KP9 A;  3PH9 A;  1HYU A;  1R5P A;  2LJK A;  1NHO A;  1XCC A;  4PXO A;  3ME7 A;  3VPT A;  5G1L A;  4ZB6 A;  5CAX A;  1K0B A;  2O8V B;  2N5A A;  3RHB A;  3M1G A;  4IHU A;  3W8J A;  4TKY A;  2QSI A;  4JED A;  5IQY A;  3AY8 A;  4NHZ A;  1SJI A;  3WGD A;  2C3T A;  3CYN A;  1WJK A;  1PSQ A;  1YEP A;  4TR4 A;  2L6C A;  1J0F A;  2HFD A;  2YJ7 A;  1A24 A;  1W4V A;  3QFB C;  4ECI A;  4EKZ A;  3APO A;  2OKA A;  5DCH A;  2J23 A;  1K3L A;  3WGX A;  3CTF A;  1DUG A;  4AGS A;  1AUC A;  1A8Y A;  3FR3 A;  1OKD A;  2ON7 A;  3IK9 A;  4WEY A;  1TU7 A;  2YPM A;  2G2Q A;  5EPF A;  1EWX A;  5ECO B;  3UVH A;  3PR8 A;  1TXX A;  2WCI A;  2O7K A;  3BOA A;  2H1B A;  1XXU A;  1O85 A;  4PNF A;  2FLS A;  1BJX A;  1FG4 A;  1QUW A;  4XTS A;  2JAD A;  3C1R A;  3ZTL A;  2RM6 A;  2E7P A;  1XW9 A;  3FKF A;  4CW9 A;  2AJQ B;  3VK9 A;  2ZCT A;  3F8U A;  1VF3 A;  2B1L A;  2GZZ A;  5IMF A;  1YZX A;  1XW5 A;  2B5Y A;  2VUP A;  1GUK A;  5E4W A;  1G6Y A;  3KMN A;  1IYI A;  2YZU A;  3Q6O A;  3IE3 A;  17GS A;  1WPI A;  1GSU A;  3EWL A;  1GUH A;  4WR4 A;  2HI7 A;  3I43 A;  3Q74 A;  4XRA A;  5J3R A;  1YEX A;  1AAZ A;  2LST A;  1OAZ A;  5JWO B;  2V1M A;  1TTZ A;  2CQ9 A;  4NXI A;  3HCZ A;  1SJ6 A;  5DCG A;  3I69 A;  1VF2 A;  1V9W A;  2GDR A;  2FWF A;  4KE3 A;  1TJD A;  1K0C A;  5IOW A;  1H75 A;  1JZO A;  3LOR A;  2JZS A;  4G9H A;  4DSR A;  2MMN A;  2CA8 A;  3MSZ A;  5IIZ A;  3IBH A;  2B6M A;  1O81 A;  4LA1 A;  3HVS A;  5CRG A;  2IMI A;  4NWY A;  3WT2 A;  1SK0 A;  4ZXG A;  1Z6M A;  3CTG A;  4ZB9 A;  1TOF A;  4FIW A;  3LJR A;  5JWQ B;  2VD1 A;  2P5R A;  4ULX A;  4MZB A;  2YJH A;  3C7M A;  1B4P A;  4ID0 A;  3VFI A;  3IV4 A;  1O7U A;  7GSS A;  4PUF C;  4JZQ A;  5GZZ B;  1PRX A;  3FZ9 A;  4AJ8 A;  4WBR D;  4HU9 A;  1FB6 A;  4F03 A;  2GS3 A;  3D0Z A;  2LRN A;  5D96 A;  4E8H A;  1AQW A;  1GTB A;  2IMD A;  2IIY A;  3FR9 A;  1ZYE A;  6GSU A;  5DAK A;  2X99 A;  2PWJ A;  4EDZ A;  3IOS A;  2PVQ A;  1B8X A;  3WT1 A;  5KN1 A;  3ZFL A;  3TDG A;  1B9Y C;  1GSQ A;  4OMV A;  5D9W A;  2N5F A;  3US3 A;  2C80 A;  1GLP A;  4JBB A;  4POM A;  1EP8 A;  3TKS E;  5J9B A;  3QMX A;  1WIK A;  2G0F A;  4ZIJ A;  3Q19 A;  2VCW A;  1U87 A;  3DVW A;  2XPD A;  4XS6 A;  1ZMA A;  3TCO A;  2QC7 A;  2KP1 A;  3H4K A;  5E59 A;  2C8U A;  4EE0 A;  2FCH A;  2C3Q A;  2DLX A;  1WRY A;  4RQR A;  4PUR A;  1E2Y A;  4MPF A;  5DQY A;  4N30 A;  1MDJ A;  2H72 A;  3IR4 A;  4JE1 A;  1TRW A;  1GLQ A;  4J2F A;  12GS A;  2H66 A;  3ZRD A;  5DAL B;  2CVB A;  4QL9 A;  2RII A;  5IMC A;  4P3Y B;  1VGL A;  5EL8 A;  2VM1 A;  5G30 A;  5DAL A;  1V98 A;  2PGT A;  4N11 A;  2E2G A;  3K8N A;  3DML A;  3F6D A;  1YQ1 A;  5ECN B;  2WDU A;  5DBQ A;  3QAG A;  4O5R A;  3EMX A;  4OCE A;  3L0H A;  3GUR A;  2R6K A;  3QPM A;  5H5R A;  5AIX A;  4IW9 A;  1M9A A;  4MH2 A;  3GL3 A;  1XWA A;  2H0G A;  5HQP A;  1ZYQ B;  2I81 A;  3F63 A;  2FUG 2;  3LYP A;  3GUS A;  1S3D A;  1MD4 A;  1XWK A;  2LRT A;  3HJM A;  2VL2 C;  3EU4 A;  4IS0 A;  4IP6 A;  2F51 A;  4MH3 A;  3E9J B;  4GSN A;  1YJ6 A;  2V6O A;  4V2N A;  3BCI A;  1O8X A;  19GS A;  4MZW A;  4KB3 A;  2JSZ A;  4O32 A;  4TN8 A;  1U88 A;  4I2T A;  4RUV A;  4X1U A;  4KAE A;  4NPB A;  2RM5 A;  2DIY A;  3DVX A;  2OBI A;  2DIZ A;  1K3Y A;  2YCD A;  3O76 A;  3TKS A;  1U3A A;  4FYB A;  4LL4 B;  2DJ1 A;  2OE0 A;  1B48 A;  4ZBD A;  1SD9 A;  5CYY A;  1DE2 A;  4QL7 A;  1M2A A;  1U6T A;  1XBS A;  3F3Q A;  1Y25 A;  1NSW A;  4QQ7 A;  4JRR A;  5JWR B;  4TXV A;  3VI7 A;  2LV3 A;  2IN3 A;  3E3E A;  2YN1 A;  3VLN A;  1KBN A;  1YF1 A;  2C0E A;  2FWG A;  2OE1 A;  2CX4 A;  3M3M A;  3EUR A;  5ECH B;  1SKR B;  1WOU A;  4ZBB A;  1K0D A;  2KUC A;  5GAN D;  5ECM B;  3P7X A;  3G7Y A;  3I9V 2;  1TW9 A;  3KD0 A;  18GS A;  1M99 A;  1SYX A;  1Z3E A;  2KOK A;  1C72 A;  1SEN A;  1J9B A;  3FZA A;  2CV4 A;  6GSV A;  3C71 A;  4MPG A;  4BA7 A;  3OR5 A;  4MDC A;  4ECJ A;  1O73 A;  2AAW A;  2RLI A;  1N8J A;  3TUE A;  4OO5 A;  4HU7 A;  5HR2 A;  1M9B A;  4FO5 A;  4WKW A;  1ZZY A;  1ST9 A;  1OE7 A;  5JCG A;  1T8E B;  2B7J A;  1QGV A;  2HSY A;  1SL2 B;  1GL8 A;  1AQV A;  1AW9 A;  2DBC A;  2E2M A;  1XOA A;  4MCU A;  2LNS A;  1QQ2 A;  5A4W A;  1PMT A;  1YY7 A;  1J08 A;  5ABR A;  2LRC A;  1X5E A; 
