3SBKA

Russell's viper venom serine proteinase, rvv-v (ppack-bound form)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
234
structure length
234
Chain Sequence
b'VVGGDECNINEHPFLVALYTSASSTIHCAGALINREWVLTAAHCDRRNIRIKLGMHSKNIRNEDEQIRVPRGKYFCLNTKFPNGLDKDIMLIRLRRPVTYSTHIAPVSLPSRSRGVGSRCRIMGWGKISTTTYPDVPHCTNIFIVKHKWCEPLYPWVPADSRTLCAGILKGGRDTCHGDSGGPLICNGEMHGIVAGGSEPCGQHLKPAVYTKVFDYNNWIQSIIAGNRTVTCPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vipera russelli proteinase RVV-V gamma
publication title Structural basis of coagulation factor V recognition for cleavage by RVV-V
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 234
sequence length 234
ec nomenclature ec 3.4.21.95: Snake venom factor V activator.
pdb deposition date 2011-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sbkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3sbkA02
1C9PA 5DP6A 3RC6A 1C2FA 4CRBA 2P8OC 3TJVA 1CT4E 2A7CA 1MTWA 1ZJDA 3BEFB 3QDZB 1P3EA 3GOVB 2LPRA 3B8JA 1QB9A 4DURA 2CHAC 3QK1A 2D1JA 1YKTA 2WPMS 1FPHH 3KQBA 1AWHB 1A2CH 3UREA 1F7ZA 2CN0H 4MNXA 1XVOA 3LIWA 1BB0B 4RKOB 1NT1A 3PM3A 2XBYA 4KGAA 3U1JB 1OYTH 1HAVA 4X2YA 1CVWH 4X6MA 2TGPZ 1W12U 4RKJB 2FLBH 1N1LA 2ASUB 1QB1A 2FX6A 1DXPA 1KDQA 1SGRE 3RMMH 2P3UB 1CHGA 1TRNA 3SV6A 3A82A 1W3CA 1TRYA 3QUMP 4HI3A 4ISLA 5AHGH 1J9CH 2OP9A 1PPHE 1OKXA 1YCPK 4VGCC 2XNIA 2ZCHP 2HWLB 1TBRH 3HATH 1YCPM 1QNJA 1X7AC 1SMFE 2GVFA 1SQAA 1QHRB 1FJSA 4CRAA 3BG4C 1ZSJA 4D9RA 3GY4A 3PO1B 4FUGA 1KXEA 4BAQB 1TMBH 4DIHH 5EODA 4XBBA 2R0KA 4Y0YE 1ZHMA 4FU7A 1TABE 1UTQA 1D3TB 2F9UA 5FCKA 1IOEA 1H9HE 5A8ZA 2SGDE 1UTNA 3ZZ9A 3RXMA 1HAIH 3PROA 1C2IA 3SV9A 1GCDA 2XC5A 2GT8A 1C5PA 2AYWA 4ZAEA 2ZU5A 1NRSH 1PPBH 1CBWB 1O5DH 1JBUH 1TNHA 3SNAA 1BHXF 1JRSA 3LGIA 1ESAA 1E36B 3RMNH 1LHCH 1EB2A 3FP8E 4MDSA 1S82A 3RU4T 1SLUB 1RJXB 3UOPA 1S6HA 3TH3H 1C1SA 1SFQB 1D3DB 1KTSB 3PLPA 3A7TA 1QIXB 1CU1A 1TIOA 4CRFA 2CGAA 1XUFA 1ANCA 4ISIH 2FOFA 1GBAA 1TNJA 3Q76A 2EI7A 3RU4D 3BIUH 1O3OA 4CR5A 4X1PU 3SV2H 3P17H 3M3SA 4R8TB 1ID5H 2B5TB 2HGTH 5AFZH 1QL8A 1J15A 1N8OB 1WV7H 2R9PA 2J2UA 1O2OA 4ABEA 3F9EA 2XTTB 3GY2A 5A2MH 1DOJA 1LQEA 2Y81A 2ZU4A 4YO9A 1O2WA 4Y8ZA 2ESTE 3GY6A 3TIUA 3MWIU 1GI2A 3BTKE 3SU4A 5F8XA 1UK4A 2AS9A 1P10A 1BRBE 4HGCA 3SJIA 1H8IH 3D62A 2V3OH 1ZMLA 2LNCA 1HDTH 2F9OA 1ZZZA 2ZKSA 5GIBA 1EZXC 1LVYA 1VITF 2PW8H 3AASA 3PTBA 1RD3B 2QC2A 3ZVDA 4GPGA 4YLQH 3SHAH 3VPKA 2G81E 5K7RA 3OU0A 5SGAE 1THRH 3PYHA 5JBTA 4ZROA 4NIXA 1VCWA 5CE1A 3A8BA 3MO9A 3H5CB 3GYMA 1Z1IA 3TGJE 4CRDA 2NU2E 2UUJB 3EA9A 5J4QA 1XKAC 1GMHF 1GJ4H 1BUIA 2ZFRH 2A4OA 2BY6X 2ZHFH 1T8OA 4IMQA 1ELDE 4DIIH 4UE7H 1VGCC 1VCPA 1H9LB 3MNXA 3ZZ4A 4I32A 4YLUA 4UEHH 1S83A 2FOEA 2F9BH 2R2MB 2TRMA 1YC0A 3A81A 4B71A 3GCTG 1QBVH 2GGVB 2AMDA 2FI5E 1TGCA 3U9AH 1WSSH 2FYRA 4WWYA 4A1TA 1HJ8A 1NROH 1OWKA 2FYQA 1GHVH 2ZFQH 4B2AA 4OGYA 5EPYA 3BTHE 4ZHLU 1CQQA 1S85A 2GD4B 4H6TA 2QA9E 1TNIA 3M61U 4IC5A 5B6OA 1UTJA 2ZHDA 1BBRH 1PQ8A 1ZRKA 3TLOA 4TY7A 2HNTC 2QXGA 4K1TA 2WYJA 4DG4A 5JYIA 4D7FA 1SGEE 1BIOA 5J4SA 3BTFE 1GL1A 1T7CA 2BX3A 3G01A 2AGEX 4Y8XA 3RXJA 4BAKB 1AHTH 1O3FA 2FZZA 2VVCA 1EP5A 1LQDB 3GCOA 2BYAX 3UFAA 3M3TA 1O5FH 1P2NA 4X2XA 2UUKB 3FP6E 3BG4B 2FESH 1T8NA 3RXRA 2BHGA 4E7NA 2ZEBA 1OYQA 3UR9A 1W2KH 2F9NA 2O8TA 1EPTA 2ZTZA 1EB1H 1HJAC 2CXVA 3DUXH 2VINA 1RTFB 4IBLH 1GBBA 1O2YA 2YNBA 1JIRA 1P11E 1UK2A 2BDBA 2PV9B 2P3TB 1LMWB 3GY5A 1BQYA 2H5CA 2I6QA 2BZAA 2SGEE 4JZDH 4ABFA 4ABIA 1AKSB 1NRRH 4CRCA 1TBZH 5C20A 3M7TA 4WVPE 2BDHA 1FY3A 4AYYB 3PMHB 2FI3E 3MMGA 1JWTA 1FPCH 1ELGA 2HPPH 4O03A 1FNIA 3PWBA 2ZC9H 1ZRBA 1G3DA 1NESE 3URCA 5FBEA 1ABIH 2C8WB 6CHAB 4JYTA 1Z8GA 3NZIA 2FIRH 4F4OC 4AGKA 1KXAA 1GBIA 1LVMA 1AY6H 1BA8B 3UNRA 1FDPA 3PV4A 1E0FD 1NU9A 4PROA 4IS5A 2PTCE 1L2EA 2FMJA 2GP9B 1BITA 1VJ9U 1WUNH 3KHVA 1UVPA 2BZ6H 3PMAB 3QTVH 1A46H 5GCHF 4XDEA 5E2OA 4D8NA 4DJZB 1L1JA 1PPCE 5C5NA 2AEIH 3DA9B 3QTOH 1OP2A 3AVZA 1WAYB 4WMEA 1FY4A 2G00A 3SUFA 3TGKE 4R0IA 2F83A 3TITA 5DP9A 1GG6B 2H2ZA 3DHKH 1WQSA 4K8BA 1XUHA 1EPTC 1A5HA 1TONA 3F9FA 3BIVH 3R3GB 1J17T 1UK3A 4NIYA 2Y5FA 3SU3A 1MCVA 1PFXC 5TCAA 5AF9H 2ODQA 5EPNA 1HPGA 2QF0A 3MNCA 4X8TH 1A5GH 4CR9A 1ZGVA 3TNTA 1C4U2 1MZDA 4I33A 3ZVCA 1GI5A 1JOUB 2F9VA 4XBDA 1UHBB 3N7OA 4CH2B 2VIDA 1Y5AT 2B7DH 1KLTA 4K2YA 4NA9H 1O3PB 1OSSA 3ATIA 3RMLH 2ZPQA 3TH4H 1YYY1 2QIQA 1EJAA 1ANDA 4AGJA 2PGBB 1CSOE 1MCTA 1YPKH 3BTGE 4FUCA 3L33A 1WBGB 1J16A 1VGCB 1UVOA 4AORA 3MU8A 1OPHB 4B2BA 1V2MT 3KEEA 5LH8A 1O3DA 3LGUA 1AMHA 4U2WA 5I25A 2CMYA 4XFQA 4FUHA 7GCHF 1PPEE 3PMBB 1FXYA 1O36A 3S69A 1B0EA 4NGAH 2XWBI 1C5TA 1P06A 2FDAA 2AIQA 1K9OE 2ZO3H 3MFJA 2PUXB 1HRTH 3ITIA 3EYDA 1C1OA 1A0HB 3S9BA 1C5OH 4FUDA 1Z6EA 1P2KA 3P92A 2V0BA 1FY1A 5GWZA 4B2CA 2OXSA 1OS8A 5F03A 1G9IE 3P8NA 3TK6A 2J34A 2C3SA 2ZGJA 3GDUA 1TB6H 5EW2H 4OS7A 4B73A 2V6NA 1FQ3A 3QWCH 3OX7U 2ODPA 3SNCA 1MUEB 3SV7A 5EU8A 1KXCA 2Z6BD 2FO9A 2JH0D 3M36A 1NTPA 4NG9H 2UWLA 3O8CA 2A5AA 6GCHF 3S9CA 1CBWC 4A6LA 8KME2 7ESTE 1ZR0A 1MU8B 2VGCB 1SB1H 1GJAB 1FAXA 1HAXB 3DFLA 3QO6A 1CHOG 2O8WA 3MH4A 5AFYH 4A92A 1O2QA 1UCYH 1JRTA 2QYIA 3SO3A 1TFXA 2GTBA 3GY7A 2VVVA 1T8LA 