3SBPA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 168
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbpA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbpA01
1GY2A 1NWPA 3P4FA 1K32A 2CO0C 5IGQA 3DM0A 4UI9R 1JZEA 3IIWA 5CXBA 1MG2A 3WKQA 2I3TA 1OCRB 1A3ZA 3ERXA 2AGZA 3E0CA 1W8EA 3PSLA 4YVDA 2DYRB 2O9KA 1HAUA 2Z2OA 5TF2A 4Q8BA 5AJAA 3IKOA 3KRXB 4PCYA 1X9RA 2H5UA 1GR7A 1PMYA 1B3IA 3CVDA 4CY3A 5CXCB 2XXFA 2DWTA 2XXGA 3OMNB 5I6NA 1GS6X 2EIKB 1JXFA 4ZK8A 4KO6A 4PXWA 2AGWA 4E9TA 1MG2C 4L9OA 4PC0A 4ERQA 4GXFA 2FNWA 3EMHA 5FXYA 2J55A 3I7HA 2EIJB 4H5JA 1GY1A 2HRGA 4PAZA 3EF4A 4YSRA 1I53A 4A0AB 3SN6B 3C99A 5F7AA 3PLYA 1XKSA 3MKQA 2XYIA 3V9CA 3FPYA 1OMWB 2AGLA 2UZXB 2AH1A 4X3EA 2EIMB 2VM3A 3CIKB 3CDZB 1V54B 1AS6A 2CBPA 2QDWA 1A0RB 2E86A 1E30A 1GSKA 5B1AB 1XB6A 3NJKA 3ZBMA 3UAAA 7PCYA 1JZJA 4HZ1A 3FU7A 1P22A 3EI4A 1WA2X 4A11B 5JWZA 2HJ4A 4CSPA 2R7EA 1B9YA 4GM8A 4BUJC 1AZNA 1CURA 3I7PA 1M9WA 2XU9A 3FGBA 2TSBA 4FHLA 1KGYE 4GP4B 1ASPA 2X87A 5I5IA 1X9UA 1ZV2A 4A7JA 2N0MA 2J57G 4J79A 3JB9L 5GXHA 1PZAA 4DP4X 1EZLA 1PLCA 2P9IC 4RH4A 3EU7A 4HDJA 3V9EA 1JXGA 2DWSA 4HAKA 3T6WA 2GC7A 2VMJA 4GY4A 4L1QD 4O9DA 2YXVA 5K19A 1SHYB 1JJUB 1RI6A 1SQ9A 3UVMA 3VA6A 1XMEB 4BDVB 2H9LA 1SFHA 3PAZA 5EMKB 3SCYA 4A2HA 2GSMB 3NVNA 4A2MA 5EM2B 2AANA 4AI7A 1SQJA 1ET8A 2IDSA 2IURA 3S3BB 3SBQA 4MFHA 2YMUA 4E9RA 4PSXB 5FKSA 2BBKH 1OF0A 2B5LA 2I85A 1AIZA 3GDCA 2YAQA 3CVBA 1HAWA 4A67A 1L0QA 2GNQA 2HXCA 5E9NA 4G56B 4GM3A 2OK6A 2W18A 4LG8A 4YSPA 5A2Qg 3AL8A 2FWLB 1L9PA 3T71A 3SXTD 2FT6A 3SHFA 2XV2A 4A0BB 2PM9A 5THAA 1YFQA 4A08B 2IWKA 1CUOA 2H9NA 3AG2B 4ZOXA 3K27A 1ILSA 1NIDA 2Y69B 1AQ8A 3PCYA 4P5RA 3NJJA 3NJLA 4YVUA 3CFVA 4ERZA 3FSWA 1JMXB 3CVCA 4HIPA 1RZQA 1S4UX 3UKRC 3SFZA 5GXIA 3X1NA 3NVXA 2Z2NA 1BXAA 2PPFA 1A4AA 5D4JA 3IJ1A 1WS8A 3FYEB 1AZUA 1WAEA 4YSDA 4CI1A 4J73A 4DP7X 4DPBX 3UADA 1J5CA 3OL2A 3N55A 3NJGA 2PBIB 4ENZA 4YSSA 2OJYA 2IDQA 4YSTA 1KBWA 4O1QD 2XYBA 4Z8LA 1ETJA 1KYAA 4WKXA 3X1GA 3SBRA 2H9PA 3FM0A 2XV0A 2ZXWB 3AH8B 3IN2A 2BO0A 3KW8A 4GQ1A 2AZUA 1ERJA 4J8GA 5FA5B 2XX1A 4HHWA 1ZIAA 4G70B 2YNOA 1ZDSA 2Q5BA 5TEFA 2EILB 4WTQA 3AW5A 5B1KA 4DP8X 1BYOA 1U4CA 1MDAH 6PAZA 3EI3B 3FRXA 3MZLA 3NVQA 4J81A 2IUPA 4ERYA 1JMZB 5HQGA 3D12B 5LDUA 3NSDA 2DV6A 2B08A 3OD3A 2MTAH 5C2VB 4KNSA 3MX0B 2IH8A 3RFHA 4YVNA 1VYHC 5CYKA 1JZFA 1B9XA 4QKTA 4XYIA 1JOIA 1GS7A 2G9AA 2OVRB 3RFGA 1A65A 3I89A 2FQDA 3L4MD 4J86A 3FQ2A 3I7NA 5IC7A 1TKWA 2CO0A 2JFCA 2G99A 3NT0A 4M3HA 1N6FA 2AQ5A 1OCZB 2JXMA 1NR0A 3NSCA 2EINB 2YARA 4Y5RD 2PP8A 2IH9A 3JZNA 4YSEA 1A4CA 5ANHA 4M4RB 2H68A 4FA1D 2PPEA 1MG3C 4E9SA 3GREA 1IUZA 1ADWA 3V9FA 2AH0A 4ZOVA 4W9ZA 5C9ZB 1MZYA 4DP2X 9PCYA 1AS7A 5FLXg 5FC9A 1AG6A 4L3HD 3OM3B 3EH4B 1BQRA 4A2FA 4NB7A 2J56H 1ZDQA 1WS7A 1PEVA 3QJRB 1TYQC 2P9KC 1M56B 3C75A 1SHWA 4NAJA 3V7DB 3EI1A 4E54A 1E5YA 1FFTB 2HX7A 1M57B 3ABGA 3NJHA 4KNUA 5I6KA 1GP2B 1PI6A 4EWRA 1IBYA 2CJ3A 2YAOA 4JD2C 1R1CA 4JKNA 1NIEA 4HCFA 3T6VA 1FA4A 2UZYB 3IJ0A 5EMJB 2PPCA 3ULEC 2MRYA 1L9OA 2WO2B 3K26A 4CC9A 5B4WA 1FWXA 2UXFA 2YXWA 4QLWA 2HX9A 1E67A 2QPEB 4O3UB 2YAHA 3MXXA 4OZUA 2XL2A 4A2GA 1A4BA 2UXTA 2B5MA 3JZGA 5CXCA 5EAMA 4KNTA 5IT9g 1NIAA 2OIZA 1GG2B 4ZOZA 3SVWD 2I0SA 1AAJA 3PAVA 1JVLA 3PE7A 4FAVD 4X63B 2ZWNA 3AG4B 1TEFA 4DP0X 2I0RA 1KV7A 3HEIB 3F3PA 5GSAA 2B4EA 1ET7A 5B7EA 3MBWB 2XUWA 4A0AA 4OWRA 4JHVA 3WI9A 1GYCA 2PPDA 3S8GB 4GMBA 2FQGA 4GYBA 3CDZA 3UVKA 3MMYA 5IGOA 3JT2A 4BL0A 3VH0A 2BHFA 3FQYA 5I6PA 4GM9A 4A2DA 5B1JA 4YL4A 4A11A 4J84A 1AZCA 3EI4B 4N14A 1QLEB 2P80D 2PLTA 3NJFA 3U4YA 4GP5B 2EBSA 5TEEA 1J9RA 2R7EB 2H9MA 4HCGA 4EF3A 4Q89A 4A09B 2YAPA 1SF5A 3EI2B 2Q7QA 3FSVA 3FU8A 3QJQB 1URIA 2WO3B 4KO7A 4HCIA 4G72B 3TBCA 4A68A 3F3GA 2OVQB 3RN0D 1PGUA 5AMSA 4A2EA 5B1JC 5AFU3 1SHXA 1J9TA 2DYSB 4A2LA 2BZ7A 1KDIA 3ZWLB 5IJ7E 1OE1A 2BWIA 4DP5X 4NSXA 4AX3A 3JAMg 4J78A 2VW4A 3S3DB 2CUAA 1AZBA 3NSYA 3X1FA 1AR1B 3DWLC 1L9SA 1GOTB 2P80A 4FAND 4JSNC 4BDVA 5EM2A 2VM4A 4KOCA 1OE3A 3EG6A 3UKUC 3RN1D 4G7SB 3FSZA 2YAFA 1UATA 2QPDB 3JROA 5PCYA 4ES0A 1NEXB 1TU2A 1ET5A 3F3FA 3KW7A 4DP9X 3DSMA 4G7QB 3OKYB 4J82A 1HFUA 1NWOA 1WA0X 2PCYA 2YAEA 4DPCX 4E9QA 2VN3A 3WG7B 3A0FA 1GXRA 3SJLD 5FQDA 2XLLA 1TEGA 4CY5A 4E5ZB 4AKOA 4A0BA 1E65A 2CN2A 1SDDB 2XU7A 1SJMA 3TASA 7PAZA 3DXMC 4A08A 5B3SB 5FKTA 2FJSA 3FPXA 4AZUA 3WKPA 2FT7A 2HJBA 4J0XA 5AZUA 4J77A 2IDTA 3RLMD 1NPNA 5FKRA 4HHGA 3FS9A 4UANA 3WNJA 5H14A 3ASOB 3ZIYA 4ESGA 3UGEA 3S8FB 1VLXA 1BYPA 1Q47A 1SF3A 4CY2A 3EH5B 4U1EI 4O3TB 1U2VC 4E9WA 3EHBB 2J55H 3FSAA 3JPXA 5F7BA 5EMMB 3FQ1A 2QXVA 4J0WA 3I7OA 5HYNB 4K9JA 5I6LA 4JSVC 1V55B 1CC3A 4QRJA 2BP0B 3T6ZA 4NERA 5HE3B 4CZVA 4FWWA 2VW7A 3IE9A 6PCYA 1AACA 2AZAA 1OCOB 1PNCA 3OMAB 4A66A 3AG3B 2OK4A 5EALA 3JRPA 1CYWA 2BP8B 4H5IA 2HYEA 1PAZA 1MG3A 4YSOA 2PP9A 4JSPC 3EI3A 5IJ8E 5I5MA 4YSAA 3FU9A 1L9QA 1OOWA 1DYZA 1BXUA 1JZGA 1RZPA 4F2EA 1AS8A 3UR4A 2TSAA 1NICA 1PZCA 2BWDA 3UAEA 1GW0A 3C5MA 3T6XA 3BQVA 5I28A 4LG9A 3NJMA 3JZHA 2OV0A 4CY1A 2IDFA 2PCFA 2XX0A 4XYHA 1SNRA 4ZOYA 2BW5A 3FT0A 3SWSD 2P9SC 