3SBEA

Crystal structure of rac1 p29s mutant
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
178
structure length
178
Chain Sequence
QGQAIKCVVVGDGAVGKTCLLISYTTNAFSGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exome sequencing identifies recurrent somatic RAC1 mutations in melanoma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ras-related C3 botulinum toxin substrate 1
total genus 59
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2011-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3sbeA00
4JZKA 1II8B 3K0AA 2C2HA 4I1SA 4JJKA 4ESHA 1E2IA 1KDPA 2EFCB 2RAPA 4URYR 5KO2A 1Q21A 1TPZA 2C04A 4HYYA 2CCGA 2V1UA 4J0QA 1T91A 3RS3A 3TKLA 4CVNA 4GT1A 3AVWA 1ZD1A 1KMHA 4DEYA 3SJAA 1QHNA 3LVQE 1TQ4A 3KB1A 2V7QD 1R0WA 2D3WA 2ZE5A 4YMWA 1GAJA 4IDPA 3RWOA 1W5TA 5TMPA 1XXHB 1TNDA 3RHFA 4MKFA 1R8SA 1DELA 1KO4A 1YR9A 2IHYA 3B1YA 4V0ME 2C9CA 4E03A 1CKEA 1SKYB 3QBVA 3E1SA 1YZKA 3QBTA 4EJSB 5P21A 4PPQA 1HURA 2WVJA 1FL9A 3RS5A 2EFEB 1F2TA 2D2EA 4V0LA 1HYQA 2A5FA 4EFLA 5CDFA 1Z2CA 2CNWA 1TQ6A 2J7KA 2Z6VA 5H8WA 2RGGA 2TMKA 1E2PA 2K5UA 2YV5A 1P60A 3TUIC 1M2OB 2G83A 4KSBA 1HE8B 2REBA 3WP1B 2AK2A 3L0PA 2P67A 1J7KA 3PIRA 1J2JA 3K0CA 2YVUA 3QG1A 2FDCA 1IONA 3MD0A 2GZHA 2ZSBA 4JLKA 2VPPA 1G291 5TARA 2GWHA 1U8ZA 2NOAA 4IJMA 2PCJA 3DOEA 2VP5A 4CT5A 1ZJ6A 2ODNA 3BC1A 4LV5B 4O3MA 1Z47A 2BVNA 2C77A 4Z8YA 4LJ8A 3VX3A 4UNQA 2Z5FA 4Q1AA 2ZQ5A 4MRRA 1EXMA 4YQFA 2PBRA 1YZNA 1KJWA 4PO1A 4IOLA 1UFQA 5FI0B 4TZ0A 3LA6A 4PC7A 2OLJA 2EVWX 3QXHA 3UMSA 4Q19A 3GFPA 5FTLA 1G6OA 2ECKA 4LJ5A 1A7JA 2BMJA 4PQYA 1W44A 4LJ4A 1G6HA 1OF1A 3OAAA 5KU1A 1KSGA 2H1LA 1UF9A 1GFIA 5H70A 1JR3A 1HE1C 5EP2A 3RC8A 4Q7MB 4U02A 1OHHD 1R10A 3FMIA 5FTKA 4Q1BA 4OK3A 3BOSA 2AL7A 3D6TB 2GVZC 4C0QC 1KNXA 5HKKD 2HF8A 2O8FB 2FSHA 4XOIA 4GPTA 1JPJA 4HLQB 1MRNA 3NBZC 2Q3MA 3OEHA 3THWB 4MGYR 5AK0A 5JJKA 3FTQA 4GI7A 1P9RA 4JVMA 4HATA 1D6JA 2GK7A 3WRXC 3K0AB 3CX7A 1R2QA 1A4RA 2ZREA 4HB4A 3GJ6A 5LDDC 3RRZA 3AVTA 1W4RA 5IHPA 2CK3D 2W0SA 4HLDA 3GFOA 2QN6A 2AR7A 1S96A 2JASA 2PH1A 5JWOA 3AVQA 3NVAA 2EYUA 3RRMA 2HYDA 5CK4A 1KMQA 5DI9A 1F2UA 2QRNA 4XVUA 1GKIA 1MR3F 2QMHA 3M4YA 1ZMXA 1N6LA 3KJHA 2O8DA 2D7CA 3IIKA 2OLKA 4UXIA 3EZ2A 1G5PA 3TVDA 4Q9LA 3SJBA 1G3IA 1UJ2A 2GDJA 4UJ5A 5IRCD 4JVLA 2MSCB 2P3SA 2RGCA 4LBVA 2NO7A 3NH6A 3QJYA 4PAMA 4TLAA 3U4QB 4RFSA 1E0KA 3NWJA 1FMLA 2FSGA 1XFAA 1E4VA 1VKJA 4P31A 3H1TA 3PUYA 3Q5EA 4HSEA 3QKUA 3IKJA 2QMUA 1CR2A 4YDSA 2NO1A 1Z22A 1SVMA 2BEJA 1YZQA 1S8FA 3LLMA 4RD2A 1VIAA 4GSYA 1N6KA 3VQTA 1YRAA 4XIGS 3QPVA 2XZOA 1JBKA 1DPFA 1S9DA 5KSZA 4AKGA 4M9XA 2IS2A 2GHIA 2ZYUX 3EZFA 4P0TA 3BFXA 1GL9B 5IK2A 4AG5A 1OFTA 2BJWA 5EE9A 4D6PA 2X77A 1J90A 4BLSA 1CJKC 3FFAA 2V3CC 1OW3B 3BK7A 4BQSA 1ZM2A 3SC3A 1N6RA 1TEXA 1H8EA 3RS0A 3OEED 3W6PA 5BW8A 4RZXA 4PO8A 4JMPA 4JSYA 1KK3A 2JGNA 1B0UA 2CE7A 2WSMA 2ZSAA 3BBPA 4Q66C 3WNBA 1BMFA 4CEIA 4LI0A 2FZ4A 1VECA 2XJ4A 2CJWA 4ABYA 3PR1A 1UBFA 3AH8A 4Q02A 4EPWA 3FHOA 1KI9A 1Z8FA 2BMFA 5A0FA 2R2AA 3NIBA 1CBUA 1CXZA 2DWQA 3FKQA 4V0NA 2IS4A 4URZR 5K8LA 2QU8A 3A1VA 1SVOA 4LBWA 1M1YE 4RD3A 1M74A 2A9KA 1X6VA 2ZAMA 3FFBA 4DXAA 1ZINA 4D4KA 1SKYE 3B2EA 3GJ5A 3P4YA 4IFEA 2PJZA 1Q1ZA 2WOJA 3SE0A 4LY6A 5KSOA 4KFSA 1IHUA 3BFKA 1TF2A 3B6EA 3PUXA 1JAIA 1FNNA 2XEXA 2GJSA 1JXMA 3L0OA 1T0HB 2GBLA 2DB3A 2IUSA 1FP7A 2IYLD 3B9QA 4LYFA 1JJVA 2OXRA 1VG1A 4Q9HA 3OIUA 3A1WA 1CEEA 3T5DA 3E2IA 3U60B 4PAOA 4LYHA 1SZPA 4PO9A 5DI3B 3OIWA 1XTKA 2J0QA 3GLHB 2ONJA 1E9CA 2BOVA 1NN1A 3SI7A 5E4FA 2GZAA 4MH0R 3K09A 1S9HA 2F7SA 4UQOA 5HE8A 3X1WA 3CWQA 4FMDB 4DT1B 2ZJ5A 1AA9A 4G5OA 4NCIA 4QFMA 2EYQA 3DMNA 3ND9A 3DMDA 3MUFA 4DUGA 1N5JA 1G64A 4QGGA 4NP6A 1CLUA 4DLYA 1SVSA 1XBTA 3NBYC 3B1WA 5DO9A 4BFTA 1OE0A 3L43A 4HDCA 3P1JA 4BFSA 1G1MA 4GOJA 4MYHA 5EE5B 1R5OA 4LHVA 4NU0A 4DWJA 2V9PA 2CCKA 4AKHA 3WXMA 3W5IA 3I61A 4N1AA 3B7GA 2PJRA 2GCPA 3G0HA 3AQ4A 2QMEA 1OH7A 4P4UA 3QEJA 3DPUA 4MDFA 2QPAA 4Q4AB 1KIMA 1N0UA 1ZD8A 1XF9A 1OH8A 4TYWA 4WXPA 3H84A 2KB0A 4HAUA 2H8KA 1E9DA 3RABA 4LWZA 2FA9A 5EP1A 5FOUA 3C5HA 3QNUA 1ESNA 2ZRMA 4TMWA 1X3SA 4N0EA 1NP6A 2V55B 5BN3A 1W5SA 1Z0DA 2QRZA 2QY9A 4EPRA 3KQHA 3QKSA 2JIZD 1GNQA 3A6PC 2BCJQ 2GXSA 1GM5A 4D82A 3EZ6A 4B3GA 3NTUA 1SHZA 2ERXA 4DVGA 4JVNA 3SYNA 4FIDA 4KYIB 4FD2A 2C03A 5E7IA 2CJWB 4JLDA 2H17A 2Z83A 2IBMA 1FUUA 2OCAA 4HB3A 1Z08A 1FQJA 1XJ0A 2XX3A 1MO6A 2YC2C 4KJZA 3UXMA 4E5UA 4EAQA 4EJSC 1XPRA 3AKDA 2IYTA 4W5WA 2DCUA 2D74A 1DVRA 4K81B 2QM7A 4M1TA 3P20A 4OHWA 1G21E 1FOEB 4UXJA 2BDTA 3CO5A 4Q00A 2RCNA 3AGPA 3A4NA 1T5IA 4YDHB 3HJNA 4B3XA 1D9ZA 3B85A 3B9PA 4QJ4A 4KAXA 1OYYA 1G4AE 2GCOA 1E9FA 2QBYB 1GWNA 1LW7A 1S1MA 3QVUA 6Q21A 1AZSC 5TB5A 3NDPA 2OV2A 2GJKA 2VBCA 3QOFA 3AKCA 4M1WA 1NRJB 3BJIC 3VKHA 2ZSDA 2QGNA 3AF3A 3QKRB 5G3YA 4PAQA 2XTZA 1TEVA 1YQTA 2E9SA 5BQ5A 4QHYA 2F43B 1ZRHA 2X2EA 1U8AA 2RGNA 3TW4A 4JBYA 1C1YA 1D8TA 5JSZB 2XB4A 4LBYA 1CF4A 5KPJA 3GJ3A 1UDXA 4ERNA 2EFGA 1Q20A 4A2WA 1XX6A 2NZJA 5FR1A 1RVDA 1ETUA 1O87A 3NKVA 1G19A 3TAHA 4LSGA 1VYVA 2WHXA 4QGFA 3EPJA 1KDTA 4WBSA 1WBBA 3MWYW 1SGWA 4DSNA 5FBLB 5K8TA 2NO9A 4A0GA 4B76A 1LFDB 4G0NA 