3SBPA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
total genus 168
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbpA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbpA01
2YXVA 5ANHA 1GOTB 3RN1D 2IURA 2E86A 4JHVA 1ZDQA 2VW7A 4YSDA 2GBAA 3EH5B 3AG1B 1OCOB 2EINB 3H56A 1P22A 4I79A 4PC0A 3SXTD 4KO7A 1NPJA 1CC3A 2H6NA 2VW6A 1J9QA 4A2HA 1AOZA 3FYEB 2CN3A 4GM8A 2CAKA 1NWPA 3AFCA 3CVBA 1CYXA 3PAVA 1PZBA 5D4JA 5HE0B 2B08A 1J5CA 2YAPA 4KO6A 1PF3A 3WG7B 2OVPB 3U25A 1EZLA 5C2VB 3JZHA 3DIVA 3T6ZA 2VMJA 4KFMB 7PCYA 3RFHA 1AQ8A 3WI9A 5AKRA 3BG1A 1A3ZA 1TKWA 3DWLC 1XB3A 4FB1D 2DY2A 2HLEB 1KCBA 1SF3A 2XV0A 4YSAA 1L9OA 4ENZA 2H9MA 4JSPC 4A2DA 4YSSA 1JJUB 1N6FA 3SQRA 4DP6X 2J55A 3L4MD 4CY3A 1WAEA 3FQ1A 2YMUA 2XU7A 1CUOA 3JROA 1BQRA 1Q47A 1B9YA 5H17A 5IT9g 1OE1A 2P9LC 1SF5A 1NEXB 2IUPA 3GFCA 1VYHC 3JPXA 3V5WB 4OWRA 3ABKB 1J5DA 4J0WA 1ADWA 1KDIA 1RZQA 4F2EA 4A0BA 4HZ1A 4XYIA 2GC4A 3PAZA 1ETJA 3PLYA 5EHFA 2YNNA 2J56H 2XL2A 2PPCA 3FPXA 3T71A 1M56B 5EMJB 3OQRA 4E5ZA 2QT6A 5FLXg 2BP0B 2CCWA 4CZXA 4G7QB 3PAUA 5A7EA 2VSMB 4QQEA 4DP9X 2G9AA 1PEVA 3QJQB 3SJLD 4AKPA 4BK5C 3PVUB 3SBQA 4FAAB 4GP8B 2VN3A 4DP7X 3SHFA 1BQ5A 4DPCX 4NAJA 4J8GA 2WO3B 4R7AB 3FRXA 1NICA 4E54B 2VM4A 3AL8A 5I6NA 4PBZA 2UX6A 1BXVA 4Y5RD 3TBBA 4BWWA 3N0DA 2CO0A 1TYQC 4GZ8A 1ILUA 1AS8A 2B4EA 3MZKA 1ZIBA 1KYAA 5IY5B 1KCWA 3U4YA 3IJ1A 2EIKB 2IAAC 1AAJA 4W1TA 3UADA 4AKOA 5HQGA 4CSZA 4FA4D 3P4FA 2R7EB 3IN0A 3OKWA 4HCFA 1MZYA 1N68A 2GC7A 2OVRB 1ASPA 4NERA 5FA5B 2DWSA 4ZN4A 4CI1A 1FWXA 3EI3B 3MBWB 5TDHB 3EF4A 4ZOVA 4E9QA 2YBAA 1K32A 1RZPA 3UVMA 1M9WA 2QC5A 1L9SA 1IUZA 2Y1AA 3CFVA 2FQGA 1JVOA 3I7LA 3ODTA 1QHQA 1J9TA 4ERQA 2I0TA 3C75A 3EHBB 1GS6X 5EAMA 3X1FA 2XX1A 4UI9R 2PP8A 2EIMB 4YSPA 1FA4A 1GR7A 3WKPA 2EILB 3FM0A 3EI2B 2Q5BA 3WNJA 3SWSD 1MG2C 2QDWA 1XKSA 3ABGA 4EWRA 4E54A 7PAZA 1QNIA 4GY4A 1MG3A 1BQKA 3FQ2A 5JWZA 3AL9A 1ZPUA 2CJ3A 3FT0A 4PBYA 5IC7A 5TEFA 4CC9A 1IBZA 3IE9A 1AANA 3IEAA 4ZK8A 3UR4A 4GMBA 2IAAA 1OV8A 1PLCA 3FS9A 3KRWB 2AH1A 2CN2A 3K27A 5CXBA 4J79A 3PCYA 5TEEA 2Q9OA 1JOIA 2A3TA 3E0CA 4GP5B 3FYIB 3UKRC 4P5SA 4EF3A 2AQ5A 1AS7A 1NINA 3T6VA 3UVOA 3F3GA 1W6LA 2VW4A 3I7NA 1RCYA 4GGDA 4MK0B 2PP9A 1JZEA 