4CI3A 3QQXA 2QT6A 2H6KA 2TRCB 2BZCA 1N70A 3H4HA 1R5MA 3OKWA 4PSWB 5A7EA 4X61B 1BAWA 1IC0A 5D4IA 4AOWA 5AFAA 3SMRA 1DZ0A 5D4HA 3TA4D 5SXMA 2OJ1A 1GS8A 3PVUB 1NDTA 2XL3A 3QJVB 5I6MA 2W8CA 1KDJA 4W1TA 1N6DA 4BH6A 3ODTA 2HESX 3QPKA 2P9PC 1OLZA 4QQEA 3AZUA 3OQRA 4L0PB 1ZPUA 5IY5B 5I6OA 2H6QA 2OVPB 3UVNA 3W15A 3PXTD 3I7KA 3PSCB 2CNXA 3I8CA 3J81g 2XV3A 3IBOA 4ZN4A 3SBPA 1L9TA 2YBAA 4G71B 2YNNA 2H47A 3OKTA 5CXBB 5EARA 4BWUA 2J57A 1BXVA 2CAKA 2I7SA 2GI0A 3GXUB 4TXVB 2CE9A 5B7FA 4AEZA 4PNKB 2VW6A 4G7RB 3X2QB 3OW8A 1RKRA 4KOBA 3JTBA 4DP6X 3EI1B 5AKRA 3V5WB 4JXMA 4CI2A 3L45A 1PBYB 1XHMA 4GGAA 4FA9D 1ID2A 3PXWD 2HLEB 4CZXA 2A3TA 2UX7A 4LGNA 1NZRA 1OV8A 4XEIC 4BXSV 2IAAC 3GYRA 4J8BA 1N6EA 2H47C 2GBAA 1NPJA 2GC4C 4GQ2P 2CE8A 4U7AA 2UXVA 5EHFA 2QC5A 3DIVA 3L4OD 4UAHA 4FA7B 2FTAA 3X1EA 2H6NA 3MKSB 5K1CC 3H56A 4GZ8A 5FKQA 4KO5A 1PCSA 3NSFA 3H4FA 3T9WA 4L3GD 1F56A 1TBGA 2FQEA 5TDHB 3N0EA 1KBVA 3NP4A 1QNIA 1MDAA 4BWTA 1K8KC 2FT8A 3FU7B 4I79A 2I7OA 1ASOA 1NIFA 4CI8A 1QHQA 3AY2A 2HX8A 2I0TA 2MTAA 2FQFA 1NTDA 4F7KA 3UVLA 1EHKB 2AGYA 3PPSA 3AL9A 2AFNA 3PXSD 4JSXC 1W6WA 2HKMA 3ABKB 2P9LC 2P9NC 1IKOP 1T5KA 2JKWA 4BK5C 2BCJB 2QDVA 4A09A 3EI2A 4DP1X 4GP8B 2PM6B 1OE2A 3UACA 1SFDA 1JZHA 2PP7A 5H1MA 4PBZA 1PF3A 1PZBA 1AOZA 2DY2A 3N2JA 2YQBA 1JOFA 1OCCB 3ZDWA 2J5WA 5HE0B 4FAAB 4D6VA 3MZKA 3IEAA 3TBBA 4QT8A 5GMKn 2IUQA 5B1BB 5PAZA 1MZZA 5TK4A 2Y1AA 2IWFA 3IN0A 3NP3A 2HZHA 4AKPA 2Q9OA 3OMIB 4UF7C 3N0DA 2XVBA 3NJNA 2J56A 3AL8B 4E9VA 3ORVD 1CYXA 1AANA 2GIMA 2H13A 3OKYA 2PM9B 3EH3B 3HB3B 1WA1X 2XWZA 1JERA 2B3IA 4X60B 3IIYA 4GGCA 2CALA 4MK0B 3ABMB 4JT5C 3EWEA 4FA4D 3ZX1A 2VSMB 2GC7C 3QJTB 3WNIA 3C75H 4K3JB 1A8ZA 5C2WB 2ZOOA 3PXLA 4AKQA 4E5ZA 1ZIBA 3GFCA 2CN3A 1SDDA 1W6LA 4J87A 4CZYA 4E9YA 1RCYA 3U25A 1KCWA 2BW4A 4BWWA 1XIPA 3I7LA 4P5SA 3OTTA 3DKHA 4D0KA 4X4KA 3RRMC 2YB8B 3RYMA 3X1BA 5EAPA 2NRDA 2AVFA 2I3SA 3BG0A 4TZ4A 3C9CA 1PLAA 3BVDB 3HFQA 1BQKA 2HRHA 2ZONA 3NYKA 3I2NA 3OL2B 3PVWB 1J9SA 3AFCA 2W88A 3RMZD 2Z2PA 1E5ZA 3G5WA 1JZIA 3CZUB 4KO9A 3J80g 2UX6A 3CG8A 3FYIB 4E9XA 3AG1B 4IA9A 2PPAA 3ABLB 4BXVA 4FB1D 3KRWB 2VSKB 1L9RA 2UXGA 3I8EA 4CSZA 1JVOA 3B7FA 4GQBB 4PBYA 3SLED 5KDOB 4HALA 3UABA 2BP0A 3S3CB 3SQRA 3IJCA 4JT6C 4JHUA 5TK2A 4DPAX 2P9UC 2HKRA 1KCBA 1PY0A 2BP8A 2CCWA 2GB2A 1N68A 2H3XA 1BEXA 1J5DA 5CYKB 1BQ5A 4Y7RA 5H17A 3VGZA 2H14A 2PM7B 3BG1A 2OCCB 2YAMA 5B7MA 2IUVA 1NINA 2IWEA 3UVOA 1AG0A 4YSCA 2X88A 3ASNB 3BWSA 4F2FA 1AZRA 1ASQA 1PNDA 1PLBA 3PAUA 3TU6A 2YNPA 2IDUA 3DXKC 1XB3A 1IBZA 4GGDA 4R7AB 2H3XC 5HE2B 3NJIA 2RACA 1J9QA 5EMLB 4N8UA 2LLNA 4K3ID 4YSUA 8PAZA 4QL1A 4IMMA 5HE1B 1ILUA 4KFMB 4O45A 3RSEC 4FA5D 2HXAA 5I26A 3QJUB 3QJSB 2WSDA 2B5NA 2IAAA 4N4YB 2GHZA 2GC4A 4YSQA 1V10A 1YLBB 1XB8A 3WIAA 3DTUB 1NIBA 1JXDA 3CFSB 2AGXA 5I5JA 4E54B
chains in the Genus database with same CATH superfamily
1L0PA 2VE6B 1NCUA 3H42H 5TDNB 3WJMB 1JZEA 1UFGA 1VACA 4V1DB 5CXBA 5C70A 2BVEA 2DYRB 4WKZB 3NFPA 3L4YA 1DN2A 2E76C 3ARDA 4R5VA 1PBYA 4PCYA 4YDKH 1PMYA 4IKIA 3ARBD 3GRWH 3VFVA 2R1YB 2QBWA 3HHSA 1GS6X 3K5RA 3KPLA 1U2YA 1W80A 4KO6A 5AD0B 1Z9NA 4G8GB 4KRPC 4RMBA 3H9YA 4QXGL 5F2FA 4GKZB 4RFEA 1RV6X 4N1EA 4ECNA 3VAEA 1H3GA 2CLVB 1QSZA 4LKXB 3S9DB 5I0XA 1UASA 3CFKA 5IG7B 3IFNL 4NC2B 4U1MA 1AI1L 1WBYA 3ESNA 5IVXB 1XB6A 3NJKA 1BEYH 1W91A 2BS71 2NW2A 1F4WL 4RRPG 3VFUB 4F2MB 2HJ4A 3ZDXF 5JDSA 3SE8L 4ZZKA 3CSGA 3N9GL 1JWUA 2XWDA 5BV7C 1TITA 2J8UF 5ALCH 1X9UA 3VWKC 4PJFF 1RPQA 2J25A 2DF3A 2N0MA 5AOLA 2IXQA 5CLXA 4OQTL 2AABH 2RMNA 3U4AA 1TZIA 2AK4E 2VAAA 3CPUA 2EE9A 3FQXA 4JKPL 3WOVA 5AG8A 3B8SA 1ZOXA 1U8NB 2VMJA 3NIDA 5GHWH 5T1MB 3IFLH 1N6QH 4ZMYA 4TF4A 4FQHB 4QRRE 3NSXA 2N59A 3LQAL 1RIHH 3U1PA 4HS6A 1EDYA 4NQSB 5E4IA 5DTFB 5BVJA 4F80A 1LD9B 2OMYB 1QI5A 2K4AA 4E9RA 1OF0A 4YHMH 3SDAB 1LE5A 4TVSa 3GB7B 3PHOB 3TN0C 5CIPB 1H19A 2BOCA 2BSEA 1AO7B 2XV2A 1FH5H 4Y2NA 2WKOF 4A08B 5BRZE 2ADFL 2RFXB 2VC2H 4ZMPA 4NRYB 5A2IH 3QIBA 4LDLB 1LDSA 2FBJH 5D71H 3WGVB 5E6UA 1L6XA 4QRUA 2OK0H 2V4LA 1MDTA 4U3SB 1Z3RA 2F9BT 3HVDA 2YMXL 4JR9H 1GRWA 2WUCH 2XWBA 5FK9B 1AZZC 3QEUB 3GS0A 5D4JA 43CAB 3FYEB 5MI0C 1ZLUK 4GW5A 1U8JB 1E8ZA 3RVXC 4J73A 4DPBX 3P4MA 4PJXA 3MKGA 3QWRD 2QZQA 1X9LA 5M61A 3L7FA 4JFXB 4R4FH 4MA1B 5I15H 2JCWA 3QIWC 4XMZA 3DBXB 4RA0C 1GOGA 4GSDL 3MROB 4IYKA 4JRYB 4AM0B 1EJOH 4O2FB 3EFFA 1ZIAA 4G70B 5D6CB 1PKQA 4NDMB 1CYGA 5D1ZD 4U6YA 2XJKA 4PJAF 4PJ7F 3HAEG 3T0AA 3V5KA 2EIZA 3PWPD 3ZT7A 2J44A 1UHVA 1A7NH 2FVNA 3TS8A 3BKML 3BT2L 3OD3A 5CU9A 1U95A 1TETH 4ANWA 4WFED 3KYMA 4KHTH 4JHNA 5FUOL 3ASWA 2GJ6B 3RUGA 1KNOB 4NQDB 3VD5A 2EVIA 1KC5H 5HYJA 2NYZA 1F6LL 4OU3A 4PJDE 1DBBH 2JCCF 2I5YL 4HGKC 5CZXD 3NSCA 5K9QI 2H32H 4XCYB 3QFJA 1Z66A 5I1AB 4HX1A 4FA1D 2R23A 4FNLH 4XP4H 5A40E 2NNAA 1CGSH 5FO7B 4G3YL 1ZT7B 1USQA 4ZOVA 3RKDD 3IMBA 4W9ZA 4OF6A 4F7PB 5T5FA 4L3HD 2OZ4L 5GGRA 4DKTA 1S7SB 4QEGA 1YC7A 4JN2B 2B1OA 3WE6B 2EIBA 4DAGH 2AMUA 2Y5EA 4LPWA 1U6AL 1QO3A 3AQZA 1O6VA 3LS4L 3FRPB 5M5VA 1FHNA 2B4CH 3QI9C 5D2NA 3VFPB 3EYVA 3EJZD 4JCWA 3VFNB 4GNKB 5E9DD 3G6DL 2YXMA 