4Q1CA 4D80A 4L4UA 4R9UC 3CZPA 1E2GA 2ZU0C 3GMTA 1E94E 3BAFA 3EASA 1CU1A 2W6IA 1E0SA 4PFSA 3KKOA 4TMKA 4Q9JA 3SHWA 1ZNYA 2VP0A 3BGWA 2ZJ8A 2OAP1 1E96A 3CNOA 4RFVA 2G0TA 5G41A 4ZIRA 3WMGA 2YWFA 3I32A 1D2EA 1QVAA 2J7PD 2X2FA 4K46A 4Q4AA 2ZYVX 4YONB 3EPKA 3HDTA 2QP4A 3N2IA 2EFHB 2KBFA 3EARA 2FGKA 3A1TA 4MYTA 2I4IA 3KKPA 5TXGA 3K9LA 4LHYA 3IPYA 5KHOC 4TYPA 4DHEA 5E95A 1HQYE 1SKQA 2ZRNA 2Z4SA 4C0JA 2XB2A 5C4GB 3H4MA 4K8OA 3I5XA 1KO5A 5HCNA 1RYFA 2CVFA 1OSNA 2F9MA 2J5XA 3K1JA 1N6PA 4QC2A 1RFLA 2PZEA 4A9AA 4DCNA 2RGDA 4DCTA 4AY2A 4URXR 3GLHA 4U7DA 1Q3TA 2JDIA 1L2TA 1F6BA 2HLDD 2F6RA 4RD1A 3TIFA 4BUJA 1F60A 2J7PA 1OXUA 3FVQA 4ZI2A 3GLFA 1SVKA 3LX8A 3AB3A 1KK2A 1NMYA 1G7SA 1UEIA 1ZUNB 2G88A 4RSGA 2CMKA 1XD2A 1WMSA 2W6JA 4YLGA 1KKMA 1KGDA 5FBVB 4IOMA 4LJ9A 2X8AA 3Q3JB 3IILA 5EP3A 4PSAA 4W5HA 5B30A 2CHQA 1RIFA 2DFNA 3TVTA 2ZITA 5CIWA 4NYMQ 5HZKA 4LC1A 3B60A 3TE6A 4KITB 4CEHA 1YR7A 3T1QA 4ZV4A 1T0JB 2QAGC 1E2HA 2JCSA 4JJZA 1W36D 3VNVA 4XTRA 1R6BX 4LCBA 4BZQA 3OFND 1GNPA 1FPMA 2X1VA 5J4VA 1JQLB 2QROA 3Q8XB 1P2UA 4TMTA 1Q3HA 3DDCA 3BH7A 4LZZA 2WKQA 1NVUQ 2B8WA 1PLLA 2W6ID 1XTJA 1GP2A 1T3LA 1I4LD 1XTQA 3U7GA 5HZHA 3FMPB 5FUXA 5KUTA 3L8ZA 3ND8A 2PEZA 2KWIA 3A36A 3C41J 3AEZA 1G8PA 3DL0A 3MWKA 4JL5A 4NCKA 4EQ6B 2NO6A 3RAPR 1VG8A 3ZH9B 1U0LA 4JS0A 1W4BA 4MQBA 2QT1A 3LNCA 3JVUA 4Q9KA 2ASEA 4JL8A 4WAUA 4P4SB 3RYTC 1YZLA 1Z0IA 1NY5A 2XZPA 2WTUA 2EQBA 3C15C 3CR8A 4I1UA 1D9XA 4OHXA 5FBQB 3B5JA 3QI2A 1VDZA 2JJ1A 5JEEA 4KO8A 2NQ2C 4F92B 5IDVA 4XWAA 3SEAA 5CM8B 2YHSA 1EX6A 3GLGE 4GP7A 4FN5A 4CT4B 4IKEA 1VHLA 2R9VA 5IF9A 4C0KA 4X8LA 5FPTA 2R65A 4HB0A 2FEOA 4DLUA 3GLFE 5EUMA 4DDVA 3PEYA 1IN7A 2F1JA 2BM1A 1US8B 2OFWA 3EC1A 3OIVA 5J40A 1Z6GA 4IXNA 5SZJA 2RHDA 3OF5A 2ZJAA 4ARZB 1OB2A 3EW9A 1BO6A 1QZXA 2P5TB 4G01B 1NIJA 2O8CB 1NG9A 3MCAA 3CPJB 5KPDA 2JJ2A 1U98A 3FB4A 4URWR 5CDFE 5AJYA 2QTVB 1ELOA 3ZJYA 1R0ZA 3TSZA 4NYJR 3ZQ6A 2FFBA 2PT5A 3BD9A 4JKIA 1IAQA 1C9KA 4GZLA 3K70C 2QSYA 5JLJA 2AD1A 5AJWA 8OHMA 4HDOB 4OI0A 1T3HA 3UG7A 3DVLA 4GOXA 2GAOA 4DDUA 1N2CE 1CJVC 1DAKA 5L3RA 3TSWA 4D2IA 4Q7LA 3U3OA 3TSOA 3OIYA 1OT3A 1TQ2A 2JEOA 3KQLA 3CIOA 3MAAC 1QF9A 4IRUB 3R7WA 1AS2A 2WJGA 1FFHA 4IEIA 5KDOA 1E1QA 3KJEA 4TQUS 3BRWD 2UZIR 4OQXA 2ATXA 3U3JA 3EZ7A 4M9SA 1TQDA 1T9HA 1OXSC 1HQCA 2MSDB 3L82B 1YZGA 3F8TA 3FOZA 4ZCIA 2VSOA 4UXHA 1SXJA 3WMEA 1AIPA 2FU5C 3KTAB 3TQCA 3ZZTA 1NBMD 2H7VA 5L3QA 2GJ9A 5TDHA 3FMFA 3IQXA 1W0KA 5FPSA 5CM9C 1JR3E 1XD9A 4GNKA 3CNLA 4HAVA 4AK9A 3EAQA 2XNSA 3NC0C 621PA 3K70B 2IX3A 4D4MA 4OL0A 3ETLA 5FTJA 3GLIB 4OK6A 4TQ9A 1VTKA 1E2NA 1Y63A 4B48A 1ZUIA 2ORIA 2WOOA 4A2PA 4BFXA 2O8CA 4MDEA 1MV5A 2ANCA 1DAIA 4DDTA 1D5CA 2FZLA 3LFUA 3OE7A 4P32A 4L16A 4IVQA 2P6UA 2WKPA 1KAGA 4IHQA 1W7AA 2QPTA 5SZIA 5AUNB 1KI2A 5KNCA 4O25A 4QG7A 1YR6A 5C4MA 3QUSA 3X1DA 1M7BA 1ZUHA 2YOGA 2ZVPX 1N6NA 1P4SA 1QG2A 1LF0A 4Q18A 4KBGA 3TNFA 1QHGA 1RZ3A 4HZIA 2IK8A 1Z6AA 2P5SA 2ZANA 3I72A 1EFRA 1TU4A 3N70A 4V0OA 5F2EA 3ZVRA 2ZR9A 3JZMA 2FSFA 2QTFA 4ZPXA 1D2MA 5GVRA 3SDZA 4Z8XA 2DBYA 1GOTA 3NG1A 1KZ7B 4LV8B 1U2RA 3LLUA 4X8OA 5H68A 2QBYA 3X1XA 3GCGA 3FPAA 5DGXA 4D0LB 3FYHA 1R7RA 3K53A 1ZNWA 4QGAA 3F0TA 2N42A 2EFDB 1TUEA 3R9WA 1UM8A 3C16C 4KI0A 4WA7A 2WAXA 4XTCS 4CEJB 4CEIB 4I1VA 5EUQB 2BV3A 4DB4A 3PVSA 3HR8A 4PXAA 2OSBA 2GZDA 3WNDA 4DIDA 4IXMA 4EJSA 2VSXA 3DZDA 2VEDA 1LY1A 3SFVA 2ZRGA 2YWGA 3P26A 1Q0UA 1V5WA 1VIYA 2ZI7A 3EWSA 4RKFA 1LS6A 1AZTA 3W8RA 3AGQA 4JLBA 3K8YA 1RE0A 3QE0A 4DBLC 4XWOA 2FNAA 4HAWA 1IOZA 4ASUA 2OCPA 1XDBA 3PEUA 1KI3A 3R7WB 2OM2A 4Q01A 5G3ZA 4TYNA 3G5UA 3QG5A 2ZS9A 2QAGB 4D26A 1ZM9A 3L8YA 2Q0HA 4PC2A 3U2QA 4C7OB 3ZYCA 1S0UA 3HPQA 5CJ2A 2YZ2A 4Q4JA 2QZ4A 2QG6A 2W00A 4DSTA 2F1RA 1P7CA 2OAQ1 1XNJA 4MUBA 2E87A 3GLFB 2BBWA 2WMOB 1NN0A 2QA5A 2ZPTX 4WW0A 2RHMA 4MRSA 4A15A 1E1RD 1JI0A 2WMNB 3CRRA 5EE3A 4N0DA 1UAAA 3KUCA 1OFHA 5DSZA 1NVXQ 2ZJOA 5EXTA 4HUQB 4D4JA 4BASA 1ZYUA 1I2MA 1NMXA 1VPLA 3CX8A 3TAUA 2WWWA 2XNDA 3U7EB 3CF6R 1OKKA 3RVBA 5LD2C 1S1CA 5KOYA 2KSQA 3OEHD 2GXAA 1QRAA 1SHKA 4II7A 4I99A 3IDQA 3M6AA 1K6MA 4WZBE 3BB4A 3UANA 4XSGA 1CRQA 3VR4A 5DI3A 3KQNA 4C7OA 3K0SA 3RNLA 3K70D 3IHWA 3HU2A 3QENA 3SZRA 3CLVA 2O8FA 2AKAB 3LBNA 5FL3A 1VCNA 4QNMA 1MKYA 2H92A 4A0RA 4HEJA 4DEXA 4CDGA 4OI4A 3SR0A 1WP9A 3I1FA 3EWAA 3PITA 2ZRIA 3W6NA 2J0UB 5JHGB 2XNDD 4MKGA 4M2LA 2N46A 1CR4A 4KBFA 4CGZA 2ZUDA 2GAAA 5JI2E 5JWRA 2QENA 5BXQC 1JJ7A 2QTHA 1G3QA 2V8OA 1TF7A 1GKUB 2WAYA 2ZRDA 3PUWA 1X8KA 1P9WA 1G4UR 1XXHA 3SU8A 4DLRA 2WM9B 3WHLA 4JLMA 2R6FA 4PANA 4LJ6A 3VR1A 4CRWB 4JVSB 2DYKA 4XSHA 1XXHE 4BFWA 4IVPA 1E0JA 1K5GA 3U6BA 1KDOA 1Q1EA 4Z1MD 2IA5A 1XPUA 1VYTA 1NLFA 5CITA 3GEHA 4KLNA 5FPKA 4HLCA 3C14C 4URVR 3NBFA 2ZU6A 3VU9B 2YWHA 2HXYA 3X1ZA 4URUR 3T1TA 1RRGA 2A3RA 4GL2A 4YC7A 4QBFA 2GETA 5JS8A 1OH5A 2BKEA 3IIJA 4AG6A 3VR5A 1EESA 4LGMA 4P33A 5BYJA 3O8DA 5FBRB 3T15A 3UK6A 2JLWA 1PVOA 4HUTA 3OE7D 5FUWA 3TR5A 1GL7A 1NSFA 3U4QA 4JBWA 4CYMA 3CR7A 5CYPA 3AVPA 2OCYC 3PUZA 4Q7KA 2ZXUA 2XJ9A 3TK1A 1M7HA 1XEWY 1Z06A 1KOFA 2EW1A 1LTQA 5FOWA 2ZRJA 421PA 3KDSE 3KXKA 3DKPA 1M8PA 1W47A 3VFDA 1NKSA 2DWPA 2XITA 