2AGWA 3SFZA 4FA9D 5B1BB 5I6MA 3ZBMA 4P5RA 3MKQA 4FAND 3DXKC 1GY1A 2I85A 2UXTA 4L1QD 1S4UX 3WIAA 2Z2PA 1T5KA 2TSBA 4E9SA 3AG3B 4A7JA 4BH6A 1PNDA 5I5IA 2BBKH 3N55A 2H9NA 3CFSB 4JKNA 4DP1X 2XVBA 3DSMA 4TZ4A 1BYPA 3KW8A 1W8EA 4WKXA 1L9PA 4A2FA 1MDAH 4J77A 3FU7B 4H5IA 1KDJA 1OE2A 3OKTA 2BWDA 2FQDA 2GIMA 3GREA 3JAMg 1XIPA 2YQBA 4KOCA 1OOWA 4NB7A 5B3SB 3HEIB 2MTAA 5B7EA 4X60B 1PI6A 1E67A 1ET7A 3EH4B 3V9CA 4O3TB 5EARA 3OMAB 1GY2A 2P9UC 3UVKA 1GSKA 3B7FA 4L9OA 5AZUA 1FFTB 1NIFA 4CY1A 2FNWA 4E9VA 1BAWA 2HESX 3F3PA 1JZGA 3NSDA 4YSUA 1XMEB 2HX8A 2B3IA 2XUWA 1RKRA 3WKQA 1GXRA 4JT5C 3VA6A 4YVNA 4E5ZB 2DWTA 2HKMA 3NSFA 2OIZA 2HXAA 5CYKA 4AZUA 4GGAA 3NJNA 5AFU3 1OCZB 2NRDA 3NVNA 3S8FB 2HX7A 3IN2A 5C2WB 2FT8A 4BXSV 1NR0A 4XEIC 5EM2A 5FKTA 4FAVD 4E9YA 2O9KA 2J57A 3FU7A 2ZXWB 4IA9A 5A2Qg 1OF0A 3C5MA 4HCGA 2H6KA 3JZGA 4PAZA 5FC9A 2JFCA 4GQ1A 1DZ0A 5I6LA 3ASOB 2ZWNA 3OMNB 1E65A 2FQEA 5EMLB 3NJGA 2IH9A 3DTUB 3UAEA 2EBSA 4D0KA 3OL2B 2AVFA 3T6WA 4YVUA 2CE8A 1KBWA 2IWEA 6PCYA 2AGLA 3NT0A 1EHKB 2OK6A 2OJYA 1MDAA 3PE7A 2OV0A 4GM9A 2BW5A 3CVDA 3OTTA 1E5ZA 4BDVA 2DYRB 2YAQA 3OW8A 5FKQA 1JZHA 3NJJA 1E5YA 5K19A 4HALA 3PPSA 5AMSA 3UAAA 3GDCA 1AZCA 2PPEA 2PCYA 1J9RA 4X61B 4K3ID 4LG9A 4A09B 1HAWA 1ET5A 1NIAA 1TEGA 3CDZA 4O3UB 4A2LA 5GMKn 4QKTA 1I53A 4PSXB 4FWWA 4CI8A 1JERA 3J80g 3I7OA 5EM2B 1YLBB 4TXVB 4G70B 1N70A 2AGXA 3S3DB 4J81A 1BYOA 1AZUA 3NSCA 5B1KA 2AFNA 1L9RA 1NTDA 2Q7QA 1SHXA 2IWKA 1WA2X 4PNKB 5B1JC 1R5MA 1OMWB 3ZDWA 1AG0A 3PSLA 3BG0A 2X88A 2XYBA 3KRXB 3FU8A 3NP4A 3QJVB 2P80D 3EMHA 4J73A 2H6QA 5IGQA 1L0QA 2AGZA 3TU6A 3NVQA 1NZRA 1NWOA 4D6VA 3EU7A 2MTAH 3PXSD 4Y7RA 5HE3B 3K26A 3V7DB 2QDVA 4LGNA 2CUAA 1L9TA 2PM9A 4BDVB 1AZRA 3DKHA 2JXMA 4X4KA 3EG6A 4JT6C 4CI2A 2H5UA 2HJBA 2RACA 2YAHA 1GS7A 4ERZA 3UACA 4KO5A 3I7HA 1ZIAA 1XB8A 1V54B 4GQ2P 2OVQB 1HFUA 3CZUB 1IC0A 4HHGA 3EH3B 2DV6A 3NSYA 4BWTA 1SHYB 2WO2B 1AG6A 1VLXA 3X1GA 2FJSA 1L9QA 2XV3A 4DPAX 5AFAA 4GYBA 3L45A 6PAZA 2P80A 4HCIA 1ERJA 4H5JA 2HJ4A 1B3IA 2AH0A 2GI0A 2GSMB 4M3HA 3MX0B 3BWSA 3OKYB 2IDUA 2H14A 3PSCB 5HE1B 2BO0A 2FWLB 3UGEA 1KV7A 4JSXC 3UABA 3FQYA 3NJFA 1PMYA 3C99A 1N6EA 2R7EA 2DYSB 2ZOOA 4XYHA 5TF2A 3UKUC 1V10A 3N0EA 5I26A 1OCCB 