#chains in the Genus database with same CATH topology
 3MIX A;  2DJ0 A;  3Q18 A;  4IQ1 A;  2ON5 A;  3HA9 A;  1A2J A;  2O87 A;  4X0X A;  6GSY A;  4DVC A;  2IWT A;  1U3I A;  2CVD A;  2VL3 A;  1Y6E A;  2PBJ A;  2FWH A;  2F9S A;  3KMO A;  4F2I A;  2AB6 A;  3UMA A;  3IC4 A;  3UBK A;  1DBY A;  2MBS A;  4HS1 A;  3LG6 A;  3ME8 A;  1OC3 A;  2YOI A;  1GSE A;  4TRX A;  5KOW A;  5JCU A;  4K7I A;  5HFI A;  1GTA A;  2WRT A;  5ECR B;  2H71 A;  1AC1 A;  2TRX A;  5ECL B;  3UL3 A;  5CRW A;  3VWU A;  4OWY A;  1GNW A;  3I6A A;  2P5Q A;  4PUA A;  3QAW A;  3D4T A;  2MYG A;  2YWM A;  1MD3 A;  3DRN A;  4IBP A;  5D73 A;  4BWS A;  4KDU A;  1A2M A;  1JHB A;  2C0G A;  4LLR A;  2GZY A;  2R3X A;  4F0C A;  1F3A A;  1M7T A;  4CDO A;  3VUR A;  2HT9 A;  3M9K A;  2GTU A;  1FAA A;  2BTO T;  4OO4 A;  1VRS D;  1PN9 A;  1XOB A;  1TU8 A;  3KTB A;  2L57 A;  5J5N A;  1UVZ A;  1A0F A;  4N0V A;  3UOM A;  4ML1 A;  1HNC A;  3A5I A;  4OFM A;  2IMF A;  1XZO A;  4IEL A;  4WR5 A;  3KJY A;  3GSS A;  1CQH A;  3D4M A;  3DYR A;  3O3T A;  5G5E A;  4I5Q A;  3RPN A;  3A5W A;  1S3C A;  3ZFB A;  4LMV A;  22GS A;  3HZ8 A;  1UC7 A;  3S9F A;  1JZW A;  2I4A A;  3D5J A;  4RI6 A;  4V1A p;  5CP1 A;  5CNW A;  1R26 A;  1LJR A;  2K6V A;  4GSS A;  1S3A A;  4PQH A;  2GGT A;  1T4Y A;  2VCZ A;  4G0L A;  1B9X C;  1TI3 A;  4KND A;  5HR3 A;  2LTK A;  1ILO A;  2REM A;  4NMU A;  1E6B A;  3UJ1 A;  2VCT A;  4D73 A;  1FVK A;  4V2L A;  4KUN A;  4G0K A;  3F3R A;  2GQM A;  4G19 A;  2L6D A;  4Z2U A;  5F05 A;  3HHV A;  2B1K A;  2A4H A;  3UVT A;  3BBY A;  1T3B A;  3N9J A;  3QOU A;  2ALB A;  1EV9 A;  2FD3 A;  3R3E A;  2NVL A;  1SL0 B;  2MZC A;  1X5D A;  3IRA A;  4MF6 A;  2VLT A;  4K0N A;  1GSS A;  4YAP A;  1HNA A;  2RUE A;  4YKG A;  5DDL A;  5D9T A;  4CY6 A;  2EIR A;  8GSS A;  1N2A A;  2OJL A;  3GTU B;  3LGC A;  3GV1 A;  3IXR A;  5CRD A;  2B5X A;  1EP7 A;  3GKM A;  2N5B A;  3GH9 A;  4RI7 A;  1K0N A;  3GTU A;  2HZE B;  1SL1 B;  5ID2 B;  2TRC P;  3HY2 A;  3FYG A;  3L9U A;  3GIX A;  3LWA A;  1FOV A;  1EOG A;  2YZH A;  4L0W A;  2HZE A;  4ZB8 A;  5F07 A;  5ID2 A;  3DIE A;  4JR4 A;  2HLS A;  2IMK A;  4I2U A;  4AF2 A;  3GST A;  4MF5 A;  4Q5F A;  2CVK A;  5EY6 A;  2C1Y A;  1BQ7 A;  2LJA A;  5ECI B;  2WJU A;  2XC2 A;  1GSY A;  3R2Q A;  2FGX A;  1PGT A;  2CAI A;  1ACV A;  3KCM A;  1GNE A;  2HXK A;  1EGR A;  2ES7 A;  3BD2 A;  4NV2 A;  6GST A;  1XG8 A;  2H01 A;  2FHE A;  2JZR A;  3ED3 A;  3SWL A;  5ECP B;  2YV9 A;  2YV7 A;  2DKI A;  3VWW A;  5DAK B;  3W8S A;  1WWJ A;  2YP6 A;  4F9Z A;  13GS A;  1GUL A;  4MK3 A;  4I8B A;  4K7N A;  3C73 A;  1MDI A;  1YDK A;  2CAQ A;  5JCW A;  3ZYW A;  2H76 A;  3TKP A;  1XVW A;  1R5A A;  4G2E A;  4EO3 A;  1PN0 A;  2A2P A;  3EMP A;  1USB A;  3EYT A;  4GQF A;  5B6N A;  1GUM A;  1M2D A;  4WF5 A;  4BVY A;  4KDY A;  4XCS A;  2DJ2 A;  3TRX A;  1JLW A;  3TGZ A;  1G0T A;  3A3T A;  2H1G A;  1W89 A;  1BX9 A;  1Z7P A;  2R37 A;  2YWN A;  3TRQ A;  4MZC A;  4O92 A;  2X8G A;  3LEF A;  4HOJ A;  11GS A;  2L5O A;  3HYP A;  1TP9 A;  4WF4 A;  4KCE A;  2D2Z A;  1M0U A;  1M3I A;  3C1S A;  3HKR A;  3GFK A;  3LXZ A;  1AQX A;  4IKH A;  3BJ5 A;  3KEB A;  2OA7 A;  1PKW A;  4OD7 A;  1B4Q A;  2MMO A;  4TR3 A;  2GT5 A;  1X5C A;  3GA4 A;  1XWC A;  3KP8 A;  1X9S B;  3TJF A;  2IPA A;  3TOT A;  3UBL A;  2PMT A;  4HUA A;  3TJG A;  1Q4J A;  4EXJ A;  1OVN A;  3ZMK A;  4EDY A;  2GQL A;  3GKX A;  4FH8 A;  3L9V A;  3IA1 A;  1M2B A;  1OYJ A;  2QGV A;  3FZ4 A;  3RAZ A;  3TB2 A;  1UN2 A;  4ML6 A;  1QXH A;  1KEB A;  1K0O A;  2LQO A;  1YF0 A;  3F4R A;  4MJA A;  1DE1 A;  2WB9 A;  1XW6 A;  2K18 A;  4IGJ A;  4IQA A;  4IVF A;  3H1N A;  1JLV A;  4ZL8 A;  2J9H A;  5GST A;  1FO5 A;  4MF7 A;  4FYC A;  3JCM L;  1TK5 B;  4JR6 A;  2AUV A;  5KN2 A;  1SK1 A;  5ELA A;  5GSS A;  2H0H A;  2DKH A;  2OAD A;  4KA0 A;  1EZK A;  3GKN A;  4ZL9 A;  4PQI A;  3UAP A;  4ACS A;  4XHM A;  1VF1 A;  5J41 A;  1OC9 A;  1RW1 A;  4K2D A;  3NOF A;  5CRE A;  4PGT A;  3G7I A;  2V6K A;  4EVM A;  1R4W A;  2M46 A;  2M72 A;  2ZNM A;  3IK7 A;  1XWG A;  3GMF A;  3APQ A;  1GP1 A;  3CXG A;  3KGK A;  2CZ3 A;  3VPQ A;  4YH2 A;  3IHQ A;  3ZL5 A;  4KSM A;  2C4J A;  2VL9 A;  1T7P B;  2B7K A;  1F6M C;  1HNB A;  2I1U A;  2DC5 A;  2LKU A;  4HZ4 A;  1YKA A;  1G6W A;  5AIV A;  2FWE