4EPTA 2YKGA 3IQWA 1GUAA 4DRZA 3DO6A 4QM6A 4TSFD 1E69A 4A8JA 3LW7A 4A2QA 5B58C 1OKKD 3PJRA 5FOVA 4NCJA 3KZ1E 1JEEA 4TMXA 2VA8A 2ZEJA 2A5DA 4PZZA 3RLFA 1BYUA 4KVAA 4PPNA 4KFUA 3I92A 1XCMA 4PPGA 4R7ZA 4RZ3A 1DADA 3W6OA 1M34E 2OUKA 3NEYA 2WJJA 4LYAA 3T61A 5J47A 2ZRHA 2WWGA 2QGZA 4E07A 3ZIAD 1DAMA 2PEYA 2PL3A 2RKOA 2ZRAA 4LX0A 1AKEA 2ZRCA 4RKEA 3SNHA 3E70C 4QGHA 1RJ9B 5F9FA 1YR8A 1VG9B 5FOXA 2IEYA 1HTWA 4TYYA 4Q4HA 2IYQA 2O8BA 2VP9A 2WJVA 4TT3A 5EZ5A 4A0FA 4PR0A 2F3RA 3CPHA 2G9NA 2QE7D 4OQNA 1RRCA 2FFHA 2ZI3A 1G8FA 4L5BA 1YHNA 3EPLA 1NLYA 3TJZA 2XSZD 2CNWD 4B33A 3W3ZB 1U81A 1H8HD 4M0LA 5ANRB 2D7DA 4BE7B 4BZPA 3GFTA 2GVDC 4AKEA 1E32A 3PCRB 4DLSA 3B1ZA 4TLDA 2CHVA 2F1IA 2QUZA 2AWOA 4QBIA 2JLQA 1CTQA 5C18A 2B6HA 4DT1A 2HUPA 4HI0E 2DFLA 1ZNXA 2OO7A 4NDZA 4DLZA 1YE8A 3QQ5A 4IDOA 4GMXA 1XCGB 1VYUA 2LKDA 2Q6TA 4B2PA 4YMTA 2IYZA 3FHCB 1CR1A 1KKLA 1FZQA 1MO5A 1OFUX 2CBZA 1GRRA 3B1XA 3T12A 3VX4A 4D81A 1G5RA 2A78A 2XAUA 3FMOB 3LRPA 3TLXA 1DE0A 2VHJA 4C0AC 4OYHA 3WBJA 4DB2A 4Q4LA 2RGXA 1XMJA 4NPHA 4Y0AA 5HCIA 4A6PA 1W2HA 5IK2D 1KJZA 1IN5A 2Z43A 3UMRA 4TZ6A 3QSYA 2WV9A 2ZRBA 1KI4A 1T5LA 5DHFA 2Z0MA 4Q5IA 2OT3B 3NHAA 4RD0A 4S2EA 3K0CC 4F4CA 3H0KA 1KZGB 3HYTA 4FCTA 5JFGA 5KTYA 4A8JC 2FPMA 4TMVA 2D2FA 1WQ1R 4TYQA 4FMCB 4OQMA 2HCBA 2Q9CA 4AYWA 4RZUA 5FOSA 1U90A 3I8XA 1R5BA 1E2MA 1N6IA 3KTAA 5EXPA 3AVVA 2VIIA 4FMBB 4B2IA 2ZS8A 3WY9A 1DO2A 2QPOA 5FI1B 1XPOA 3R9XA 1E0AA 3I73A 5AR1A 2R6AA 3BORA 3U61B 1EK0A 1LV7A 4HAZA 2YNMA 2ZVQX 3TMKA 2GBLC 4PPFA 2RB4A 1CP2A 1OHHA 1E2KA 1OXVA 2AK3A 2OBLA 2YOHA 3T35A 3ZVNA 5CLQA 2D4HA 5KYKA 2GTPA 3W5JA 2BKUA 3QKSB 2E1RA 5AWFC 2ZSEA 4E09A 5D3MB 5LD2B 2XGJA 1CIPA 3Q72A 2VP2A 1AQYA 4US1R 4B44A 1Z0AA 4AC9A 3U7FB 2HF9A 2ZI6A 3BERA 3R8CA 4Q4JB 2BHRA 2W83A 2RGAA 1HH4A 5JCZA 2O8EA 1E9SA 2CEAA 2YINC 2BBOA 4F4IA 2CK3A 3VR6A 2WICA 2JA1A 2IWHA 2J45A 1W4CA 4A6XA 4F4JA 4LPKA 1FP6A 4QXAA 4YMUA 1II8A 5F9HA 1WF3A 2JLXA 3WYGA 4B47A 5DNYB 3KL4A 3HWSA 3K0FA 3N2EA 4CF7A 1IY2A 4Q1EA 3U3MA 3ZGXA 5DHAA 2VHQA 3LQQA 1E99A 1EWQA 2GA8A 2JLRA 4HAYA 1A5TA 5CLLA 1U99A 2ZE7A 3ZD6A 4TWZA 1E79D 1XP8A 2J0SA 4KCGA 4TTRA 3THXB 4BLRA 3GLHE 3KQUA 4Q47A 3V4FA 1Z28A 1UBEA 3RSLA 1N0VC 1WXQA 3K9GA 4NH0A 1QDEA 3LDAA 2GEDA 5JBQA 2C9OA 2CLSA 3ZZ0A 1G7TA 1JNYA 2VF7A 1AGPA 4XVQA 1DBSA 1JPNA 1PJRA 1M6NA 4Q9IA 5JMTA 3EIHA 2EWWA 3LWNA 2ZI5A 4IDQA 2FJUA 4TQAA 4ARZA 4RCYA 2VHUA 2PMDA 2J41A 1A82A 3D7MA 4LHXA 1GRNA 2IYRA 3VKWA 4D0NA 3KFXA 1ZC4A 1VCOA 2ZUBA 3CF0A 2XXAB 4IFBA 4PTLA 1E2FA 4OK5A 4JLJA 2FGJA 4KLZA 4NCNA 1WB9A 3W8NA 4MYUA 4PQFA 1KHTA 3CM0A 4MRNA 4LJYA 1S3GA 4LV6A 3UATA 4BEBA 3WYFA 2WKRA 1GILA 4BFZA 1AM4D 1UKEA 4JLNA 2O0KA 5EE0A 1SXJE 1PUJA 4BGDA 2J46A 3PXGA 3AM1A 1L8QA 4EKDA 1F2TB 4LHZA 1XTIA 2CE2X 3KUDA 1H8HA 2RGBA 2WWXA 4QHTA 4Q21A 3PV0A 1GZSA 3GJ8A 1W2GA 4CEJA 3A1SA 2ONKA 3BIFA 3OZXA 3CKLA 4HB2A 3RSOA 2ANBA 4HAXA 1DARA 2V1XA 4TL9A 3N5CA 3MG9A 3BB1A 4TLCA 3SS8A 5FPYA 1ZIPA 3C8UA 2QNRA 1T8TA 2F43A 2ZRFA 5L8VA 4X8MA 1DAEA 5EQTA 5JEDA 4QBGB 5J4LA 3UPUA 1NMZA 4LJ7A 5G53C 4WIAA 3RRNA 2Q9BA 2R44A 2ZRLA 4TL7A 1IJEA 2F3TA 2V6JA 2REXB 4RY2A 3U3RA 3K9HA 4M1YA 1GRQA 1P72A 2WJIA 4PHHA 2FEMA 1TADA 4KODA 5FUYA 1XTSA 4JKYA 3TQFA 4BLTA 1X1RA 4F38A 1ZM3A 4MUAA 2ODBA 3CRW1 3UWOA 5ELXA 4CEHB 4EIWA 2I1QA 4M4SA 4OQLA 5FTNA 1IY1A 1NL3A 2KJQA 3EXAA 3HR7A 1ANKA 3HYRA 3UKDA 1Z6TA 5GADl 4BRUA 1G17A 4ON9A 5FFMA 4U5XA 4BLQA 2IS6A 1WA5A 1DAFA 4UJ3A 1SULA 5FUVA 3CPEA 1QVRA 1JB1A 1BH2A 1CULC 1DS6A 1G16A 4OJKA 3QY0A 4DC9A 1G18A 4DSUA 2QMOA 2WZQA 1ZU5A 2FMXA 1XEWX 2FPLA 1N6OA 1P5ZB 4QOSA 1COWD 2IXGA 2DHRA 4IDNA 5J5CA 1G20E 2ZETA 4ACAA 1KK1A 4PHFA 1SVIA 2W2XA 1Q22A 1Z29A 4PC3A 1TU3A 1YU9A 3A4LA 2HJGA 2HDNB 3FWYA 1RJ9A 2GJAA 2Z4RA 4QNRA 3LQRA 5GJCA 1IXZA 1XWIA 3AP2A 4GMDA 1ODFA 4A92A 1YKSA 1KO8A 1R5NA 1BKDR 4M1KA 4TL8A 5DE3A 121PA 1I2DA 1FX0A 1P62B 2DFKB 1X8LA 2V6IA 4B43A 4M1SA 1SQ5A 3KKMA 1DG1G 1FTSA 4OBEA 4NMMA 1U94A 1E2LA 1FUKA 1LS1A 2A5GA 2H16A 3NEJA 2OCBA 5AJVB 4NONA 4Z54A 3L0SA 1II0A 4M22A 3KFVA 1E9RA 1NF3A 1TL7C 2AFIE 2PCLA 1U8YA 1J8MF 1AS0A 1A2KC 1OLOA 4QL3A 2BEKA 1JALA 1OJLA 4I81A 4DLWA 5GVSA 1U9IC 3TRFA 5L3SB 3SQWA 4D0GA 5KDDA 3CW2A 1SVLA 3W9YA 4LJAA 2OHFA 2O5VA 3PENA 4QM7A 1ZM7A 2FH5B 3GQBA 2OEPA 3CNNA 4HDQB 1KI6A 1CRPA 4JLAA 3R9IA 3IO3A 2IYYA 3O8BA 2NZ8A 4KFTA 3LV8A 1K8RA 1R0YA 3D3QA 4FW9A 4XH9B 2NGRA 2IEZA 1HUQA 2UVQA 3VR3A 5TV2A 2DPXA 2XSZA 1TX4B 2B8TA 2HLDA 2JDID 3AVOA 3MJHA 2AWNA 3ECCA 1MRSA 4EUNA 2OBNA 2OG2A 3TR0A 3M0EA 3O8CA 2YJTD 3LO5A 1F5NA 1ZW6A 2WPDD 1AKYA 1RKBA 3EZ9A 2OFXA 4V03A 5EZ6B 4EFMA 4ZDJA 5BWMA 4MGKR 2FX3A 4JLPA 3T5GA 2CDNA 3ADDA 3CRQA 1IN6A 3ICQB 4DZZA 2VYFA 5FH9A 3GJ7A 4NKRA 1KK0A 1G5TA 2ZR0A 1T4GA 2J87A 1VG0B 4NYIQ 3A1UA 3T34A 4B74A 1BMFD 1XD2B 2QI9C 4G5SA 1UADA 4HZUB 5EXSA 1Q44A 1G41A 4R98A 2B7CA 1IXRC 2GF9A 4XVRA 4NYMR 1XEFA 4WXRA 4DDWA 1RW4A 4NBSA 4NYJQ 1ZBDA 3SBDA 1RRFA 1QHHB 1P2TA 1CJTC 3KJGA 4DUGD 4KXFB 1H8ED 3GLIA 3OEEA 1JR6A 2QM8A 3SBEA 1F2UB 4CIDA 1KDRA 2JLZA 3SJZA 1QHXA 2GXQA 3AVYA 4TSFA 2IF0A 4OHVA 3X1YA 3EX7C 1Z6XA 1HV8A 5LBIA 3A37A 2GKSA 2XOKA 5C2JB 