3M7UA 4JZEH 1HAZB 1HJAB 3F9GA 5HMAA 1WTHD 2XWAA 1GBHA 1O2JA 1ZGIA 2QXJA 1P09A 1V2QT 1Y3XA 2ZFTA 3UOUA 5EQSA 1AO5A 1C2HA 1L4DA 1P05A 2AMQA 4AOQA 5CHAB 3GICB 2Z9IA 4K8YA 2GMTC 2Z3EA 3UR6A 1CA8B 2CF8H 3BTTE 2QV1A 1Z8IB 2G5VA 1DPOA 1GBFA 5BPEA 1FUJA 3EE0B 1N8OC 1G3EA 2FI4E 3A8DA 3PLBA 3CS7A 4HZHA 2ZPRA 1BMLA 2Z7FE 1CGHA 1TWXB 4D9QA 2GX4A 1T8MA 1SGYE 3O8RA 4UDWH 4ZXYH 2SGPE 2BD7A 1K1OA 1BTZA 1N6XA 1RGQA 3KNXA 4ZXXH 2UWPA 3FFGA 1F2SE 2BQWB 9LPRA 1UMAH 3RUOA 1OWDA 1HAYB 2A2XH 4CREA 4MPXA 1EAWA 1GJDB 5EXLA 3SU5A 4X6NA 3ZVAA 2PSYA 5DO4H 4K3JA 1DM4B 3TK9A 2WV5A 5FX5A 4Y7AA 1O2VA 3V7TA 2ZF0H 4H4FA 3RXQA 4IGDA 2FOHA 4ABBA 2VIPA 3F9HA 2EEKA 5GCHG 1TE0A 1QTFA 5JBAS 3AW0A 4ESTE 3S7KB 3OYPA 3Q3YA 1P0SH 4NIWA 1EATA 1IQNA 1AUJA 1ELCA 2FS9A 6LPRA 1ESBA 2XCFA 2YOLA 3GCTF 1EUFA 2XBXA 4NA7A 3R0FA 4IC6A 4OS6A 4BOHA 2Q6DA 1C5RA 1C5LH 1XMNB 2YNAA 5DP7A 1ZJKA 1G32B 3SI3H 1W0YH 3LDXH 2P94A 1NFXA 1AKSA 1ZPZA 1SL3A 4I8HA 1SPJA 4I8GA 2JH6D 2C90B 1FY5A 2ZPSA 2A4RA 3SGAE 3TK5A 2VIWA 4FUEA 1IQGA 4OS5A 1BDAA 1BRCE 2H6MA 1BTPA 3SGBE 4A1XA 1O2SA 2RDLA 3EA7A 3V12A 2VIVA 3MU1A 4X6PA 5C2ZA 3OTJE 1O2ZA 3AAUA 2ALVA 1GDNA 2ANMH 4ISOA 3STIA 5EG4A 1NU7B 1O38A 1NRQH 5C1YA 2ZHWH 1XM1A 1WYKA 1MTUA 5LGOA 4Y7BA 1BMMH 1Z71A 2A5IA 3SU1A 1TPOA 2SGAA 4ZHAA 1SGFA 1BCUH 4ZKRU 1ELEE 3RXBA 2IN2A 1C5MD 1V2ST 2V35A 1A0LA 2A4GA 3P70B 2G55A 1S84A 5LPFA 3GCHB 7GCHG 1D6WA 1IQIA 1C2KA 1AIXH 1GBCA 1GMDF 1BBRK 3ATMA 1PQ7A 2B9LA 5A0AE 1GI0A 1TGSZ 3U1IB 3ZZCA 1C1WH 4RN6A 3OY5U 1GPZA 1QL7A 2W26A 2VJ1A 4DY7B 1HXEH 1C1UH 4E7RG 2OQUA 1BOQA 1D4PB 1V6DA 3K2UA 3SUEA 4AFQA 4ABHA 5A8YA 1C2LA 1A1RA 3Q3KA 5E0JA 2GDDA 1GHZA 3A7WA 1MTSA 3UIRA 1W8BH 1TAWA 4MNYA 4F49A 1YLDA 3SQEE 1KY9A 1P03A 1MU6B 1KXBA 1UHBA 1QQUA 1DSTA 5EGMA 2WYGA 2OINA 1MD7A 1DWCH 2UUYA 4X8SH 4Y0ZE 4NIVA 6GCHG 2ZGHA 1FMGA 1LHDH 2JETB 5F8ZA 6CHAC 4DW2U 5EW1H 2G5NA 1SHYA 1P8VC 2PGQB 2VU8E 1ABJH 1F5RA 1SOZA 3RXHA 3NCLA 3QN7A 2FP7B 1O3MA 1MTVA 4LOYH 1A3BH 2CJIA 4X1RU 3RXIA 2GMTB 1WU1A 3BSQA 3HK6B 4AG1A 5GXPA 3S9AA 1W11U 3VXFH 2QGRA 3A85A 1BBRE 1DT2A 1KLJH 3CENA 4MTBA 1YPGH 1WQVH 1GBJA 1Y3VA 2P93A 4YT7H 1D3QB 2I6SA 1NC6A 5A0BA 2STAE 3BEUA 3GYLB 2AH4X 1GL0E 1ZOMA 1GG6C 1DDJA 4A1VA 1VZQH 1C5XB 2C93B 1GJ7B 3C1KA 2VWNA 3RXGA 1GJ5H 2IOTA 1SBWA 2R3YA 4AYVB 1V3XA 3LH1A 1TOMH 3MH6A 2XC4A 3ESTA 1GJ6A 1SOTA 3LC5A 4ZKNU 3MNBA 4BXSA 3M5LA 5E2PA 1Y59T 5FCRA 1O2HA 4GCHG 3ZYDA 4K5ZA 1V2TT 1P01A 1XUKA 1RTLA 2IJOB 1JIMA 3L3TA 7KMEH 1SHHB 2BM2A 2AERH 1SLVB 2J4IA 4KTUA 3ZVFA 4Y79A 1MTNB 1O2PA 3Q3XA 1GHWH 3UY9A 4X8VH 2QY0B 5DKMA 2G4UA 3B23B 4ABDA 3UNQA 2THFB 4LZ4B 1EQ9A 1MKXH 9ESTA 2OC8A 1GGDC 4Y71A 1J14A 2A32A 1TBQH 8ESTE 2FX4A 2WPIS 3LU9B 4ZUHA 1FONA 3A7XA 2D26C 2FXRA 4X2VA 3MH7A 5T6DA 5ABWA 3SQHE 4XOJA 3RMOH 1JMOH 2BVSH 2PFEA 3A84A 2BY9X 1SI5H 1QCPA 3BTEE 1YPHE 2AGGX 4AB9A 3P6ZB 3M35A 1DY9A 1DICA 2OCVB 1O5BB 1GVZA 3AW1A 1NN6A 1HXFH 3LH3A 4Q7XA 3A7ZA 1C2GA 1GJCB 4X1NU 3RXDA 5IDKA 3A7VA 1O3KA 3A83A 1DXWA 3M3VA 1ZSLA 1AQ7A 1OWIA 4OS2A 2BD2A 4CHAC 3E6PH 3SN8A 3K6YA 3KF2A 2ZG0H 3RM2H 1QJ7B 2CF9H 1HCGA 3KN2A 4NSYA 4O97A 4YOGA 2VB0A 2XC0A 1C1VH 2HNTF 5EQRA 1ARCA 4K69A 3SI4H 3SGQE 1W7XH 1TPPA 1W10U 4IN2A 1CHOF 4WJG2 1UVSH 5IYTA 2SNWA 4K60A 1UTMA 4O3UA 3RM0H 2BOKA 5L2ZH 2VIOA 3LOXA 3ZV8A 2F3CE 2VGCC 1W0ZU 2GCTB 2Y7XA 4KTCA 1P04A 5DGJA 1CO7E 1UTLM 1PYTD 1L1NA 1O37A 3RU4E 4A7IB 4KTSA 1K1NA 2P59A 4Q7ZA 3RXAA 2GV7A 2ZNKH 1E35B 2AFQB 5HYOA 2BDIA 6ESTA 1LPGB 1GMDG 2WPLS 2RA3A 4K1SA 1BMNH 3A8CA 2Q6FA 1G37A 5CHAC 5E0HA 1ESTA 1A7SA 1GJ9B 1MQ6A 1SG8B 4YOIA 1TX8A 5T3HA 2BQ6B 3EGKH 1Y5UT 3UUZA 1NFYA 5C67A 1QRXA 4MPVA 5BRRE 2W7SA 1GHAF 2C4FH 1D6RA 1UCYK 1Y3UA 5GJ4B 4NWKA 5FHTA 1BHXB 1PPZA 4DGJA 1CE5A 7LPRA 5DJ7A 5JB9S 1L1GA 1AZ8A 1ETSH 4FXGH 2A2QH 1E34B 1G30B 1ZTLA 2Z9JA 1K28D 2BD5A 2NU1E 5AVDA 1HAOH 1SSXA 2VH6A 1V2WT 3WY8A 3NWUA 1VR1H 1YPLH 1O3IA 1E37B 2BLQA 4INHA 1UTOA 3HKIB 1IQMA 2J9NA 4NZLA 1C2DA 4WMFA 1O33A 1P2JA 1ETRH 1Y3WA 1P9UA 1YPEH 2O8UA 1TX6A 1QBNA 3TJOA 1AZZA 4UFEH 3Q77A 2ZA5A 2FOBA 1L0ZA 2PWXA 1ANBA 4FVBA 3MTYA 2ALPA 1O31A 1LTOA 1QRZA 4O9VA 1RIWB 3CP7A 4I7YH 1KSNA 1O30A 1O2LA 3VFEA 2WPJS 4UFFH 1ZHRA 4K1EA 4KELA 2Y5HA 2Z3CA 1HIAB 1UTPA 3T27A 5DG6A 4DVAU 4GVUA 1PYTC 1UCYE 4JZFH 4RSPA 1EAUA 1HNEE 4YT6H 2FOAA 3SJKA 1Q3XA 1O5EH 4YM9A 4JZIA 1P3CA 3TVJB 1EXFA 4JK5A 4FUFA 1GBDA 3V0XA 1V2UT 3A8AA 2OLGA 1M9UA 1UVUH 2Z9KA 4QT8C 4WH8A 4D7GA 1K1PA 4AX9H 1QRWA 2HLCA 3E90B 3F1SB 1OOKB 1GBMA 1GGDB 2A45B 4NCYA 3RXLA 8LPRA 2NWNA 3QX5H 1FN6A 4LZ1H 2XXLA 4Z0KA 2ZDNA 2QXIA 2WUBA 1N6YA 2BDGA 3T62A 2RA0A 2OTVA 1MKWH 1O5AB 1YPJH 1G2LA 3A89A 4ABGA 1DVAH 4YOJA 2PKSB 1O2UA 2BMGB 3RLYH 2F9PA 1C5ZB 1TMTH 3MNSA 2ANWA 1LPKB 1AUTC 1LO6A 2J94A 3ZVGA 5A0CA 1GI6A 1DUAA 1TNLA 1DWBH 3UWJH 1O3LA 3GCHC 1QB6A 2C8ZB 2HALA 4AN7A 1OX1A 4CHAB 1LVBA 1QJ1B 1B0FA 2BD9A 1TYNA 3UNSA 2AGIX 3UTUH 1LKAA 1C1NA 3RXOA 2NU0E 3ZZ8A 2ZDVH 4INKA 3GDSA 1EAXA 3MI4A 1P57B 3H7OA 1QGFA 2ZWLH 1AI8H 1SGCA 1Y5BT 2GCHG 2BX4A 2Y6TA 1ZPCA 4WXVA 2PLXA 3KQCA 1S5SA 1HUTH 4JK6A 1INCA 1HAGE 1NY22 1K1MA 3E0NB 1A4WH 1C1RA 2BOHB 2FODA 1V2VT 4JMYA 3SBKA 3UQOA 3ZZDA 3GY8A 3SJOA 1IQLA 1MZAA 3LGVA 