A;  3F9U A;  2VLV A;  1FB0 A;  4V1A g;  2R2J A;  4PQ1 A;  1THX A;  5INY A;  3M9J A;  4MNN A;  3J7Y b;  5DVB A;  4KW6 A;  3HZ4 A;  2EIQ A;  3GHA A;  4ICY A;  1XFL A;  2LUS A;  2ZUP A;  5IO2 A;  2HRN A;  2MMA A;  3VWX A;  4ZL7 A;  2P31 A;  5CO3 A;  1F3B A;  2PVO C;  3F0I A;  3KM6 A;  2JSY A;  4KX4 A;  1TKD B;  1EEM A;  5HR1 A;  5H5Q A;  1VF4 A;  2M80 A;  1K0M A;  2BJX A;  4EF0 A;  2VAF A;  1TK0 B;  2EIO A;  1TDI A;  4MJC A;  3F4S A;  4PNG A;  3A2W A;  1ZL9 A;  2VD0 A;  4MJB A;  1V57 A;  3ZRE A;  2CT6 A;  2HZF A;  2R4V A;  2VIM A;  2AHE A;  2VL2 A;  3IAS 2;  3CRU A;  3KTL A;  1X0R A;  3EIN A;  4N0Z A;  4YAV A;  5H5S A;  1G7E A;  4DSQ A;  5IM9 A;  4EUY A;  4ZIL A;  1GTI A;  4YQU A;  14GS A;  3L78 A;  3KXO A;  3M8N A;  1SKW B;  3GRX A;  3QFA C;  2LS5 A;  4KGI A;  4J56 E;  5KN0 A;  2MMZ A;  4HJ2 A;  1ABA A;  2X8H A;  3TKQ A;  5B8B A;  4XRD A;  2H19 A;  5DJL A;  2HE3 A;  1GSF A;  3VWV A;  4GCI A;  3N5O A;  2R0C A;  3P2A A;  3DEX A;  2DJ3 A;  4EL1 A;  3J7Y k;  2LQQ A;  2OE3 A;  1Z9H A;  3GX0 A;  2DJK A;  3HVV A;  4Q5R A;  1LU4 A;  4DEJ A;  1LBK A;  3V1W A;  3EVI A;  4KH7 A;  10GS A;  2F8F A;  1K3O A;  1HQO A;  4KCA A;  1MEK A;  5J9C A;  4HZ2 A;  4CY8 A;  2O85 A;  2NDO A;  2X4A A;  3HJO A;  4NV5 A;  3ZIJ A;  3BCK A;  2GSR A;  2DML A;  4LL1 B;  3D22 A;  4NHW A;  1GSD A;  1OKT A;  1XWB A;  4IN0 A;  1PA3 A;  5HR0 A;  3CSH A;  3ZIT A;  2R0G A;  2Z9S A;  1PD2 1;  1YKC A;  1MDK A;  5IMV A;  3WGE A;  4GXZ A;  2I3Y A;  4USS A;  2IFQ B;  1QMV A;  1SU9 A;  2B5E A;  2WFC A;  2K8V A;  4ISD A;  4L5O A;  4K9Z A;  2QA2 A;  3KH9 A;  4N10 A;  4K0G A;  3UEM A;  2H6X A;  2IFQ A;  2NBS A;  1PKZ A;  2UZ8 A;  4Q5N A;  5KEJ A;  3H93 A;  1X9M B;  1V40 A;  3DXB A;  1XPV A;  4I97 A;  3U5R E;  3QD9 A;  1WE0 A;  4XS1 A;  3TRP A;  2WGR A;  1KTE A;  3PPU A;  2QKE A;  1ERW A;  3A2X A;  4D73 B;  2GLR A;  4NAX A;  2H8L A;  2A2R A;  3QR6 A;  5ELG A;  2IJY A;  5C00 A;  1A0R P;  2L4Q A;  3FR6 A;  4GWR A;  4EIP A;  2GST A;  4KDX A;  3G9B A;  4L8E A;  1A2L A;  4TXO B;  1XIY A;  3PGT A;  5DQS A;  1T00 A;  2KLX A;  3UIW A;  3LSZ A;  1ZYN A;  1ZCP A;  2LNT A;  4IJ3 A;  4TXO A;  4YQV A;  1TRU A;  5A4V A;  4GQC A;  2K8S A;  5IPH A;  3FY7 A;  1NW2 A;  5COH A;  1SJZ A;  3IPZ A;  3P8W A;  5FWG A;  3ZZX A;  4TR0 A;  5CRH A;  4YQM A;  1I9D A;  3QCP A;  1ERU A;  4PTS A;  1ERV A;  1ERT A;  3FZ5 A;  3FK8 A;  2VLU A;  2H1A A;  2VM2 A;  3H8Q A;  2PUK C;  5L71 A;  3HXS A;  2RUF A;  1DSB A;  4G10 A;  1OC8 A;  4POL A;  2YNX A;  4GLT A;  2KP2 A;  1FOH A;  3CQF A;  4BPY A;  1QK8 A;  1SK2 A;  3A2V A;  3ZML A;  2V32 A;  3GH6 A;  1EV4 A;  3FHK A;  4MA9 A;  1A23 A;  3GNJ A;  3QAV A;  4ILF A;  2H70 A;  4WXT A;  2JAC A;  5AN1 A;  4POK A;  3LFL A;  3EC3 A;  5IO0 A;  2VO4 A;  4KF9 A;  2HNL A;  4DSS B;  1KNG A;  2A4V A;  2IME A;  2XHF A;  1F2E A;  5B7C A;  3MDK A;  2F8A A;  3H79 A;  2XBQ A;  2V2G A;  5D8I A;  1AIU A;  4LMW A;  4DSS A;  2NPB A;  3P90 A;  1THO A;  2H6Z A;  2HSH A;  3D21 A;  3PIN A;  2YWO A;  3C8E A;  1PX7 A;  4HSC X;  3D6I A;  6GSW A;  1H4O A;  3MNG A;  1SD8 A;  5IMA A;  2GSS A;  4BVY B;  5IOX A;  1Q98 A;  3DKS A;  3HVX A;  20GS A;  4L0U A;  5IMZ A;  1A8L A;  2GSQ A;  1G7O A;  3WYW A;  5IMD A;  2E0Q A;  2LJR A;  4MAB A;  4MMM A;  3E0U A;  3FW2 A;  1BYE A;  2FNO A;  5ECQ B;  1T4Z A;  3GKK A;  1TI1 A;  1K0A A;  3TKS C;  1AXD A;  2H74 A;  4HEA 2;  5F06 A;  3KIJ A;  4K7O A;  4AJ7 A;  2K9F A;  1FW1 A;  4TOP A;  1JFU A;  4ECB A;  2QA1 A;  3NZN A;  9GSS A;  5D9V A;  3L4N A;  2JL4 A;  4A5P A;  5AGY A;  3MWH A;  3MAK A;  2WS2 A;  3FRC A;  3F6F A;  3TOU A;  2IL3 A;  3CMI A;  5GAP D;  5LNK e;  1Z5Y E;  1R7H A;  2XPE A;  5EVO A;  1BAY A;  2PN8 A;  5HFK A;  2VCX A;  2H0I A;  1FHE A;  2BMX A;  1I5G A;  1GTU A;  4F0B A;  5HFG A;  1O6J A;  4POB A;  3SBC A;  2P0G A;  2V41 A;  2H73 A;  5A5K A;  5KOX A;  2R5G A;  2AV4 A;  1GH2 A;  3GL5 A;  2I9H A;  5G1K A;  2X8C A;  2PU9 C;  4CHS A;  2C0D A;  3ERW A;  4X43 A;  3NIV A;  4OCF A;  2B3S A;  6GSX A;  1O8W A;  2DSA A;  3RPP A;  4BL7 A;  3W6G A;  1EOH A;  5KN3 A;  4HJM A;  4TW5 A;  2AYT A;  3LXT A;  5LD0 A;  1FVJ A;  1PL2 A;  3DWV A;  4RQX A;  2OAC A;  3TJJ A;  5ENU A;  3DGQ A;  1M3J A;  2C3N A;  2EC4 A;  3FMW A;  2FA4 A;  