5L3QB 5GJBA 4TTQA 2KBEA 3GJ0A 4Q03A 2IXFA 1Z07A 1G7RA 1Z6YA 3MWLA 4POAA 4EPXA 1XMIA 2JLSA 1NSTA 3CRVA 3LW8A 5J4KA 4LDJA 1TTTA 1ZNZA 2IYSA 2GRJA 1NJGA 3I3SR 3KXLA 2FF7A 4DJTA 2HT6A 2VH5R 2HV8A 2B92A 4FWIB 1NVVQ 1UDWA 4Q7JB 4B32A 1G3RA 2XTMA 4B6EA 2FPKA 5J4HA 3GLGB 2A30A 1EFCA 2ZJ2A 2Y8EA 3UWKA 4NTZA 2IYWA 4TL6A 1GNRA 2EU8A 4ZDIA 5A5GA 4AKIA 4ZDKA 1NVWQ 2CLCX 2QEQA 2F9LA 1EFUA 5FL7D 4EDHA 1OYWA 1LF5A 3IBGA 3I62A 1YVDA 3OFNA 2IL1A 5JWHA 2V7QA 1N5LA 1ESMA 4OQFA 1OIXA 1KI8A 1TUIA 1V43A 1KI7A 1YZUA 2Q9AA 4YXWD 1BYIA 4B75A 2XZLA 1RPZA 1U9IA 3K0EA 4F93B 2O52A 2WPDA 3AVXA 4JLOA 1W0JA 4PSKA 4OJQA 4RZ2A 4EPVA 1CJMA 4LBZA 5L3VA 2QAGA 3U44B 3Q7PA 4LOAA 5JECA 4BECA 4C0HA 3RC3A 2D62A 3G82C 4ZI3A 2AKYA 1Z83A 3RS2A 3QPUA 3GP8A 3GLGA 1NN5A 1HY3A 3U6KA 5LB2A 3VHLB 2OE2A 2JJ1D 3FHTA 2H18A 2KE5A 3O47A 2ATVA 1GKYA 1QHHA 3PEVA 2F55A 2GCOB 1P3JA 2WWFA 4NHOA 4XWKA 1LB1B 1L7VC 3AV0B 3WMFA 4YXWA 3THOA 2CL0X 2JAQA 3BFVA 4A1FA 2CCJA 2Q21A 3K9NA 1N25A 2JIZA 2PMKA 3IO5A 3WNCA 5CJPA 3V9PA 3DM5A 4E22A 4MKIA 1W0KD 4B73A 2OXCA 2CHGA 2W0MA 3CRMA 4UNSA 3DKVA 2PLRA 2MSEB 4X8HA 1S2MA 2QORA 4G1UC 1Q57A 1S3SA 4BFVA 3CONA 3KB2A 4LPSA 3KKQA 3AP1A 4M9ZA 4S35A 2WSSA 1XEXB 3ZS8A 3ZQJA 2OZEA 2QQ0A 5JI3E 5E7MA 4BLPA 4RD4A 1F3OA 2P6NA 3P32A 3U5ZB 4DLTA 5EE1A 2GESA 2KI5A 1AN0A 3MWJA 4R2HA 2CXXA 5KDLA 4W5JA 2NIPA 3RS4A 1E98A 2G77B 2ZYTX 4IOJA 4BZXA 1ONBA 2CVHA 4C30A 5F3WB 5JJLA 3NC1C 3AF0A 5JZVA 2CL6X 4P4TA 3ADKA 3IPXA 2I3BA 5E7JA 2VP4A 1UBGA 3H2YA 2YWEA 1E6CA 4ZKDA 1PUIA 3CH4B 5JCPA 2NG1A 3ZS9A 1Q1QA 5CIQA 2IXEA 2QAJA 4BWYA 5HTKA 2GCNA 3GD7A 4L8GA 1OFIA 4BPBA 5AUOB 1W49A 3MSXA 4KVGA 4ESVA 3GPLA 2NPIA 1J70A 4BRWA 1JXOA 2VL7A 4C0SA 2O8DB 1XEXA 4TT3D 1WE2A 5D3QA 3PEWA 3MFYA 4G5RA 3FDIA 1ZD9A 1RRPA 3DM9B 4EFNA 3IEUA 4QBHA 1KI6B 5JRZA 1Q12A 4HUQA 2V54A 2JJ8A 1G3UA 4HLUC 4RFSB 1N5IA 4W9MC 1UBCA 4CZ2A 4ZKEA 4O0MA 5M04A 4IW3B 5GJVC 4DCVA 5HPYB 2WIBA 1IN8A 1R0XA 1TAGA 1JQJC 2JATA 3L0IB 2I1VB 3K0FB 3CBQA 1SXJD 3VAAA 1W36B 4C2UA 1GDDA 1UEJA 4M1MA 3J81k 4AI6A 3AF2A 2O8BB 2W6JD 5DYIA 3SJCA 1KY2A 1W46A 2C99A 3E5HA 3BXZA 2VLIA 3Q7QA 2PZGA 3EA0A 4MA4A 3TUJC 4M9QA 1MABA 4FWTA 2F1HA 2FE4A 1XB2A 5JS7A 4NZYA 3T1OA 3AVUA 3ASZA 1RYHA 4UNNA 3UG6A 4B2LA 1PLJA 5JRJA 2FV8A 2VP6A 4R2IA 2V4ZA 2G6BA 3MRSA 3SQXA 1DAHA 3QF4B 3GEEA 4DCSA 2LCFA 3R20A 4F91B 1EFHA 4ZCMA 4DKXA 1Z5ZA 3OAAD 2A5JA 4A0HA 4BEJA 4MITA 4MGZR 2OILA 3QPWA 4PHGA 2ZRKA 5G40A 5JSZA 1G3MA 3B82A 4U00A 2R6DA 2J9RA 1W4AA 4IDHA 4LYJA 5B57C 1IJFA 2WSSD 5EXXA 1HEIA 2NMVA 1E9AA 2FG5A 2ZI4A 4AIIA 4HZUA 2R62A 2IYUA 1IQPA 3ASYA 3LXRA 3EC2A 1N3BA 1JAHA 1Y3AA 1DTSA 4L9SA 4HLUA 1MH1A 2IUUA 3LD9A 2ZS7A 4FMCF 1XRJA 2SHKA 2G3YA 1LNZA 1EFTA 2PT7A 4OI1A 4B3DA 1NJFA 4FINA 1G8HA 3WHKA 5EP4A 4TTPA 3IEVA 2GJ8A 3B13B 3AUXA 4XD7D 2HJVA 2OFOA 3QKRA 1J99A 1KI1A 2ZRPA 3TUZC 3ZDQA 2YYZA 2C98A 4JIMA 4ZDWA 4UNRA 1BS1A 4C0BA 1P73A 5FOTA 2H5EA 2X19A 4JT4A 1G8GA 1YZTA 1W0JD 3P27A 4FXPA 3CZQA 1XTRA 3PQCA 4JL6A 3VNUA 4NE2A 3KKNA 4G5QA 2GEVA 4PHTA 1EG7A 1X86B 4AYTA 4C9BA 4Y0VA 2NTYC 4YMVA 3HPRA 2ZUCA 2VHCA 1E2JA 3LXXA 3CUEF 3TBKA 2P6RA 3HU1A 4D25A 3K09C 1L4YA 4Z51A 1MO4A 4Q48A 3QXSA 1OPXA 3GJ4A 2ZI9A 3EG5A 3SFZA 4QJ3A 2YOFA 2IWRA 5HR5A 4C2TA 5UKDA 4XJXA 5TY0A 1EWRA 1HT1E 1PV4A 2C9YA 2AX4A 4GBMA 1GSIA 4DIEA 1W48A 1GITA 5J4YA 4M1OA 3ZVLA 2J0UA 1HT2E 2MMCA 2QL6A 721PA 1WCV1 2UKDA 221PA 2FSIA 2J3EA 3CWZA 3V4RA 4PC6A 3Q9LA 5AUPB 4TMZA 4CW7A 1KAOA 1ZIOA 1QHSA 2WWHA 2WWIA 1FX0B 3CX6A 4BFYA 1E1QD 3FKSA 3EPHA 4MKHA 4OHZA 3BB3A 3RS7A 3SYKA 1KSHA 1Z3IX 3W90A 4OKSA 4WOPA 2P2LA 5KSPA 1E9EA 3GJXC 2CLDX 2L0XA 3MJRA 4P3YA 1ZM4A 3EIEA 3A8TA 1ZCBA 1I4DD 2AHOA 2BBSA 3PFIA 1R4AA 4BLOA 2RGNC 2UZ3A 3C4JA 2FN4A 3WP0A 4DLXA 3U44A 1NVVR 2JJ2D 4FCVA 4H9GA 1DG3A 5F98A 2ZIAA 2O0JA 1E9BA 4UKDA 3DOFA 1WDTA 5DIFA 2A2ZA 4V0MA 2PZFA 1GG2A 1KSFX 4FI3C 1CJUC 1GTVA 3LAWA 1WBDA 2IF2A 2CL7X 3WYAA 2GXUA 1AJEA 2PX3A 2VRWA 4MGIR 4A4DA 4NYIR 2ZM5A 4AWXA 2NO0A 4BFUA 1OB5A 1MABB 3ZIAA 3THYA 3JZAA 2R8RA 3NXSA 2REOA 3QKTA 4FMDF 4ILEA 5CK5A 1IN4A 1M7GA 3OHMA 5DN6D 1F48A 4IVRA 3LX5A 2BBTA 2NPFA 4DLVA 3KQKA 2HT1A 2WJYA 3BH0A 5LB4A 3H86A 5B2ZA 3I8SA 2HEIA 2JLUA 2QE7A 4US0R 2ZJYA 1KO7A 2VF8A 2O8EB 3B78A 2C5LA 2QP3A 2N1BA 2GILA 3BS4A 1UKVY 2Q3FA 2BJVA 3S1AB 1W36C 5AJXA 2C8VA 1T8UA 4EQ6A 3U7HB 3IUYA 1DAGA 4OHYA 2FFAA 4AURA 1T6NA 5AUQA 4B35A 5KNDA 4RJLA 4ACBA 3CF2A 5DISB 1KYIA 2VHTA 5TVKA 2ZAOA 2IS1A 3QEOA 1QG4A 4OI2A 2IC5A 4KYUA 4M21A 2G0NA 1YRBA 3EA5A 2AN9A 5DLQC 1P6XA 5DN6A 3UIEA 1AGRA 3AUYA 2R6GA 1AS3A 1NY6A 5SZKB 3Q5DA 2ZJZA 3TH5A 3S1AA 2VTKA 3GEIA 4I4LA 2BM0A 3FGNA 3VMFA 4R71A 1H65A 3O8RA 1XMSA 4IEEA 1O3YA 2QT0A 3CB4A 4JSTA 2EWVA 4LRWA 1XCPA 1DO0A 1B23P 3HP1A 2YC4C 3IBYA 3IHLA 4H1VA 4D4LA 2A5YB 2ZYWX 3LH5A 4GFDA 1G9XA 1KO1A 3REFA 4ASUD 1CR0A 4NCHA 1P2VA 3FKSD 3MLEA 2ZR7A 1E2DA 3BE4A 2BWJA 1YJ5A 3JVVA 2IYVA 1ZCAA 1BOFA 2GNOA 821PA 4RD6A 3EIQA 2B21A 3THYB 1Z0KA 3MGCA 4PSVA 2AFHE 4I1OA 4MYCA 5BYKA 1L4UA 4JBXA 2ODWA 1GIAA 1P61B 3FE2A 2IHBA 3DEFA 1NNEA 2GK6A 3DHWC 2R6CA 2ZTSA 3ICEA 1OXTA 4N3NA 4TLBA 3AP3A 4KSCA 4W7SA 5KNBA 4XD7A 4MRVA 