1IAUA 3GDVA 1GBKA 1BTYA 2J38A 3M5MA 1UTKA 2TGTA 1LHEH 1ELVA 4FU9A 3SNDA 1XXFA 5DP8A 5HXFA 2B8OH 2QF3A 5JB8S 2JETC 2OQ5A 4Q80A 1DANH 1YLCA 1S0RA 3GY3A 5E8EH 1O0DH 2ZZUH 3E3TA 4BNRA 5C5OA 1O2TA 1SLWB 1EASA 2PKAB 5FXLA 1C1TA 4U30A 4MVNA 4ISHH 1ZLRA 3A7YA 1GVKB 4H6SB 2CV3A 1EJNA 3EA8A 1DITH 5LPRA 3QGNB 1RXPA 1ACBE 3SNBA 4TWWA 3VB4A 2GZ9A 4KP0A 4YTAA 1GMCF 2TPIZ 2M5TA 3ZZAA 1HAHH 4TWYA 2BDAA 5TJXA 2DE9A 1SLXB 4TPYA 2Z3DA 2ZQ1A 1RFNA 1GHAG 1EKBB 1OP0A 3PLKA 1S0QA 3KCGH 1GBTA 2A7JA 1O2GH 1DS2E 4ASHA 1GI8B 1E38B 1AE5A 2UUFB 2BB4A 2FTLE 4GLYA 4FUIA 2R2WU 3B9FH 1WOFA 1ZPBA 1HBTH 1FLEE 4GCHF 2ZDAH 5GDSH 2FOCA 3OY6U 2ZP0H 4B74A 3RXTA 3URDA 1XUGA 2P3FH 4Y11E 3ATWA 1OXGA 1P02A 3UWIA 1LHFH 4IMZA 3MO6A 2BD4A 3RC4A 3SORA 1B5GH 4GHTA 1CA0B 2VWLA 1K1IA 5LPEA 1GHYH 1Z1JA 2ZGBH 1P2MA 4ZKOU 3BEIB 2SFAA 1ZMNA 1AD8H 1MTNC 1P2IA 4ZH8A 3T5FH 4XBCA 1SGIB 3BTWE 3MU4A 4A5TS 5TCCA 1BJUA 1ETTH 1V2OT 1BRAA 2A4QA 1SR5C 3ATLA 3I29A 1SFIA 3NUMA 1C5SA 4X1SU 1V2LT 2OC7A 5DP3A 4ISNA 1O3JA 2FOMB 2JH5D 3TH2H 3QGJA 2ZI2H 4AFUA 3W94A 1QA7A 2A0QB 4BANB 2HRVA 1P2OA 4GHQA 1EJMA 3LGWA 4CBOA 2PUQH 4UD9H 1F0TA 3TPIZ 1GI9B 3H7TA 2EI6A 3ODDA 2RCEA 1BZXE 3VB3A 4JZ1A 5EQQA 5ESTE 1TNGA 2Y5GA 4OS4A 4UONA 3T28A 1AVXA 1MKXK 4ZMAH 3D23A 2ZTYA 2ULLA 1WCZA 3HKJB 1AFQB 3U8TH 4X8UH 1TOCB 4Y10E 1Q2WA 4M7GA 1IQJA 2XW9A 1Z7KA 1P2QA 4WF8A 2ANKH 1O2XA 2TGAA 3EQ0H 2ZECA 3P8OA 1CT0E 1HGTH 2BVRH 4Y76A 3V13A 2H5DA 5L6NH 1RS0A 4NSVA 3FP7E 3SU6A 1IQKA 3T2NA 1OWEA 4NWLA 3P8FA 5HM9A 2EC9H 1GHBF 1GJ8B 3E91A 2GCTC 1H8DH 1A61H 1IQFA 1LPZB 3LPRA 2FLRH 4FU8A 2BY8X 2OBQA 1O3EA 1RRKA 1AB9B 4WH6A 1ARBA 2BXUH 1TQ7B 4MG3A 1BMAA 1SC8U 3O8DA 4NA8A 3FZZA 2GZ7A 2G8TA 1MAYA 2O8LA 4JYVH 1O3AA 2Y7ZA 2W3KA 3U98H 2HOBA 3IITA 3HGPA 1K1LA 3U69H 2BQ7B 4Y6DA 2ILNA 1HIAA 5JPMH 1MQ5A 1XUJA 5JBBS 4DCDA 3KIDU 2O9QA 3BV9B 4U32A 4ABAA 3RLWH 4XSKU 1PJPA 2ZFFH 1T32A 4FVDA 1NFUA 2A5KA 2H9TH 1G36A 3L6PA 2ZHEH 2ZFSA 4CH8B 4E05H 4X2WA 3MYWA 1JXPA 3VGCB 1A5IA 3MU0A 1H4WA 4MPUA 1F92A 1TGNA 1F5KU 1O2MA 1Z8RA 1GWAA 1FIWA 3ENSB 1U6QA 1AE8H 1S81A 1WTGH 3STJA 2ZDMA 3EAJA 2AMPA 1KXDA 1SGDE 3SUGA 3GISB 2PTNA 5K0HA 1LHGH 1K1JA 4BAOB 1C5NH 1LDTT 1TLDA 3PMJA 1C5VA 2ZCKP 3PWCA 1A3EH 2ODYB 1K21H 1VCQA 3LGTA 1YGCH 1UJ1A 2FOGA 4SGAE 1AGJA 2GT7A 2GZ8A 1O5GH 1FZZA 2AIPA 1GMCG 1O3NA 1SQTA 3F6UH 1GHXH 2J92A 5HM2A 1DE7H 1RIWC 4GAWA 2BLOA 1ZTJA 1BJVA 2BY7X 1AU8A 2GKVE 2PR3A 2ZDLA 3BTQE 1TPSA 3ZZ6A 1TX7A 1DLKB 3RXCA 1ELBA 1P12E 1NPMA 3RXSA 3VB6A 3RXFA 5HGGA 1GCTB 1QBOA 5JDUB 2BY5X 1C5UA 3RP2A 2R3UA 1F5LA 1SGTA 1QR3E 1K2I1 1H9IE 4ZHMU 3DD2H 3VB7A 2BDYA 2VVUA 2ZDKA 3LC3A 8GCHF 1C1MA 3RC5A 5JBCS 5L2YH 3ZZ5A 2B0FA 2P16A 5PTPA 1YPHC 2Q1JA 3PTNA 5CMXH 5C1UA 1AVGH 1QA0A 4LXBH 4MNWA 5A8XA 1O34A 4DT7B 1THSH 2XYAA 2WV4A 3SW2B 3SV8A 3E8LA 5FBIA 2PKAA 3CS0A 3IG6B 1O2IA 2XBVA 1DUEA 1MBQA 2Z94A 1OWJA 1MD8A 2ZGCA 2VIQA 3E1XB 3D49H 4BAMB 2PKSC 3MH5A 4FUBA 1ZTKA 2FEQH 2BD3A 5C3NA 1IHTH 2F91A 1XX9A 2P8OB 2ZU2A 3U8RH 4IW4E 3HGNA 1BTXA 1O3HA 1OP8A 2QAAA 2QN5T 2GCHF 3LJOA 1BTWA 2VWOA 2CHAB 4UFDH 1PPGE 2BD8A 1SGPE 1XUIA 1YCPH 1TQ0B 3PB1E 3A80A 2OC1A 3T29A 1EZQA 1MKWK 3LJJA 2XRCA 3UQVA 3RXPA 1P9SA 4I8KA 3ZZ3A 3V3MA 2VNTA 2STBE 2W3IA 1IQHA 1B7XB 4THNH 5H4IB 1TGTA 2SGQE 2IPHA 4MQAA 2VH0A 3MHWU 1TA6A 1NM6A 1T4VH 3E0PB 1AN1E 1GHBG 4AFZA 1MH0A 3K65B 5FPTA 1PQ5A 1SGNE 4NFEA 4VGCB 2KAIB 1MAXA 1C1QA 3KQEA 1OWHA 2HNTE 1DSUA 1CT2E 2QCYA 3VB5A 4MNVA 4JYUH 2G4TA 1EZUC 2D2DA 1L4ZA 2QXHA 4U01A 1W14U 3A86A 3JZ2B 1ELAA 3M7QA 1MMJN 4KKDA 1Y8TA 5EOKA 3BTME 3ZV9A 2TBSA 3MOCA 3QZQA 1UO6A 4GSOA 4WXIA 1QJ6B 1FY8E 1DLEA 1T31A 2R0LA 3W95A 4HTCH 2TGDA 2ZTXA 2OUAA 2ZU3A 1FN8A 3FZDA 1XVMA 1O3CA 1EZSC 1TALA 2FTMA 4DOQA 1YPMH 4BXWA 3EDXB 1Q31A 2UWOA 4Y8YA 1EAIA 3DT0H 1GI3A 4B75A 1VITH 2H9EH 1GDUA 1O3BA 2XBWA 3ZVEA 1V2KT 2OBOA 1HYLA 2Y80A 1O2NA 1LCYA 2WUCA 4B1TA 1GI7B 3BF6H 2FPZA 1HAVB 1Z6JH 3FAOA 4TY6A 1O2RA 1QFKH 1W7GH 2H1UA 3HK3B 1YP9A 1T4UH 1ZMJA 2BLVA 1GI1A 4Q7YA 5A09A 2ZGXH 1DX5M 1W13U 3RDZA 1YF4A 1KDQB 1CA0C 5ESBA 2EI8A 2Z9GA 2PHBA 2BDCA 5I46H 5L30H 3S7HB 2VWMA 1SGFG 1THPB 4E06H 3T25A 2Y82A 3BG8A 5T6FA 3RXUA 1S6FA 1NZQH 2NU4E 1FAKH 5DK1A 1FIZA 4INLA 2A7HA 2Q6GA 1C2MA 1V2PT 1IQEA 3Q00A 4SGBE 4WMDA 2BTCE 1H1BA 3QZRA 3NKKA 3TGIE 1AVWA 4D76A 4H42U 5C1XA 1AWFH 1KYNA 1O39A 1GBLA 2Z9LA 1NO9H 1C5WB 1ELFA 2ZCLP 1PPFE 1HFDA 1YBWA 4AB8A 1BRUP 2DE8A 1KTTB 1Y3YA 2FM2A 1NRNH 4TPIZ 3U8OH 1KLIH 1AFEH 3KL6A 3ODFA 1O3GA 2GDEH 2BLWA 4XE4A 3K9XB 5DPAA 4IN1A 1AFQC 3DFJA 3JZ1B 3SU0A 1VITG 4OS1A 8GCHG 3SJ9A 4BTUB 1SQOA 2P95A 1ZHPA 4ABJA 3SU2A 3SUDA 1HLTH 5FPYA 1TRMA 3ZYEA 3A87A 4YZUA 2J95A 1GJBB 3VXEH 3AAVA 2V3HH 3TJUA 3KGPA 1J8AA 3D65E 1ORFA 2SNVA 3S0NA 4B76A 2RG3A 1GMHG 1ANEA 1GBEA 4I8LA 1KIGH 1DWDH 1PQAA 1XXDA 1XKBC 5EXMA 2FS8A 5T6GA 2HVXA 1C2JA 1V2NT 5DP5A 1AB9C 3RXEA 4YESB 2WPKS 1MBMA 3O8BA 2C8YB 2ZQ2A 1TMUH 3SHCH 1CGIE 3FVFB 3M37A 1HB0B 3SNEA 1V2RT 2H9HA 5FX6A 3TJNA 3C27B 2OD3B 2NU3E 1EP6A 1DFPA 5EXNA 2BVXH 3A88A 3PO1C 3LKWA 1LKBA 1F0UA 5ETXA 2XCNA 1KXFA 3K6ZA 5E0GA 4J1YA 4NFFA 3IWMA 1IHSH 1BTUA 1YM0A 3NXPA 4FUJA 1EOLA 4ZKSU 4JCNA 5GPIB 2A31A 3VGCC 1CGJE 1C9TA 