4A66A 2YB8B 2CBPA 3X1NA 3EI3A 5CXBB 5I6KA 1NDTA 1NPNA 1J9SA 1E30A 4JHUA 2J57G 2TRCB 2XL3A 3QQXA 2VM3A 1JMXB 2PM9B 4ERYA 3ABLB 3EWEA 1UATA 2CO0C 4Q8BA 4U7AA 3FSWA 4BUJC 2J5WA 4ESGA 4A08B 1ID2A 3CVCA 3MMYA 3RMZD 3IIWA 1PLBA 1CURA 3EI2A 2AANA 3AH8B 4CZVA 2YAFA 4FA5D 1PZAA 3D12B 5HE2B 3ULEC 1SNRA 3NJHA 3AG4B 3AY2A 4UF7C 5I5JA 3AL8B 1WA0X 2XYIA 2Z2OA 1ILSA 4F7KA 3V9FA 4L0PB 4O1QD 4E9RA 3ZIYA 2ZONA 1JZJA 3J81g 4A08A 4ES0A 3IJ0A 5CXCB 3ASNB 5F7BA 3GXUB 4DP0X 3TBCA 2FT6A 4G56B 4DP8X 1R1CA 4A0AA 3ERXA 4KOBA 3FSVA 4CY5A 4YSTA 1GP2B 1ASQA 1IBYA 2MRYA 3IJCA 5IJ8E 4BXVA 5GXIA 1OE3A 5I28A 4ZOZA 3ABMB 3UVLA 5FKRA 1SJMA 2GNQA 1U2VC 1MZZA 4A2EA 2P9SC 3PVWB 1SFHA 2UXVA 1X9RA 4DP4X 1A4BA 2IUVA 4N14A 4G72B 5PCYA 5FKSA 4BWUA 3S3CB 1NIBA 3QJTB 1YFQA 1AACA 1V55B 1SHWA 3NJIA 4IMMA 1B9XA 3JTBA 3I8EA 5FXYA 4CY2A 4G7RB 3I7KA 2GC4C 2AZUA 1SFDA 1K8KC 4JD2C 1PGUA 3A0FA 5LDUA 4L3HD 3FSZA 5KDOB 3MKSB 4CZYA 4DP5X 5B7MA 5GSAA 1PZCA 4HAKA 1X9UA 1A8ZA 5I5MA 4JSNC 1WS7A 4MFHA 2IDQA 4UAHA 5D4IA 3ORVD 2YARA 4YSRA 4JXMA 2IWFA 3H4HA 1SDDB 4AOWA 1SDDA 1ZV2A 4UANA 3I7PA 2EIJB 3PXWD 2GHZA 4WTQA 2AGYA 2W88A 1N6DA 2J55H 4OZUA 4YVDA 5SXMA 3FU9A 3IBOA 2YNPA 3NJKA 4E9TA 3I8CA 4GM3A 1AIZA 5I6PA 5CYKB 4J78A 4Z8LA 2BZ7A 3NJLA 1NIDA 1ZDSA 5I6OA 4L3GD 1BEXA 3RRMC 3OD3A 3S3BB 1TU2A 3CDZB 3S8GB 3EI4B 3JZNA 3NP3A 4AX3A 2P9NC 1A65A 4QRJA 3X2QB 2XX0A 4RH4A 4QLWA 1A0RB 3AW5A 4GQBB 2UXFA 3QPKA 2I7OA 2I3TA 2PPDA 3BVDB 4A67A 2IH8A 2FT7A 4KNSA 4YSOA 1HAUA 2B5MA 3OL2A 3C9CA 5FQDA 3L4OD 3VGZA 5EMKB 1ASOA 3NYKA 2YAOA 3OMIB 3X1BA 8PAZA 1U4CA 3DM0A 3MZLA 2BCJB 1A4CA 1BXUA 4HIPA 2Z2NA 3JRPA 4A2MA 1AZBA 3SN6B 3CG8A 3T9WA 2B5LA 2I3SA 3PXTD 4PXWA 4A11B 2H47A 2PLTA 5K1CC 4A11A 2WSDA 1XHMA 2HXCA 2GB2A 1M57B 2H68A 3QJSB 2H3XA 3CIKB 2GC7C 4JSVC 5GXHA 2XLLA 2YAMA 3AG2B 3WNIA 4YSEA 4X3EA 2JKWA 2I0SA 1MG3C 1JOFA 2B5NA 1BXAA 1JXGA 1PNCA 3PXLA 4KNUA 3X1EA 5F7AA 5IGOA 4A2GA 5H1MA 3HB3B 2PM6B 3NVXA 2BW4A 5E9NA 4AI7A 3N2JA 4FHLA 4X63B 4A09A 3JB9L 1URIA 4DP2X 4G71B 1RI6A 2UZYB 3EI4A 5EALA 4ZOYA 5TK2A 2PPAA 3QJRB 2HRGA 2I7SA 3SLED 2H9PA 4O9DA 1PAZA 1ET8A 4A68A 3UVNA 3ZWLB 4ZOXA 1F56A 2FTAA 3FPYA 4LG8A 3T6XA 1JXFA 1WS8A 5IJ7E 3KW7A 3QJUB 1NIEA 5B7FA 