3PGDB 1UT9A 1DDTA 4KWUA 5DURD 1E27A 3WIFB 4HV8B 4I0PA 4NM4L 2DQTH 2OIZA 3SGEI 3E7JA 4X50A 5EBWA 4J3OH 3VDBA 4ODSH 2YEZA 5JORB 4RIRB 5LBGA 5MENA 4F7EA 5GSAA 3B4NA 2B4EA 1AH1A 2ADJA 5D2LE 3RBSA 1A7PL 4IS6A 4UYQA 2Z7WA 3CDGB 2NZ1A 4KKCD 5FOJA 3Q43A 1HOCA 2DICA 4MXWL 3CDZA 3MFGB 5I76A 3MMYA 5GZNC 3QDJE 5IGOA 2CJUH 3CE1A 3TBWB 3GSOA 5ECGA 4Z0XA 5KYUA 2CA4A 3ZE2E 2OSXA 4F37K 1T66C 4GSXA 5AZEH 1XL6A 5FF6B 1WFUA 3HE6A 1GCFA 4Y5VB 2X44D 1DBML 2ZP8A 3BH9B 3TXAA 4ZW3A 3CFMA 1VFMA 3M07A 4XP9L 5FHBL 3RAJH 1KWKA 1VGEH 5KYYA 1PGUA 2NQCA 4L9DA 5FW8A 1MHEA 4TNWK 5DK0A 4B0MM 1DJGA 1AFVH 2H6OA 3O9WA 3EUUA 3FOMA 1KPUB 3AS2A 1H15A 4BDVA 2AC0A 3EG6A 5FLUA 3OZLA 2L4OA 3MJ9H 4GMSH 5DRWB 3WUZA 3PUUA 4K3ID 1EEYA 5L4JA 2CHXA 3SPHA 1IAII 4DKEL 2I9LB 1QW8A 4UOW1 4CADB 2XKNA 2R29H 2OP4L 2GAZA 4AMWA 3NIFF 1S9XB 3TOPA 3VDCA 1HWGB 2XPGB 4PJGF 3TVMC 4MQSB 2WUBL 2HT4C 3BGAA 3WKML 1QI4A 2FT7A 4RSVA 4J77A 4Y4FC 1RIVH 2WKLA 3O4OC 5DJDA 32C2B 3D7PA 4F9LA 1C8PA 1NFKA 1FVEB 1KTRL 3B2VH 4FFTA 1KIQA 3NCWA 2IGFH 4NOBA 2OSLB 4NPJA 3MRPB 1UA7A 2R0LH 1VEPA 2JNZA 1E4KA 2WYIA 1DN0A 1TZHB 4OGYL 3I6KA 9CGTA 4DUVA 1AIFA 2C9PA 3VSTA 4KGJA 3HE7D 3I7OA 1LILA 1NC2B 1CC3A 2QKIC 2X2UA 5E6RB 1AQDB 3NMEA 5E99H 3AG3B 1X4XA 4G8EA 2DIEA 1T3FA 2GITB 4PS4L 4MMXB 2E27H 3GIVA 4GS7C 5CCJA 1FBIL 2NCEA 4WFGE 4D0CA 1JZGA 4LLUB 4F2EA 5FGSA 3ZKXB 4J6IA 4WV1C 2D7MA 2VLMD 3FH7A 5TQ2H 4AQ1C 1T89C 4AZ8A 3EJUA 2EICA 1J5IA 5DJ8B 4X80L 3AUWB 2DQFA 3HRZB 4FULA 3S34H 2FEDD 5DMKA 4PJ8A 3T0BA 2BZCA 4K4KA 5AWNH 5GGTA 3HS0C 2Y7QB 3VGAB 4IGBC 1AP2A 4XXWC 5AFAA 4LRIA 2NY7H 1EEZB 3KYOA 1XH0A 5CZVH 3O6FC 1DE4A 4LAQL 1XCQA 3QJVB 1ROCA 3ORJA 3X14B 5ADPL 1N2RA 2HESX 1F1AA 2ITCB 4QQEA 1OLZA 1Q72H 3K2UH 5F7WC 1A6TA 1H3UA 2WP3T 2BSDA 3VCLB 4ZOCA 2NLJA 2XG4A 2XN9E 1UUSA 3LZPA 5HHNB 4IRZL 5JXED 5BO1L 1GGIL 3SQBA 3P73A 4BWUA 2CAKA 1QX1A 3LCYA 4AMKL 1HINL 2E9WA 4A7VA 2EDDA 4PJHA 4TULL 4HOZA 1I82A 3QUYA 5GZOA 2PF6A 5IJVA 3ESPA 4I0CC 2DRUA 1UM4L 2PXYD 5I0YA 3L9YA 3GBMH 1DANU 1AGEA 4NO3B 1QAWA 4P2OC 5F89B 5FXCH 4UDTB 4U7AA 1QFSA 4OLVL 2AK1L 4I77H 1MEXH 4WHYH 1LP9E 3EJPA 2AJZA 1OAXL 1L6ZA 1ZLSH 2VDNB 1NGXB 3B3IA 1MCSA 1MDAA 2FT8A 3IDUA 4X5RA 3PUCA 4H5SB 5TDOA 4AGLA 5IR1A 1JI2A 3GHBH 4JFDB 1ACZA 1JDCA 4G43B 3ZY7A 5LO7A 1LEGA 1TTGA 2V3DA 2B59B 4ODHL 1FH2A 4HUMB 1W0VA 3C5ZD 3CHRA 4KJQD 4EOWH 2DQIL 5B39G 3VJ6A 3G5ZA 3M1BA 4C8XA 2ZUSA 3OLGA 4XRCB 2O5YH 3K2IA 1T1YB 5LGKA 1OPGH 3GJEB 3QNZA 5ID0A 4XVSH 3W3BA 3E3QE 5LAPA 1U8OA 4DN4H 3QUZD 1MJ8L 2NDGA 2NTFA 4LHUA 3TPKA 3WELA 4GKSB 4ZNCD 1A9EA 3MZKA 3UCRA 2H41A 3QUHA 5L4MA 3IB4A 4UQ2B 4M7KL 3RIAF 2ZOKA 2Q9OA 4BD4A 5D7IB 3NJNA 4IIQC 1GOHA 5HDBE 1PX4A 4L1SA 4FYSA 4UNVA 2GIMA 4FABH 1G0XA 2IPUG 4LLWB 2M1KA 5E4EC 4CUCA 1FZJA 3G5XB 4FERA 3BSZL 3PXLA 1ZLVH 3MRJB 2YPLD 4X4YB 3O6LH 4IMKA 1W6LA 2QPSA 1HHHB 1VDGA 4OFIA 4OJAA 1PSKH 2J88L 1QASA 1LO0L 2O5NA 4HFUH 4OCYL 3BFOA 3SDCA 4KY2A 1N67A 3JYCA 2C4FU 2HJKA 3Q6GH 2ITEA 3NYKA 1ACXA 1ZK5A 5EO1B 1YHPA 5GS2D 3I2NA 1T80A 4UU9B 4GBXD 1GGCH 4FXTA 1UXMA 4XAKE 4NQVA 3B2UC 3ABLB 4LLYA 5E1AA 5FUCC 3UPRB 3KRWB 4Z8FL 3QIBC 4BHUA 1JVOA 5LNGA 3LPFA 2IOIA 4PGDB 5I71B 3FQWB 2Q6WB 1MH5B 1QFWL 1N12A 4LARH 2HTLC 1F97A 3UPCA 2P5EB 2EUWA 1SLUA 1QWNA 2C7UA 4R4ND 4X6EA 5IV2A 3PXHA 4ZX3A 1AR2A 1JPFA 2VSCA 4F2FA 5F0LB 4HW6A 4MJJA 3ILQD 4P46C 3DURB 4HGWA 1QPKA 4FA6A 2VXVL 4KXZI 4N8UA 1NBYA 5K59E 1T0NA 4QL1A 3WTUA 3Q8FA 4I87A 2EVJA 5DEGA 3V52H 2XI9A 1QTYT 5DU7A 5ICZA 2B5NA 1JRHH 1MQ8A 2VXUL 4I9XA 4Z7WF 4LIQH 4G8IA 1E2ZA 2V17H 1Z9LA 4GAYB 3CHPA 3KPPB 3L3DB 3P4FA 5EBMB 5HI3D 5HY9B 1P4IH 4RGND 4MD0B 2HLAA 3SIKA 2OXGA 4IK7A 1ZK9A 2WNGA 4QOKD 2ZXBA 5DVKA 5AYQA 3LIZL 5HYIA 2EVGA 4J5VA 3O3DB 5CD5D 5TF0A 4ZK8A 3C6EA 1UOPA 1MCRA 1SYSA 1SXBA 1TJGH 5BOZG 5D5MF 4DNVA 3KPMA 4L8SB 1QHPA 1Y6MR 1J0KA 1CLZL 1UQSB 4E9LA 4XCCH 4GEIA 1NCDL 3RL2B 2Y23A 4UIKH 1N9PA 4AQEB 5EZJB 1D9KA 4NNXA 4OVUA 5IBLD 4UDUB 1AS6A 1SUHA 3F12B 3FZUC 5D2NC 2HKRA 3UAAA 1J1XL 2IVFC 5EC2A 4OCSH 5DZJA 4PVNA 4W6XB 3P54A 3I7PA 2EDRA 2VWEC 2TSBA 3UAJC 1KGYE 1TJIL 3RWGA 5EEYA 1ASPA 1S9WB 2I60H 4Y1SA 2F5AH 2WWNA 4A7JA 1PZ3A 2V2WB 4QHMB 4G8AC 1BVKA 1QYGL 2NYKA 3RWFB 2VXTH 3ME0A 5K19A 1I8IA 2ZOLB 3MR9A 2XCMC 4NN7C 4DCQB 3KPQA 2E46A 3QXAA 5DQDH 5DR5L 4G7VL 4PG2A 5I1KL 2ZUYA 1KLGA 4P23B 3VI3A 4ZUUA 3GSWA 1OT2A 4AI7A 2IDSA 1OCWL 5SWZD 4P3DA 4YX2L 2WAHA 5DJ2B 2AQ3A 2WLJA 4OD1H 3HE6C 1DO6A 3ZT5A 4OGXL 3PWJB 3RVTD 4PJFA 4A67A 3I74A 3VH8G 3N40P 1U8IB 2F58H 3QQ3A 3V0WL 4OLYH 3QAZB 3A4AA 2FT6A 3I84A 2GCYA 3VFRA 4JVWA 4KKZA 3U4BH 2LLLA 3K27A 2WBXA 3SGJA 3O9WC 5EB9A 4MAYA 4M4PA 2NY5C 1ETZA 1C9SA 4Y2DD 1JGEA 2BOBB 2WWMD 3D30A 1UD4A 3QDGD 1YY9C 4C83B 3ZMRA 1IX2A 3IDMB 3FUNA 2RR3A 5TE7H 4IKJA 4DNLA 2WKOA 3FUMA 4QHLA 1HQ4A 3WXVH 3BKYL 3PWVB 5SWSB 4NZDA 3QZPA 3J7HA 4U1LB 2YD1A 3C2AH 4U1IA 5D7SH 1ERJA 1KTCA 1H2YA 4M6ML 5FM8A 1QVOB 1FG9C 1A4KA 3NVQA 3FNKA 6PAZA 3EI3B 3KPNA 3OJMB 4HLZG 2OMWA 3D12B 3HC0B 3FKUS 5ANMA 2VLLB 5DF0A 1B9XA 1RUQH 4QKTA 2FJUB 5E70A 4KROD 4XYIA 5TQ0H 1E4KC 4B0MB 2NY3C 1XGUA 1ZE3H 3PHAA 