1GVLA 1EX3A 4MPWA 4CBNA 1F0RA 1K22H 3LGYA 2D8WA 3ELAH 1GDQA 3OSYA 3M5NA 4BTTB 3ZVBA 3M5OA 4LK4A 3UPEA 3MO3A 2GV6A 3QLPH 5F8TA 3KQDA 1D9IA 2ANYA 1O5CB 5DP4A 5FPSA 3F68H 4WY3A 1EOJA 3TU7H 3RXVA 3BN9A 1O2KA 3ATKA 2W7UA 1TGBA 3RXKA 1TA2A 2OC0A 2PSXA 3P8GA 3GCNA 4X1QU 3VEQB 4AZ2B 3SOSA 2HPQH 4BTIB 1V2JT 2K1QA 1G3BA 1BT7A 4TYDA 2G52A 3FANA 1GI4A 3E16B 1Z8JB 1A0JA 2W5EA 3MU5A 4AG2A 4OGXA 3HPTB 1VJAU 4I31A 1C2EA 3I78A 1C5QA 1ZSKA 3ZZBA 5F6MA 3T26A 3NK8A 1NRPH 2O8MA 1QY6A 2ZIQH 3NPSA 1FI8A 2DUCA 1O35A 1C5YB 2WINI 3TNSA 1NFWA 1NS3A 2JKHA 2ZU1A 2FWWA 1GCTC 2BXTH 4CRGA 1C1PA 1BTHH 1ELTA 1D3PB 2G51A 1O32A 3LONA 1UVTH 3I77A 1F0SA 1LVOA 3BTDE 2TIOA 4I8JA 1TPAE 1G3CA 4AFSA 1ZYOA 2C8XB 1HAPH 2A1DB 2SGFE 1RTKA 4Z6AH 3LT3A 4HFPB 1G2MA 1HJ9A 4X0WU 4BAHB 3P95A 2KAIA 1TNKA 2EA3A 4NZQA 2ZHQH 1C4V2 2ZFPH 1SGQE 3SJ8A 4Q2KA 5FAHA 2WPHS 4UFGH 4GUXA 1EPTB 1DWEH 1QQ4A 1SVPA 4J2YB 1QURH 1HV7A 5G4BA 1QL9A 3SZNA 1FV9A 1DY8A 4MLFB 4O3TA 1C4Y2 4X6OA 3ZZ7A
chains in the Genus database with same CATH superfamily
1C9PA 5DP6A 2GJGA 3RC6A 1C2FA 4CRBA 2P8OC 3TJVA 5EIYA 1CT4E 2A7CA 1MTWA 1ZJDA 2M2AA 3BEFB 3QDZB 1P3EA 3GOVB 2LPRA 3B8JA 1QB9A 4DURA 2CHAC 3QK1A 2D1JA 1YKTA 2WPMS 1FPHH 3KQBA 1AWHB 1A2CH 3UREA 1F7ZA 2CN0H 4MNXA 1XVOA 3LIWA 1BB0B 4RKOB 1NT1A 3PM3A 2XBYA 4KGAA 3U1JB 1OYTH 1HAVA 4X2YA 1CVWH 4X6MA 2TGPZ 1W12U 4RKJB 2FLBH 1N1LA 1W0JD 2ASUB 1QB1A 5C0UA 2FX6A 1DXPA 1KDQA 1SGRE 3FN8A 2P3UB 3RMMH 1CHGA 1TRNA 3SV6A 3A82A 1W3CA 1TRYA 3QUMP 4HI3A 4ISLA 5AHGH 1J9CH 2OP9A 1PPHE 1OKXA 1YCPK 4VGCC 2XNIA 2ZCHP 2HWLB 1VKYA 1TBRH 3HATH 1YCPM 1QNJA 1X7AC 1SMFE 2GVFA 1SQAA 1QHRB 1FJSA 4CRAA 3BG4C 1ZSJA 4D9RA 3GY4A 3PO1B 4FUGA 1KXEA 4BAQB 1TMBH 4DIHH 5EODA 4XBBA 2R0KA 4Y0YE 1ZHMA 4FU7A 1TABE 1UTQA 1D3TB 2F9UA 5FCKA 3KYFA 1IOEA 1H9HE 5A8ZA 2SGDE 1UTNA 3ZZ9A 3RXMA 1HAIH 1YWUA 3PROA 1C2IA 3SV9A 1GCDA 2XC5A 2GT8A 1C5PA 2AYWA 4ZAEA 2ZU5A 1NRSH 1PPBH 1CBWB 1O5DH 5CDFE 1JBUH 1TNHA 3SNAA 1BHXF 1JRSA 3LGIA 1ESAA 1E36B 3RMNH 1LHCH 1EB2A 3FP8E 4MDSA 1S82A 5EJ1A 3RU4T 1SLUB 1RJXB 3UOPA 1S6HA 3TH3H 1C1SA 1SFQB 1D3DB 1KTSB 3PLPA 3A7TA 1QIXB 1CU1A 1TIOA 4CRFA 2CGAA 1XUFA 1ANCA 4ISIH 2FOFA 1GBAA 1TNJA 2HLDD 3Q76A 2EI7A 3RU4D 3BIUH 1O3OA 4CR5A 4X1PU 3SV2H 3P17H 3M3SA 4R8TB 1ID5H 2B5TB 5EJLA 2HGTH 5AFZH 1QL8A 1J15A 1N8OB 1WV7H 2R9PA 2J2UA 1O2OA 4ABEA 3F9EA 2XTTB 3GY2A 5A2MH 1S6LA 1DOJA 1LQEA 2Y81A 2ZU4A 4YO9A 1O2WA 4Y8ZA 2ESTE 3GY6A 3TIUA 3MWIU 5FL7D 3WW7A 1GI2A 3BTKE 3SU4A 5F8XA 1UK4A 2AS9A 1P10A 1BRBE 3SZEA 4HGCA 3SJIA 1H8IH 3D62A 2V3OH 1ZMLA 2LNCA 1HDTH 2F9OA 1ZZZA 2ZKSA 5GIBA 5HIZA 1EZXC 1LVYA 1VITF 2PW8H 3AASA 3PTBA 1RD3B 2QC2A 3ZVDA 4GPGA 4YLQH 3SHAH 3VPKA 2G81E 5K7RA 3OU0A 1W0KD 5SGAE 1THRH 3PYHA 5JBTA 4ZROA 2HVYB 4NIXA 1VCWA 5CE1A 3A8BA 3MO9A 3H5CB 3GYMA 2VBCA 1Z1IA 3TGJE 4CRDA 2NU2E 2UUJB 3EA9A 5J4QA 1XKAC 1GMHF 1GJ4H 1BUIA 2ZFRH 2A4OA 2BY6X 2ZHFH 3WWFA 1T8OA 4IMQA 1ELDE 4DIIH 4UE7H 1VGCC 1VCPA 1H9LB 3FOAA 3MNXA 3ZZ4A 3OEED 4I32A 4YLUA 4UEHH 1S83A 2FOEA 2F9BH 2R2MB 2TRMA 1YC0A 3A81A 4B71A 3GCTG 1QBVH 2GGVB 2AMDA 2FI5E 1TGCA 3U9AH 1WSSH 2FYRA 4WWYA 4A1TA 1HJ8A 4TSFD 1NROH 1OWKA 2FYQA 1GHVH 2ZFQH 4B2AA 4OGYA 5EPYA 3BTHE 4ZHLU 1CQQA 1S85A 3H09A 2GD4B 4H6TA 2QA9E 1TNIA 3M61U 4IC5A 5B6OA 1UTJA 1E79D 2WV9A 2ZHDA 1BBRH 1PQ8A 1ZRKA 3TLOA 4TY7A 2HNTC 2QXGA 4K1TA 2WYJA 3N7DA 4DG4A 5JYIA 4D7FA 1SGEE 1BIOA 5J4SA 3BTFE 1GL1A 1T7CA 2BX3A 3G01A 2AGEX 4Y8XA 3RXJA 4BAKB 1AHTH 1O3FA 2FZZA 2VVCA 1EP5A 1LQDB 3GCOA 2BYAX 3UFAA 3M3TA 1O5FH 1P2NA 3PV2A 4X2XA 4P00A 2UUKB 3FP6E 3BG4B 2FESH 1T8NA 3RXRA 2BHGA 4E7NA 2ZEBA 1OYQA 3UR9A 1W2KH 2F9NA 2O8TA 1EPTA 2ZTZA 1EB1H 1HJAC 2CXVA 3DUXH 2VINA 1RTFB 4IBLH 1GBBA 1O2YA 2YNBA 1JIRA 1P11E 1UK2A 2BDBA 2PV9B 2F4LA 2P3TB 1LMWB 3GY5A 1BQYA 3FO8D 2H5CA 2I6QA 2BZAA 2SGEE 4JZDH 4ABFA 4ABIA 1AKSB 1NRRH 4CRCA 5DN6D 1TBZH 5C20A 3M7TA 4WVPE 2BDHA 1FY3A 4AYYB 3PMHB 2FI3E 3MMGA 1JWTA 1FPCH 1ELGA 2HPPH 4O03A 1FNIA 3PWBA 2ZC9H 1ZRBA 1G3DA 1NESE 3URCA 5FBEA 1ABIH 2C8WB 6CHAB 4JYTA 1Z8GA 3NZIA 2FIRH 4F4OC 4AGKA 1KXAA 1GBIA 1LVMA 1AY6H 1BA8B 3OE7D 3UNRA 1FDPA 3PV4A 1E0FD 1NU9A 4P02A 4PROA 4IS5A 2PTCE 1L2EA 2FMJA 2GP9B 1BITA 1VJ9U 1WUNH 3KHVA 1UVPA 2BZ6H 3PMAB 3QTVH 1A46H 5GCHF 4XDEA 5E2OA 4D8NA 4DJZB 1L1JA 1PPCE 5C5NA 2AEIH 3DA9B 3QTOH 1OP2A 3AVZA 1WAYB 4WMEA 1FY4A 2G00A 3SUFA 3TGKE 4R0IA 2F83A 3TITA 5DP9A 1GG6B 2H2ZA 3DHKH 1WQSA 4K8BA 1XUHA 1EPTC 1A5HA 1TONA 3F9FA 3BIVH 3R3GB 1J17T 1UK3A 4NIYA 2Y5FA 3SU3A 1MCVA 1PFXC 4RT0A 5TCAA 5AF9H 2ODQA 5EPNA 1HPGA 2QF0A 3MNCA 4X8TH 1A5GH 4CR9A 1ZGVA 1EFRD 3TNTA 1C4U2 1MZDA 2J5UA 4I33A 3ZVCA 1GI5A 1JOUB 2F9VA 4XBDA 3F2GA 1UHBB 3N7OA 4CH2B 2VIDA 1Y5AT 2B7DH 1KLTA 4K2YA 4NA9H 1O3PB 1OSSA 3ATIA 3RMLH 2ZPQA 3TH4H 1YYY1 2QIQA 1EJAA 1ANDA 4AGJA 2PGBB 1CSOE 1MCTA 1YPKH 3BTGE 4FUCA 3L33A 1WBGB 1J16A 1VGCB 1UVOA 1SKYE 4AORA 3MU8A 1OPHB 5B6LA 5KEDA 4B2BA 1V2MT 3KEEA 5LH8A 1O3DA 3LGUA 1AMHA 4U2WA 5I25A 2CMYA 4XFQA 4FUHA 7GCHF 1H8ED 1PPEE 3PMBB 1FXYA 1O36A 2XOKD 3S69A 1B0EA 4NGAH 2XWBI 1C5TA 1P06A 2FDAA 2AIQA 1K9OE 2ZO3H 3MFJA 2PUXB 2JJ2D 1HRTH 3ITIA 3EYDA 1C1OA 1A0HB 3S9BA 1C5OH 4FUDA 1Z6EA 1P2KA 3P92A 2V0BA 