3RN0D 5EAPA 1AZNA 3DXMC 1JXDA 5B4WA 3IKOA 3NJMA 2P9PC 5EMMB 3H4FA 2XXFA 3F3FA 4AKQA 4BL0A 2VSKB 2H47C 3RSEC 3W15A 2CNXA 3I89A 2HKRA 5CXCA 5AJAA 4FA7B 1PBYB 5PAZA 2H3XC 3JT2A 4A0BB 1CYWA 1TBGA 4HHWA 4W9ZA 3GYRA 2QPDB 1PY0A 2CE9A 2P9KC 4GP4B 4O45A 2IDTA 1KBVA 4KO9A 1OLZA 4PSWB 2BP0A 3VH0A 5D4HA 2IDFA 2UX7A 1W6WA 3RYMA 1JMZB 4J82A 5B1JA 2H9LA 2Y69B 2HYEA 3SVWD 4E9XA 1PCSA 2PP7A 4J84A 4AEZA 3OKYA 2OK4A 4GXFA 1GS8A 4N8UA 2UZXB 2G99A 2HX9A 2N0MA 2CALA 1QLEB 2OJ1A 3MXXA 1JVLA 4DPBX 1SQ9A 3TASA 5HYNB 3EI1B 2YAEA 2XV2A 2BZCA 2YNOA 4N4YB 4G7SB 2IDSA 3BQVA 3SMRA 2BWIA 3AZUA 4NSXA 4KNTA 2PCFA 2FQFA 4YL4A 3FGBA 1GYCA 4J0XA 1JZFA 2TSAA 3SCYA 5B1AB 3TA4D 1GG2B 2I0RA 1DYZA 4K9JA 1TEFA 2PM7B 4E9WA 1MG2A 3IIYA 2HRHA 2W18A 2XWZA 4QT8A 4U1EI 2BP8A 2BP8B 4J8BA 2QXVA 4Q89A 1SQJA 2X87A 5THAA 4HDJA 2OCCB 4CSPA 3RLMD 2PPFA 4QL1A 2BHFA 4K3JB 4YSQA 4GGCA 3HFQA 5TK4A 4FA1D 1A4AA 2J56A 2PBIB 2HZHA 4YSCA 3SBPA 1XB6A 4CI3A 2LLNA 9PCYA 3EI1A 3G5WA 5H14A 3RFGA 1KGYE 1GW0A 3I2NA 2XXGA 2QPEB 3FSAA 1OCRB 2P9IC 2XU9A 1JZIA 2AZAA 3OM3B 2UXGA 2YXWA 3ZX1A 4M4RB 4PCYA 1AR1B 2H13A 3C75H 2IUQA 1WA1X 1AS6A 1PLAA 3SBRA 4F2FA 5C9ZB 4J86A 4A0AB 4J87A 1IKOP 2W8CA 3V9EA
chains in the Genus database with same CATH superfamily
5LBSA 1MRFH 4PGZA 2HU7A 4RX4D 1GGBL 2E56A 2CRYA 2JKLA 3N50A 3I50L 2EINB 4XNQA 1IGYA 1Y6MR 3TYGL 3VWJC 5IQMA 5FGCB 1TZHA 4I0PB 1KG0A 2ILLA 3V4PA 3HBQA 1AZZC 1KYDA 1OGAA 1RY7B 1YMHA 2BX5A 2J8UF 1QLFB 1VA9A 2QBWA 5IGXH 1CYGA 2ZIDA 3ARQA 4DNUA 4UOZA 4G9FB 1E7VA 5TF1L 3RVXD 1AQ8A 1JK9A 5AKRA 3ZRSA 3NTCH 1XB3A 3FXIC 4LPUA 1SF3A 4OUOA 4OFIA 4HUVB 2ZX5A 1OWRM 2J12B 3AQXA 3WUZA 3JWNC 2DKSA 5E4IA 4HIJA 3K4ZA 3LQAL 5GS3A 3VGAC 1OE1A 1FG9C 3BN9D 5FYLL 1KWKA 4I3SH 4IIQB 2P4AB 4JAMA 3U2SA 3O4LD 1RULL 3K7UA 3QI0A 2IUPA 3D25B 3AQYA 5AVTB 3T0VA 3ZDXB 4F2EA 1UA6L 3O4OC 5LWYL 1ETJA 2AXFA 1OQXA 1SXZA 1E4XI 1NBQA 2J8UE 1LXMA 3LN4A 4FQ1L 4O2EB 4Z7OB 3ARBA 4U1NB 3ZE2B 4IKIA 4PRDA 4FAAB 3MJ6A 2N1TE 3MNMA 4IJTA 5H94A 3X12A 4EMZA 4OLVH 1J0HA 4OIIH 1AHKA 2EH8L 5TDNA 1X9LA 3EGSB 1KPVA 2BKLA 2D3LA 5F88B 4P4RA 1UGKA 4NZ8A 3N0DA 1HEHC 3C09C 3BP4A 5CIPA 5CIPB 1EAPA 4Q14A 2M2DA 1TNMA 1NANH 4AKOA 1VFOA 1IT9H 4P5TC 5HHMD 