1BG5 A;  1GWC A;  2VCV A;  5IPG A;  2HRA A;  2F3M A;  1OE8 A;  2VCQ A;  3ZVJ A;  5AIS A;  3ERG A;  2CZ2 A;  3RDW A;  4EIQ A;  6GSS A;  1OC9 B;  1NHY A;  2GZP A;  2OBK A;  1EGO A;  1UA5 A;  2GVP A;  2X64 A;  2HYX A;  4K2X A;  1ZGN A;  4V2M A;  3KZQ A;  1QFN A;  1X9W B;  2A2S A;  3TKR A;  1WP0 A;  4E8E A;  5D93 A;  4IP1 A;  3IAM 2;  4F82 A;  4WBJ A;  4TVE A;  5J4U A;  3FEU A;  1ZOF A;  2JU5 A;  3RHC A;  4KSO A;  4K1F A;  4O7H A;  4MJE A;  3APS A;  3O6T A;  2KHP A;  3EPT A;  1URM A;  5C04 A;  4H86 A;  1PX6 A;  1CQG A;  1IYH A;  2WUL A;  4AJ6 A;  5DJM A;  1SKS B;  3LYK A;  16GS A;  3CBU A;  5ECK B;  4I6X A;  4L5L A;  3G7J A;  4MLY A;  5B8A A;  3M0F A;  2GQK A;  2PPT A;  3WD6 A;  3GX8 A;  1Z7R A;  1RQM A;  3CSJ A;  4FQU A;  1HD2 A;  2TIR A;  4GTU A;  4Q5Q A;  1F37 A;  1RK4 A;  2JZT A;  2L4C A;  3RBT A;  2O89 A;  5FHI A;  3ZIV A;  3HDC A;  2H1D A;  3ISO A;  4HI7 A;  4GST A;  3QDN A;  4TR1 B;  3ERF A;  1EEJ A;  4K5R A;  1NM3 A;  3EU3 A;  3U6V A;  4K5S A;  1ML6 A;  5BMU A;  2NTO A;  3TJK A;  1PL1 A;  4K6X A;  4HQZ A;  3EE2 A;  4WET A;  2H75 A;  1S3R A;  4TR1 A;  3TJB A;  3ZVJ D;  3L9S A;  5LCZ A;  1XVQ A;  2H6Y A;  3VI5 A;  2PER A;  2FY6 A;  4K8M A;  5F0G A;  1TRS A;  4BWQ A;  3HD5 A;  1BED A;  4ZBA A;  4GRF A;  3F4T A;  5G31 A;  2YAN A;  3GN3 A;  2VOC A;  1TRV A;  1JZD A;  5A4U A;  2YWI A;  5G2Z A;  1GRX A;  4MP4 A;  1JZR A;  5G5F A;  2L5L A;  4HDE A;  3ZLP A;  4XIH A;  5FT3 A;  1WMJ A;  4IJI A;  1PQN A;  2HRF A;  2MBT A;  2LEG A;  1T1V A;  1V2A A;  2FA8 A;  3UAR A;  4YKF A;  3CRT A;  3CSI A;  4BVX B;  2GT6 A;  2C0F A;  4HQS A;  2DMM A;  5ECS A;  4J57 E;  4XS4 B;  5B6M A;  4BVX A;  4OFT A;  4OFN A;  3HJP A;  2H30 A;  3IC8 A;  4GF0 A;  4FYU A;  4XS4 A;  4PX1 A;  3GYK A;  1ON4 A;  1TK8 B;  2XBI A;  4EC0 A;  2WZ9 A;  5D9X A;  1F9M A;  2DJJ A;  1MTC A;  4Z7X A;  3LQ7 A;  1SYR A;  3DD3 A;  2L59 A;  5F8B A;  1V58 A;  2CX3 A;  4ECC A;  4JU5 A;  3KH7 A;  3IDV A;  1Z6N A;  3KP9 A;  3PH9 A;  1HYU A;  1R5P A;  2LJK A;  1NHO A;  1XCC A;  4PXO A;  3ME7 A;  3VPT A;  5G1L A;  4ZB6 A;  5CAX A;  1K0B A;  2O8V B;  2N5A A;  3RHB A;  3M1G A;  4IHU A;  3W8J A;  4TKY A;  2QSI A;  4JED A;  5IQY A;  3AY8 A;  4NHZ A;  1SJI A;  3WGD A;  1PFO A;  2C3T A;  3CYN A;  1WJK A;  1PSQ A;  1YEP A;  4TR4 A;  2L6C A;  1J0F A;  2HFD A;  2YJ7 A;  1A24 A;  1W4V A;  3QFB C;  4ECI A;  4EKZ A;  3APO A;  2OKA A;  5DCH A;  2J23 A;  1K3L A;  3WGX A;  3CTF A;  1DUG A;  4AGS A;  1AUC A;  1A8Y A;  3FR3 A;  4BIK A;  1OKD A;  2ON7 A;  2HRK A;  3IK9 A;  4WEY A;  1TU7 A;  2YPM A;  2G2Q A;  5EPF A;  4Z2R A;  1EWX A;  5ECO B;  3UVH A;  3PR8 A;  1TXX A;  2WCI A;  2O7K A;  3BOA A;  2H1B A;  1XXU A;  1O85 A;  4PNF A;  2FLS A;  1BJX A;  1FG4 A;  1QUW A;  4XTS A;  2JAD A;  3C1R A;  3ZTL A;  2RM6 A;  2E7P A;  1XW9 A;  3FKF A;  4CW9 A;  2AJQ B;  3VK9 A;  2ZCT A;  3F8U A;  1VF3 A;  2B1L A;  2GZZ A;  5IMF A;  1YZX A;  1XW5 A;  2B5Y A;  2VUP A;  1GUK A;  5E4W A;  1G6Y A;  3KMN A;  1IYI A;  2YZU A;  3Q6O A;  3IE3 A;  17GS A;  1WPI A;  1GSU A;  3EWL A;  1GUH A;  4WR4 A;  2HI7 A;  3I43 A;  3Q74 A;  4XRA A;  5J3R A;  1YEX A;  1AAZ A;  2LST A;  1OAZ A;  5JWO B;  2V1M A;  1TTZ A;  2CQ9 A;  4NXI A;  3HCZ A;  1SJ6 A;  5DCG A;  3I69 A;  1VF2 A;  1V9W A;  2GDR A;  2FWF A;  4KE3 A;  1TJD A;  1K0C A;  5IOW A;  1H75 A;  1JZO A;  3LOR A;  2JZS A;  4G9H A;  4DSR A;  2MMN A;  2CA8 A;  3MSZ A;  5IIZ A;  3IBH A;  2B6M A;  1O81 A;  4LA1 A;  3HVS A;  5CRG A;  2IMI A;  4NWY A;  3WT2 A;  1SK0 A;  4ZXG A;  1Z6M A;  3CTG A;  4ZB9 A;  1TOF A;  4FIW A;  3LJR A;  5JWQ B;  2VD1 A;  2P5R A;  4ULX A;  4MZB A;  2YJH A;  3C7M A;  1B4P A;  3IHG A;  4ID0 A;  3VFI A;  3IV4 A;  1O7U A;  7GSS A;  4PUF C;  4JZQ A;  5GZZ B;  1PRX A;  3FZ9 A;  4AJ8 A;  4O5U A;  4WBR D;  4HU9 A;  1FB6 A;  4F03 A;  2GS3 A;  3D0Z A;  2LRN A;  5BRT A;  5D96 A;  4E8H A;  1AQW A;  1GTB A;  2IMD A;  2IIY A;  3FR9 A;  1ZYE A;  6GSU A;  5DAK A;  2X99 A;  2PWJ A;  4EDZ A;  3IOS A;  2PVQ A;  1B8X A;  3WT1 A;  5KN1 A;  3ZFL A;  3TDG A;  1B9Y C;  1GSQ A;  4OMV A;  2N5F A;  5D9W A;  3US3 A;  2C80 A;  1GLP A;  4JBB A;  4POM A;  1EP8 A;  3TKS E;  5J9B A;  3QMX A;  1WIK A;  2G0F A;  4ZIJ A;  3Q19 A;  2VCW A;  1U87 A;  3DVW A;  2XPD A;  