1FY1A 5GWZA 4B2CA 2OXSA 1OS8A 5F03A 1G9IE 3P8NA 3TK6A 2J34A 2C3SA 2ZGJA 3GDUA 1TB6H 5EW2H 4OS7A 4B73A 2V6NA 1FQ3A 3QWCH 3OX7U 2ODPA 3SNCA 1MUEB 3SV7A 5EU8A 1KXCA 2Z6BD 2FO9A 2JH0D 3M36A 1NTPA 3OFND 4NG9H 2UWLA 3O8CA 2A5AA 6GCHF 3S9CA 1CBWC 4A6LA 8KME2 7ESTE 1ZR0A 1MU8B 2VGCB 1SB1H 1GJAB 1FAXA 1HAXB 3DFLA 3QO6A 1CHOG 2O8WA 3MH4A 5AFYH 4A92A 1O2QA 1UCYH 1JRTA 2QYIA 3SO3A 1TFXA 2GTBA 3GY7A 2VVVA 1T8LA 3M7UA 4JZEH 1HAZB 1HJAB 4Z1MD 3F9GA 5HMAA 1WTHD 2AHME 2XWAA 1GBHA 1O2JA 1ZGIA 2QXJA 1P09A 1V2QT 1Y3XA 2ZFTA 3UOUA 5EQSA 1AO5A 1C2HA 1L4DA 1P05A 2AMQA 4AOQA 2YMSB 5CHAB 3GICB 2Z9IA 4K8YA 2GMTC 2Z3EA 3UR6A 1CA8B 2CF8H 3BTTE 2QV1A 1Z8IB 2G5VA 1DPOA 1GBFA 5BPEA 1FUJA 3EE0B 1N8OC 1G3EA 2FI4E 5KECA 3A8DA 3PLBA 3CS7A 1MABB 4HZHA 2ZPRA 1BMLA 2Z7FE 1CGHA 1TWXB 4D9QA 2GX4A 1T8MA 1SGYE 3O8RA 4UDWH 4ZXYH 2SGPE 2BD7A 1K1OA 1BTZA 1N6XA 1RGQA 3KNXA 4ZXXH 2UWPA 3FFGA 1F2SE 2BQWB 9LPRA 1UMAH 3RUOA 1OWDA 1HAYB 2A2XH 4CREA 4MPXA 1EAWA 1GJDB 5EXLA 3SU5A 4X6NA 3ZVAA 2PSYA 5DO4H 4K3JA 1DM4B 3TK9A 2KZ4A 2WV5A 5FX5A 4Y7AA 1O2VA 3V7TA 2ZF0H 4H4FA 3RXQA 4IGDA 2FOHA 4ABBA 2VIPA 3F9HA 2EEKA 5GCHG 1TE0A 1QTFA 1UW7A 5JBAS 3AW0A 4ESTE 3S7KB 3OYPA 3Q3YA 1P0SH 4NIWA 1EATA 1IQNA 1AUJA 1ELCA 2FS9A 6LPRA 1COWD 1ESBA 2XCFA 2YOLA 3GCTF 1EUFA 2XBXA 4NA7A 3R0FA 4IC6A 4OS6A 4BOHA 2Q6DA 1C5RA 1C5LH 1XMNB 2YNAA 5DP7A 1ZJKA 1G32B 3SI3H 1W0YH 3LDXH 2P94A 1NFXA 1AKSA 1ZPZA 1SL3A 4I8HA 1SPJA 4I8GA 2JH6D 2J97A 2C90B 1FY5A 2ZPSA 2A4RA 3SGAE 3TK5A 2VIWA 4FUEA 1IQGA 4OS5A 1BDAA 1BRCE 2H6MA 1BTPA 3SGBE 4A1XA 1O2SA 4AC9A 2RDLA 3EA7A 3V12A 2VIVA 3MU1A 4X6PA 5C2ZA 3OTJE 1O2ZA 3AAUA 2ALVA 4RI0A 1GDNA 2ANMH 4ISOA 3STIA 5EG4A 1NU7B 1O38A 1NRQH 5C1YA 2ZHWH 1XM1A 1WYKA 1MTUA 5LGOA 4Y7BA 1BMMH 1Z71A 2A5IA 3SU1A 1TPOA 2SGAA 4ZHAA 1SGFA 1BCUH 4ZKRU 1ELEE 3RXBA 2IN2A 1C5MD 1V2ST 2V35A 1A0LA 2A4GA 3P70B 2G55A 1S84A 5LPFA 3GCHB 7GCHG 1D6WA 1IQIA 1C2KA 4YXWD 1AIXH 1GBCA 1GMDF 1BBRK 3DSGA 3ATMA 1PQ7A 2B9LA 5A0AE 1GI0A 1TGSZ 3U1IB 3ZZCA 1C1WH 4RN6A 3OY5U 1GPZA 1QL7A 2W26A 2VJ1A 4DY7B 1HXEH 1C1UH 4E7RG 1BOQA 1D4PB 2OQUA 1V6DA 3K2UA 3SUEA 5C0TA 4AFQA 4ABHA 5A8YA 1C2LA 1A1RA 3Q3KA 5E0JA 2GDDA 1GHZA 3A7WA 1MTSA 3UIRA 1W8BH 1TAWA 4MNYA 4F49A 1YLDA 3SQEE 1KY9A 1P03A 1MU6B 1KXBA 1UHBA 1QQUA 3WWBA 1DSTA 5EGMA 2WYGA 2OINA 1MD7A 1DWCH 2UUYA 4X8SH 4Y0ZE 4NIVA 6GCHG 2ZGHA 1FMGA 1LHDH 2JETB 5F8ZA 6CHAC 4DW2U 5EW1H 2G5NA 1SHYA 1P8VC 2PGQB 2VU8E 1ABJH 1F5RA 1SOZA 3RXHA 3NCLA 3QN7A 2FP7B 1O3MA 1MTVA 4LOYH 1A3BH 2CJIA 4X1RU 3RXIA 2GMTB 1WU1A 2KX4A 3BSQA 3HK6B 2W6ID 4AG1A 5GXPA 3S9AA 1W11U 3VXFH 2QGRA 3A85A 1BBRE 1DT2A 1KLJH 3CENA 4MTBA 1YPGH 1WQVH 1GBJA 1Y3VA 2P93A 4YT7H 1D3QB 2I6SA 1NC6A 3SYJA 2STAE 5A0BA 3BEUA 3GYLB 2AH4X 1GL0E 1ZOMA 1H8HD 1GG6C 1DDJA 4A1VA 1VZQH 1C5XB 5HIYA 2C93B 1GJ7B 3C1KA 2VWNA 3U28C 3RXGA 1GJ5H 2IOTA 1SBWA 2R3YA 5T1VA 4AYVB 1V3XA 3LH1A 1TOMH 3MH6A 2XC4A 3ESTA 1GJ6A 1SOTA 3LC5A 4ZKNU 3MNBA 4BXSA 2W6JD 3M5LA 5E2PA 1Y59T 5FCRA 1O2HA 4GCHG 3ZYDA 4K5ZA 1V2TT 1P01A 1XUKA 1RTLA 2IJOB 1JIMA 2YMSD 2V3MA 3L3TA 7KMEH 1SHHB 2BM2A 2AERH 1SLVB 2J4IA 4KTUA 3ZVFA 4Y79A 1MTNB 1O2PA 3Q3XA 1GHWH 3UY9A 4X8VH 2QY0B 5DKMA 2G4UA 3B23B 4ABDA 3UNQA 2THFB 4LZ4B 1EQ9A 1MKXH 9ESTA 2OC8A 1GGDC 4Y71A 1J14A 2A32A 1TBQH 8ESTE 2FX4A 2WPIS 3LU9B 4ZUHA 1FONA 3A7XA 2D26C 2FXRA 3W1EA 1QZ8A 4X2VA 3MH7A 5T6DA 5ABWA 3SQHE 4XOJA 3RMOH 1JMOH 2BVSH 2PFEA 3A84A 2BY9X 1SI5H 1QCPA 3BTEE 1YPHE 2AGGX 4AB9A 2EY4C 3KQ5A 3P6ZB 3M35A 5C17A 1DY9A 1DICA 2OCVB 1O5BB 1GVZA 3AW1A 1NN6A 1HXFH 3LH3A 4Q7XA 3A7ZA 1C2GA 1GJCB 4X1NU 3RXDA 4B6EA 5IDKA 3A7VA 1O3KA 3A83A 1DXWA 3M3VA 1ZSLA 1AQ7A 1OWIA 4OS2A 2BD2A 4CHAC 3E6PH 3SN8A 3K6YA 3KF2A 2ZG0H 3RM2H 1QJ7B 2CF9H 1HCGA 3KN2A 4NSYA 4O97A 4YOGA 2VB0A 2XC0A 1C1VH 2HNTF 5EQRA 1ARCA 4K69A 3SI4H 3SGQE 1W7XH 1TPPA 1W10U 4IN2A 1CHOF 4WJG2 1UVSH 5IYTA 2SNWA 4K60A 1UTMA 4O3UA 3RM0H 2BOKA 5L2ZH 2VIOA 3LOXA 3ZV8A 2F3CE 2VGCC 1W0ZU 2GCTB 2IPQX 2Y7XA 4KTCA 1P04A 5DGJA 1CO7E 1UTLM 1PYTD 1L1NA 1O37A 3RU4E 4A7IB 4KTSA 1K1NA 2P59A 4Q7ZA 3AK5A 3RXAA 2GV7A 2ZNKH 1E35B 2AFQB 5HYOA 3OAAD 2BDIA 6ESTA 1LPGB 1GMDG 2WPLS 2RA3A 4K1SA 1BMNH 3A8CA 2Q6FA 1G37A 2YMSC 5CHAC 5E0HA 1ESTA 1A7SA 1GJ9B 1MQ6A 1SG8B 4YOIA 1TX8A 5T3HA 2BQ6B 3EGKH 1Y5UT 3UUZA 1NFYA 5C67A 1QRXA 4MPVA 5BRRE 2OK5A 2W7SA 1GHAF 2C4FH 1D6RA 1UCYK 1Y3UA 5GJ4B 5DSFA 4NWKA 5FHTA 1BHXB 1PPZA 4DGJA 1CE5A 7LPRA 3OEHD 5DJ7A 5JB9S 1L1GA 1AZ8A 1ETSH 4FXGH 2A2QH 1E34B 1G30B 1ZTLA 2Z9JA 1K28D 2BD5A 2NU1E 5AVDA 1HAOH 1SSXA 2VH6A 2EQNA 4XD7D 1V2WT 3WY8A 3NWUA 1VR1H 1YPLH 1O3IA 1E37B 2BLQA 4INHA 1UTOA 3HKIB 1IQMA 2J9NA 4NZLA 1C2DA 4WMFA 1O33A 1P2JA 1ETRH 1Y3WA 2IJD1 1P9UA 1YPEH 2O8UA 4TT3D 1TX6A 1QBNA 3TJOA 1AZZA 4UFEH 3Q77A 2ZA5A 2FOBA 1L0ZA 2PWXA 1ANBA 4FVBA 3MTYA 2ALPA 1O31A 3GS9A 1LTOA 1QRZA 4O9VA 5F53A 1RIWB 3CP7A 4I7YH 1KSNA 1O30A 1O2LA 3VFEA 2WPJS 4UFFH 1ZHRA 4K1EA 4KELA 2Y5HA 2Z3CA 1HIAB 1UTPA 1E1RD 3T27A 5DG6A 2JDID 2XNDD 4DVAU 4GVUA 1PYTC 1UCYE 4JZFH 4RSPA 1EAUA 1HNEE 3N99A 4YT6H 2FOAA 3SJKA 1Q3XA 1O5EH 4YM9A 2WZQA 4JZIA 1P3CA 3TVJB 1EXFA 4JK5A 4FUFA 1GBDA 4ACAA 3V0XA 1V2UT 3A8AA 2OLGA 1M9UA 2WSSD 1UVUH 2Z9KA 4QT8C 4WH8A 