5LG1A 3WMQA 1BECA 2C1OB 1EJOL 3MSPA 3H85A 1UADC 2CIKB 1ZVHA 4O9HL 2LABA 2OL3B 3OF6D 1FRGH 2BVQB 3HMWL 1MWAH 4BKTC 1LEGA 4IS6A 4YAQA 2HSIA 4G9DA 4D3CH 2XPGB 1FAIL 3MRLB 2I0TA 4J4PD 4F3FA 4U05A 2HWZH 3S37H 3WKPA 2Z34A 3UTOA 4MAYB 2AGJH 1LO5B 1QG3A 4R7XA 5KS9F 3US1A 3BI9X 4G6KL 4GY4A 5F9WC 4UILL 1GTFA 1M71B 4UM8B 5TE4L 4C56A 3DO7B 4B97A 1CQYA 4LOVA 4FXKA 4Q2ZA 4YHLH 2BNRD 3HPLA 1IGTA 4I5BB 5C6TL 1VFBB 1NGXB 4G11A 2CN2A 2H26B 5CBAA 4YBQD 3GBLA 4RBPH 1PDKB 5JDSA 5B39A 3QG6A 2V7NA 3QG6B 3U48A 1I7RA 3F3GA 1JGLL 4BFNA 5J13C 1I3RB 4OAWB 4NUJB 4U6YA 2ZCZA 4IKKA 3U1SL 5C0RL 3ZBMA 4FAND 1MCQA 5E1IA 1GGBH 1W15A 1A4JA 1ZS2A 5CF3A 1JI1A 1LK3H 4NO0B 2EDTA 3AG3B 3RWJA 3VH8B 5K9OA 2F68X 1KTBA 1YEEH 1LMIA 4XP5L 1TDQA 1AQDA 3WHE0 4TZ4A 2MNJB 4CN6A 1I4FA 1VGEH 3P4OA 1CF8H 4EUPG 4LVHB 4AEHL 2YQ3A 4H5IA 2OW6A 4U33A 5D7JD 3UZQA 1XIPA 4G8IB 4H4NA 4KOCA 3BP6B 6FABH 4H5SA 1OP5K 4BE6A 1PG7H 3WEAA 4NBMA 3UVKA 3OGOE 3EYQC 5EUOB 3RDTD 3WTUA 3IJ7A 4X80L 1JSYA 3UEZA 1OHZA 4CBPA 2FNWA 1BAWA 2X6BA 3ARGC 1LO2L 4FTVB 1JZGA 1KEMH 4FTVA 2HESX 2COQA 4FDWA 5GGUB 2B3IA 3LXAA 2XUWA 3EJPA 3LV3A 2BCKB 4TSAL 1A14H 4KXZH 3BAWA 3FRUA 3K74B 1JHLL 3CFTA 2NRDA 3NVNA 4HOMA 5FKTA 3QUZD 4X9GA 4JZOA 1B0GA 3WN5B 5GS1A 1YY9D 5K9JH 4Y4KB 1FVDB 3JXAA 2Y5TB 4Y4HD 1MNUH 5ICXA 2QPFA 5D1ZB 5CJBA 4AGPA 2V7HA 3VB8A 4Z23A 2GTZA 2J6WA 3FCSA 1E2ZA 1AQKL 4L4VA 4P2QB 5LAPA 3O6KH 4ZW6A 5M5RA 2DLEA 4P46A 1B4JH 2GY5A 1IBGL 5GS2D 2YZ8A 1XH1A 5C0AE 1RP8A 3MLYH 4GSDL 2DLHA 3LZRA 5AYUL 2X4TA 3UTQB 3FUIA 3KDMA 3GDCA 3VGHA 2PPEA 5IJVB 2IH1A 5DVOA 1FZJA 2OULB 5JPNC 4XVUC 1DEEB 1DQKA 1IAOB 1DEEA 1IAOA 2ZXGA 1OTTC 3D39D 4R3SB 1KJ2A 2F1AA 1PG7X 1S5HA 4J81A 4ZUUB 4HFUH 2XQBL 4PS3A 5GJTL 5KYWB 2JH2A 4HH9B 1ODAA 5BXFA 5EZOL 1WH0A 4WK2A 1T2XA 4YK4C 2C5DC 4B0MB 2XYBA 4HS6A 4FFYL 4PJEB 2FCBA 4QXGL 4WTXA 5SWZE 4M9OA 1UVQA 2VLJE 2B4CL 1MJ7H 3N41F 2AGZA 3EQ9A 3BZ5A 4K23L 1DN0B 1GGYA 4OW6A 3VH8G 3VGDA 4LGNA 2CUAA 1W8NA 4WHYG 3GSQB 4NJAH 2QKIB 4G1MA 3N91A 4ICWA 4QHKJ 1QPXA 2EUXA 5BZZA 3H9SA 3G08B 4W4NA 4OB5L 3EH3B 2DV6A 4MTMA 5KVDL 2A9BA 3TOPA 3MR9B 4LSDA 2YLKA 1ESOA 5AFAA 1NC4D 4H5JA 1U8MB 4HKJA 4R6UA 1ERJA 5LKNA 1KWGA 1F58H 3EO9L 1B3IA 1IIIA 1JFQH 1CFTB 