5BN4A 2BCGY 4NL4H 4B71A 4B6FA 1E1RA 521PA 1NI3A 5DH9A 2JLVA 1VHTA 3F3YA 2ZJBA 1XZPA 3B1VA 1XMVA 5L3SA 3QXXA 1ZVQA 1UKZA 2LKCA 1DOAA 2AD5A 3REGA 1NKTA 5A4JA 3UMFA 5FPHA 1KNQA 1Z2AA 3D8BA 1A2BA 1CS4C 2XTNA 5SZHB 1EFRD 1IM2A 4ITRC 5CB6A 1KTVA 2ZE8A 3ADBA 4Q1FA 4YMSA 1XD8A 1JECA 1PLKA 4LK2A 4B3CA 5LPNA 1XJCA 1SVWA 2BMEA 2IW3A 2AXNA 1AQUA 3I5YA 1FTNA 4Q4HB 1BIFA 4UNPA 1Z63A 5FR2A 2J1LA 3C7KA 2W2TA 4O2LA 4PC1A 4QHSA 2J0VA 2GF0A 3I4LA 4DSOA 5CB8A 3F5FA 4B34A 4PZLA 2ZSFA 1X8JA 5KSYA 4WVFA 2ERYA 1J8YF 3PG5A 4V02A 4AD8A 3GLIE 1G7CA 2ORWA 2DY1A 2QSZA 4KU4A 3W34A 1E3MA 1OXXK 2PX0A 1IY0A 1ZU4A 3PUVA 1NG1A 1N0WA 2FWRA 2QP9X 2ZROA 3LVRE 1XU4A 4C0LA 2IUTA 4LUCA 3SN6A 2C95A 1COWA 4JT2A 4F7WA 3ZVMA 2FOLA 5DYGA 2BC9A 1RC8A 3BH6A 2VQSA 1GVNB 3QVVA 4EPYA 4DCUA 2J59A 2DR3A 2BMDA 3QIAA 3W3AA 1OIVA 2OESA 2HYIC 3NBXX 2WIAA 4G3XA 4WZAE 2G1KA 1UKYA 5C46F 4KV9A 1DEKA 3VU9A 5B64A 1E79A 1P2SA 5BN5A 4ZO4A 3T1VA 1QHIA 1K5DA 1S4QA 1AK2A 1EX7A 4JYBA 1SXJC 2QQEA 4PZYA 3ZD7A 3VKGA 3VTKA 3AF1A 1HA3A 1US8A 5EJEA 3TW8B 4WZ6A 1MO3A 3RANA 1LVGA 1UPTA 4KFRA 2A7QA 3SHFA 3WBKA 3MMPA 3BWDD 1WRBA 4M8NE 1VCMA 4C3ZA 2B7BA 2DWOA 1KJYA 2H57A 2RH5A 1TF5A 3QXCA 3LY5A 3NH9A 1P75A 3P4XA 3A4MA 5HE9A 4JLVA 2MMGA 3KX2A 4P4SA 1EGAA 2DFTA 4GRAA 2Q3HA 1Q1BA 3X2SA 1E2EA 4QRHA 2PLFA 4A36A 2RGEA 3A58B 4LHWA 3V00A 2ODEA 4H1UA 5AJZA 5JJIA 2W58A 4L15A 2VO1A 4A82A 4L9WA 1PZNA 2WJHA 3ZLJA 1T3SA 1KSJA 1R8QA 1D2NA 2ORVA 3NHBA 4GZMA 5FTMA 3CH5A 1G8YA 1VCIA 1FNMA 3ONWA 2W2VA 4GOKA 4RCZA 2FFQA 2JLYA 1SXJB 5GJWC 2C78A 4TN1A 5K8UA 5FL7A 1IXSB 2XXAA 1A1VA 1P9NA 3RRYA 3VHXA 1FMJA 1XZQA 3AF4A 4Z1MA 4GDFA 3R8FA 2VSFA 1MT0A 5JHHB 2BIFA 1ZC3A 3M1IA 4QKQA 1Z0JA 4O2RA 4C4PA 5CYOA 3LBIA 1N5KA 1KMHB 3WRYC 4ZCLA 1GL6A 3RWMB 1MOZA 4G5GA 1E2QA 3D31A 1JEDA 1QBKC 2IT1A 4B3FX 3LBHA 3ADCA 1U0HC 2LWIA 3KJIA 1VMAA 4B3BA 3IGFA 1OH6A 1IBRA 1QHYA 4GP6A 5C1BA 2HCJB 3QXJA 1FQKA 4RVCA 1C4OA 2RMKA 3T06B 1KY3A 4JYCA 3HU3A 3RDPA 4A8JB 1NIPA 3Q85A 5E3HA 1II9A 3DZ8A 1E4YA 4LC0A 3IIMA 4Q1DA 1X1SA 4IOKA 1ZAKA 1NBMA 2GEUA 2AXPA 2P0EA 4FCWA 1N6HA 2D06A 3OESA 5FBWB 3SOPA 3AKYA 2OBMA 2WBLC 2P65A 4QJ5A 2IYXA 4KHZA 1U0JA 4AYXA 2C96A 3B8HA 3KXIA 1XJQA 1NLZA 2ZE6A 4PX9A 1TMKA 2XOKD 3QF4A 3U3KA 5K8IA 3TGPA 4M53A 1JR3D 4US2R 3THXA 2G1JA 1W1WA 1Z0FA 4MRPA 3C5CA 1NN3A 1NBME 2HXSA 1FW6A 3QF7A 4TLEA 3SYLA 3AKEA 3ZZUA 1OIWA 3NDBB 5H1YA 1ZP6A 4V0KA 5IT5A 5D3MA 1OV4A 5HKKA 3THWA 4PQRA 3L2OB 2O0HA 3VR2A 2WWYA 1I4TD 4ZIRB
chains in the Genus database with same CATH superfamily
5AK3A 3MS7A 3K0AA 2C2HA 1C1DA 3BZWA 1E2IA 3HMQA 3PNPA 2TECE 5I9SA 5KO2A 3HFJA 2GK4A 3OT5A 4YCCA 3CLTD 2FQWA 4QYSA 3Q6IA 5CD9A 1DMRA 3PC7A 4BTEA 4J0QA 3VC2A 3RS3A 3ZHRA 2A5LA 1EFPB 3BKWA 3GUYA 3OIGA 4GT1A 4JY7A 5J58A 3GRCA 4DEYA 3SJAA 3A1DA 3HJTA 1LI4A 1QHNA 5K2MA 2XBMA 4B4VA 3D81A 5HIMA 1R0WA 1DZIA 1Y8QA 2D2VA 4IDPA 4DR1B 5TMPA 1OOEA 4YAKA 2PMWB 4L07A 4G0XA 4GPAA 4LISA 2EBWA 1YR9A 5L4LA 3OKAA 3PQ8A 2A0KA 4YV7A 3B1YA 4V0ME 4B2YA 1CKEA 1FFDA 3BHIA 3FN4A 3QBVA 4M37A 4Y9RA 1ZUWA 4EJSB 3EMBA 2WVJA 1FNSA 4U7JA 3T3DA 1F2TA 4ZVQA 1UXIA 3I2HA 4A1OA 3DZHA 1WETA 2D2EA 3FSRA 3MM4A 2A5FA 3MSCA 1Q0RA 1U8EA 1ZONA 5EXDA 5CDFA 3A6EA 2XUJA 1MAWA 1YSCA 1IZYA 3FF1A 1DFIA 1NVBA 1TQ6A 2J7KA 2Z6VA 1GN9A 4EF4A 4EYSA 2ZP1A 4Z4HA 5LQAA 2K5UA 3FBWA 1KQPA 2IVZA 1OPRA 4NULA 2G83A 2VF2A 4QWMA 4AY4A 1CQIB 5JAQA 2QRUA 3JQFA 2Q5OA 3FNIA 4AZTA 1I7PA 1Y6QA 1HE8B 5J2UB 1PEDA 2H2AA 1L3CA 4FNAA 5LXTF 4A3SA 1DOZA 2I2FA 2F8MA 1JF8A 3L0PA 4ZOLB 2P67A 1QH1A 1GCAA 3NCTA 2X5OA 3K0CA 3EDRA 3K05A 2AE1A 4G67A 5C53B 4YA6A 3C6QA 5HRCA 2Q6LA 1PAUA 1E3JA 1LVHA 1QLWA 3ZHOA 1A5ZA 4MR8B 2NOAA 4KGDA 2YXBA 5KQMA 4LV5B 3BC1A 4O3MA 1ADFA 4Z8YA 1Z62A 5FA5A 5TC4A 3IEIA 2FP4B 2Z5FA 4UNQA 3TQIA 4V1CB 5JOQA 3S55A 1EXMA 2H0AA 3TZBA 3W2FA 3M89A 2J09A 1VL5A 3QBJA 3H3XA 5FWAA 3OBBA 2G4CA 3RS8A 2C00A 4RVOA 4FE4A 5IU6A 1RQ2A 7MHTA 2FVXA 2R00A 4TZ0A 2D0OB 1VI2A 4OAPA 1Y34E 3I12A 1ATIA 3HUTA 3ITDA 3OC6A 2C4KA 3PC8A 3CW9A 4K9KA 5HJ5A 3C74A 4KAJA 5IUJC 1P44A 3GFPA 2NYAA 1G6OA 1K9SA 1M8JA 3CXUA 2BMJA 3P9KA 2G1AA 4PQYA 3VYSB 2X14A 1G6HA 4G0OA 3BGSA 1KSGA 3VV2A 1QYWA 1FU4A 3L6EA 4M60A 1A77A 1U5AA 3L06A 1FCJA 3EMKA 4UMEA 1A1SA 2C2OA 2HHCA 2WF7A 4UCFA 4XPIA 2C4VA 4BY9E 2W5UA 2BZSA 3HDGA 3IALA 4FDUA 3TDNA 5KINB 1R10A 1SZJG 3U17A 1J2EA 5FTKA 2AL7A 3EH1A 2GVZC 1LRJA 5HKKD 4KDFA 4XOIA 3F97A 5I7HA 1CZUA 2PNJA 3OEHA 6NULA 4FXOA 3THWB 4MGYR 3N6RA 5DVZA 1VL0A 1XMPA 1P9RA 1DRJA 3DMRA 4GI7A 1KYTA 4JVMA 4CU5A 1XLTC 1C1DB 4UBOA 5LDDC 1IPFA 4LJSA 5KYTA 1CFJA 5BVHB 5FWNA 5BSWA 3VOTA 1N2HA 2AFRA 2LZ0A 2W0SA 1Q3KA 5E2BA 3M3PA 4G25A 3AF6A 1EE1A 2EIHA 2QN6A 5JWOA 3NVAA 1M1UA 3RRMA 5BV2P 2Q8NA 4XLTA 3VZBA 1KMQA 3KVRA 2KLHA 3DULA 5DI9A 3V7UA 2XIQA 2QRNA 2WJAA 4X61A 4DE5A 3M4YA 1CNMA 2XA2A 1Q84A 3JQDA 1T2FA 5JG7A 1G5HA 4ZYUA 1QTNA 1G3IA 1MIOB 2GDJA 4UJ5A 4DNPA 4G36A 5IRCD 1U9ZA 4RESA 1PG5A 4JVLA 1PFWA 4LTMA 5H0IA 2D0PB 2O1WA 1MZVA 4LBVA 4NE9A 3I1JA 4IDCA 1QKKA 1KARA 5TGTA 5A2GA 6REQB 3U13A 3DP7A 2NSLA 1V7PC 4YCDA 1TYEB 1XFAA 1E4VA 2F67A 3RAGA 4BOYA 4HSEA 2JHCA 2O2ZA 1V5EA 3EIXA 