4D7GA 1K1PA 4AX9H 1QRWA 4F55A 2HLCA 4ZCNA 2QE7D 3E90B 3F1SB 1OOKB 1GBMA 4B6FA 1GGDB 2A45B 4NCYA 3RXLA 8LPRA 2NWNA 3QX5H 1FN6A 4LZ1H 2XXLA 4Z0KA 2ZDNA 2QXIA 2WUBA 1N6YA 2BDGA 3T62A 1NBME 3F0OA 2RA0A 2OTVA 1MKWH 1O5AB 1YPJH 1G2LA 3A89A 4ABGA 1DVAH 4YOJA 2PKSB 1O2UA 2BMGB 3RLYH 2F9PA 1C5ZB 1TMTH 2V7QD 3MNSA 2ANWA 1LPKB 1AUTC 1LO6A 2J94A 3ZVGA 5A0CA 1GI6A 1DUAA 1TNLA 1DWBH 4XRNA 1O3LA 3GCHC 3UWJH 1QB6A 2C8ZB 2HALA 3F0PA 4AN7A 1OX1A 4CHAB 1LVBA 1QJ1B 1B0FA 2BD9A 1TYNA 3UNSA 2AGIX 3UTUH 1LKAA 1C1NA 3RXOA 2JJ1D 2NU0E 3ZZ8A 2ZDVH 4INKA 3GDSA 1EAXA 3MI4A 1P57B 3H7OA 1QGFA 2ZWLH 1AI8H 1SGCA 1Y5BT 2GCHG 2BX4A 2Y6TA 1ZPCA 3NRLA 4WXVA 2PLXA 3KQCA 1S5SA 1HUTH 4JK6A 1INCA 1HAGE 1NY22 4HG6A 1K1MA 3E0NB 1A4WH 1C1RA 2BOHB 2FODA 1V2VT 4JMYA 3SBKA 3UQOA 3ZZDA 3GY8A 3SJOA 1IQLA 1MZAA 3LGVA 1IAUA 3GDVA 1GBKA 1BTYA 2J38A 3M5MA 1UTKA 2TGTA 1LHEH 1ELVA 4FU9A 3SNDA 1XXFA 5DP8A 5HXFA 2B8OH 2QF3A 5JB8S 2JETC 1BMFD 2OQ5A 4Q80A 1DANH 1YLCA 1S0RA 3GY3A 5E8EH 1O0DH 2ZZUH 3E3TA 4BNRA 5C5OA 1O2TA 1SLWB 1EASA 2PKAB 5FXLA 1C1TA 4U30A 4MVNA 4ISHH 1ZLRA 3A7YA 1GVKB 4H6SB 2CV3A 1EJNA 3EA8A 1DITH 5LPRA 3QGNB 1RXPA 1ACBE 3SNBA 4TWWA 3VB4A 2GZ9A 4KP0A 4YTAA 1GMCF 2KCPA 2TPIZ 2M5TA 3ZZAA 1HAHH 4TWYA 2BDAA 5TJXA 2DE9A 1SLXB 4TPYA 2Z3DA 2ZQ1A 1RFNA 1GHAG 1EKBB 1OP0A 3PLKA 1S0QA 3KCGH 1GBTA 2A7JA 1O2GH 1DS2E 4ASHA 1GI8B 1KMHB 1E38B 3MQKC 1AE5A 2UUFB 2BB4A 2FTLE 4GLYA 4FUIA 2R2WU 3B9FH 1WOFA 1ZPBA 1HBTH 1FLEE 4GCHF 2ZDAH 5GDSH 2FOCA 3OY6U 2ZP0H 4B74A 3RXTA 3URDA 1XUGA 2P3FH 4Y11E 3ATWA 2KCYA 1E1QD 1OXGA 1P02A 3UWIA 1LHFH 4IMZA 3MO6A 2BD4A 3RC4A 3SORA 1B5GH 4GHTA 1CA0B 2VWLA 1K1IA 5LPEA 1GHYH 1Z1JA 3DSPA 2ZGBH 1P2MA 4ZKOU 3BEIB 2SFAA 1ZMNA 1AD8H 1MTNC 1P2IA 4ZH8A 3T5FH 4XBCA 1SGIB 3BTWE 3MU4A 4A5TS 5TCCA 1BJUA 1ETTH 1V2OT 1BRAA 2A4QA 1SR5C 3ATLA 3I29A 1SFIA 3NUMA 1C5SA 1YY3A 4X1SU 1V2LT 2OC7A 5DP3A 4ISNA 1O3JA 2FOMB 2JH5D 2J98A 3TH2H 3QGJA 2ZI2H 4AFUA 2RDEA 3W94A 1QA7A 2A0QB 4BANB 2HRVA 1P2OA 4GHQA 2QF4A 5EJZA 1EJMA 3LGWA 4CBOA 2PUQH 4UD9H 1YLNA 1F0TA 3TPIZ 1GI9B 3H7TA 2EI6A 3ODDA 2RCEA 1BZXE 3VB3A 4JZ1A 5EQQA 5ESTE 1TNGA 2Y5GA 4OS4A 4UONA 3PV5A 1AVXA 3T28A 1MKXK 4ZMAH 3D23A 2ZTYA 2ULLA 1WCZA 3HKJB 1AFQB 3U8TH 2KFWA 4X8UH 3UB0A 3VG8A 1TOCB 4Y10E 1Q2WA 3EE7A 4M7GA 1IQJA 1C4Y2 2XW9A 1Z7KA 1P2QA 4WF8A 2ANKH 1O2XA 2TGAA 3EQ0H 2ZECA 3P8OA 1CT0E 1HGTH 2BVRH 4Y76A 3V13A 2H5DA 5L6NH 1RS0A 4NSVA 3FP7E 3SU6A 1IQKA 3T2NA 1OWEA 5CHBA 3PRBA 4NWLA 3P8FA 5HM9A 2EC9H 1GHBF 1GJ8B 3E91A 2GCTC 1H8DH 1A61H 1IQFA 1LPZB 3LPRA 2FLRH 4FU8A 2BY8X 2OBQA 1O3EA 1RRKA 1AB9B 4WH6A 1ARBA 1FX0B 1TQ7B 2BXUH 4MG3A 1BMAA 1SC8U 3O8DA 4NA8A 3FZZA 2GZ7A 2G8TA 1MAYA 2O8LA 4JYVH 1O3AA 2Y7ZA 2W3KA 3U98H 2HOBA 3IITA 3HGPA 1K1LA 3U69H 2BQ7B 4Y6DA 2ILNA 1HIAA 5JPMH 1MQ5A 1XUJA 5JBBS 4DCDA 3KIDU 2O9QA 3BV9B 4U32A 4ABAA 3RLWH 4XSKU 1PJPA 2ZFFH 1OHHD 1T32A 4FVDA 1NFUA 2KCAA 2A5KA 2H9TH 1G36A 2QF5A 3L6PA 2ZHEH 2ZFSA 4CH8B 4E05H 4X2WA 3MYWA 1JXPA 3VGCB 1A5IA 3MU0A 1H4WA 4MPUA 1F92A 1TGNA 1F5KU 1O2MA 1Z8RA 1GWAA 1FIWA 3ENSB 1U6QA 1AE8H 1S81A 1WTGH 3STJA 2ZDMA 3UAIC 3EAJA 2AMPA 1KXDA 1SGDE 3SUGA 3GISB 2PTNA 5K0HA 1LHGH 1K1JA 4BAOB 4M9FA 1C5NH 1LDTT 1TLDA 3PMJA 1C5VA 2ZCKP 3PWCA 1A3EH 2ODYB 1K21H 1VCQA 3LGTA 1YGCH 1UJ1A 2FOGA 4SGAE 1AGJA 1SQRA 2GT7A 2GZ8A 1O5GH 1FZZA 2AIPA 5C94A 1GMCG 1O3NA 1SQTA 3F6UH 1GHXH 2J92A 5HM2A 1DE7H 1RIWC 2F43B 2BLOA 4GAWA 1ZTJA 1BJVA 1K0HA 2BY7X 1AU8A 2GKVE 2PP6A 2PR3A 2ZDLA 3BTQE 1TPSA 3CNRA 3ZZ6A 1TX7A 1DLKB 3RXCA 1ELBA 4RT1A 1P12E 1NPMA 3RXSA 3VB6A 3RXFA 5HGGA 1GCTB 1QBOA 5JDUB 3F2HA 2BY5X 1C5UA 3RP2A 2R3UA 1F5LA 1SGTA 1QR3E 1K2I1 1H9IE 4ZHMU 5KGOA 3DD2H 3VB7A 2BDYA 2VVUA 2ZDKA 3LC3A 4F48B 8GCHF 1C1MA 3RC5A 5JBCS 5L2YH 3ZZ5A 2B0FA 2P16A 5PTPA 1YPHC 2Q1JA 3PTNA 5CMXH 5C1UA 1AVGH 1QA0A 4LXBH 4MNWA 5A8XA 1O34A 4DT7B 1THSH 2XYAA 2WV4A 3SW2B 3SV8A 3E8LA 5FBIA 2WPDD 2PKAA 3CS0A 3IG6B 1O2IA 2XBVA 1DUEA 1MBQA 2Z94A 1OWJA 1MD8A 2ZGCA 2VIQA 3E1XB 3D49H 4BAMB 2PKSC 3MH5A 4FUBA 1ZTKA 2FEQH 2BD3A 5GNDA 5C3NA 1IHTH 2F91A 1XX9A 2P8OB 2ZU2A 3U8RH 4IW4E 3HGNA 1BTXA 1O3HA 1OP8A 2QAAA 2QN5T 2GCHF 3LJOA 1BTWA 2VWOA 5HKKD 2CHAB 4UFDH 1PPGE 2BD8A 1SGPE 1XUIA 1YCPH 1TQ0B 3PB1E 3A80A 2OC1A 3T29A 1EZQA 1MKWK 3LJJA 2XRCA 3UQVA 3RXPA 1P9SA 4I8KA 3ZZ3A 3V3MA 2VNTA 2STBE 2W3IA 1IQHA 1B7XB 4THNH 5H4IB 1TGTA 2SGQE 2IPHA 4MQAA 2VH0A 3MHWU 1TA6A 1NM6A 1T4VH 3E0PB 1AN1E 1GHBG 4AFZA 1MH0A 3K65B 5FPTA 1PQ5A 1SGNE 4NFEA 4VGCB 2KAIB 2J98B 1MAXA 1C1QA 3KQEA 1OWHA 1NBMD 2HNTE 1DSUA 1CT2E 3PRDA 2QCYA 3VB5A 4MNVA 4JYUH 2G4TA 1EZUC 2D2DA 1L4ZA 2QXHA 4U01A 1W14U 3A86A 3JZ2B 1ELAA 3M7QA 1MMJN 4KKDA 1Y8TA 5EOKA 3BTME 3ZV9A 2TBSA 3MOCA 3QZQA 1UO6A 4GSOA 4WXIA 1QJ6B 1FY8E 1DLEA 1T31A 2R0LA 3W95A 4HTCH 2TGDA 2ZTXA 3OTPA 2OUAA 2ZU3A 1FN8A 3FZDA 1XVMA 1O3CA 1EZSC 1TALA 2FTMA 4DOQA 1YPMH 4BXWA 3EDXB 1Q31A 2UWOA 4Y8YA 1EAIA 3DT0H 1GI3A 4B75A 1VITH 2H9EH 1GDUA 1O3BA 2XBWA 3ZVEA 1V2KT 2OBOA 1HYLA 2Y80A 1O2NA 1LCYA 2WUCA 4B1TA 1GI7B 3BF6H 4FOUC 2KR7A 2FPZA 1HAVB 1Z6JH 3F3BA 3DSOA 3FAOA 4TY6A 1O2RA 4ASUD 1QFKH 1W7GH 2H1UA 3HK3B 2RFKC 1YP9A 1T4UH 1ZMJA 2BLVA 1GI1A 4Q7YA 5A09A 2ZGXH 1DX5M 1W13U 