2GSMB 4WUUA 3DO3A 5JPMB 1UZ6F 2FWLB 1U42A 4MHHG 1OGTB 2HN7A 4J12A 2VO5A 3TURA 1WP6A 1D7DA 2F5AL 1JDCA 2ODIA 4F93B 2CG9X 3T0AA 1V10A 3DI2B 1A7QL 2VLKA 2XZCL 1TQCB 3FBQA 4WI9A 3X1NA 1HJCA 2WQUA 2XN0A 1F00I 5D2NC 1QLRB 1L7TH 5LBVA 3SKJL 4XP1L 4U1HA 3RVTD 5AENA 5GGVY 2KZKA 4XHQA 2X4QA 5IB4B 4OIIL 1R17A 4WU5B 4EVNA 2GTWA 5EO9A 4O2CB 5I6XC 2YS4A 3HHSB 4OCLC 4F7PB 2X0UA 1LO0L 2VLRA 4P23B 1F13A 2VZTA 2Z2OA 1KENL 1K8IB 2GABA 4X6CF 2WLIB 1SDYA 5I73C 1X7TA 2FJGA 4UNUA 3RPKA 1RZ7L 3VFVA 4TUKH 5F93C 1AD9B 4ES0A 1BZQK 3GXUB 2COVD 1JD9A 3T8XA 4XB7A 1SPDA 3H42L 1TZGH 4X5RA 3RBGA 3VFOB 4OTXL 5L4FA 4H0GA 1R0AH 4E5XG 3X3FL 3KBEA 4YSTA 3BIKA 4P06A 5B21A 5DEGB 3PWJB 3ZZLA 5GXIA 3DV6A 2GAZB 1GMIA 3ZE1E 3DMMA 1QSFA 2OP4H 4O5LH 3UL4A 4ZOZA 2VLMD 3MC0A 3S5ZA 1KYOJ 2XWRA 3WNOA 2K7PA 2BSDA 5LAXB 2YD1A 3U1SH 4CN4A 3CHRA 2CDFA 3ARZA 1P2CB 4BWUA 4K5OA 4YH6A 4EKJA 4LDOB 5T1JA 4M7LH 1KTJA 2BSEA 1QAWA 1R3JA 4KK8D 1G7JB 4B95C 2QGDA 3WTYA 3RHWK 3NCCB 3EGSA 3EOAA 3CH8A 3NA4A 3RAJH 4AW4A 3OKOA 4DGYL 2JLLA 3TJEL 3APCA 2ADFL 3K71A 3LKNB 3R8QA 1E6OH 1FFOB 1IGIH 5HHOA 3SYOA 4MFHA 1FFNA 4HKXA 4PCTA 3HNVH 4B53A 3IVKB 1P4LB 2VDPL 4XMKH 1RK1B 4HBQA 1LNUB 3T4YA 5SXMA 5C09A 1MCRA 3T3PB 1CWVA 3VRJA 1E28B 5CSZA 1KIPB 1WFJA 3S8GB 2P9NC 4U1NA 3ZE2A 1ZHNB 1A0RB 3SZ6A 3QPKA 1J0IA 3WXWL 3QDJA 2KT6A 3MRQB 4TMPA 1PY9A 1AY1L 2HVKB 3Q2NA 3UG4A 5ADPH 3C9CA 3KJ6L 4QTHA 3K81A 2Z2NA 5TJWK 2WIMA 3F83A 3QJHB 2Z7WA 3KWUA 4A11B 3WFZA 3V6OC 2CR3A 2EVGA 4WV1A 1KCRL 2WKOF 5CJQL 1M7IA 4MMZB 4NC1C 4RNRB 3WNIA 2VTFA 3WE6A 4IRZA 4ZQKA 5AUMB 4U1MB 4O51B 4GG6A 3X1EA 5H1MA 5CXPA 4R2GD 1DSFH 5CJXA 1I3RA 4OAWA 5IOKA 3NFPB 4MDRA 1A5FH 1DBBL 2AERT 4ZOYA 2G3MA 1XDTT 3SE8H 5D70H 3F7PC 3RL1A 5E5RB 2IXQA 1TJGH 2HA1A 3ME0B 4RIRB 4G1EA 5E1QA 1KT2A 3SDDD 4IHOB 4P59L 1MIMH 1AZNA 2R29A 4IYKA 2P9PC 1HXMA 4P2OD 4KXZI 4CVUA 3VJ6A 5TF0A 5CXCA 5CLTA 4FA7B 3RI5F 3KNBA 3JT2A 5AJAA 3KYAA 4PQXA 4JEGB 4W9ZA 3GYRA 4TULH 1PY0A 3A6CH 3V0AC 2P9KC 2WYTA 1OLZA 3LQZA 4K23H 3QDMB 1AXSB 2VLRE 4HFWB 4Z3EA 5B39B 2XN9D 1G94A 4YAQB 4DESA 3PGDB 1VZGA 4LHUB 3OZ9H 3EDFA 4L0ZA 3GSWB 2WBWB 3AAZA 5IROA 4WO4D 5A3IC 4N8UA 1I3GL 4I7ZC 3FFOA 4PLOB 2ZUQB 4QEGA 5F9DC 2Y06L 3SKNA 