2X49 A;  4XS6 A;  1ZMA A;  4O5Q A;  3TCO A;  2QC7 A;  2KP1 A;  3H4K A;  5E59 A;  2C8U A;  4EE0 A;  2FCH A;  2C3Q A;  2DLX A;  1WRY A;  4RQR A;  4PUR A;  1E2Y A;  4MPF A;  5DQY A;  4N30 A;  2R0P A;  1MDJ A;  2H72 A;  3IR4 A;  4JE1 A;  1TRW A;  1GLQ A;  4J2F A;  12GS A;  4G0I A;  2H66 A;  3ZRD A;  5DAL B;  4BL7 B;  2CVB A;  4QL9 A;  2RII A;  5IMC A;  4P3Y B;  1VGL A;  5EL8 A;  2VM1 A;  5G30 A;  5DAL A;  1V98 A;  2PGT A;  4N11 A;  2E2G A;  3K8N A;  3DML A;  3F6D A;  1YQ1 A;  5ECN B;  2WDU A;  5DBQ A;  3QAG A;  4O5R A;  3EMX A;  4OCE A;  3L0H A;  3GUR A;  2R6K A;  3QPM A;  5H5R A;  5AIX A;  4IW9 A;  1M9A A;  4MH2 A;  3LW9 A;  3GL3 A;  1XWA A;  2H0G A;  5HQP A;  1ZYQ B;  2I81 A;  3F63 A;  2FUG 2;  3LYP A;  3GUS A;  1S3D A;  1MD4 A;  1XWK A;  2LRT A;  3HJM A;  2VL2 C;  3EU4 A;  4IS0 A;  4IP6 A;  2F51 A;  4MH3 A;  3E9J B;  4GSN A;  1YJ6 A;  2V6O A;  4V2N A;  3BCI A;  1O8X A;  19GS A;  4MZW A;  4KB3 A;  2JSZ A;  4O32 A;  4TN8 A;  1U88 A;  4I2T A;  4RUV A;  4X1U A;  4KAE A;  4NPB A;  2RM5 A;  2DIY A;  3DVX A;  2OBI A;  2DIZ A;  1K3Y A;  2YCD A;  3O76 A;  3TKS A;  1U3A A;  4FYB A;  4LL4 B;  2DJ1 A;  2OE0 A;  1B48 A;  4ZBD A;  1SD9 A;  3HVN A;  1ZYP A;  5CYY A;  1DE2 A;  4QL7 A;  1M2A A;  1U6T A;  1XBS A;  3F3Q A;  1Y25 A;  1NSW A;  2HSM A;  4QQ7 A;  4JRR A;  5JWR B;  4Z2T A;  4TXV A;  3VI7 A;  2LV3 A;  2IN3 A;  4X4J A;  3E3E A;  2YN1 A;  3VLN A;  1KBN A;  1YF1 A;  2C0E A;  2FWG A;  2OE1 A;  2CX4 A;  3M3M A;  3EUR A;  5ECH B;  1SKR B;  1WOU A;  4ZBB A;  1K0D A;  2KUC A;  5GAN D;  5ECM B;  3P7X A;  3G7Y A;  3I9V 2;  1TW9 A;  3MYD A;  3KD0 A;  18GS A;  1M99 A;  1SYX A;  1Z3E A;  2KOK A;  1C72 A;  1SEN A;  1J9B A;  3FZA A;  2CV4 A;  6GSV A;  3C71 A;  4MPG A;  4BA7 A;  3OR5 A;  4MDC A;  4ECJ A;  1O73 A;  2AAW A;  2RLI A;  1N8J A;  3TUE A;  4OO5 A;  4HU7 A;  5HR2 A;  1M9B A;  4FO5 A;  4WKW A;  1ZZY A;  1ST9 A;  1OE7 A;  5JCG A;  1T8E B;  2B7J A;  1QGV A;  2HSY A;  1SL2 B;  1GL8 A;  1AQV A;  1AW9 A;  2DBC A;  2E2M A;  1XOA A;  4MCU A;  2LNS A;  1QQ2 A;  5A4W A;  1PMT A;  1YY7 A;  1J08 A;  5ABR A;  2LRC A;  1X5E A; 
#chains in the Genus database with same CATH homology
 3MIX A;  2DJ0 A;  3Q18 A;  4IQ1 A;  2ON5 A;  3HA9 A;  1A2J A;  2O87 A;  4X0X A;  6GSY A;  4DVC A;  2IWT A;  1U3I A;  2CVD A;  2VL3 A;  1Y6E A;  2PBJ A;  2FWH A;  2F9S A;  3KMO A;  4F2I A;  2AB6 A;  3UMA A;  3IC4 A;  3UBK A;  1DBY A;  2MBS A;  4HS1 A;  3LG6 A;  3ME8 A;  1OC3 A;  2YOI A;  1GSE A;  4TRX A;  5KOW A;  5JCU A;  4K7I A;  5HFI A;  1GTA A;  2WRT A;  5ECR B;  2H71 A;  1AC1 A;  2TRX A;  5ECL B;  3UL3 A;  5CRW A;  3VWU A;  4OWY A;  1GNW A;  3I6A A;  2P5Q A;  4PUA A;  3QAW A;  3D4T A;  2MYG A;  2YWM A;  1MD3 A;  3DRN A;  4IBP A;  5D73 A;  4BWS A;  4KDU A;  1A2M A;  1JHB A;  2C0G A;  4LLR A;  2GZY A;  2R3X A;  4F0C A;  1F3A A;  1M7T A;  4CDO A;  3VUR A;  2HT9 A;  3M9K A;  2GTU A;  1FAA A;  2BTO T;  4OO4 A;  1VRS D;  1PN9 A;  1XOB A;  1TU8 A;  3KTB A;  2L57 A;  5J5N A;  1UVZ A;  1A0F A;  4N0V A;  3UOM A;  4ML1 A;  1HNC A;  3A5I A;  4OFM A;  2IMF A;  1XZO A;  4IEL A;  4WR5 A;  3KJY A;  3GSS A;  1CQH A;  3D4M A;  3DYR A;  3O3T A;  5G5E A;  4I5Q A;  3RPN A;  3A5W A;  1S3C A;  3ZFB A;  4LMV A;  22GS A;  3HZ8 A;  1UC7 A;  3S9F A;  1JZW A;  2I4A A;  3D5J A;  4RI6 A;  4V1A p;  5CP1 A;  5CNW A;  1R26 A;  1LJR A;  2K6V A;  4GSS A;  1S3A A;  4PQH A;  2GGT A;  1T4Y A;  2VCZ A;  4G0L A;  1B9X C;  1TI3 A;  4KND A;  5HR3 A;  2LTK A;  1ILO A;  2REM A;  4NMU A;  1E6B A;  3UJ1 A;  2VCT A;  4D73 A;  1FVK A;  4V2L A;  4KUN A;  4G0K A;  3F3R A;  2GQM A;  4G19 A;  2L6D A;  4Z2U A;  5F05 A;  3HHV A;  2B1K A;  2A4H A;  3UVT A;  3BBY A;  1T3B A;  3N9J A;  3QOU A;  2ALB A;  1EV9 A;  2FD3 A;  3R3E A;  2NVL A;  1SL0 B;  2MZC A;  1X5D A;  3IRA A;  4MF6 A;  2VLT A;  4K0N A;  1GSS A;  4YAP A;  1HNA A;  2RUE A;  4YKG A;  5DDL A;  5D9T A;  4CY6 A;  2EIR A;  8GSS A;  1N2A A;  2OJL A;  3GTU B;  3LGC A;  3GV1 A;  3IXR A;  5CRD A;  2B5X A;  1EP7 A;  3GKM A;  2N5B A;  3GH9 A;  4RI7 A;  1K0N A;  3GTU A;  2HZE B;  1SL1 B;  5ID2 B;  2TRC P;  3HY2 A;  3FYG A;  3L9U A;  3GIX A;  3LWA A;  1FOV A;  1EOG A;  2YZH A;  4L0W A;  2HZE A;  4ZB8 A;  5F07 A;  5ID2 A;  3DIE A;  4JR4 A;  2HLS