3RDZA 1YF4A 1KDQB 1CA0C 5ESBA 2EI8A 2Z9GA 2PHBA 2BDCA 2JIZD 5I46H 5L30H 3S7HB 1WDIA 2VWMA 1SGFG 1THPB 4E06H 3T25A 2Y82A 3BG8A 5T6FA 3RXUA 1S6FA 1NZQH 2NU4E 1FAKH 5DK1A 1FIZA 4INLA 2A7HA 2Q6GA 1C2MA 1V2PT 1IQEA 2K8IA 3Q00A 4SGBE 4WMDA 4OM9A 2BTCE 1H1BA 3QZRA 3NKKA 3TGIE 1AVWA 4D76A 4H42U 5C1XA 1AWFH 1KYNA 1O39A 1GBLA 2Z9LA 1NO9H 1C5WB 1ELFA 2ZCLP 4FETA 1PPFE 5IK2D 1HFDA 1YBWA 4AB8A 1BRUP 2DE8A 1KTTB 1Y3YA 2FM2A 1NRNH 4TPIZ 3U8OH 1KLIH 1AFEH 3KL6A 3ODFA 1O3GA 2GDEH 2BLWA 4XE4A 2CK3D 3K9XB 5DPAA 4IN1A 1AFQC 3DFJA 3JZ1B 3SU0A 1VITG 4OS1A 8GCHG 3SJ9A 4BTUB 1SQOA 2P95A 1ZHPA 4ABJA 3SU2A 3SUDA 1HLTH 2WHXA 3FKSD 5FPYA 1TRMA 3ZYEA 3A87A 4YZUA 2J95A 1GJBB 3VXEH 3AAVA 2V3HH 3TJUA 3KGPA 1J8AA 3D65E 1ORFA 2SNVA 4ACBA 3S0NA 4DT4A 4B76A 2RG3A 1GMHG 2LP6A 1ANEA 1GBEA 4I8LA 1KIGH 1DWDH 1PQAA 1XXDA 1XKBC 4Q4LA 5EXMA 2FS8A 3N7EA 5T6GA 2HVXA 1C2JA 1V2NT 5DP5A 1AB9C 3RXEA 3F2FA 4YESB 2WPKS 1MBMA 3O8BA 2C8YB 2ZQ2A 1TMUH 3SHCH 1CGIE 4Q63A 3FVFB 3M37A 1HB0B 3SNEA 1V2RT 2H9HA 5FX6A 3TJNA 3C27B 2OD3B 2NU3E 1EP6A 1DFPA 5EXNA 2BVXH 3A88A 3PO1C 3LKWA 1LKBA 1F0UA 5ETXA 2XCNA 1KXFA 3K6ZA 5E0GA 4J1YA 4NFFA 3IWMA 1IHSH 1BTUA 1YM0A 3NXPA 4FUJA 1EOLA 4ZKSU 4JCNA 5GPIB 2A31A 3VGCC 1CGJE 1C9TA 1GVLA 1EX3A 4MPWA 4CBNA 1F0RA 1K22H 3LGYA 2K0QA 2D8WA 3ELAH 3DCLA 1GDQA 3OSYA 3M5NA 4BTTB 3ZVBA 3M5OA 4LK4A 3UPEA 3MO3A 2GV6A 3QLPH 5F8TA 3KQDA 1D9IA 2ANYA 1O5CB 5DP4A 5FPSA 3F68H 4WY3A 1EOJA 3TU7H 3RXVA 3BN9A 1O2KA 3ATKA 2W7UA 1TGBA 3RXKA 1TA2A 2OC0A 2PSXA 3P8GA 3GCNA 4X1QU 3VEQB 4AZ2B 3SOSA 2HPQH 4BTIB 1V2JT 2K1QA 1G3BA 1BT7A 4TYDA 2G52A 3FANA 1GI4A 3E16B 1Z8JB 1A0JA 2W5EA 3MU5A 4AG2A 4OGXA 3HPTB 1VJAU 4I31A 1C2EA 3I78A 1C5QA 2LELA 1ZSKA 3ZZBA 5F6MA 3T26A 3NK8A 1NRPH 2O8MA 1QY6A 2ZIQH 3NPSA 1FI8A 2DUCA 1O35A 1C5YB 2WINI 3TNSA 1NFWA 1NS3A 2JKHA 2ZU1A 2FWWA 1GCTC 2BXTH 4CRGA 1C1PA 1BTHH 1ELTA 1D3PB 2L6OA 2G51A 1O32A 3ZIAD 3LONA 1UVTH 3I77A 1F0SA 4I86A 1LVOA 3BTDE 2TIOA 4I8JA 1TPAE 1G3CA 4AFSA 1ZYOA 2C8XB 1HAPH 2KCOA 2A1DB 2SGFE 1RTKA 4Z6AH 3LT3A 4HFPB 1WXRA 1G2MA 1HJ9A 4X0WU 4BAHB 3P95A 2KAIA 1TNKA 2EA3A 4NZQA 2ZHQH 1C4V2 2ZFPH 1SGQE 3SJ8A 4Q2KA 5FAHA 2WPHS 4UFGH 2L74A 4GUXA 1EPTB 1DWEH 1QQ4A 3KYGA 1SVPA 4J2YB 1QURH 1HV7A 5G4BA 1QL9A 3SZNA 1FV9A 1DY8A 4MLFB 4O3TA 2KM0A 4X6OA 3ZZ7A
chains in the Genus database with same CATH topology
1C9PA 5DP6A 3RC6A 1C2FA 4CRBA 2P8OC 3TJVA 1CT4E 2A7CA 1MTWA 1ZJDA 3BEFB 3QDZB 1P3EA 3GOVB 2LPRA 3B8JA 1QB9A 4DURA 2CHAC 3QK1A 2D1JA 1YKTA 2WPMS 1FPHH 3KQBA 1AWHB 1A2CH 3UREA 1F7ZA 2CN0H 4MNXA 1XVOA 3LIWA 1BB0B 4RKOB 1NT1A 3PM3A 2XBYA 4KGAA 3U1JB 1OYTH 1HAVA 4X2YA 1CVWH 4X6MA 2TGPZ 1W12U 4RKJB 2FLBH 1N1LA 2ASUB 1QB1A 2FX6A 1DXPA 1KDQA 1SGRE 3RMMH 2P3UB 1CHGA 1TRNA 3SV6A 3A82A 1W3CA 1TRYA 3QUMP 4HI3A 4ISLA 5AHGH 1J9CH 2OP9A 1PPHE 1OKXA 1YCPK 4VGCC 2XNIA 2ZCHP 2HWLB 1TBRH 3HATH 1YCPM 1QNJA 1X7AC 1SMFE 2GVFA 1SQAA 1QHRB 1FJSA 4CRAA 3BG4C 1ZSJA 4D9RA 3GY4A 3PO1B 4FUGA 1KXEA 4BAQB 1TMBH 4DIHH 5EODA 4XBBA 2R0KA 4Y0YE 1ZHMA 4FU7A 1TABE 1UTQA 1D3TB 2F9UA 5FCKA 1IOEA 1H9HE 5A8ZA 2SGDE 1UTNA 3ZZ9A 3RXMA 1HAIH 3PROA 1C2IA 3SV9A 1GCDA 2XC5A 2GT8A 1C5PA 2AYWA 4ZAEA 2ZU5A 1NRSH 1PPBH 1CBWB 1O5DH 1JBUH 1TNHA 3SNAA 1BHXF 1JRSA 3LGIA 1ESAA 1E36B 3RMNH 1LHCH 1EB2A 3FP8E 4MDSA 1S82A 3RU4T 1SLUB 1RJXB 3UOPA 1S6HA 3TH3H 1C1SA 1SFQB 1D3DB 1KTSB 3PLPA 3A7TA 1QIXB 1CU1A 1TIOA 4CRFA 2CGAA 1XUFA 1ANCA 4ISIH 2FOFA 1GBAA 1TNJA 3Q76A 2EI7A 3RU4D 3BIUH 1O3OA 4CR5A 4X1PU 3SV2H 3P17H 3M3SA 4R8TB 1ID5H 2B5TB 2HGTH 5AFZH 1QL8A 1J15A 1N8OB 1WV7H 2R9PA 2J2UA 1O2OA 4ABEA 3F9EA 2XTTB 3GY2A 5A2MH 1DOJA 1LQEA 2Y81A 2ZU4A 4YO9A 1O2WA 4Y8ZA 2ESTE 3GY6A 3TIUA 3MWIU 1GI2A 3BTKE 3SU4A 5F8XA 1UK4A 2AS9A 1P10A 1BRBE 4HGCA 3SJIA 1H8IH 3D62A 2V3OH 1ZMLA 2LNCA 1HDTH 2F9OA 1ZZZA 2ZKSA 5GIBA 1EZXC 1LVYA 1VITF 2PW8H 3AASA 3PTBA 1RD3B 2QC2A 3ZVDA 4GPGA 4YLQH 3SHAH 3VPKA 2G81E 5K7RA 3OU0A 5SGAE 1THRH 3PYHA 5JBTA 4ZROA 4NIXA 1VCWA 5CE1A 3A8BA 3MO9A 3H5CB 3GYMA 1Z1IA 3TGJE 4CRDA 2NU2E 2UUJB 3EA9A 5J4QA 1XKAC 1GMHF 1GJ4H 1BUIA 2ZFRH 2A4OA 2BY6X 2ZHFH 1T8OA 4IMQA 1ELDE 4DIIH 4UE7H 1VGCC 1VCPA 1H9LB 3MNXA 3ZZ4A 4I32A 4YLUA 4UEHH 1S83A 2FOEA 2F9BH 2R2MB 2TRMA 1YC0A 3A81A 4B71A 3GCTG 1QBVH 2GGVB 2AMDA 2FI5E 1TGCA 3U9AH 1WSSH 2FYRA 4WWYA 4A1TA 1HJ8A 1NROH 1OWKA 2FYQA 1GHVH 2ZFQH 4B2AA 4OGYA 5EPYA 3BTHE 4ZHLU 1CQQA 1S85A 2GD4B 4H6TA 2QA9E 1TNIA 3M61U 4IC5A 5B6OA 1UTJA 2ZHDA 1BBRH 1PQ8A 1ZRKA 3TLOA 4TY7A 2HNTC 2QXGA 4K1TA 2WYJA 4DG4A 5JYIA 4D7FA 1SGEE 1BIOA 5J4SA 3BTFE 1GL1A 1T7CA 2BX3A 3G01A 2AGEX 4Y8XA 3RXJA 4BAKB 1AHTH 1O3FA 2FZZA 2VVCA 1EP5A 1LQDB 3GCOA 2BYAX 3UFAA 3M3TA 1O5FH 1P2NA 4X2XA 2UUKB 3FP6E 3BG4B 2FESH 1T8NA 3RXRA 2BHGA 4E7NA 2ZEBA 1OYQA 3UR9A 1W2KH 2F9NA 2O8TA 1EPTA 2ZTZA 1EB1H 1HJAC 2CXVA 3DUXH 2VINA 1RTFB 4IBLH 1GBBA 1O2YA 2YNBA 1JIRA 1P11E 1UK2A 2BDBA 2PV9B 2P3TB 1LMWB 3GY5A 1BQYA 2H5CA 2I6QA 2BZAA 2SGEE 4JZDH 4ABFA 4ABIA 1AKSB 1NRRH 4CRCA 1TBZH 5C20A 3M7TA 4WVPE 2BDHA 1FY3A 4AYYB 3PMHB 2FI3E 3MMGA 1JWTA 1FPCH 1ELGA 2HPPH 4O03A 1FNIA 3PWBA 2ZC9H 1ZRBA 1G3DA 1NESE 3URCA 5FBEA 1ABIH 2C8WB 6CHAB 4JYTA 1Z8GA 3NZIA 2FIRH 4F4OC 4AGKA 1KXAA 1GBIA 