4UIMA 1CK0L 4KY1H 2G99A 2HU5A 4OIBA 4EN3A 1N6FA 2D31A 2G2NA 1SBSH 3F83A 4JL1A 1JK9A 2FBOJ 3WL9A 2IH9A 5BQDA 4ZD3L 1U58A 1KT2B 4PJ7A 4R2GD 3SYQA 3EOAA 4ZOEA 4KKPA 4NP9A 1EXHA 5FA4B 2DDQL 2ZWYA 3N40F 1U8LA 4PRIE 3HI1B 4A2FA 3U9PL 2ZWSA 5C0RL 2VUKA 3C8KB 3K74B 4XT1C 4APQD 3ULUF 3CVHB 4Z9KB 4PJ8C 2VDOB 3ZTJH 1MWAA 2VABA 1KB5A 3MV7B 5M5UA 1OGSA 4HP5A 3DJTA 1FFRA 1NA8A 4ZMTA 2DQJH 4O3UB 4NKDB 3IDGB 1CE6A 1JD7A 1OAUH 4DVBA 2RHEA 4PJ9D 5IT9g 5CP7A 1GG2B 1HI6A 4JPWL 3CMOL 2ED7A 1JVLA 4J6RL 4M03A 4OAWB 3RB5A 1DVQA 1CICD 2VMDA 1CWVA 4L4TA 2BKLA 1EO7A 1G7LA 1IAMA 1AGBB 3CC5A 2LU5A 3L1FA 3WSQL 3GEFA 2Y5QA 3O2WH 3QUYC 5FYJH 3UIZA 1SN5A 2YHGA 2F5BL 4UQ3B 3QEQA 5GZOC 4GYBA 2BNRB 5IHZA 3CD4A 1YYMH 1DQIA 5FV2A 3UBXG 4BL0A 2Z91B 5FOBB 2AK4B 1YEDA 2CLZA 2XZQH 4I7ZC 3BUQA 4MBOA 4JG1L 1MFAH 4IRJA 5GSVA 5EU4B 3RY4A 2Y07L 2FEEL 4D7PA 2LAGB 2YWYA 4HEPA 1KXVC 4EF3A 1VFUA 3K71A 1MCOL 1JPEA 4QRRB 1EIBA 2VL5A 1URIA 4FXGA 4JM2D 4LB8A 5IW1A 4LEEA 4Z7UF 1D5XB 3W2DH 4GXUN 1KGCD 3B37A 1KDIA 5KZCB 4BE5A 3LTVA 3D69B 1Z7JA 5CEZD 2IQ9H 2HRPH 1RUMH 3ZPDA 2GTWB 3HAEB 5DDHB 4XPFL 3HI6H 4PJBA 4G7SB 4UT6L 1FP5A 1KFAL 2YAFA 3FSZA 4KJYA 5BRZB 5EBGA 5HHPA 3OKYB 5F9JA 3KW7A 1JFQH 3DSMA 3K1KC 3O4LE 1DBAL 3QORB 3CBKB 1YAZA 3WEMA 5FO8B 2W92A 3TESA 4G1MB 5EIVA 5E08L 4A0BA 2QADB 4Y4KB 3RDTC 1JV2A 1YNTF 3I6LD 5K9KB 4ZPTA 3BJLA 4WFHE 3WKPA 3ZE0E 5E1IA 1JFHA 3RI5K 3LZRA 3NDYE 4XXDB 1WIPA 2Z93B 3WEOA 4AJYV 5JIIA 1V3JA 2W9EH 5EU3A 2GIYA 1C12B 2CIKA 3IMVA 3MV8D 3X12B 3W82A 5DS8A 4AN1A 3DPBA 4I18A 1AQKL 2DIJA 3QNYB 3WIHA 3U7YH 1R5IB 3FSAA 4V33A 3UJIH 1TJHH 3ARGD 4AEFA 3BPNC 3T0EE 3GRWL 5AVVB 4HS8H 4Y1TA 3DXAA 1UT2A 1XF2B 4IMKC 1V55B 4BSVA 4N14A 3IJ8A 2AZAA 4XCEA 1MOEA 1CYWA 2Q76A 2ZUTA 5DRXA 1LYQA 3VTAA 3HR5A 5DJYB 3ROOB 2YSSB 4YHYB 2P8MB 1ZGLA 4JFFE 1T4WA 1CFTA 2WWOA 4KZCA 4PJDB 3EFDL 3PQYA 3T6XA 5I28A 1HT6A 1AYOA 1BD2A 1YG9A 5E00B 1DQDH 2GFBA 3KPRA 5C0BD 2MTPA 4WNSA 5KN5B 2YUVA 3EHBC 4LCWD 3F6JA 2BW5A 2F7RA 1FVCA 3CMGA 3SWSD 4CI3A 3DUSA 4XNZC 4OSUH 4N0CC 1F4YL 3CNKA 4KFMA 1NM4A 3WO3B 3L95B 3HZMA 4FI6A 5BZWB 4FL4C 1IGMH 2AABL 3D50A 4GSQA 5EOCH 2AQQA 3ZDYF 1N6DA 2DN7A 3QPKA 5DUPL 1ONQB 3IFLL 2FZ3B 1U3HA 3ZRFC 2QQLH 2ICWB 2K45A 3O8XA 1DANT 1HEHC 4FQQB 3LHPH 4TXVB 1G1CA 2I7SA 5DRZB 5B7FA 1IGCH 4YDNA 4P2RB 1IFRA 4BSJA 5FUZH 3KLQA 2UY7A 1NLBL 1NUGA 1QFPA 2VDRB 3FO1B 3SOTA 4IM8A 5KSBA 3V5WB 2ARJA 3CIQA 5LBVA 2LGNA 2WXOA 4TTDD 5C7ZA 4CU6A 1HHKB 2AV1A 1JUFB 2IGLA 1FH5L 1RUKH 1YNKH 2Z3FA 3FFCD 4ZMOA 4XWOC 1FVDA 1KCVH 3DVIA 4HXBL 3DGDA 2VYRE 5HI4D 5EHFA 4AEIL 1FDLH 2QC5A 1N5YL 4GUOA 2R4RL 1UOOA 3OAZH 4X7CC 1Q94A 3H56A 1IGFH 2OTWB 3GXNA 5BZXA 4JFYA 5CM1A 4I2XA 1N3NA 1P1VA 2QFPA 3QQ4A 3UBXI 3ZE2B 5EFIB 5FV1L 3JZYA 4Z7NA 5DJXA 1KBVA 4Z7VE 3DX9A 2C1OB 3JTTB 4DO5A 4CI8A 1YYCA 3UVLA 2UY6B 2ZQKA 2BERA 2P4AB 5CJXA 3BPCA 1FO0B 3AL9A 1ODAA 4EZJA 5IEKA 1JWMA 4HZAA 3ZKQD 2P9NC 1T21A 4LEXH 3MGTA 1P2CB 4BH8B 3TA3B 4R7NA 4H13C 3WNMA 3UG3A 4L1MA 2BFGA 3EI2A 4PBZA 1FZOB 1D9KC 1OTUC 1QLFA 5FKAB 4YGVB 1X9QA 3EJJX 5KVGL 1IQDA 4NO0B 3CFDA 12E8H 3NPSC 3SKNB 4PRHE 5ICXA 5HHQB 5PAZA 1NEZA 2W5PA 4BINA 1UB5A 2Q8BH 4QRPA 3UBHA 4N9OB 4HIHA 1H8OA 1FFOB 4L48A 4Y9GA 1VADA 2Q2EB 4WEBH 1I3UA 1YPZF 2J56A 2NSQA 5EG6C 4BZ1A 1G9MH 3ARUA 4AMXA 3CWGA 4FNLL 1N5AA 4IJ3C 1CGSL 2VXQL 4MK0B 4OZGF 2WSPA 4MA8H 4KX8A 3I9IA 5H35A 2HFGH 3JWDH 3CH1B 4WJG3 2J12B 5D9SB 4R0LB 4KTDL 2CN3A 3AU1A 4ZBJA 3GWJA 1CVRA 5EORL 1A6AA 1QUNB 3DETC 1ZTMA 2DH2A 1T7WA 4HETA 4JY4B 4UQEA 1ZT4B 3CZGA 2NRDA 4DAGL 3GK8L 4X6CF 3BG0A 2NY5L 3PVWB 3Q8CA 4J27A 3E6FA 1M7DB 1MXGA 1EV2E 5BV7H 2I69A 2WYTA 3MRLA 2JIXD 1TDQA 2CMRH 3P4OA 1I31A 3F00A 3TEWA 4MAYC 4JDEB 5G55A 3T4YB 4Z5RB 1KYOJ 1II4E 2HT2C 4UUJB 4I4WB 4QTIL 4WTXA 3SYPA 1KCBA 1UXSA 2VDMA 4JPKH 4QF1A 4MD4A 3F85A 5F7FA 2H3XA 3KWVA 1BQ5A 4Y7RA 1E42A 4KMLB 1EERB 3L9RB 5TH2A 5HDRA 3GI8L 3TH4T 1X7QA 5F3BA 3KLKA 2NSMA 4AW4A 2FO4B 3T0DA 3LKRB 3RY6A 1R34A 1J9QA 2IDCA 3BC9A 2AQRA 3QHZL 2ROXA 43C9A 2HFFB 1MQKL 4FJ6A 2XN9B 5GGVH 1ILUA 1F58H 4OZHE 3RAJL 2HXAA 1I8UA 3FTVA 3QO1A 5I26A 4NC4A 2DJSA 3PV7A 4ESKA 4CMHB 5LAXB 3KVDD 5JPNB 4ELMF 1ZLVK 1BZDA 3LNFA 3CLFH 3QZWA 2HJLB 5CO1A 1NCAH 5AOMA 5EIIG 5C2UB 3GF8A 2PW1B 2HJFB 1GY2A 5B39B 5I17B 1YEKL 4EN3C 4D0BA 2Z31C 4JFPA 1YECL 2P26A 5BNXD 1DSFH 3S36L 3QZOA 3ERXA 4A7GF 5T33L 1FIEA 2VJ8A 3K8KA 4PLNC 1HAUA 1P6AB 2Z2OA 5JXEA 2GK0A 5DD0H 1DBJL 5B22A 2R29L 3B34A 3INUL 1LP9B 1NSNH 4QRBA 2D2OA 5GS1B 2VDPA 3TZVA 4ZUWA 3OZ9L 4KZEL 1VESA 1QFWM 4KTGA 1UZ8B 1RIVL 1DVFB 1GY1A 2DBLH 3MNZB 3PL6D 3QIUB 3GKWL 4MJIB 5CJOH 4TTGA 1TENA 3NEOA 3WFCL 4QI3A 5ACZB 3L4XA 1WF5A 2W95A 1XKSA 3C99A 2OMVB 3FPYA 4IEFB 4OCMC 2Y2WA 4N1CA 2DYPD 1THCA 5B1AB 4N2GA 4HIIA 2OMXA 2A4CA 1Q90A 1SUJA 1Z1WA 3CUPB 3RNQA 4NUGH 3SGDI 1HSAA 2YJLA 2UWEE 4G6FB 4TSAL 5HXMA 2ZX5A 1JHTB 2Q7NA 4FI7A 2ADGB 5C9KA 4MDJB 2OR9H 1MCLA 1R24A 1IEAB 3ARBC 2QQNL 3DOIA 5G4OA 4N2MA 2W38A 1AGDA 2GKIA 5IM7B 5I5RA 1JD9A 3B6SB 5FB8A 1GYVA 1TOXA 4B3EA 4WU7A 5ICYA 3PHQA 5C07D 2WZPD 2YD2A 1B0WA 5ISZD 4HS3A 4BELD 4YPGA 