4ZD3L 2Z7YA 4ENED 1T22A 5KN5B 4DPBX 5DO8A 1S9KC 1IFHH 2CNZA 2JKXA 3O6FB 4F7EA 3NRFA 1TMCB 3K91A 4ZDHB 4JFEA 1YNLL 2PO6A 4G7SB 4ORZC 3UYOD 4DK5A 2YD7A 2AKRB 3QCTH 4JGMA 1GKEA 2XY2A 3BWZA 3JTTB 5AYUH 3WJJA 2IWGA 5C2BL 1N0XL 1BFVL 4NNXA 2WJ5A 4GAJH 2C34A 5I30H 1OAQH 2FSEA 1CFSA 4HDJA 2CGRL 4OLYL 1UT1A 2E7BA 3MUJA 1FZJB 3WY1A 1EUUA 3V5DA 1HINL 4GKNB 3K72A 1I8MB 1MNUL 4H0LC 4HU2A 2YD2A 3NN8A 5HPMB 2VLKE 1NOAA 1XQ4A 3TH3T 1PSKL 3CLEL 1QTSA 2DOCA 4LL9A 3VM7A 4DVRL 1TO4A 1BQHB 2CLZA 3RWEA 1YNTA 1OTSD 1K2DA 4M6AA 3TNMA 2ED7A 5KWYC 2XBDA 1NMCB 4B50A 4F57H 1IGFL 2J6EA 5C09E 2VQ1A 5D1XA 1JF6A 1IM9D 3SKJH 3V9EA 2CJUL 1U8JB 4ZO9A 4WLCA 1LE5B 1CDHA 3V0EA 1U3HA 3OR7A 3WSQL 4H88L 1X4ZA 4WO4B 5E94B 1P22A 5JHDE 3TFKC 1ZSHA 4ZOEA 4KHTH 3ARVA 2QADC 3FT1A 2CN3A 1WZKA 3V5HB 2VWEE 1YEIH 2ID5A 1RJZA 1PAMA 2OVPB 5D7LD 2R15A 3WN5A 4PMFA 4EQ2A 4LCWA 1KCSH 1Z5LB 4QTIH 3W82A 3DWLC 5IFJA 4FXGB 2V2TA 4A2DA 3TGXA 2V7HB 5CJXC 1EXHA 1OGTA 2HN7B 5IHUL 1HZLA 1MFCH 4Y4FB 5MENB 1HOCA 4XCEA 4XCEB 1MLCB 4UAOC 3RL2B 2Z31A 4LLQB 5T1DL 4JW3A 1G6RH 3TEYA 3QZBA 1XGQA 1YUKB 5HI5C 4L8DB 3OKMA 2GC4A 5EEVA 5EHFA 3FPXA 2EXSA 2XRAH 4JB9H 3RZCB 2Y36H 2A7BA 4CZXA 4G7QB 4LLVA 4UCFA 1GC1C 1N0LB 1DJGA 4JO3H 3LIUA 1RP9A 1TVHA 4XB3A 2WTOA 2CJTA 3LH9A 3OZLA 3BDBA 3VSTA 3ZR5A 1NICA 4NC4A 2OQJB 2VM4A 5DZAA 3QXTA 4LXFA 2Y2WA 3ZL4H 4G42A 3B2VL 3BSGA 1HOEA 1KTDB 1QVOB 2OMBA 1EZUA 1E9PA 4QRFA 1KYAA 5HYEA 1XAKA 1FVEB 2R1WA 2Q7NA 5FA4B 4NHCL 4AEHH 1R3KB 2OXHB 1H3PL 1E4HA 2R7EB 4HCRA 4WSJA 5KOMC 3FQUB 1YHPA 3VFWB 3BP7A 3PABB 3FT9A 1AQMA 5SV4A 1OK8A 3B9EA 1JPTH 2OMXA 3K1DA 4Y2OB 1XF1A 2QC5A 3O3AB 4PR5A 4QY8A 1DVTA 3HI5H 3KPSB 5EBMB 3S5YA 3CQPA 3EHBB 4WJKB 1AKJB 4GKSB 3BZ4A 5SWSB 4OQ1A 4P4KA 1N8ZB 1SYSB 4AWJC 1JHLH 2Y7LA 3N3EA 3EJRA 7PAZA 3VWKC 1TQBC 2XJLA 2EE6A 1IB5A 3M1BA 2EC8A 1A9EB 5DS2A 1IEAA 1CGVA 3O2DH 4AM0B 1CXFA 1LO2H 3RKPA 1ZPLA 2AH1A 2P47B 3CLWA 3NK3A 2ZICA 3B3BA 4J79A 2O5ZL 3ZO0A 1FL3B 2IIJA 4JO4L 4AOFA 3UKRC 5E2VL 2VW4A 2ZXEB 3BIKB 4L4VE 5TE6H 5I18H 5KVEL 4OJAA 3DECA 2DIEA 2C8NA 2Z4QB 4D9LH 5C0IA 3AC0A 5CINL 2QFRA 1QOKA 2NT0A 4JQVC 3RNQA 1BVKA 2D03L 2H2SC 3G5YB 3F7VA 4N68A 4P2YA 4DP1X 5B38B 1I8LC 3ZKXC 4CJ0A 3HC0B 1RUML 