A;  2IMK A;  4I2U A;  4AF2 A;  3GST A;  4MF5 A;  4Q5F A;  2CVK A;  5EY6 A;  2C1Y A;  1BQ7 A;  2LJA A;  5ECI B;  2WJU A;  2XC2 A;  1GSY A;  3R2Q A;  2FGX A;  1PGT A;  2CAI A;  1ACV A;  3KCM A;  1GNE A;  2HXK A;  1EGR A;  2ES7 A;  3BD2 A;  4NV2 A;  6GST A;  2H01 A;  2FHE A;  2JZR A;  3ED3 A;  3SWL A;  5ECP B;  2YV9 A;  2YV7 A;  2DKI A;  3VWW A;  5DAK B;  3W8S A;  1WWJ A;  2YP6 A;  4F9Z A;  13GS A;  1GUL A;  4MK3 A;  4I8B A;  4K7N A;  3C73 A;  1MDI A;  1YDK A;  2CAQ A;  5JCW A;  3ZYW A;  2H76 A;  3TKP A;  1XVW A;  1R5A A;  4G2E A;  4EO3 A;  1PN0 A;  2A2P A;  3EMP A;  1USB A;  3EYT A;  4GQF A;  5B6N A;  1GUM A;  1M2D A;  4WF5 A;  4BVY A;  4KDY A;  4XCS A;  2DJ2 A;  3TRX A;  1JLW A;  3TGZ A;  1G0T A;  3A3T A;  2H1G A;  1W89 A;  1BX9 A;  1Z7P A;  2R37 A;  2YWN A;  3TRQ A;  4MZC A;  4O92 A;  2X8G A;  3LEF A;  4HOJ A;  11GS A;  2L5O A;  3HYP A;  1TP9 A;  4WF4 A;  4KCE A;  2D2Z A;  1M0U A;  3C1S A;  3HKR A;  3GFK A;  3LXZ A;  1AQX A;  4IKH A;  3BJ5 A;  3KEB A;  2OA7 A;  1PKW A;  4OD7 A;  1B4Q A;  2MMO A;  4TR3 A;  2GT5 A;  1X5C A;  3GA4 A;  1XWC A;  3KP8 A;  1X9S B;  3TJF A;  2IPA A;  3TOT A;  3UBL A;  2PMT A;  4HUA A;  3TJG A;  1Q4J A;  4EXJ A;  1OVN A;  3ZMK A;  4EDY A;  2GQL A;  3GKX A;  4FH8 A;  3L9V A;  3IA1 A;  1M2B A;  1OYJ A;  2QGV A;  3FZ4 A;  3RAZ A;  3TB2 A;  1UN2 A;  4ML6 A;  1QXH A;  1KEB A;  1K0O A;  2LQO A;  1YF0 A;  3F4R A;  4MJA A;  1DE1 A;  2WB9 A;  1XW6 A;  2K18 A;  4IGJ A;  4IQA A;  4IVF A;  3H1N A;  1JLV A;  4ZL8 A;  2J9H A;  5GST A;  1FO5 A;  4MF7 A;  4FYC A;  3JCM L;  1TK5 B;  4JR6 A;  2AUV A;  5KN2 A;  1SK1 A;  5ELA A;  5GSS A;  2H0H A;  2DKH A;  2OAD A;  4KA0 A;  1EZK A;  3GKN A;  4ZL9 A;  4PQI A;  3UAP A;  4ACS A;  4XHM A;  1VF1 A;  5J41 A;  1OC9 A;  1RW1 A;  4K2D A;  3NOF A;  5CRE A;  4PGT A;  3G7I A;  2V6K A;  4EVM A;  1R4W A;  2M46 A;  2M72 A;  2ZNM A;  3IK7 A;  1XWG A;  3GMF A;  3APQ A;  1GP1 A;  3CXG A;  3KGK A;  2CZ3 A;  3VPQ A;  4YH2 A;  3IHQ A;  3ZL5 A;  4KSM A;  2C4J A;  2VL9 A;  1T7P B;  2B7K A;  1F6M C;  1HNB A;  2I1U A;  2DC5 A;  2LKU A;  4HZ4 A;  1YKA A;  1G6W A;  5AIV A;  2FWE A;  3F9U A;  2VLV A;  1FB0 A;  4V1A g;  2R2J A;  4PQ1 A;  1THX A;  5INY A;  3M9J A;  4MNN A;  3J7Y b;  5DVB A;  4KW6 A;  3HZ4 A;  2EIQ A;  3GHA A;  4ICY A;  1XFL A;  2LUS A;  2ZUP A;  5IO2 A;  2HRN A;  2MMA A;  3VWX A;  4ZL7 A;  2P31 A;  5CO3 A;  1F3B A;  2PVO C;  3F0I A;  3KM6 A;  2JSY A;  4KX4 A;  1TKD B;  1EEM A;  5HR1 A;  5H5Q A;  1VF4 A;  2M80 A;  1K0M A;  2BJX A;  4EF0 A;  2VAF A;  1TK0 B;  2EIO A;  1TDI A;  4MJC A;  3F4S A;  4PNG A;  3A2W A;  1ZL9 A;  2VD0 A;  4MJB A;  1V57 A;  3ZRE A;  2CT6 A;  2HZF A;  2R4V A;  2VIM A;  2AHE A;  2VL2 A;  3IAS 2;  3CRU A;  3KTL A;  1X0R A;  3EIN A;  4N0Z A;  4YAV A;  5H5S A;  1G7E A;  4DSQ A;  5IM9 A;  4EUY A;  4ZIL A;  1GTI A;  4YQU A;  14GS A;  3L78 A;  3KXO A;  3M8N A;  1SKW B;  3GRX A;  3QFA C;  2LS5 A;  4KGI A;  4J56 E;  5KN0 A;  2MMZ A;  4HJ2 A;  1ABA A;  2X8H A;  3TKQ A;  5B8B A;  4XRD A;  2H19 A;  5DJL A;  2HE3 A;  1GSF A;  3VWV A;  4GCI A;  3N5O A;  2R0C A;  3P2A A;  3DEX A;  2DJ3 A;  4EL1 A;  3J7Y k;  2LQQ A;  2OE3 A;  1Z9H A;  3GX0 A;  2DJK A;  3HVV A;  4Q5R A;  1LU4 A;  4DEJ A;  1LBK A;  3V1W A;  3EVI A;  4KH7 A;  10GS A;  2F8F A;  1K3O A;  1HQO A;  4KCA A;  1MEK A;  5J9C A;  4HZ2 A;  4CY8 A;  2O85 A;  2NDO A;  2X4A A;  3HJO A;  4NV5 A;  3ZIJ A;  3BCK A;  2GSR A;  2DML A;  4LL1 B;  3D22 A;  4NHW A;  1GSD A;  1OKT A;  1XWB A;  4IN0 A;  1PA3 A;  5HR0 A;  3CSH A;  3ZIT A;  2R0G A;  2Z9S A;  1PD2 1;  1YKC A;  1MDK A;  5IMV A;  3WGE A;  4GXZ A;  2I3Y A;  4USS A;  2IFQ B;  1QMV A;  1SU9 A;  2B5E A;  2WFC A;  2K8V A;  4ISD A;  4L5O A;  4K9Z A;  2QA2 A;  3KH9 A;  4N10 A;  4K0G A;  3UEM A;  2H6X A;  2IFQ A;  2NBS A;  1PKZ A;  2UZ8 A;  4Q5N A;  5KEJ A;  3H93 A;  1X9M B;  1V40 A;  3DXB A;  1XPV A;  4I97 A;  3U5R E;  3QD9 A;  1WE0 A;  4XS1 A;  3TRP A;  2WGR A;  1KTE A;  3PPU A;  2QKE A;  1ERW A;  3A2X A;  4D73 B;  2GLR A;  4NAX A;  2H8L A;  2A2R A;  3QR6 A;  5ELG A;  2IJY A;  5C00 A;  1A0R P;  2L4Q A;  3FR6 A;  4GWR A;  4EIP A;  2GST A;  4KDX A;  3G9B A;  4L8E A;  1A2L A;  4TXO B;  1XIY A;  3PGT A;  5DQS A;  1T00 A;  2KLX A;  3UIW A;  3LSZ A;  