1GYUA 2XJLA 3REVA 1MFEL 4GUQA 3P02A 1PW3A 1LO4H 2C3GA 2VH5H 3DVGB 3EGSB 3MBEB 2B39A 2NY7L 4RGMC 5E0QA 3VI4E 5CJQH 4LCIL 1J0YA 3VXUE 5CZVL 2NXZB 1VRSA 3P1VA 2IFGA 4LF3B 3LQZB 2OL3A 3K2UL 4ZQTA 2ZYSA 4X9YA 4P5RA 1U4FA 5DD1H 1EO8L 4NQQA 4TSBL 3EOTL 3JV4A 2AQSA 3VRIB 2XXCB 4YIQB 3SFZA 1WD8A 2CKBH 4M5ZH 4IRSA 1G6RH 1AZUA 3N1PC 4AVHA 4XPTL 3OL2A 4NZUH 1KGUA 4NEHB 2VLJE 4Y16D 3LXUX 3MUJA 2G4EA 1QFHA 5IBTL 3X1GA 5HHOE 1L9NA 3GBML 1UOKA 4CAGA 5C2BL 5JOFB 2GBUA 4IMLA 2VUYA 4R90H 4X9HA 2HFEA 2DQCH 2PR9A 4WF7A 5B38G 5JMRA 1FGVH 4QXTA 1E9PA 2FGWL 3AXLA 3OJDB 1UD2A 4I77L 5T5NF 3FRXA 2EZ0C 1G9NH 5SX4H 2NYYD 2Z65C 1G7IA 1C08B 3L3IB 4WO0A 2XTJC 1PFOA 2DQHL 3GO1H 3U7WH 5DUBA 1CDUA 1JZFA 4I18C 4PTUA 1OB1B 2ZJSH 2Z7ZA 3D18B 4UILL 3DV6A 3IXTA 1AYRA 1JPTH 1TKWA 3KCPB 4GMTH 3GHBL 2G3NA 4DNUA 4HJUA 5L8LB 2EINB 4Y5RD 3QBTB 2PP8A 1FNEB 1UH4A 3MODH 4ODWA 4WWKB 4GUCA 5CGTA 1LQBC 2AJSH 4PD4K 1IUZA 3RVVC 2NPLX 3KPSA 3GSXB 1OPGL 1A21A 1T5WB 5LCVL 9PCYA 1MNNA 2EDMA 3VXMA 1NOAA 4ZTEA 3AMLA 1IGJB 3V4PA 4PN6A 3MV01 4YQXL 4GRLD 5LQBL 2G0KA 3PU7A 5H4ZA 1PI6A 3ABGA 4KNUA 4N2OA 3SO3B 4TRPL 1TVBB 1FE8H 2YAOA 3G08A 3NFSL 1R1CA 1KOAA 3GI9H 3TL5A 1W0WA 3K2KA 3UC2A 2HFTA 1T4KA 4KKRA 4FABL 2J43A 3V55A 3D87B 2BNQD 3ZZSA 1RERA 2CDEB 5IVXF 1GSMA 4DSYA 2X1OA 5CZXC 2PNDA 1OB0A 4DGYL 2J1ZA 1RZKC 1DDHB 4S1SH 1A4BA 4NNYB 1NIAA 3ZGIA 5CWSA 4OF5A 5HGHB 3O8XC 4M5SA 5ESVA 3ESUF 1QEWA 2WSKA 3EYFA 3VH8B 5JHDA 3PE7A 3RKDC 3NCJH 1TEFA 1VEOA 4G9DA 4EE2A 1MHHB 4LP4A 4AXWB 3MGOA 4XH2B 1BGXL 3FB8B 1KXHA 4ACTA 3EW3B 5KBNC 1V7MH 1NFAA 1RVFL 4I9WD 3BOVA 2EDLA 2EYRB 1UACH 4CMMB 4F5CA 2I9TB 3HG3A 1DJHA 4XAWH 2IO5A 5TPWL 1IEHA 4UTAH 1UZ6F 1SJEA 2BY1A 2XWXA 3BKCL 5KVGE 1SMAA 3AXIA 3NJFA 4O2EB 2F54B 3S5ZA 3IMUA 3EQ8A 1KACB 4LASH 2AXGB 2ZF9A 3GIZL 4NT6B 2YA0A 2DL9A 3R7RA 4A39A 5BS0E 4YHNB 5EOTB 3Q1SH 3DOSB 4G72B 3BCDA 3BAWA 4YJZL 1XH1A 5E5LA 4F58L 1J10A 4AQAB 4KZ0A 1OE1A 3ARXA 3RZCB 4OFYD 5I8EA 2FEEI 4WTZG 1DQLL 5ESQA 1ZVSA 2EUZA 5CJXC 3S35X 1GGTA 1IL1A 4GLRI 4MCNA 1U21A 4BCZA 3ZUNC 1ET5A 2H3NA 2CCVA 3NG5A 3ZTEA 2ZTBA 3FFDA 4D0DA 1J9CT 2BSTB 2OAAA 1C5CH 4AL8L 2ICWJ 3WO4C 1D5RA 1IKNA 4E2OA 3SJLD 2XLLA 2JJSA 5DD6A 1SPDA 1RZIA 4FQ2L 1KBPA 3DX7A 1IIKA 2V9TA 3WEXB 1S6NA 1MCKA 1IFHL 1XF4B 3E2HB 3F7QA 2OYMA 4JRXE 4I3RH 3LEVL 1JZ8A 3LIUA 4WUUE 1WAAF 4KK9D 1UWGH 4YXLL 5KJRH 5AUMA 2DLTA 4HU2A 5IKCA 1K6QH 1K8IA 4JFEA 2JK5A 2K9UA 2PYEE 3VXNA 1SQMA 5HBBA 3S2AA 1TQBB 3TBYB 3UEZA 1OXYA 3IETA 2MNJB 4WEEA 2K8MA 4LZKA 1JNJA 1F8TL 4ODTL 3T8XB 3QDGA 1YNTA 2WAQA 1JXJA 3KXFA 3US1A 2BXYA 3GBNH 1Y0LA 4XZUA 5ENWA 4A2LA 3IE9A 3IDXL 1PNCA 1ZHKA 2FJFA 3NA4A 4YR6B 4YBQC 2DI8A 5GGUB 3BVWA 2LQRA 1BXUA 2NNXA 4MXVF 5DC9B 3SPVA 4AH2B 5TF1H 1NDMB 3O3AB 4G5ZH 2VZUA 2ADIB 1R3IH 4KH9A 5CD3B 3FQRA 4GQQA 4OCSL 2VDLH 1N6UA 2P9SC 3CQPA 1E28B 3OF6D 2VSDA 1SDYA 4WI2A 4X0KA 3S6CA 3DHJA 4J3OG 2F5AL 4AYMC 3SMRA 4PRIB 3ESMA 5CEXA 4JPVL 4L3EE 5FM4A 1ZSDB 2WXKA 2HVJA 4HT1H 3AREA 3VQLA 3W5NA 3HE7C 3VXSD 1O6FA 3KHOA 4BH6A 1PX3A 4S1DD 2ICEB 3OSKA 3DX8A 2OVPB 1YMHB 3UYRL 2X6MA 2APSA 1MNUH 3GLZA 4JHPC 5A2FA 1E43A 3ETTA 3PFQA 2WXQA 2BX5A 3FT1A 3SJVE 3LB6D 5J8OA 3UTTA 3BI9X 4KOBA 5J6GB 3EI1B 2V7NA 3HBPA 2EEAA 1K4CA 4PCKA 4QRTB 4UT7L 4HDIB 2OX5B 4K3DL 2FEDC 3ZDYA 1A9BA 2GUOB 2VN5A 2XHNA 4BXSV 1XGTA 4J8BA 4L2LA 3WTTA 1JHLL 2W0PA 4ZFZA 5AVTB 2Q1EA 3A21A 3ZHDA 3TNNB 4WNJA 5FFOA 1HILB 5LUMA 5DO2D 4PEEA 3U4KA 4ODVL 3THML 5IB2B 1U8KB 1FF5A 1S9YA 5ICUA 3FL7A 4J3BA 4H2CA 1NCWL 3E80A 5TDHB 1QBBA 1QD0A 3FTUA 5JXEC 4BCXA 4ZTOL 4MNGA 3BJ91 3MLYH 1I8MA 5EO0B 1WFTA 1NIFA 1B9KA 3MLUL 5C0CD 1KB5L 2MTAA 3EBGA 1KG0B 1U3YA 2VLKA 2APTA 3S37H 1MF2L 3FQTB 4H1LA 3C2AL 4PG9B 1T5KA 3MQIA 2DQEH 5KS9F 4J12A 4X7DC 2WZ0A 4KDWA 1W8NA 1DVYA 4YEFA 4KAQH 2CLRA 2IPKA 5B3JF 4Y19A 4DP1X 4NJ9L 2F53A 3UACA 3VD4A 2PM6B 3CFBA 5H1MA 3F7PC 1WBZA 5C08D 1Y1DA 2R39A 5EEZA 2YRPA 2YLKA 4GQRA 5AQ0A 3PABA 1RUQL 5HE0B 3D08A 3KYAA 3CBJB 3CFNA 5HP5A 4QT8A 3O4LB 3QWQB 3ZTCC 4HBCH 1BMWA 1J87A 3KAAA 4G6KH 2FYYA 2KLRA 2Y1AA 2XN0A 4EI5D 1SBSL 1ES0A 1UOWA 3SDDB 2XVBA 5T5FH 3QUKA 5EU6A 3M7OA 1L7TL 4G9FB 5A2BA 1S7RB 2N3JA 5MI0B 3QCTH 1WEJL 3ABMB 3P3SA 2IFFL 2JTYA 2VSMB 3QYCA 3WNIA 4FQXB 2A7BA 4DERA 1A8ZA 2VZVA 1UOVA 2FB4H 4RAUB 3K6SB 4HUWB 3VU2A 1MCPL 1NCCH 3QIWB 3EOYG 5EA0L 3RWCB 4MNQE 4KI5C 3SCMB 3VU1A 4BFGA 5MEPA 4KKQA 2GJRA 4QY8A 2YB8B 3HMXL 1GZPA 3LRSB 3OAZK 3ZHFA 5J7CC 1BQKA 3G9VA 3SD5A 3T0EB 4K3HA 1J9SA 4IOIA 2PETA 2LVCA 2UYLA 3O6MH 5DVOA 4HAFA 2B1HH 4YZFE 2A9CA 5HVWA 1D5ZB 2B5IC 3P77B 1FL5B 1RPUA 3L6FA 1RFDL 1J5OH 4KX7A 3EJSA 2IAMD 2DQJL 4AIOA 2PPAA 2ZSVA 4D9QE 4XNQB 4FB1D 2VSKB 2Y06H 5GGSB 2VRQA 2YBGA 2OW7A 3R06B 2OW6A 4JFFB 1RZJC 1DEEA 3ILPA 6FABL 2N1TE 4GJTB 5I66B 2CO2A 4IHOA 3TCTA 5D7JD 2IANE 1CU4L 5C0GA 4IRSC 1YQ2A 3U30C 1QRND 3UBFA 4RNRB 3IKKA 1AD0A 3MNMA 4PGEA 4J3VA 2MSPA 1YYML 4QT5B 4NQEB 1PNDA 4LQFH 4PGCB 4C56B 4WW1A 1MFAL 4GBXC 2KYIA 3QQ9C 1M7IA 1T6BX 4FMKA 2VXSL 3P9LB 1IGTB 3LN5A 4PLKC 3BGFC 3C5SA 2WTRB 1D5BB 4O45A 1F3JB 2A0LC 1A1MB 4ZT1A 3QI9B 5F1SA 3W2DL 