1CR2A 3HFGA 4YJ2F 5B64A 2NO1A 2XOEA 1Z5WA 1SVMA 2BEJA 1NXQA 3I09A 4JUDX 3LLMA 1VIAA 1FE8A 1N6KA 3IMFA 4IIEA 3VQTA 1TTPB 2YVKA 2ZW9A 3VOBA 1JDTA 3INRA 3D43A 1WR8A 2R8BA 4ER3A 3R6WA 1QGUB 4FUQA 4M55A 1C41A 1AKMA 1ZK1A 1S9DA 5KSZA 4CKWB 4AKGA 4M9XA 1IXYA 2OXFA 5I8PA 3EZFA 3BFXA 1U0RA 3QEMB 2R4TA 3S4YA 3H8VA 4HG2A 1OFTA 3UMBA 4AG5A 2BJWA 4BO0A 4OLAA 2D00A 2ADFA 2V3CC 3I9NA 1BS9A 1QKJA 2X5KO 1ZM2A 3SC3A 3OX3A 4V3BA 1N6RA 4R3UC 5IN5A 3OEED 5BW8A 1SBYA 4RA6B 4JSYA 2JGNA 3OKCA 2WSMA 3BBPA 4Q66C 1H3NA 2RBKA 5JEDA 3K1TA 1L4BA 4LI0A 3ZWDA 4XRRA 4RETA 1UWCA 4ZAXA 1VECA 3PZBA 1V1JA 2NZYA 1ORHA 2DQYA 5AXBA 5H4GA 5LSAA 3RIGA 4FNGA 2UU9B 1Z33A 3KK0A 2PKEA 3ZCTA 4C6RA 1T2UA 4HNHA 3FXAA 4F1WA 3SQNA 1BHSA 4Q02A 3AUAA 3FHOA 3NMUF 3ZE2B 1U8CB 5A0FA 4EI2A 3GVPA 2IS4A 2DWQA 2Q0XA 3S68A 4IV5A 3AFNA 3AW9A 1SVOA 2QLTA 2A9KA 4DXAA 1Q0PA 4BNTA 5IJ0B 2ZBQA 3VSBA 1JLMA 4CL3A 1NZFA 1UPXA 2MHCA 3ITNA 3NTXA 4ZVPA 5A3VA 4E08A 4LY6A 2RHWA 1JYFA 2CJXA 1IHUA 2RHGB 3VR3D 4ASUD 4CV0A 3B6EA 2B4KA 1FNNA 4Z7QB 2AOTA 2GJSA 3WGLA 3L0OA 3DAPA 4BMYA 5C8YB 3D5TA 5HKOA 1YVPA 1OASA 3BSSA 2DB3A 2AC7A 1VB5A 1FP7A 1IHXA 1PK8A 2VRNA 3R5JA 3U4IA 2GEJA 1JJVA 2INGX 1TCUA 3BIXA 4LYFA 4KIFA 2JRCA 3SXJA 4CQMD 4ZT4A 4QPZA 4FOLA 3M3DA 4ZVVA 3QWBA 3T5DA 4EZEA 1JDUA 1OV6A 3E2IA 1RLTA 4BO3A 1SZPA 4PO9A 5DI3B 2BR5A 4CKWA 3ET5A 4UMVA 3GLHB 5AVKA 4KFCA 4GICA 2BOVA 3CNQS 1NN1A 1T43A 1FX1A 2Z8YM 2GZAA 2WIJA 3K09A 1S9HA 1MDBA 3OJXA 3A04A 3V34A 3EK2A 1JU4A 2FPUA 2I5PO 1TU0A 1IBSA 3IVMA 4FYPA 1VXOA 2FPPA 4FMDB 3EY4A 3V8PA 2CWWA 3RVSA 4G5OA 1L5MA 1LI7A 5CG1A 1GZ3A 2C07A 3LWBA 3P2JA 3ZI0A 2J3LA 2OO5A 4R2MA 4U2GA 2O23A 3MUFA 5ERGB 4AMGA 4DCGA 2CJFA 4H3KB 3LZ6A 4NARA 3DOUA 4QECA 3AUKA 3I2IA 3IKLA 2V58A 4QAJA 4BFTA 3OJCA 3I0NA 3R5SA 1OE0A 1U7HA 5A5VA 3SMQA 4BFSA 1G1MA 1HYHA 1QVZA 4ZZ2A 3DOIA 3JD4A 1R5OA 3IULA 3OC0A 4NU0A 3ESRA 3O26A 1F17A 2V9PA 2Z09A 3GARA 3OCYA 5AKZA 3WVNA 4RKQA 4DWJA 3W5IA 4UQLA 1Q7EA 2GCPA 2QL9A 1L7MA 2EARA 2QMEA 3RO7A 1JSZA 2HV9A 3Q2OA 3K71B 1NVGA 3ZEIA 2JI7A 3DPUA 4MDFA 3G2KA 5C1OA 4Q4AB 1KIMA 1N0UA 2X4DA 2YZMA 3CPSA 1CUYA 2C31A 3H42B 3PHBE 2IPNA 4HDRA 1HSZA 2EOAA 2F2TA 4PLVA 2FA9A 1J2UA 2RH4A 4MQEB 1XU7A 4YAOA 1X3SA 5KCZA 1NP6A 3AZPA 3IE2A 1Z0DA 2QY9A 4HQ6A 9ATCA 5MFZA 3QX9A 3DMPA 3ROGA 1OGJA 3IDAA 3QKSA 3E3MA 1VKNA 5ECDA 1JLKA 4YAGA 1GM5A 1OGYA 1ZGGA 3O82A 4B8ZA 4B3GA 4OMDA 1R4NA 1SHZA 2NU7B 2Y1KA 3RV4A 3HJAA 2V0GA 5JFOA 4KYIB 4BQFA 2C03A 3F73A 4K5QA 5E7IA 2JKYA 2CJWB 2DVMA 2RCYA 3TZKA 3U19A 3U1TA 4B4DA 3AI3A 3AJEA 2I2WA 3SBXA 1XJ0A 3UXMA 4EJSC 4ZAYA 4ALMA 4ZICA 3B53X 4JENA 2HA6A 3ISJA 3AKDA 2IYTA 4WACA 4W5WA 5F5NA 4IUDS 5AVOA 3WGVA 3W8EA 4NE7A 1DVRA 1TIKA 2ZG6A 3QVXA 4K81B 5B1IA 5ALDA 4OJYA 4F4UA 5EOVA 4W63A 4FHEA 1FOEB 4D3XA 2ZTVA 4NU6A 5CPFA 2XR1A 1SCBA 5FI3A 3CO5A 4X7MA 1LDEA 4NBUA 2DCMA 3AGPA 2ZPAA 3A4NA 3TXAA 3HJNA 1T6BY 4LSWA 2B1JA 4W1QA 2VP3A 1R1DA 2CSUA 3BICA 4QDXA 1DCTA 2QBYB 1LW7A 1S1MA 1T4BA 2A0WA 1YHYA 4Z2AA 5CXSA 6Q21A 3MGBA 2A0XA 4M36A 4XE5A 3L7KA 4IDDA 4R16A 1ISFA 4YAIA 1JXAA 3QEKA 2JJMA 1C7EA 2GTHA 3UHJA 4EG4A 1SZCA 3ZY3A 4Z49A 1IHPA 3R4VA 4AJOA 4U2FA 4PAQA 1ZG3A 2ZKLA 1FDTA 3PQ4A 3H5NA 3QX7A 4RTPA 4G89A 2NN3C 3L1HA 1UXHA 2IOFA 4RDHA 3V8QA 1U8AA 1FLVA 4FE7A 4ZO7A 1YOVB 4IS3A 4WJLA 2GEBA 1GTMA 1NXVA 1Q20A 2EFGA 3PGKA 1DWUA 2VJPA 5DHSA 2OFFA 4X1OA 5FR1A 1IHDA 5KC8A 4FHDA 1ESZA 5M2QA 3N8IA 1JQ5A 3OZCA 1G19A 3MYYA 4LSGA 3JQCA 1VYVA 2JD1A 2JCBA 3LPCA 3ZE8A 3LKVA 4AJLA 1WBBA 1SGWA 1NSYA 5TQ2A 4OFBA 1J2RA 5FBLB 1DKUA 1PNRA 2NO9A 3BG5A 4B76A 1F7VA 2I6XA 1CFZA 4G8JA 3V8MA 5K8VA 2DLDA 4Q1CA 4ZEMA 1VLMA 3OZFA 2BFCA 3KEQA 2ZJFA 3DTNA 1E2GA 3U4DA 3GMTA 2CVOA 2CJYA 2IIVA 4DYVA 4ALJA 1YNOA 3A7EA 2XW6A 3CVOA 4ZYWA 1E5XA 1M8GA 4OXNA 5BVGB 1T2VA 2D3TA 1KFJB 1GPH1 2ZJ8A 4RM2A 2J3DA 4MI3A 2P90A 4AECA 1E7SA 1T9KA 4K7JA 1L1RA 4RFVA 1X9HA 1QRRA 2JKVA 4KRFA 2YWFA 1BCRB 2I2CA 2J7PD 4G41A 4Q4AA 2FKAA 2NAPA 3EPKA 2PHZA 2P9FA 3NQ41 2L42A 4M1QA 3UW3A 3B1JA 2F3SA 3JQ9A 3ZV5A 2I4IA 1JEAA 2M32A 1U2SA 3WL3A 5CDYA 2VATA 3IPYA 1YO6A 2X8JA 5CCXA 5ALOA 2WRZA 4DHEA 3SKVA 1TT5B 3GLKA 4C0JA 4E1VA 1PFYA 1L5ZA 3LCCA 3I6BA 2YS7A 3I5XA 5BV7A 1OSNA 1K2WA 1N6PA 1E1LA 3H5RA 1OA1A 2PZEA 5E6SB 1DG9A 4XGKA 2RGDA 2BFCB 3EVGA 4DCTA 4YYZA 3Q1KA 3R8XA 4AY5A 2IU3A 4M8IA 1SOVA 1YB1A 1L2TA 4WXHA 5DHTA 3TIFA 4XJVA 3TJRA 2J7PA 3HWX1 4ZI2A 4LNUA 4O59O 1ZUNB 2G88A 3ML1A 4YHBA 4XYGA 2CBGA 1Q7RA 3Q40A 1LTHR 1XD2A 2E7ZA 3MD9A 3IQEA 1KAMA 3ACCA 3K3PA 3PC4A 4I50B 1GAWA 4BLVA 4LJ9A 4NNPA 1IB6A 3GNSA 3VGPA 1KPHA 1LLQA 4OXYA 1FU7A 4FYJA 2D8AA 4MUMA 5ED0A 3L6OO 4WT7A 1PN3A 2JBWA 3BPSA 3OZDA 3B60A 5ALGA 3PHLA 3JPWA 4PYNA 3FZNA 1JKIA 4CEHA 3GC6A 4HQOA 2QAGC 1W5AA 4NABA 2O5EA 4PC1A 1E2HA 4Y7DA 5AW0A 4M9RA 3VNVA 1Y3IA 2PBFA 2VUHB 3FYSA 1YJCA 1YR2A 2GRAA 3G2IA 3Q8XB 4MR9A 4R05A 1H5NA 1SBNE 2WT4A 1XRMA 1T1IA 2HFJA 1YS7A 1KR2A 3BH7A 4LZZA 4RDXA 2Q29A 1JHQA 2P68A 3WGQA 1R0RE 4BNGA 1JFFA 1MX5A 1SG6A 5J1SB 2AB0A 3HO6A 3DEHA 4WNYA 5CTJA 2W6ID 4UHKA 4PLZA 4UVEA 1T3LA 2B34A 2VDOB 3BWYA 2HMTA 4H6VA 2IV7A 4RJTA 1W5FA 4CR6A 5KUTA 5LZ2A 3AUTA 2XCUA 3ND8A 