1ZYN A;  1ZCP A;  2LNT A;  4IJ3 A;  4TXO A;  4YQV A;  1TRU A;  5A4V A;  4GQC A;  2K8S A;  5IPH A;  3FY7 A;  1NW2 A;  5COH A;  1SJZ A;  3IPZ A;  3P8W A;  5FWG A;  3ZZX A;  4TR0 A;  5CRH A;  4YQM A;  1I9D A;  3QCP A;  1ERU A;  4PTS A;  1ERV A;  1ERT A;  3FZ5 A;  3FK8 A;  2VLU A;  2H1A A;  2VM2 A;  3H8Q A;  2PUK C;  5L71 A;  3HXS A;  2RUF A;  1DSB A;  4G10 A;  1OC8 A;  4POL A;  2YNX A;  4GLT A;  2KP2 A;  1FOH A;  4BPY A;  1QK8 A;  1SK2 A;  3A2V A;  3ZML A;  2V32 A;  3GH6 A;  1EV4 A;  3FHK A;  4MA9 A;  1A23 A;  3GNJ A;  3QAV A;  4ILF A;  2H70 A;  4WXT A;  2JAC A;  5AN1 A;  4POK A;  3LFL A;  3EC3 A;  5IO0 A;  2VO4 A;  4KF9 A;  2HNL A;  4DSS B;  1KNG A;  2A4V A;  2IME A;  2XHF A;  1F2E A;  5B7C A;  3MDK A;  2F8A A;  3H79 A;  2XBQ A;  2V2G A;  5D8I A;  1AIU A;  4LMW A;  4DSS A;  2NPB A;  3P90 A;  1THO A;  2H6Z A;  2HSH A;  3D21 A;  3PIN A;  2YWO A;  3C8E A;  1PX7 A;  3D6I A;  6GSW A;  1H4O A;  3MNG A;  1SD8 A;  5IMA A;  2GSS A;  4BVY B;  5IOX A;  1Q98 A;  3DKS A;  3HVX A;  20GS A;  4L0U A;  5IMZ A;  1A8L A;  2GSQ A;  1G7O A;  3WYW A;  5IMD A;  2E0Q A;  2LJR A;  4MAB A;  4MMM A;  3E0U A;  3FW2 A;  1BYE A;  2FNO A;  5ECQ B;  1T4Z A;  3GKK A;  1TI1 A;  1K0A A;  3TKS C;  1AXD A;  2H74 A;  4HEA 2;  5F06 A;  3KIJ A;  4K7O A;  4AJ7 A;  2K9F A;  1FW1 A;  4TOP A;  1JFU A;  4ECB A;  2QA1 A;  3NZN A;  9GSS A;  5D9V A;  3L4N A;  2JL4 A;  4A5P A;  5AGY A;  3MWH A;  3MAK A;  2WS2 A;  3FRC A;  3F6F A;  3TOU A;  2IL3 A;  3CMI A;  5GAP D;  5LNK e;  1Z5Y E;  1R7H A;  2XPE A;  5EVO A;  1BAY A;  2PN8 A;  5HFK A;  2VCX A;  2H0I A;  1FHE A;  2BMX A;  1I5G A;  1GTU A;  4F0B A;  5HFG A;  1O6J A;  4POB A;  3SBC A;  2P0G A;  2V41 A;  2H73 A;  5A5K A;  5KOX A;  2R5G A;  2AV4 A;  1GH2 A;  3GL5 A;  2I9H A;  5G1K A;  2X8C A;  2PU9 C;  4CHS A;  2C0D A;  3ERW A;  4X43 A;  3NIV A;  4OCF A;  2B3S A;  6GSX A;  1O8W A;  2DSA A;  3RPP A;  4BL7 A;  3W6G A;  1EOH A;  5KN3 A;  4HJM A;  4TW5 A;  2AYT A;  3LXT A;  5LD0 A;  1FVJ A;  1PL2 A;  3DWV A;  4RQX A;  2OAC A;  3TJJ A;  5ENU A;  3DGQ A;  2C3N A;  2EC4 A;  3FMW A;  2FA4 A;  1BG5 A;  1GWC A;  2VCV A;  5IPG A;  2HRA A;  2F3M A;  1OE8 A;  2VCQ A;  3ZVJ A;  5AIS A;  3ERG A;  2CZ2 A;  3RDW A;  4EIQ A;  6GSS A;  1OC9 B;  1NHY A;  2GZP A;  2OBK A;  1EGO A;  1UA5 A;  2GVP A;  2X64 A;  2HYX A;  4K2X A;  1ZGN A;  4V2M A;  3KZQ A;  1QFN A;  1X9W B;  2A2S A;  3TKR A;  1WP0 A;  4E8E A;  5D93 A;  4IP1 A;  3IAM 2;  4F82 A;  4WBJ A;  4TVE A;  5J4U A;  3FEU A;  1ZOF A;  2JU5 A;  3RHC A;  4KSO A;  4K1F A;  4O7H A;  4MJE A;  3APS A;  3O6T A;  2KHP A;  3EPT A;  1URM A;  5C04 A;  4H86 A;  1PX6 A;  1CQG A;  1IYH A;  2WUL A;  4AJ6 A;  5DJM A;  1SKS B;  3LYK A;  16GS A;  3CBU A;  5ECK B;  4I6X A;  4L5L A;  3G7J A;  4MLY A;  5B8A A;  3M0F A;  2GQK A;  2PPT A;  3WD6 A;  3GX8 A;  1Z7R A;  1RQM A;  3CSJ A;  4FQU A;  1HD2 A;  2TIR A;  4GTU A;  4Q5Q A;  1F37 A;  1RK4 A;  2JZT A;  2L4C A;  3RBT A;  2O89 A;  5FHI A;  3ZIV A;  3HDC A;  2H1D A;  3ISO A;  4HI7 A;  4GST A;  3QDN A;  4TR1 B;  3ERF A;  1EEJ A;  4K5R A;  1NM3 A;  3EU3 A;  3U6V A;  4K5S A;  1ML6 A;  5BMU A;  2NTO A;  3TJK A;  1PL1 A;  4K6X A;  4HQZ A;  3EE2 A;  2H75 A;  4TR1 A;  4WET A;  3TJB A;  3ZVJ D;  3L9S A;  5LCZ A;  1XVQ A;  2H6Y A;  3VI5 A;  2PER A;  2FY6 A;  4K8M A;  5F0G A;  1TRS A;  4BWQ A;  3HD5 A;  1BED A;  4ZBA A;  4GRF A;  3F4T A;  5G31 A;  2YAN A;  3GN3 A;  2VOC A;  1TRV A;  1JZD A;  5A4U A;  2YWI A;  5G2Z A;  1GRX A;  4MP4 A;  1JZR A;  5G5F A;  2L5L A;  4HDE A;  3ZLP A;  4XIH A;  5FT3 A;  1WMJ A;  4IJI A;  1PQN A;  2HRF A;  2MBT A;  2LEG A;  1T1V A;  1V2A A;  2FA8 A;  3UAR A;  4YKF A;  3CRT A;  3CSI A;  4BVX B;  2GT6 A;  2C0F A;  4HQS A;  2DMM A;  5ECS A;  4J57 E;  4XS4 B;  5B6M A;  4BVX A;  4OFT A;  4OFN A;  3HJP A;  2H30 A;  3IC8 A;  4GF0 A;  4FYU A;  4XS4 A;  4PX1 A;  3GYK A;  1ON4 A;  1TK8 B;  2XBI A;  4EC0 A;  2WZ9 A;  5D9X A;  1F9M A;  2DJJ A;  1MTC A;  4Z7X A;  3LQ7 A;  1SYR A;  3DD3 A;  2L59 A;  5F8B A;  1V58 A;  2CX3 A;  4ECC A;  4JU5 A;  3KH7 A;  3IDV A;  1Z6N A;  3KP9 A;  3PH9 A;  1HYU A;  1R5P A;  2LJK A;  1NHO A;  1XCC A;  4PXO A;  3ME7 A;  3VPT A;  5G1L A;  4ZB6 A;  5CAX A;  1K0B A;  2O8V B;  2N5A A;  3RHB A;  3M1G A;  4IHU A;  