1MREL 1XEUA 1TG8A 1M05A 4LOUD 4NX0A 1YLBB 1YMMA 2XA3A 4PS7A 3DSNB 1NGQL 3IDNB 1XXDC 2HRPL 1XR8A 1NWPA 5E94A 1ORSB 3ALPA 2YN5A 5I30H 2XVGA 2UV3A 2CHNA 3N1GC 1JFQL 1P7QA 4KJWC 1QHOA 4KRMB 3SE3A 2BOLA 3OKEA 4YLCA 2N7AA 1CZ8H 2WM0A 4L23A 3S35H 5CXCB 3H9SD 5I6NA 3WDIA 4ELMA 3AM8A 3MRFA 1UWXH 1RIUH 4FJYA 5C0DB 2WIIB 3VD2A 4Z7VB 4X0NA 2QGCA 2ZKWA 4KQ3H 3EFOA 4OBRA 4BBWA 1E9OA 3PLYA 3FTSA 2NUTB 2VZOA 5LWYH 2A5UA 1KLFB 4M6OH 2QDWA 2E86A 1A9VA 5HI3C 1T20A 4EJ1C 4ZUSB 3N6YA 2HPTA 3QNFA 5C0AE 4DH2A 4BUJC 4YOKA 1GGYA 2B3RA 3U1SL 4P48A 1PG7X 4Z0BL 3WNNA 4DP4X 1VFAB 1FUNA 2CR3A 2PR4H 2X4RB 4PRHB 4U1SA 2CRIA 3D3VB 5CD5C 4HDJA 4K7PY 4J23A 4Z7OE 5B1CA 3ULSA 1R46A 2YXVA 1Y18A 3TPUA 3KL5A 2OCJA 5E2TL 1J1OH 1JJUB 4FLSA 1TLKA 3ZE1F 4MMYB 1A6ZB 1SFHA 2L0DA 3R8QA 3TVMB 3L4WA 3IAQA 1S7QB 1OAQL 3L5WB 1A3LH 4WK0A 4GI8A 5EC1B 4K94L 5IBLC 4LIQE 4OF8A 4ONFL 4OSUL 4XMLL 3ZK0A 5BMFH 1FL3B 4APXB 3BHBA 2W18A 3PWUA 3V0IA 1H6UA 3OXRA 2AVGA 3HBZA 3T04D 3BE1H 2WOYA 3PWNB 4WJKA 2JKIS 3HNVH 4G6JL 5I8KL 5TGBA 4WAFA 1E8YA 1WIUA 2Y69B 1AQ8A 3C6LD 5D4QA 1DR9A 3RWJA 3HNSL 3IFPA 1CGVA 3I02B 3LHPL 2QKIB 4XNAA 4JJOA 3RA7L 2H6PA 3BN9C 4HIEA 1BXAA 1XHHA 2P5WE 3IJ1A 1OVZA 4LVOB 4KKAC 2G5UA 5J4MA 2YQGA 1D6EA 3UADA 3BH4A 2NCMA 2NY0D 4N2KA 4DKFL 1IKNC 4M5YH 2W81C 5A2JH 3DDGA 3Q6FA 1CVSC 4WV1B 1RZ8A 2J6EH 5DSCB 2BC4B 4PJ5A 2BO0A 4YH6A 3IJSB 4Y7OC 3WMSA 5TEFA 3TIEB 4FZEH 1U4CA 1MDAH 3HS0B 4W68A 5FHAH 4U3CA 4U1NB 1IM3D 4J81A 4IGBB 4FXLA 1KCLA 5HQGA 2PO6A 1UVQA 1FC2D 2B08A 2WYZA 3NEXA 4MAUH 4R7VA 4X6DE 3O6FB 2IH8A 3QA3A 3TO2B 2W07A 1OAYH 3AFLA 3FK3A 4LSUL 3D2UB 2X4QA 2WWMC 1X7TA 2FQDA 5I1LB 3L4MD 3DYPA 2M2DA 4S2SA 2Y6TE 4F7MA 4OZHB 1J0IA 1IM9A 3L54A 4EN2A 1DUYB 3ZZLA 2GVYA 2LFEA 3QEHA 2ICCA 3TP4A 2Z34A 3RFZC 4ZXBA 5FC9A 5E8PB 1AG6A 1KIPB 4LSVL 5EOCJ 4FTVE 5DHMC 5K39A 4P5KB 4FFZA 5AVSB 1J12A 4HD5A 3I50H 3WN5A 1MPAL 1X44A 4N9GA 2CXGA 4YUEH 1QSFE 1WG3A 4ONGH 1N7ML 3W0WD 3FOLB 3OLEA 3QJRB 2WXHA 4WK4A 3K0YA 2P9KC 4UZUA 1JNHB 5M5SA 3IMTA 3LN4A 1HQRB 1Q4NX 1URZA 3C6SB 5TDNA 3WJMA 4V1DA 4TQEL 5HI5C 4QHKJ 1VACB 2WZ6A 3D6GA 3F58H 3GMMB 3AREC 3L3OB 3MBXH 2ZOTA 2UXFA 3IUMA 2R0ZH 3EKCA 4FFWD 2CSPA 3WIIH 4J39A 4KJPD 3VXQB 4F8TA 1T2JA 3VFVB 3P30L 4YK4C 3ARYA 5AD0A 3D0AA 3U0TB 3KPLB 4QWWC 2WQVA 1SY6A 2WJ7A 3G6JF 4KRNA 4GKZA 3MBWB 2CLVA 2AJXL 2UWEB 3BSGA 4LKXA 2EADA 5IG7A 3S8GB 2D4DA 1E5AA 5F6HJ 3FQYA 5IVXA 4F2MA 4U1MB 5HPMB 1CL7H 1JZ5A 4G42B 1CGTA 5E5RB 5EUKA 3VFUA 4YBLB 1H0DB 5I82A 2W0FB 4OI9A 1GJIA 1FN4B 5TE6H 3FTYA 2YGVA 5KOVC 1C1EL 2EKSB 3ECVA 4IIQB 4U3XA 3L3JB 2O26U 4Y0GA 1ML0A 4PJ9C 3WCYA 1T03H 3RTQD 2VAAB 3F5WB 1GA2A 3FQXB 3OZKA 1S7WA 1WPCA 2XETA 3HRPA 4XVUD 1U8NA 3JVGA 2XKUA 5T1MA 2BWIA 1J0JA 4HVBA 3JAMg 4PJCE 1JIBA 5GJTH 3X1FA 3FRUB 3FCSB 4FQHA 2P80A 2JKTM 1S7VB 3DTDA 4QRQA 2HWZH 4LT7A 5DTFA 4POUB 4LK4A 1LD9A 2OMYA 4HS6B 2Z9TA 4ES0A 1IJ9A 1BCIA 5BVJB 4MKMA 1I3RB 2AEWA 2XQBL 4G7QB 1A7QL 3SDAA 3TYGH 3GB7A 3PHOA 3WU1A 3WNLA 5CIPA 1F58L 1ERNA 4CY5A 3K4ZA 1WWCA 2XU7A 5F7DB 4A08A 2IG2H 3F2LA 3F84A 2RFXA 1DQJB 2FJSA 5JHBA 3CLFL 3LEXB 2E7MA 3DK2A 1NCAL 2IDTA 5T1LD 3A6CL 1GKEA 2GT9B 4BSWB 3MRMA 4B5ZA 4CVZB 1E8MA 3ASOB 3IKCB 4DEWA 5FK9A 2Q8AL 3QEUA 3VG0L 2XWBB 4WCYL 3ISRA 1SF3A 43CAA 1JRHI 1U8JA 4JG9A 3EH5B 3SE4A 2WN2A 4HEMA 5DD0L 1AXSA 1BREA 3JPXA 3BWUF 4JFXA 3WFDL 1VZGA 4JUTA 1CDYA 1E3XA 2H1PL 5MHSD 1JGVL 1N8OE 5FYJE 4J0WA 5HYQB 4ORGA 5HE3B 2P7TB 3DBXA 3GT6A 3MROA 4DQOH 4JRYA 5GS0D 5GRYA 4AM0A 1ZTXL 4O2FA 4R9HA 5KSVB 3ULVC 5EALA 4P46B 5D6CA 1P6WA 4NDMA 2F8IA 3ZRSA 1GAFH 4K07A 1WAAA 4O5LH 4YSOA 3FMGH 4KXDA 1RZJL 3UR4A 4GIPD 1QSVA 2B0SH 2EIZB 2ED9A 1PZCA 4PM1A 4GW4B 1CFSB 2FX7H 3LZFH 1OGTA 1KBGH 4N8CH 1MHPH 3NOIA 1KNOA 3GUFA 3FT0A 1I85C 1WUNT 3QDAA 4HMDA 4IKKA 3BRGC 1DVXA 2BMKB 2UZPA 3ZR5A 5HYJB 1HESA 3KWTA 2O5ZH 3HUJF 3LAFA 2OR9L 4XCYA 1NGZB 4ILDA 5E6ID 4UTBL 5I1AA 4BP8A 1B4LA 5DXWA 3PWPE 3KBEA 1YQVH 5FO7A 1OP5H 3BIKA 1ZT7A 4P3WA 1JYNA 4ZOAA 5I6OA 2H6QA 4F7PA 2ESVD 4DF9A 1YEJH 3VM7A 1PG7H 2EECA 3N06B 2CUHA 1BM3H 3L4VA 4F7TB 2J57A 4CVUA 3V0EA 4JN2A 2WXRA 4J4PD 4BUQA 2J7LA 5HPOA 1VA9A 3JTBA 2FSDA 5IMMB 1LO4L 2VH5L 3T3PE 1WFMA 3FRPA 4NWTH 1QO3B 1SVBA 3VFPA 5C09D 5D2NB 3VFNA 4MSWB 3QDJD 3PGDA 3RB7A 4N0FB 1F02I 1A5FH 4JO1H 1ESOA 3M8OH 4HV8A 5KBLA 1UM6H 3X1EA 4O02H 2NXYB 2V5SA 5FKQA 2XACC 2BHUA 2AEOA 4IBSA 2HMIC 2DW5A 2FWSA 4ZZFA 2DMGA 3TJEH 4DTGH 5GISH 3G5VB 4Z3JA 1K8KC 4ZG1A 4I79A 3CDGA 1MJUH 4NN7B 3SE3C 1KGXA 1F6AA 4Z76B 4WW2B 4F7KA 3EO9L 5E9DE 5I76B 4ETYA 1BVNP 3FC8A 3GSOB 4R90L 3MREB 4CJ0A 1TCMA 3ARZA 5FF6A 5IMKB 2W65B 4Y5VA 4R3SB 4UOQA 3BH9A 3HE6B 4IBZA 2PMZA 2YK1L 1JZHA 4HC1A 1E4XL 1KCUH 2J21A 1PF3A 1FL6B 1XAUA 4JW3A 5IJBC 5IFAH 4WK2B 1ZS2A 1U93B 4BQCA 4D6VA 2MCMA 2IWGA 2ZJSL 1TSHA 3JSSA 1KPUA 1X5ZA 3V5DB 2XTLA 1JPTL 3JWNE 3KDPB 4JMXA 1XSKA 3DMMD 4E5XG 4HJTA 4XP6H 2HZHA 5D93C 1BFTA 1O75A 3GSUB 4JFQB 4JN1L 4ODXB 4HLJA 4UF7C 3MUHL 4XOCA 2AGJH 3V2AR 2AEQL 1YNLH 5C1MB 5DRWA 4RBPH 3EH3B 3OWRA 1JERA 1PZ5B 4JRXB 2I9LA 3ZX1A 4CADA 4WUUB 4K9EC 3BD4A 2XKNB 4NC0B 