5GV7A 1HNNA 2B78A 4WY8A 1FJGB 3AEZA 1G8PA 3HDHA 2PPVA 5DTEA 2NO6A 2Q6VA 1VG8A 3HMKA 3IX7A 4FEYA 2PQ2A 2I6GA 3F7NA 3MVEA 1ONNA 2ASEA 3DE2X 3DUFB 2V4MA 4BX0A 4P4SB 1P9LA 1YI1A 5K3BA 4ZOEA 5BWNA 1I0IA 4NPCA 1NY5A 4HH4A 4RM3A 4WLEA 4CQLA 2F4NA 5JAMA 4GM4A 1C8VB 1AZWA 3C15C 1MIHA 3GLUA 1D9XA 4I1UA 3ONEA 3MMNA 4JUBA 4OHXA 3GCDA 4YJHB 5EQDA 4R9RA 1IZ0A 3QI2A 1VDZA 2JJ1A 3C4QA 4C22A 3JQ6A 4C4SA 1UP4A 3C6XA 4TYNA 4F92B 1VSQA 1SG0A 3SEAA 3NGXA 1T1SA 2YHSA 1KRXA 2RGRA 2Z98A 2DH5A 3PPYA 4IKEA 2J3JA 4OHMA 3UGKA 2WQ7A 3ZWBA 4BYMA 4PXSA 2R9VA 4HGPA 3QW4B 3SK0A 2AJBA 4ZYLA 4GLFA 3E6AA 2R65A 2XUKA 4WGGA 5CW1A 3A31A 1TZMA 5EUMA 3VH3A 5JROA 1KRWA 2V5AA 4M6WA 3EC1A 2UYCA 1NNLA 1Z6GA 3P45A 4IXNA 4X20A 1QFZA 2RHDA 3I6MA 1Z4LA 2O2HA 5IAEA 5JMPA 4ARZB 3DEAA 3ORYA 1IL0A 1BO6A 4OCZA 4NC9A 4OIMA 5TPWB 2P5TB 2ZDQA 2OBXA 1X80A 2JCGA 1MAUA 2CYAA 5LCXA 4A91A 4F9GA 2ODPA 4XVCA 3CPJB 4YP1A 3R7FA 1S7GA 3DBRA 3HUFA 3LBFA 2NYRA 4JJGA 3W4JA 4BMSA 2PX6A 1U98A 3A6DA 5CDFE 4XLLA 3TE6A 3W5BA 2EXXA 1GEEA 1YQQA 2QTVB 2XNCA 1X0XA 3HKEB 3YASA 4BN4A 5F7OA 1R0ZA 3CKYA 4YRLA 5DOVA 3IBTA 3B38A 2JIRA 2PT5A 1O5TA 2ZTUA 4LVOA 4P3XA 1DQSA 1UZLA 1ZGZA 2KX7A 3I30X 5AH0A 2I7XA 4URFA 2QSYA 5JS2A 4WZBB 1GXSB 1SC9A 2AD1A 5AJWA 1LDYA 3VYUB 8OHMA 3DVLA 4HAOA 1G21A 3A26A 1WPQA 1O94D 2GAOA 3P9XA 3PDWA 4GBJA 1IK4A 5D1HA 3IT1A 2LIPA 1TMGE 3OHPA 2VI5A 2YMPA 1WLSA 3ENKA 5TEVA 1EZZA 1BQ4A 3KWLA 3S6JA 1OT3A 2JJQA 3DP9A 4RTNA 3L8EA 2YWCA 3KQLA 2H07A 1FYDA 2WJGA 4V0RA 1X14A 2JFYA 5IZCC 4N3BA 5DGTA 2RAFA 1M8KA 4EJMA 4IO0A 4C20A 4HSGA 4TQUS 3BRWD 4E30A 2JHPA 3Q9UA 4G4GA 3VU3A 1IWOA 3HBJA 3U3JA 3EZ7A 2P5UA 4M9SA 4O8ZA 5AVRA 2C29D 3GH3A 4XCXA 1OXSC 1UMCB 4KPUB 1L5SA 2NADA 2VTDA 3A6HA 3PQFA 4UDNA 3WMEA 3KTAB 5HS6A 3RODA 4WA8A 3TQCA 1YDEA 4YK7A 3VPCA 1NBMD 3ZZTA 4AN0A 1H2XA 4KQWA 5F5XA 3TNJA 4UDXX 5TDHA 4U3JB 5FPSA 3T3GA 2HR1A 4FDLA 5CM9C 4YUYA 1OREA 2ILVA 4GNKA 4U39A 3FOBA 5IKMA 1ABBA 4GEGA 1ECLA 4HAVA 4QPPA 4AK9A 3NC0C 2CC2A 3EB9A 4CLRB 621PA 2JAUA 5C35A 4L5AA 2BZ1A 3GLIB 4TQ9A 3WLAA 2J3KA 4B48A 4BFXA 4HX5A 1MV5A 4OO3A 1USWA 2WD7A 1T26A 4RBNA 5ITZA 1Z88A 3PTLA 2N9UA 2FZLA 2Z3WA 3LFUA 4IIGA 3ZDCA 4P32A 1VHJA 4L16A 4RA6A 2R1VB 1M2GA 1B43A 2G06A 5ETJA 1GZ6A 1Z73A 8GPBA 2QPTA 5GQSA 1MH9A 1ISSA 3GRFA 2H7CA 2P75A 4UE3S 5KNCA 2YV2A 1D1PA 4YREA 3D6JA 1QIKA 4A27A 2Q6OA 1ZQ1A 3X1DA 1DP4A 2X4LA 3RS9A 1L5GB 3EDOA 4FNMA 4QSMA 1LF0A 4Q18A 4KBGA 2MR6A 1U3DA 3QZUA 2BI8A 1EK6A 3K8OE 4HZIA 3DWGA 1XA4A 1Z6AA 2IK8A 2C7GA 2P5SA 2RGUA 1TU4A 4LMAA 3UAVA 3KPYA 5IJ0A 3BXGA 2XTAA 1U1GA 4HWOA 2ZDHA 2QD4A 1NVMB 1D2MA 2Z2KA 4P8RA 4QDJA 4W9RA 3SDZA 2BN4A 3WSWA 1PL8A 1WCIB 4RPKA 2DEUA 2D4AA 1GOTA 3FR8A 3NG1A 3OURA 4BQNA 3HBFA 3L7MA 3VAZA 4AX8A 3LLUA 1MQ9A 4X8OA 5H68A 4TV8A 2SBTA 3FPAA 4FOSA 3VM6A 3ZV7A 3DBHB 4IH1A 4PG5A 2DOKA 2PA3A 3COVA 3FYHA 4D0LB 1A9XA 2V98A 5EHXA 4QGAA 1T36A 1TUEA 3BZBA 2QZPA 3AI7A 1I4WA 1TZKA 1WTAA 2VHWA 4JCCA 1VLVA 4IUYA 1Z5NA 4UEQA 4WA7A 4JI5B 4J07A 2WAXA 4MDYA 4X3OA 3X0DA 4ZYYA 1DKLA 4XTCS 5LQUA 2Q4EA 2HA7A 3FDFA 4LF5B 2PFKA 5EUQB 3SLGA 1FFEA 2IOYA 3PVSA 4V0SA 3ZH2A 5TSDA 3HR8A 3EEQA 3WNDA 2GZDA 1U7DA 3L8GA 4XX0B 2ISCA 1N7JA 1N9GB 2H63A 5H80A 4DIDA 2QRVB 4IXMA 3SZGA 4QASA 3FFWA 5DX1A 3EAGA 3DE1X 1LY1A 3EWSA 1V5WA 3ABIA 3MS4A 1U2DA 3AGQA 1F0KA 3CB2A 3TYXA 1ENPA 1CT9A 1DXOA 2FNAA 2W98A 4TKVB 7GPBA 4HAWA 3DE6X 1RTKA 2IP4A 1XDBA 3IQZA 4WUVA 4EA9A 4CI0B 3G5UA 4WHMA 2ZS9A 4PYIA 5T4BA 4RGQA 3SZMA 5TT1A 5AIBA 2Q0HA 1X39A 3DWEX 4KE6A 1L8LA 4U6SA 3THSA 1GUFA 5CJ2A 1ATZA 3N2GA 1UXOA 3CGWA 1PSWA 1TRHA 2QZSA 4MQ6A 1CDZA 2W00A 3SIRA 2DSTA 3VKVA 3ZDZB 2CDBA 4BHTA 2F1RA 1GZDA 3ESAA 4IIDA 4A8PA 2I9PA 4DV2B 3M4XA 4EZBA 3AJAA 2VQFB 2B9EA 2BISA 4ZFNA 4DR4B 4M98A 3HKCB 3ROZA 1NN0A 3AG5A 4WW0A 4FOOA 5I9TA 1K98A 1KS2A 1NYQA 3AIKA 2A1TS 3UPTA 4R8RA 1RYMA 4QU9A 1JI0A 1TC1A 4TZKA 5EE3A 3KYBA 2IY7A 2X7XA 1AUQA 1NR7A 2V65A 1NVXQ 2QF7A 4MWZA 3KWMA 5K0ZA 3HJUA 5EXTA 1AY0A 1RNLA 3NP9A 3G5MA 1P5RA 3BXPA 2V0CA 2XBUA 3MILA 1ZYUA 4FLMA 1NMXA 1M66A 1K7FB 4HP8A 5FAKA 3EH2A 2AMVA 4IIXA 1AOXA 2FETA 2AGVA 4MS3B 1QB7A 1EGQA 5LD2C 2Y6UA 1Z82A 3D5EA 3V2HA 2F8SA 4X6YA 1IZZA 4II7A 5AKXA 1ZJWA 3KEOA 3EFOA 3IDQA 1K6MA 3WKBA 4E6PA 3UANA 1F4LA 4H1HA 3VR4A 3MTBA 1YMQA 2TYSB 2LRHA 2EC5A 3PKZA 2FK8A 1QB8A 2X13A 2PBLA 4EJ2A 2FX2A 3A9UA 2NU6A 2Y1CA 1QC5B 1TQHA 2PGIA 1WB5A 1ZGJA 1NBOA 3MWGA 4KV7A 4XXHA 2O8FA 2TS1A 1H1TA 1VGVA 1LPOA 4L4XA 4OI4A 2GUWA 2PMFA 1WP9A 3HB0A 4G9BA 3SR0A 1P18A 4PNZA 4P5EA 2L17A 4JJ7A 4LDNA 4KPGA 1BH6A 4KQ9A 4XIFA 5AKKA 1AGYA 2PGNA 3ANLA 4C7MA 4ESEA 1JA1A 1AV6A 3QWHA 5ITWA 1WVMA 1NJ1A 3MLBA 4CUZA 2Q5FA 5FXMA 5FX2A 1QRTA 3R9XB 5JHGB 1SHTX 3AR8A 2QGFA 5DLPA 1OZHA 3PPVA 4MKGA 3RRFA 1M10A 2EEPA 2GN9A 4J4TA 3UPDA 3L18A 4KBFA 3UT5B 3QMWA 4I19A 1UDCA 3RYHA 2K7ZA 3VYTB 5JWRA 1FA9A 1T6YA 4CM6A 5BXQC 1JJ7A 2YIMA 1G3QA 1ULAA 2GCIA 5CLIA 2QZ9A 4PYQA 1X8KA 1LQ2A 1P9WA 3UC9A 3SU8A 3WJ1A 2QN2A 4NZPA 3SICE 4Y6LA 4PANA 3VTZA 1QTRA 4B6PA 4H7HA 5E3IA 3PFKA 2FN9A 3IUEA 5LQMA 4OMFG 1K5GA 3IC5A 3UUWA 5AK4A 2RHTA 1CIVA 1Q1EA 4BWVA 2CNKA 2ODTX 3PQ2A 2ZIXB 2BFAA 