3W8J A;  4TKY A;  2QSI A;  4JED A;  5IQY A;  3AY8 A;  4NHZ A;  1SJI A;  3WGD A;  2C3T A;  3CYN A;  1WJK A;  1PSQ A;  1YEP A;  4TR4 A;  2L6C A;  1J0F A;  2HFD A;  2YJ7 A;  1A24 A;  1W4V A;  3QFB C;  4ECI A;  4EKZ A;  3APO A;  2OKA A;  5DCH A;  2J23 A;  1K3L A;  3WGX A;  3CTF A;  1DUG A;  4AGS A;  1AUC A;  1A8Y A;  3FR3 A;  1OKD A;  2ON7 A;  2HRK A;  3IK9 A;  4WEY A;  1TU7 A;  2YPM A;  2G2Q A;  5EPF A;  4Z2R A;  1EWX A;  5ECO B;  3UVH A;  3PR8 A;  1TXX A;  2WCI A;  2O7K A;  3BOA A;  2H1B A;  1XXU A;  1O85 A;  4PNF A;  2FLS A;  1BJX A;  1FG4 A;  1QUW A;  4XTS A;  2JAD A;  3C1R A;  3ZTL A;  2RM6 A;  2E7P A;  1XW9 A;  3FKF A;  4CW9 A;  2AJQ B;  3VK9 A;  2ZCT A;  3F8U A;  1VF3 A;  2B1L A;  2GZZ A;  5IMF A;  1YZX A;  1XW5 A;  2B5Y A;  2VUP A;  1GUK A;  5E4W A;  1G6Y A;  3KMN A;  1IYI A;  2YZU A;  3Q6O A;  3IE3 A;  17GS A;  1WPI A;  1GSU A;  3EWL A;  1GUH A;  4WR4 A;  2HI7 A;  3I43 A;  3Q74 A;  4XRA A;  5J3R A;  1YEX A;  1AAZ A;  2LST A;  1OAZ A;  5JWO B;  2V1M A;  1TTZ A;  2CQ9 A;  4NXI A;  3HCZ A;  1SJ6 A;  5DCG A;  3I69 A;  1VF2 A;  1V9W A;  2GDR A;  2FWF A;  4KE3 A;  1TJD A;  1K0C A;  5IOW A;  1H75 A;  1JZO A;  3LOR A;  2JZS A;  4G9H A;  4DSR A;  2MMN A;  2CA8 A;  3MSZ A;  5IIZ A;  3IBH A;  2B6M A;  1O81 A;  4LA1 A;  3HVS A;  5CRG A;  2IMI A;  4NWY A;  3WT2 A;  1SK0 A;  4ZXG A;  1Z6M A;  3CTG A;  4ZB9 A;  1TOF A;  4FIW A;  3LJR A;  5JWQ B;  2VD1 A;  2P5R A;  4ULX A;  4MZB A;  2YJH A;  3C7M A;  1B4P A;  3IHG A;  4ID0 A;  3VFI A;  3IV4 A;  1O7U A;  7GSS A;  4PUF C;  4JZQ A;  5GZZ B;  1PRX A;  3FZ9 A;  4AJ8 A;  4O5U A;  4WBR D;  4HU9 A;  1FB6 A;  4F03 A;  2GS3 A;  3D0Z A;  2LRN A;  5BRT A;  5D96 A;  4E8H A;  1AQW A;  1GTB A;  2IMD A;  2IIY A;  3FR9 A;  1ZYE A;  6GSU A;  5DAK A;  2X99 A;  2PWJ A;  4EDZ A;  3IOS A;  2PVQ A;  1B8X A;  3WT1 A;  5KN1 A;  3ZFL A;  3TDG A;  1B9Y C;  1GSQ A;  4OMV A;  2N5F A;  5D9W A;  3US3 A;  2C80 A;  1GLP A;  4JBB A;  4POM A;  1EP8 A;  3TKS E;  5J9B A;  3QMX A;  1WIK A;  2G0F A;  4ZIJ A;  3Q19 A;  2VCW A;  1U87 A;  3DVW A;  2XPD A;  2X49 A;  4XS6 A;  1ZMA A;  4O5Q A;  3TCO A;  2QC7 A;  2KP1 A;  3H4K A;  5E59 A;  2C8U A;  4EE0 A;  2FCH A;  2C3Q A;  2DLX A;  1WRY A;  4RQR A;  4PUR A;  1E2Y A;  4MPF A;  5DQY A;  4N30 A;  2R0P A;  1MDJ A;  2H72 A;  3IR4 A;  4JE1 A;  1TRW A;  1GLQ A;  4J2F A;  12GS A;  4G0I A;  2H66 A;  3ZRD A;  5DAL B;  4BL7 B;  2CVB A;  4QL9 A;  2RII A;  5IMC A;  4P3Y B;  1VGL A;  5EL8 A;  2VM1 A;  5G30 A;  5DAL A;  1V98 A;  2PGT A;  4N11 A;  2E2G A;  3K8N A;  3DML A;  3F6D A;  1YQ1 A;  5ECN B;  2WDU A;  5DBQ A;  3QAG A;  4O5R A;  3EMX A;  4OCE A;  3L0H A;  3GUR A;  2R6K A;  3QPM A;  5H5R A;  5AIX A;  4IW9 A;  1M9A A;  4MH2 A;  3LW9 A;  3GL3 A;  1XWA A;  2H0G A;  5HQP A;  1ZYQ B;  2I81 A;  3F63 A;  2FUG 2;  3LYP A;  3GUS A;  1S3D A;  1MD4 A;  1XWK A;  2LRT A;  3HJM A;  2VL2 C;  3EU4 A;  4IS0 A;  4IP6 A;  2F51 A;  4MH3 A;  3E9J B;  4GSN A;  1YJ6 A;  2V6O A;  4V2N A;  3BCI A;  1O8X A;  19GS A;  4MZW A;  4KB3 A;  2JSZ A;  4O32 A;  4TN8 A;  1U88 A;  4I2T A;  4RUV A;  4X1U A;  4KAE A;  4NPB A;  2RM5 A;  2DIY A;  3DVX A;  2OBI A;  2DIZ A;  1K3Y A;  2YCD A;  3O76 A;  3TKS A;  1U3A A;  4FYB A;  4LL4 B;  2DJ1 A;  2OE0 A;  1B48 A;  4ZBD A;  1SD9 A;  1ZYP A;  5CYY A;  1DE2 A;  4QL7 A;  1M2A A;  1U6T A;  1XBS A;  3F3Q A;  1Y25 A;  1NSW A;  2HSM A;  4QQ7 A;  4JRR A;  5JWR B;  4Z2T A;  4TXV A;  3VI7 A;  2LV3 A;  2IN3 A;  4X4J A;  3E3E A;  2YN1 A;  3VLN A;  1KBN A;  1YF1 A;  2C0E A;  2FWG A;  2OE1 A;  2CX4 A;  3M3M A;  3EUR A;  5ECH B;  1SKR B;  1WOU A;  4ZBB A;  1K0D A;  2KUC A;  5GAN D;  5ECM B;  3P7X A;  3G7Y A;  3I9V 2;  1TW9 A;  3MYD A;  3KD0 A;  18GS A;  1M99 A;  1SYX A;  1Z3E A;  2KOK A;  1C72 A;  1SEN A;  1J9B A;  3FZA A;  2CV4 A;  6GSV A;  3C71 A;  4MPG A;  4BA7 A;  3OR5 A;  4MDC A;  4ECJ A;  1O73 A;  2AAW A;  2RLI A;  1N8J A;  3TUE A;  4OO5 A;  4HU7 A;  5HR2 A;  1M9B A;  4FO5 A;  4WKW A;  1ZZY A;  1ST9 A;  1OE7 A;  5JCG A;  1T8E B;  2B7J A;  1QGV A;  2HSY A;  1SL2 B;  1GL8 A;  1AQV A;  1AW9 A;  2DBC A;  2E2M A;  1XOA A;  4MCU A;  2LNS A;  1QQ2 A;  5A4W A;  1PMT A;  1YY7 A;  1J08 A;  5ABR A;  2LRC A;  1X5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...