2XPGA 4HWEH 1NBCA 3EJQA 1OZTG 1TEYA 1EHXA 2HVKB 1MWAH 1PU0A 2WO4A 3HS8A 1HWWA 1NLDH 5KVMC 2BSCA 1AE6H 3JV5A 5JIHA 4X4KA 3E6HB 4YHOH 3WFHB 2WZAA 3QHFL 1A14H 3UTSD 2W88A 4QHPA 4WFGD 2JB6A 3AU0A 2OSLA 5C0ND 2C9RA 3B5TA 5EUOF 3RHWK 4E9XA 5KW9L 4FQCL 1N64H 3MRPA 4G6MH 3JWNG 1TZHA 3NIGE 5DZAA 4FKEA 4R8WH 4RFNC 1FSKB 2NY3B 4PBYA 1NC2A 1XMWA 2WQ8A 4HALA 4KXBA 5ESAB 4NYLB 4Q9BA 3INOA 5E6RA 1I7ZB 1AQDA 5E8DH 3NCJL 4N8PA 2KDGA 4HWZB 5IW6B 2GITA 4Q0XH 4MMXA 3ZDZF 2FD6H 4WGWB 2JLLA 3QHTC 4LEBA 4LLUA 2B2XH 3V4UL 4D0CB 5KVEL 2IPTH 3HG1B 5EF1A 1VZ3A 2IUVA 5J3HD 4YSCA 3BZFA 4JREC 2CBQA 3BWSA 1CFMA 4L3EB 5DJ8A 3HRZA 3CLEH 4GW1A 4WI5A 3VGFA 1BOYA 3CBRA 3UYPA 2Y7QA 4DGIH 2PN5A 4PJ8B 3KMDA 4AWJC 3UJJH 2WCPA 2MQ0A 5AENA 1OIOA 3UYOD 3IMWA 1JZ4A 1GXEA 4PYGA 3RGHA 1O9VA 4KK8D 2PO6C 1CTOA 3KVQA 4KKLC 3X14A 2C1PB 2VKWA 2ITCA 5DVLA 3PV6B 1K4DB 4FQIH 5FGCE 1HYSC 3KE0A 3VCLA 2VLME 3KJ6H 3CH8A 5IJKC 2AGXA 2ZCKH 2Q0ZX 4FA8A 5HHNA 2X4UB 4B60A 2KI6A 1I1RA 4MVBC 2Q86A 1DBKH 4JY6A 3IIWA 5FW7A 3N85H 5G4NA 4RE6A 1OAZL 1DVSA 2CQVA 4OJFL 2BY2A 3LNDA 1B4JH 2IH1B 3MRIB 5DT1H 3VSVA 1ZAGA 5AJAA 1Q0YH 1BIIB 3QUYB 5LG1A 4ZXBC 2PCXA 3F7LA 3HN5A 4NKQB 2XXGA 3U2SB 5D1ZI 1UD6A 3WN5C 4NO3A 1LO2L 5F89A 4E9TA 2J6WA 2R9HD 3MLVL 4PVBA 2AGWA 2Y3NA 4PRPE 4UDTA 4L1BA 4MHHG 3IDIB 4AQZA 3ELQA 4PAZA 3WIHH 4L8DA 4A0AB 3RIFF 2YKLH 5L2JB 2EIMB 3SQOH 1RJLA 4P9HL 4EKJA 2VDNA 1NGXA 3SBWC 3ZBMA 3FT2B 4PSPA 1TNMA 3B1TA 4H5SA 4K5MA 4JFDA 4PJIE 2OJZL 1OGAB 1HXYB 1NGWB 1CN4A 1DHKA 5B3NA 1S4IA 2HTKD 3SOBL 1BQLL 3CK0L 1J8HD 4XRCA 1JXGA 4EAEA 2GC7A 2WJ5A 3VJ6B 3AITA 3G5ZB 3M1BB 1QPPA 4JKWA 4BK4A 1WBXA 1RI6A 5TF1L 4GRWH 1EHNA 3MGAA 2H9LA 4A2MA 3RDTB 2Y25A 4GKSA 1ET8A 3MRQB 2VDLL 2HH0L 3S3BB 5KANG 1A9EB 4LEOB 1TU2B 4FNPA 1BW8A 2B8OT 3V6BR 5D7IA 2CWRA 4P3CH 1OD9A 1I3GH 2PTUA 4H8QA 4JS7A 4LLWA 3B9DA 4X5WB 2Y36L 3JVGC 3MRJA 3LZOA 4OKVB 4X4YA 3BPNB 2KHAA 5T3ZH 2BY3A 1MNUL 4BIKA 1DL7L 1NFDF 1UWXK 1FFPB 1RU9L 3X1NA 3RURA 4DVRL 4JZOB 1IZJA 2PPFA 4D9LL 2WXFA 3U6XS 1U91B 2CG9X 5KYWB 4LGNA 5EO1A 3N55A 3L1OL 1S7UB 4FE9A 4UU9A 4X5LA 3AC0A 3QDMD 1F5WA 5T1DH 5HDQH 5IGXL 4ATWA 5KVDH 5CEZL 3TV8A 3OKOB 1EO5A 3IN2A 3C2SA 4RGOL 2X4NB 5DQJB 4LU5H 4ZW6A 1U42A 3GMRB 5AVQB 3ILEA 1ZLEA 4JQIL 1ZDSA 2EILB 4WTQA 3W11D 4HKZB 3C60D 1MVYA 2IAMA 4XNZB 1NCBH 4H20H 4PGDA 2XZZA 5DZLA 3FQWA 1CE1H 1MH5A 1C7TA 1Z9OA 3RFHA 1ZWIB 1SJHB 3KGUA 3L2NA 3SE4C 4HF5L 2C7UB 1TTCA 4MA1C 4FP8H 2CO0A 1DJWA 3DIFB 3GNML 2VB5A 2AQ5A 5IOPB 3IE4A 1N0XL 3DURA 5F6HI 1UT1A 1Q38A 4TV3A 3ZHNA 1FRGH 1CCZA 2A9BA 1A6WH 3K5SA 2Z8RA 1XBDA 3VXOB 5KYNA 2A77H 2BHYA 2EDTA 4H26B 5DEGB 2DQGH 1SXSA 3K4DA 5F3HA 3LEYL 1NAML 1ZDQA 2WLKA 2J56H 4HCRA 4ZFFB 4GAYA 3V0FA 2HX7A 3L3DA 5EBMA 5HY9A 4MD0A 1BX2B 1NMCB 4P2AA 3BW9B 3UDWA 1YEHH 3LVTA 1A47A 3JUZA 4YHZL 3C08L 4LSSH 2G60H 2YXWA 4G55A 4NQCD 1J0HA 4HWBL 1QSED 1TTRA 4MHHI 2ATKB 3O3DA 3X3FL 2IH3B 1NCCL 5J1AB 3NJXA 3NZUA 2FGZA 2HA1A 2I07B 4L8SA 5F9WB 1D6VL 1UQSA 2WGXA 3P40A 3E8VA 4RGNE 1I1AD 5C0AB 3RL2A 4OZIE 3WAKA 3LZLA 4JHVA 4PP1D 4TPRL 4AQEA 5EZJA 3H3PH 1FI8C 2WVUA 3DDFA 4UDUA 2X9XA 1O0VA 4P59L 3F12A 4QOKE 5E2WH 2AAVA 1J5OL 1YYLL 2R8SL 4C4BA 3NPSB 2VDMH 5I1EH 1J5HA 5DHEA 4CGTA 3WLWD 3D4CA 1MCNA 2Z35A 3TIDB 1YEEL 3VMOA 3AQYA 2MEJB 1SF5A 1G0DA 4OT1L 2V2WA 2JV6A 4QHMA 4A68A 4GI6A 3RWFA 4PJEE 1EBPA 4A2EA 3QK0A 2E9IA 4FOMA 3SOBH 2ZOLA 4IJ3B 4DCQA 3ME0B 1F18A 2WQSA 3KPQB 3DWLC 1R3JB 3Q2LA 2OSYA 3QXTA 4LP5A 4P23A 4PCSA 5A6MA 4M62L 4ZUUB 2CK0L 4LQFL 4O4YL 1QA9B 1UATA 5DJ2A 1SGKA 5PCYA 3TT3L 2ZICA 4TNFA 4P3DB 5GRWA 1U8MB 4JPSA 4Y5VC 3PWJA 3U7AA 4JG5A 4S0HA 3N41B 5KAQG 4U1HB 1U8IA 4JMNA 4C4KO 3DOHA 25C8L 1DUZB 2XQYK 3LDBB 3DXMC 4LSTH 2GCYB 4H25B 5LLIC 4AZUA 4EIBA 3AWGA 3RLMD 5FYKU 4KHXH 3SZ6A 2A6DB 1KJMA 1WWWX 3ZIYA 4H4NA 5SWZE 2BOBA 3VD3A 1JGEB 2VDPH 3H6JA 4HUNB 4PS3A 3V0GA 1MCWM 1DLHB 2DEYX 4CBZA 4HLEA 1N4XL 5FCSH 2HAZA 3BP6B 3IDMA 4O3TB 4KC3B 3H9HB 3EXLA 3S35L 2GQHA 3PWVA 2HPOA 5SWSA 5KVEE 4QHLB 4WIQA 1HQ4B 4X6DB 4CZVA 3B43A 5HGAB 4U1LA 1MIMH 4Q2ZB 1QVOA 3OAUL 2YGOA 3EI3A 2DWEB 2O5XH 4YSAA 3VRLF 4ANKA 2EXTA 1AS8A 3HC0A 4JQVA 2A73A 1RD6A 1TJXA 4M6OL 4P4KD 1HNGA 1SN0A 2VLLA 4S11A 2AJUL 4DO6A 1XGRB 3MTXA 2JQZA 5IT2H 3FB5B 1HEZB 5EU7C 5I0VA 1QLRB 2X3BA 4G11A 5A7EA 1BAWA 5D4IA 5H94B 4FTVB 1KY6A 4D9SA 2Z31B 4YDLC 4LRNL 3O0LA 1LMIA 2PR4L 1UYWL 4MMXC 4L1HA 3D85D 4RRPA 4G1EB 5FCUH 1U58B 1OTSC 1SOKA 3F7RA 4JDZB 4RISL 1ZPUA 4ZS7H 5FA4A 5GRVK 1J1OL 1X6LA 3FBKA 4K3EH 5F7LB 5KSAD 3ZKXC 4KV5E 4Q9RH 3HI1A 1U8LB 3BMVA 3SBPA 3GZKA 3IJYA 2R69L 3NDZE 2H47A 3C8KA 3PJSB 3HRZC 1IGIL 1YO4A 1KJ2L 3CVHA 4G7RB 5J9PB 2VDOA 2OL3H 4DP6X 3MSPA 3QE5A 1XEDA 1YJDL 2ZPKL 4ENEC 1H9DA 1MRDL 2K0RA 1KB5B 1NMAH 1ZY9A 2FR4B 2ZP0T 4G82A 4OBSA 4NKDA 3IDGA 3IU4L 3A0OA 1LQSR 5C9JA 3FULA 4L1TA 2FTAA 4DVBB 1FNHA 4YHKH 5HHMD 3TV3H 3UJTH 1RK1B 2TRYA 1AY1H 5CUSL 5AVYB 1NCNA 3US0A 2C8NA 3ARBB 5DMYA 1VFOA 1LHZA 4UQ3A 1ASOA 3WD5H 3AY2A 4JY5H 1AXTH 4MXQD 2Z91A 2J6EL 4BFNA 3WTWA 5FOBA 3Q9PA 3V7MA 2AK4A 3FO2B 2H6UA 1LK2B 1KIUB 3BUPA 1PGRB 1T1XA 5E95B 