3E23A 4KLNA 5AICA 3C14C 3QVGB 3WMXA 2XCRB 1GTSA 3NBFA 2XQFA 1X15A 1DIGA 3J81A 1RSZA 2C2BA 3WB2A 3HNOA 4JJFA 3SM9A 4UHFA 4IIJB 1VE3A 3FUTA 3HB9A 1WWKA 4YC7A 3TO5A 3JQBA 4AM8A 1IOWA 1SOAA 2BKEA 2PZKA 4QQNA 1FRNA 5LWQA 2J6HA 5LMCA 2H2WA 1OYOA 3UK6A 2NACA 1P0IA 3DE3X 1XI2A 1M1XB 4HUTA 1YRQA 1I7QB 5IG2A 1CB7A 4JBWA 4XDGA 4CYMA 4EARA 3UHAA 3RTBA 2X4GA 1HZJA 3QOWA 7REQA 4MYRA 1CUGA 3JY6A 2GFQA 3R7BA 4DIFA 4I55A 4TKLA 3LRXA 3UJ6A 2NLOA 1KOFA 2PXXA 5FOWA 1LPNA 1TD1A 5KYVA 421PA 3HY3A 3GJTA 3KDSE 2I54A 3KXKA 1W47A 2R7LA 4E2ZA 4G5FA 3VFDA 1NKSA 2ZUEA 3BE5A 4EPTA 1Q91A 1YI0A 3DO6A 1JPVA 5BOSA 1T4DA 2BEVA 2OL4A 5FJJA 4D96A 3Q4GA 4IMJB 3P8ZA 1MJFA 3LT1A 1TAHA 3LW7A 1SUWA 1U04A 3GFBA 4G5YA 2PRZA 3R7AA 3OZ7A 4UHEA 1QH9A 4S1NA 3PJRA 5JJCA 2V3VA 1F0PA 3IOYA 2Y6VA 2C1EA 2NWQA 1JDPA 3L9XA 4L3OA 2HPZA 5JC1A 1QIDA 3OQBA 4PBRA 3NEYA 4JBNA 3K1AB 5ALHA 3WQHA 1OI7A 4LYAA 4UM8B 4BC0A 5IT4A 1F6DA 2WWGA 1MGPA 4E07A 4D9EA 4MXDA 2ZRAA 2RKOA 4BO5A 2DWCA 2XDWA 2ZRCA 3DOJA 4QGHA 1DI0A 1ZJ4A 1YR8A 4OIFA 3I52A 4ND4A 1LBIA 4NLLA 1HTWA 1PJZA 3HG7A 3K94A 4N7BA 3ZWCA 2PUEA 4TYYA 2IYQA 2O8BA 3SHVA 2BGKA 5KBYA 1WEHA 3DCJA 2IELA 2CFSA 1E3EA 2FK7A 3FYTA 3OUUA 5LL6P 2UVPB 2O19A 3RARA 3OQNA 4HWSA 4B0PA 3KSUA 1RD4A 3L7LA 1RABA 4JQSA 4LXXA 2CVQA 3JZDA 1CUDA 1HORA 1NLYA 3WAJA 5EINA 2CNWD 4I9HA 1K8YB 3GWGA 4M38A 5F64A 4M0LA 4ENTA 2P7IA 3E4CA 1P5FA 3RKSA 5BUSA 2GVDC 2C4NA 2WA2A 1JILA 2P9YA 3S8MA 4BV2A 1EFAA 4TLDA 1JHDA 2F1IA 3H75A 3C3KA 2JFGA 1DUIA 3WTBA 5C18A 3U48A 2O9JA 2GS9A 1UPCA 1KH1A 4KO1S 4YEDA 1P74A 1DEHA 4DKJA 1T8WA 2NTVA 3KQOA 3QQ5A 4E3WA 1M6WA 4ZJZA 4OYLA 1U7ZA 3K2IA 3PI6A 4GMXA 2GPYA 1VYUA 1LWOA 3COSA 2Q6TA 1CUBA 3QOYA 4MWTA 4YMTA 1KU6A 3TG2A 3FHCB 2CBZA 4J49A 4HBGA 1ORWA 5EJGA 3TOVA 3FMOB 2VHJA 4ZJYA 4NBKA 5WRFA 4JFAA 2Q2WA 3NHYA 3SS9X 1Q0HA 3A1CA 4WNCA 2GHRA 3LX6A 2WF5A 3G79A 3HBNA 4NPHA 3WGTA 1E63A 3WJ2A 3ZWQA 1XZCA 6GPBA 2O59A 3TEJA 3JD0A 4C4OA 3HGMA 3COPA 4JI7B 5I8ZA 3CNEA 1KI4A 2PO7A 1JHOA 3KB8A 4HDAA 4Q5IA 3MXOA 1J0DA 2PUBA 3CZ9A 3D7NA 3TZCA 3HYTA 2BSXA 5J23A 4O4HA 1TEHA 1USKA 5KTYA 1KHHA 2HO4A 2X6TA 4TMVA 1WQ1R 2WW8A 4K6MA 4CG1A 1EDBA 1CDOA 2Q9CA 3H6HA 1YL6A 3GGDA 4RZUA 3DDNA 2P8JA 2BR4A 4G0YA 3AF5A 4KHPB 5FF9A 1GYPA 1ZD2P 2HMUA 3DD1A 3HJHA 3LI2A 4RSHA 1R4MA 5ECWA 3QU9A 4FX5A 2B94A 1DO2A 3WGIA 3HA5A 5JVDB 1XPOA 4MV6A 5G0TA 2Q1TA 5J1TB 4LX8A 1DT5A 3CH6A 1K66A 3BORA 4PZEA 4HAZA 2AMFA 3OZTA 5LA6B 1SK8A 4PPFA 2RB4A 2J0EA 1Y6JA 1E2KA 2VT6A 1P1BA 4ALLA 5DBOA 4M0FA 3REQA 5IZCA 5DM2A 1CUXA 2GSWA 4LZLA 3L0CA 5BSUA 5ALRA 2G09A 4N76A 2XGJA 2AJTA 4RADA 1H2YA 2FZVA 4WECA 3ZCQA 1KXZA 1Q11A 3OP1A 3CZAA 4RA9A 1WMDA 1Z13A 4RF5A 5DYYA 3T4PA 3N2KB 2EGUA 1E9SA 3ZK7A 1QIIA 3ZD8A 2BBOA 2XDQA 2VC2B 1R3DA 4ZOBA 1I2ZA 1DMSA 3PNMA 3QY9A 5LP6F 5ARCA 2WICA 1THZA 1RJEA 4AN1A 4F4JA 1FTYA 3ILHA 4FCCA 5CFPA 5M7EA 4YMUA 3LBAA 5AHKA 4EGAA 1WF3A 1IZ9A 2NQTA 2PZ8A 2YQ5A 1E5VA 3R77A 4J1SA 4COKA 3OCWA 3WV5A 4OHUA 4Q1EA 4B8YA 3ZGXA 3VAYA 2VHQA 3LA8A 4ID3A 1E99A 4QFCA 2O48X 2I22A 5JR3A 5CRIA 3UW1A 1U99A 2ZE7A 1DQZA 1W5BA 1YBVA 4N5DA 3ZD6A 4J76A 4KCGA 1OZFA 3QYPA 2MTBA 4Q47A 3GDGA 2DFDA 4JELA 1ODSA 1KYVA 4YY3B 4BYGA 3RBZA 2WM8A 2C9OA 2JW5A 3DLCA 3QLJA 2CLSA 3ZZ0A 2FW8A 3AEXA 1TZCA 2Q9UA 1FFCA 2O7RA 2E5WA 5KWEA 3FD8A 4XVQA 5A06A 1OXKB 4J0HA 1NNUA 4NZNA 1HLFA 1I51A 2YIJA 1PJRA 1M6NA 1U5BB 4KVFA 1ESEA 5JMTA 1XNGA 2EWWA 2VUTA 3LWNA 4IDQA 2FJUA 4RKYA 1I7DA 1KQ3A 1EVZA 1THGA 3MJ4A 1E8NA 4HYEA 4OXRA 5EKXA 4BJHB 4EEKA 1NMEA 1SC4A 4KGZA 4RCYA 2PMDA 3Q6NA 4X1IA 4O2BB 3W06A 2OWDA 1L4FA 4LHXA 4JNKA 3KFXA 1Z26A 1ULUA 2ZUBA 3IP5A 4BFLA 3UJNA 1C8BA 1Z0ZA 5A4KA 1A9RA 4PTLA 1Z4QA 1ULBA 3W5VA 4JLJA 1UJMA 3L7IA 3MWFA 4NCNA 4MYUA 4WY5A 4TWAA 5A5EA 3H4TA 4TXJA 3D6MA 2WUDA 3UATA 4II3A 1O97D 4QYIB 1Z2PX 2HQ1A 3USCS 1UKEA 1EUZA 3A1EA 1DSSG 3FMVA 3K30A 4JLNA 2VHXA 5EE0A 2J46A 3K6KA 1OI3A 3G8AA 3KYIB 1F2DA 1L8QA 1WUKS 4LCJA 2J3HA 4LHZA 5F1YA 4ZV7A 4EKDA 3CMMA 1JG6A 2RGBA 2J9XB 4Q21A 2RDMA 1GZSA 2VH1A 2ORED 4JAVC 4NNOA 3IMKA 1NBEA 4ZQEA 4ZT7A 1OCEA 4P3PA 4IHKA 4NZMA 3BIFA 4P92A 4ISBA 3AUJB 3RSOA 3AYZB 3T3MB 5K6AC 3MG9A 3BB1A 1JFFB 1L7OA 2AMJA 4ZAZA 1WNTA 2OFPA 3DQZA 4M86A 3OX4A 4O8CA 1BTOA 1I3NA 1U1FA 4J90A 4W7HA 4YBZA 4FBLA 1NMZA 4JEHA 5J4LA 4AUKA 2REQB 5G53C 5A02A 1OI4A 2VNIA 2JCYA 2ZRLA 5JBNA 5KJFA 2XYGA 2AC2A 2CKDA 2VK1A 3R3XA 1IJEA 1OX4B 4TL7A 2DT5A 5P8WA 3Q8MA 3T52A 1HL7A 4BGIA 2QUKA 3K9HA 3OZSA 1GRQA 1SCDA 2OO5C 3QWAA 3DF9A 4I50A 1B6RA 1A9YA 2WJIA 3PPWA 4AX4A 2HPHA 4QVIA 2H8GA 4KGVA 3H99A 4MVJM 1JDZA 4L76A 5KHAA 2YQZA 5IC5A 3PXXA 1X1RA 2PFSA 3G9TA 1D0SA 4O2BF 1N9KA 1QM5A 4RMIA 5EIWA 5KYWA 4L5IA 4MUAA 1VKHA 3CRW1 1FBNA 3UWOA 1RBMA 2JI4A 4OQLA 1WPGA 3ETGA 1IY1A 2I3GA 1HR0B 3CF4G 5DMXA 1ANKA 1TJPB 4F6RB 4EMUA 2FMTA 3ZGYA 3F7TA 1ADJA 5EPEA 3PJDA 1EIWA 2EKBA 2A9FA 2GM5A 2P2YA 4IG4A 1EB8A 1WA5A 5LU8A 4Z86A 5I7EA 1DAFA 3V1TC 1PFUA 2FQ1A 1B4DA 4RHFA 3CPEA 1QVRA 1YCDA 3I4FA 5DTIA 1CULC 3QY0A 1G18A 4Z9YA 2QMOA 1GPJA 3PZRA 3N05A 1ZU5A 5KVAA 2FPLA 4HFMA 2A84A 2Q7XA 3EA4A 2GZ3A 2BTQA 1Q92A 3V3TA 2DHRA 3IAM1 1G20E 5KYYA 1RM5A 1KK1A 5TT0A