1LVMA 1AY6H 1BA8B 3UNRA 1FDPA 3PV4A 1E0FD 1NU9A 4PROA 4IS5A 2PTCE 1L2EA 2FMJA 2GP9B 1BITA 1VJ9U 1WUNH 3KHVA 1UVPA 2BZ6H 3PMAB 3QTVH 1A46H 5GCHF 4XDEA 5E2OA 4D8NA 4DJZB 1L1JA 1PPCE 5C5NA 2AEIH 3DA9B 3QTOH 1OP2A 3AVZA 1WAYB 4WMEA 1FY4A 2G00A 3SUFA 3TGKE 4R0IA 2F83A 3TITA 5DP9A 1GG6B 2H2ZA 3DHKH 1WQSA 4K8BA 1XUHA 1EPTC 1A5HA 1TONA 3F9FA 3BIVH 3R3GB 1J17T 1UK3A 4NIYA 2Y5FA 3SU3A 1MCVA 1PFXC 5TCAA 5AF9H 2ODQA 5EPNA 1HPGA 2QF0A 3MNCA 4X8TH 1A5GH 4CR9A 1ZGVA 3TNTA 1C4U2 1MZDA 4I33A 3ZVCA 1GI5A 1JOUB 2F9VA 4XBDA 1UHBB 3N7OA 4CH2B 2VIDA 1Y5AT 2B7DH 1KLTA 4K2YA 4NA9H 1O3PB 1OSSA 3ATIA 3RMLH 2ZPQA 3TH4H 1YYY1 2QIQA 1EJAA 1ANDA 4AGJA 2PGBB 1CSOE 1MCTA 1YPKH 3BTGE 4FUCA 3L33A 1WBGB 1J16A 1VGCB 1UVOA 4AORA 3MU8A 1OPHB 4B2BA 1V2MT 3KEEA 5LH8A 1O3DA 3LGUA 1AMHA 4U2WA 5I25A 2CMYA 4XFQA 4FUHA 7GCHF 1PPEE 3PMBB 1FXYA 1O36A 3S69A 1B0EA 4NGAH 2XWBI 1C5TA 1P06A 2FDAA 2AIQA 1K9OE 2ZO3H 3MFJA 2PUXB 1HRTH 3ITIA 3EYDA 1C1OA 1A0HB 3S9BA 1C5OH 4FUDA 1Z6EA 1P2KA 3P92A 2V0BA 1FY1A 5GWZA 4B2CA 2OXSA 1OS8A 5F03A 1G9IE 3P8NA 3TK6A 2J34A 2C3SA 2ZGJA 3GDUA 1TB6H 5EW2H 4OS7A 4B73A 2V6NA 1FQ3A 3QWCH 3OX7U 2ODPA 3SNCA 1MUEB 3SV7A 5EU8A 1KXCA 2Z6BD 2FO9A 2JH0D 3M36A 1NTPA 4NG9H 2UWLA 3O8CA 2A5AA 6GCHF 3S9CA 1CBWC 4A6LA 8KME2 7ESTE 1ZR0A 1MU8B 2VGCB 1SB1H 1GJAB 1FAXA 1HAXB 3DFLA 3QO6A 1CHOG 2O8WA 3MH4A 5AFYH 4A92A 1O2QA 1UCYH 1JRTA 2QYIA 3SO3A 1TFXA 2GTBA 3GY7A 2VVVA 1T8LA 3M7UA 4JZEH 1HAZB 1HJAB 3F9GA 5HMAA 1WTHD 2XWAA 1GBHA 1O2JA 1ZGIA 2QXJA 1P09A 1V2QT 1Y3XA 2ZFTA 3UOUA 5EQSA 1AO5A 1C2HA 1L4DA 1P05A 2AMQA 4AOQA 5CHAB 3GICB 2Z9IA 4K8YA 2GMTC 2Z3EA 3UR6A 1CA8B 2CF8H 3BTTE 2QV1A 1Z8IB 2G5VA 1DPOA 1GBFA 5BPEA 1FUJA 3EE0B 1N8OC 1G3EA 2FI4E 3A8DA 3PLBA 3CS7A 4HZHA 2ZPRA 1BMLA 2Z7FE 1CGHA 1TWXB 4D9QA 2GX4A 1T8MA 1SGYE 3O8RA 4UDWH 4ZXYH 2SGPE 2BD7A 1K1OA 1BTZA 1N6XA 1RGQA 3KNXA 4ZXXH 2UWPA 3FFGA 1F2SE 2BQWB 9LPRA 1UMAH 3RUOA 1OWDA 1HAYB 2A2XH 4CREA 4MPXA 1EAWA 1GJDB 5EXLA 3SU5A 4X6NA 3ZVAA 2PSYA 5DO4H 4K3JA 1DM4B 3TK9A 2WV5A 5FX5A 4Y7AA 1O2VA 3V7TA 2ZF0H 4H4FA 3RXQA 4IGDA 2FOHA 4ABBA 2VIPA 3F9HA 2EEKA 5GCHG 1TE0A 1QTFA 5JBAS 3AW0A 4ESTE 3S7KB 3OYPA 3Q3YA 1P0SH 4NIWA 1EATA 1IQNA 1AUJA 1ELCA 2FS9A 6LPRA 1ESBA 2XCFA 2YOLA 3GCTF 1EUFA 2XBXA 4NA7A 3R0FA 4IC6A 4OS6A 4BOHA 2Q6DA 1C5RA 1C5LH 1XMNB 2YNAA 5DP7A 1ZJKA 1G32B 3SI3H 1W0YH 3LDXH 2P94A 1NFXA 1AKSA 1ZPZA 1SL3A 4I8HA 1SPJA 4I8GA 2JH6D 2C90B 1FY5A 2ZPSA 2A4RA 3SGAE 3TK5A 2VIWA 4FUEA 1IQGA 4OS5A 1BDAA 1BRCE 2H6MA 1BTPA 3SGBE 4A1XA 1O2SA 2RDLA 3EA7A 3V12A 2VIVA 3MU1A 4X6PA 5C2ZA 3OTJE 1O2ZA 3AAUA 2ALVA 1GDNA 2ANMH 4ISOA 3STIA 5EG4A 1NU7B 1O38A 1NRQH 5C1YA 2ZHWH 1XM1A 1WYKA 1MTUA 5LGOA 4Y7BA 1BMMH 1Z71A 2A5IA 3SU1A 1TPOA 2SGAA 4ZHAA 1SGFA 1BCUH 4ZKRU 1ELEE 3RXBA 2IN2A 1C5MD 1V2ST 2V35A 1A0LA 2A4GA 3P70B 2G55A 1S84A 5LPFA 3GCHB 7GCHG 1D6WA 1IQIA 1C2KA 1AIXH 1GBCA 1GMDF 1BBRK 3ATMA 1PQ7A 2B9LA 5A0AE 1GI0A 1TGSZ 3U1IB 3ZZCA 1C1WH 4RN6A 3OY5U 1GPZA 1QL7A 2W26A 2VJ1A 4DY7B 1HXEH 1C1UH 4E7RG 2OQUA 1BOQA 1D4PB 1V6DA 3K2UA 3SUEA 4AFQA 4ABHA 5A8YA 1C2LA 1A1RA 3Q3KA 5E0JA 2GDDA 1GHZA 3A7WA 1MTSA 3UIRA 1W8BH 1TAWA 4MNYA 4F49A 1YLDA 3SQEE 1KY9A 1P03A 1MU6B 1KXBA 1UHBA 1QQUA 1DSTA 5EGMA 2WYGA 2OINA 1MD7A 1DWCH 2UUYA 4X8SH 4Y0ZE 4NIVA 6GCHG 2ZGHA 1FMGA 1LHDH 2JETB 5F8ZA 6CHAC 4DW2U 5EW1H 2G5NA 1SHYA 1P8VC 2PGQB 2VU8E 1ABJH 1F5RA 1SOZA 3RXHA 3NCLA 3QN7A 2FP7B 1O3MA 1MTVA 4LOYH 1A3BH 2CJIA 4X1RU 3RXIA 2GMTB 1WU1A 3BSQA 3HK6B 4AG1A 5GXPA 3S9AA 1W11U 3VXFH 2QGRA 3A85A 1BBRE 1DT2A 1KLJH 3CENA 4MTBA 1YPGH 1WQVH 1GBJA 1Y3VA 2P93A 4YT7H 1D3QB 2I6SA 1NC6A 5A0BA 2STAE 3BEUA 3GYLB 2AH4X 1GL0E 1ZOMA 1GG6C 1DDJA 4A1VA 1VZQH 1C5XB 2C93B 1GJ7B 3C1KA 2VWNA 3RXGA 1GJ5H 2IOTA 1SBWA 2R3YA 4AYVB 1V3XA 3LH1A 1TOMH 3MH6A 2XC4A 3ESTA 1GJ6A 1SOTA 3LC5A 4ZKNU 3MNBA 4BXSA 3M5LA 5E2PA 1Y59T 5FCRA 1O2HA 4GCHG 3ZYDA 4K5ZA 1V2TT 1P01A 1XUKA 1RTLA 2IJOB 1JIMA 3L3TA 7KMEH 1SHHB 2BM2A 2AERH 1SLVB 2J4IA 4KTUA 3ZVFA 4Y79A 1MTNB 1O2PA 3Q3XA 1GHWH 3UY9A 4X8VH 2QY0B 5DKMA 2G4UA 3B23B 4ABDA 3UNQA 2THFB 4LZ4B 1EQ9A 1MKXH 9ESTA 2OC8A 1GGDC 4Y71A 1J14A 2A32A 1TBQH 8ESTE 2FX4A 2WPIS 3LU9B 4ZUHA 1FONA 3A7XA 2D26C 2FXRA 4X2VA 3MH7A 5T6DA 5ABWA 3SQHE 4XOJA 3RMOH 1JMOH 2BVSH 2PFEA 3A84A 2BY9X 1SI5H 1QCPA 3BTEE 1YPHE 2AGGX 4AB9A 3P6ZB 3M35A 1DY9A 1DICA 2OCVB 1O5BB 1GVZA 3AW1A 1NN6A 1HXFH 3LH3A 4Q7XA 3A7ZA 1C2GA 1GJCB 4X1NU 3RXDA 5IDKA 3A7VA 1O3KA 3A83A 1DXWA 3M3VA 1ZSLA 1AQ7A 1OWIA 4OS2A 2BD2A 4CHAC 3E6PH 3SN8A 3K6YA 3KF2A 2ZG0H 3RM2H 1QJ7B 2CF9H 1HCGA 3KN2A 4NSYA 4O97A 4YOGA 2VB0A 2XC0A 1C1VH 2HNTF 5EQRA 1ARCA 4K69A 3SI4H 3SGQE 1W7XH 1TPPA 1W10U 4IN2A 1CHOF 4WJG2 1UVSH 5IYTA 2SNWA 4K60A 1UTMA 4O3UA 3RM0H 2BOKA 5L2ZH 2VIOA 3LOXA 3ZV8A 2F3CE 2VGCC 1W0ZU 2GCTB 2Y7XA 4KTCA 1P04A 5DGJA 1CO7E 1UTLM 1PYTD 1L1NA 1O37A 3RU4E 4A7IB 4KTSA 1K1NA 2P59A 4Q7ZA 3RXAA 2GV7A 2ZNKH 1E35B 2AFQB 5HYOA 2BDIA 6ESTA 1LPGB 1GMDG 2WPLS 2RA3A 4K1SA 1BMNH 3A8CA 2Q6FA 1G37A 5CHAC 5E0HA 1ESTA 1A7SA 1GJ9B 1MQ6A 1SG8B 4YOIA 1TX8A 5T3HA 2BQ6B 3EGKH 1Y5UT 3UUZA 1NFYA 5C67A 1QRXA 4MPVA 5BRRE 2W7SA 1GHAF 2C4FH 1D6RA 1UCYK 1Y3UA 5GJ4B 4NWKA 5FHTA 1BHXB 1PPZA 4DGJA 1CE5A