4LPVA 5EU4A 5KSUB 4YDJA 3RVWC 3ENEA 4FZEL 4PJCB 1KCSL 3MJ6A 4NJAH 4QKXB 3NEEA 2ZYRA 4QRRA 3F7KA 4RGMB 3NIDE 4MAUL 1D5XA 1E9QB 2YQBA 1OP5K 1G7QB 5DO2C 1W72H 3LKQB 1JV5B 3D69A 4W9FC 4WFHD 1M3JA 1NAKH 2XZAL 2GTWA 3IWVA 3HAEA 1T7VA 5DDHA 4CC4C 4YLBA 5SX4I 3OLIA 5CZRA 3MV11 5BRZA 4E9VA 4PJBB 3IGLA 2ENSA 1HXKA 4MCMA 3OKYA 3V4PH 5F6IB 3QORA 4NN5B 4RMVA 2ZUUA 5FO8A 5I23A 2GC7C 5HDWA 3O41A 4HJJH 3MLSH 3TNMA 4G1MA 2VZTA 1AD9A 4Q56A 3GSNH 4Y4KA 1KGCE 1KEML 4JM4L 5K9KA 3DTXB 3ZKMD 3U25A 1GYAA 1Q9KB 3WY4A 5HHXH 5DA0B 1A25A 2Y5TB 1M4KA 4K8RC 4YXHL 2FX8L 1FJ1A 1G87A 3PE9A 1C12A 5D1QD 5IB4B 5EU3B 4PWJA 4OCRH 2HUEA 3X12A 4OV6F 2GJ6D 3HC4H 1QABA 2G30A 3FYIB 3IU3B 3MBXL 2H0EA 1A64A 3QNYA 1IAKB 2R0ZL 5DS8B 4IDLA 1R5IA 4BXVA 4K3JL 1X5KA 3ULUH 5JUEL 4POZD 4RX4A 3B7FA 4OIAA 3NCMA 1XF2A 3I6LE 1KULA 2XBZA 3ARSA 4Z23A 1YEIH 4BSVB 1KENH 4PR5B 5T1KD 2E56A 1BEXA 5DRXB 5H17A 5DJYA 3ROOA 2YSSA 2P8MA 3SPCA 4PRAB 4PJDA 3AAZB 1U2HA 4KK5D 5H37H 3RUGE 4CNIB 4Q97A 2WXLA 2FLRT 4OW6A 5IZ7A 5JW4R 2JLPA 5E00A 2DM2A 4QD2E 2JXMB 5KN5A 2E7LA 3VYNA 1TQCC 2Y9RT 4W9CC 2JELH 1BZQK 3TGXA 1U8QB 6CGTA 3DUSB 4LKCA 3L95A 1XV8A 2IAMC 2VR3A 4PHZA 5BZWA 5I71C 3LRKA 3O4GA 4KFMB 3MC0A 3PIQB 4RBPK 2HCZX 3QJSB 1VPOH 1DQMH 1KIRB 2ZNXA 2AJVH 3FO0H 3U6XA 2BVUA 1ONQA 4OUUB 4Z3EA 2CZNA 2ZXCA 3N44B 5GJTL 3K6FA 5I5JA 5AYUL 3NAAH 1GCYA 1LO3L 2CO0C 1J8KA 4UI9R 3GMPB 4LCWE 5DRZA 1E5BA 1Q9OA 2AGZA 5FGRA 5E2VH 4Y4HA 1W8EA 2VDRA 3FO1A 5AVXB 3PS6A 1HHKA 5I1HH 5DK3A 1SXNA 2ARJB 5KSBB 4OLUH 1XF3B 1NKGA 2XXFA 4XVTL 4E5XB 2IG2L 4XCFH 2RA1A 3D05A 4DOHE 1MAJA 4JFWA 2IV8A 4MS8D 2J55A 1FVDB 4YZWA 4P57B 2XDWA 3MVSA 4L3CB 1T6WA 5MENE 5AEAA 4L4VD 4LOUC 4RMSA 2OTWA 3MOQA 5F7EH 2A9MH 2ZWZA 5E9DB 2UZXB 3T2NH 3CIKB 3UDWC 3WJLC 3ZE2A 5EFIA 4I2XB 5DURB 4U1EI 1VJSA 4FYRA 3EI4A 2C1OA 3NCXA 1K5NB 3QUGA 1K3IA 3D25B 3DX9B 1KBBA 1WQVT 5LXVA 2UY6A 3FFCE 3MRNB 2EXSA 1FG2B 3CFEB 3Q2WA 1FO0A 5I73C 2HT3C 3TT1H 3BPCB 5D6DA 3S3PA 1RLWA 4L8SC 4ZTPH 1P2CA 3QEGL 1T21B 3TA3A 3ZKNC 4DIXA 3FMGL 4MJ6B 3LS5H 1JGDB 1SHYB 4MRCA 3DHPA 5JZ7D 1FZOA 4G83A 5FKAA 4YGVA 2OMTB 2VITB 4XMKL 4QAMA 2JKJA 3PAZA 1KBGL 2QV2A 4A2HA 2MJWA 1UKSA 5HHQA 3B1UA 3CFDB 3FT4B 3S97C 2WCSA 4L05A 4FMFA 5CZKA 1FGNH 1FFOA 4N5ED 2WMPB 4QRPB 3ZYJA 2O5ZL 5C0JB 1AKJD 2E9BA 2YD7A 2F74A 3GPSA 3QWOB 3LPPA 2EUVA 2EE6A 3SHFA 3V6FB 2VISB 2BH0A 2WWKO 1B2WL 5D7LD 5CBEA 1CUOA 4JO3L 1NIDA 4W9KC 3FUDA 5D9SA 1GPOH 2UVEA 4R0LA 3AY4A 3MUGB 1PG7L 1QUNA 1JMXB 4R7XA 5I1GH 1BM3L 1PFCA 2ZCLL 1RZQA 2DKSA 3O4JA 1MY5A 2W9DH 5DFVD 4JY4A 4P5TD 4BFEA 1ZT4A 3PNWA 4L3AA 2ICES 4HQQL 1ZANH 1CI5A 2H4EA 4N0YL 2LU4A 1L5GB 4D9RD 2E8ZA 3QAZC 2ZX6A 4U1KA 3S5LG 4GRMB 3MLWL 4RQQB 1W2KT 2X09A 1L7IH 1OARL 3GXFA 4GG6E 2YNOA 1QNZH 3M8OL 2A1WL 4H0LC 4JDEA 3AW5A 3T4YA 4Z5RA 3WFZA 3MLRL 4O02L 4UUJA 4I4WA 2A99A 4K7PX 4C57C 4Q9CA 2MTAH 5C2VB 3P0VL 3NRQA 4H1LH 3GMNA 5F71A 4S1QL 4MD4B 4DTGL 3HE7B 3TO4D 3L9RA 1O7SA 1QLEH 4OR1A 3NZ8B 3I89A 4J7RA 4AGMA 4X9IA 2R4SL 3PPEA 4W93A 1X7QB 1TQVA 2FO4A 3LKRA 3L7EB 1CXFA 4M1DL 4M4RB 4UM8B 1A4JB 5CGYD 2XWJB 1GOFA 4OTXL 4K7FB 2HFFA 4AUYA 2XN9A 3AS1A 1XF5A 1NDGB 4GQ9L 1KCUL 4JQVC 2GPZA 1EUTA 1NC4D 3EH4B 3B7TA 3GHPA 5DJ6B 3VFWB 3VX0A 2XT1B 3QO1B 3NZHH 5LAXA 5JPNA 1EMTL 1L3NA 1WS7A 3VMNA 4CW1B 2PW1A 3V7DB 2HJFA 1U41A 2VLRD 4B9PA 5B39A 3BXNA 5I17A 4XP6L 3O0RL 5HD8D 4FCHA 4PU2A 1QQDA 4UYPA 1WISA 2FSEA 1ZVYA 3MXWH 1L9OA 4UM9D 4PWHA 4K23L 4JEGB 2ITDB 2MH4A 4N87A 4Z1PA 1DSYA 1LP9A 2QMKA 5GS1A 5EZLB 4U6VH 5EAMA 4KNTA 2VJXA 3VXRD 4M93C 3BH8B 3Q13A 2NY1C 2OMNA 3QZBA 1P7HL 3OGOE 2PCPB 4GSRA 2Y3AA 3ZSTA 1UZ8A 4OQTA 4MJIA 1DVFA 3QIUA 3MNZA 3FHQA 4NHUB 2FL5A 1C16B 2OMVA 3G7TA 2EVHA 4IEFA 4PJIB 4ALAC 2FATH 1DVUA 2V37A 4AJVA 4XZ4A 1WHOA 4NCC1 3AABA 4NFBA 4XXCC 5KBMA 4KMQA 2HKHH 3CUPA 3FCTB 4OLZH 1GZHA 1HSAB 1JHTA 5L6YL 2ADGA 2EDKA 1KFGA 4AYGA 5IEHB 4MDJA 3FU8A 3BQUD 2WLZA 3TBCA 1IEAA 3FHEA 3QXDB 5AB2A 1R24B 5CKAA 5IM7A 4BFOA 3CX2A 3B6SA 1ZMYA 3S3DB 1FYTD 3NSYA 3C09C 2ZKHH 3C5ZB 4RETB 4WU7B 2M26A 2WGNB 3SY0A 2VZ1A 1DSWA 1HJCA 1MW1A 3GJFH 3O2DL 4J82A 1B0RA 4JKLA 3QRLA 1DFBL 3X3GH 3EGSA 3HTLX 3MBEA 1DVTA 3DVGA 4NAQA 3UJJL 5I1DA 4N5UA 1PQZA 3QUZB 5DLMH 1HDMB 1G7PB 2VLJD 5DLLA 4LF3A 2B5IB 5L7XL 3LQZA 3FQUB 3OB0H 1JHKH 5HHOD 2DLEA 2XWTA 4FQJH 4OVVA 2EXWD 3RIAK 5ILTH 4J0XA 2GABA 2PWFA 4P06A 3UO8B 5C07E 3LRHA 3SKOB 3VRIA 5ISZE 2IMNA 4XVUC 3I9GH 3LKOA 4N85A 3JV4B 3G3LA 5IROD 3OAYH 2YPLB 1J88A 4UMSA 2CHZA 1EVTC 2X1QA 3U30B 4BV1A 1BOGB 2QADC 2R51A 4Y4KC 2YS4A 4N2AA 3T6ZA 1BF2A 4X6FB 2VN4A 4X5XB 2OK4A 4A66A 5KOMC 4OF7A 3VWJD 3SHSA 1MWOA 4NNPH 3OJDA 4GBXB 4N3TA 1DCEA 3ATFA 4LDCA 4QXTB 1R17A 5I5MA 1MIEH 4X42A 4J3TA 4NFDA 3MRBB 3BGFB 1C08A 2G2PA 3L3IA 5F0JB 2A6JB 1PIFA 3G9AB 4JZJA 2OZ4A 4P2QD 4HH9A 3ZMEA 1JGUL 3SDXF 1PKOA 5E7BA 1G94A 3MRKA 1OB1A 1NKRA 3D18A 4OD3L 4ZOYA 4CN1A 3KCPA 4X61B 3FF7A 1KN2H 2ZZUT 1GC1C 1JZ3A 1B3JA 4AVIA 1WDAA 1WIOA 4I13B 3APMA 1DJSA 5LBSL 2ZX8A 1DFXA 1FNEA 1W8OA 3GFUA 3QUML 4GOSA 1NDTA 1R19A 4WSGA 4WWKA 2XL3A 4UV7H 2C9VA 2CU9A 2W8CA 3MXVH 3GSXA 5GS0C