2WANA 2PR9A 3DTXA 1IL1B 2FQDA 2F74B 4HUUB 1T0MB 4LARH 4RMVA 3DGGB 5JOEA 4MJ4A 3HCVA 5B3SB 1AKPA 4QRAA 4X60B 2YBRB 1E67A 3VI4B 1ET7A 2DM2A 2FO4B 4OCSL 4JRFA 4Z7NE 3JV0A 4XPHH 4BYHA 4I1NB 5BRQA 3CFCH 3VG0L 4L5FH 4JE4B 3SDDA 2LE9A 3I9GH 3D18A 3BKCL 2B16A 4HKZB 1PLGL 2E27H 3D33A 4ZO6A 4U1MA 1EEZA 2D03H 3EH1A 3FO9B 3I75B 3QG7L 4K3GA 3D0AA 4E5ZB 4ZMAT 1DCLA 3EHBC 4PRIE 1Q0XL 1AXTH 5HGDB 4K3EL 3ESOA 4HWEL 3ATFA 3HJEA 3B1TA 1NR0A 4NQDE 4PJFF 4X4XA 5F9WB 2XTJD 4XWOC 1VZHA 5HVFB 1A1OA 2WXQA 3BP5A 2FQEA 3OAWA 5B39G 3ULVE 3DTUB 1GCFA 4IGBC 5EMLB 4D0KA 4WI7A 1CLYL 1CXEA 3JWNE 2EYRA 1O9WA 2Z6FA 3T6WA 1JNHB 4R4BA 4J3XA 5AW4B 3L7FB 3SJVE 5IVNA 2E27L 2VJ8A 2JXMB 1KBGL 3K80A 2YMOA 1WFOA 4NRYB 1F4AA 4FFZA 3WHXB 5L7XH 4TN9A 4Z3IA 5J56B 4B9FA 3E6HA 4AITA 5FO9B 2GW5A 4K3ID 4LLMA 2HPOA 1J1PL 5EWIH 1YPZB 1TJHH 1RU9H 4CVZA 2Z4TA 5EM2B 5T3XH 3S3DB 4DKAA 1HZKA 3MRRB 4JKPH 1J8KA 3ZUCA 4MA8H 5H37H 1FNFA 4BFJA 2JK5B 3QUYC 5JZ7D 1R5MA 4G1EB 5C2UB 4TQEH 3KRXB 3NP4A 2QZ5A 4X0KA 1ZVSA 4HA1A 3HHMA 5ECGA 1BWMA 5BCAA 3GBDA 4D6VA 5CZVH 3CK0L 2MTAH 3JTTA 4KUCF 5BO0D 5FK9A 1AZRA 3MBWA 4Z77A 1JCVA 3TBSB 1MCOH 3PDOB 2ENQA 4PG9B 2CLRA 1ZIAA 4RA0C 3NQKA 5HI3D 1LEIB 3CFKA 1TZ8A 3HE6A 4NUGH 1ZLWK 1SHYB 1SEQL 4IIQC 4XI5C 4IKNA 3KBFA 1L9QA 8FABA 2YFNA 4M61B 5KYUB 2P80A 5C0GB 3MLWH 1DP0A 3NFNB 5E95B 2HJ4A 3LX9A 1TQUA 2CH8A 1FNGB 3PWPD 2AXHA 4LLYB 1WYJA 2YPKB 2YPKA 4KQ4L 1FSKB 1J8HB 4QXGH 4XMWA 2R0LH 1C8PA 3EDDA 4K3DL 1E8WA 4QOKD 1PMYA 2OMZB 2OMZA 4GLRI 4PTTA 2ZOOA 5EOQL 2F53A 2VN5A 2H3NB 2Y5QA 1ZK9A 4PRPA 1OCCB 5IW6A 5AD0A 1U8PA 4JHUA 4WAFA 5EU6A 3VG9C 5HHPA 2J57G 3LH2H 2WYIA 4HJGA 4C56D 2K8MA 3CFQA 4XNMB 3ZE0F 2CO0C 4JY4B 2GJ6E 2IMNA 1TYEB 2VR5A 3TX4A 1J18A 4NKDB 3DVGA 3EO9H 2VDLH 3MLXL 1IJ9A 1EFXB 4AW7A 4G8GE 3EI2A 3FU3A 2YC1B 4EQ3A 2VNCA 3NIGF 2XQ0A 3I9IA 4UI2A 4GKNA 2WSKA 2E7CA 3CPLA 3SE6A 1MCIA 1G6RB 5DURD 3SDXB 5DQDL 1ZE3C 4FMKA 4IBVA 5C0JA 1C7TA 5E1HB 5KS9E 1UURA 5CN2A 3VXTB 3G5VB 1Q9LB 5C08B 3WNMA 1FC1A 5GGRY 2XRAL 1M3IA 5IJ8E 2YK1L 4XNQB 2BRRL 5LGJB 1QI5A 4Y5YC 4PJ7E 3OKDA 1IC7H 3QZWB 3L4VA 4Y19D 5FR3A 5TQ2L 2GNQA 4ELKA 1R5WA 4Z3JA 5I1LA 5IFHH 3HZKB 5JTWA 4KMTL 3OXSA 2YA2A 4O2FB 3MACH 1BDYA 5KAQF 4JK0D 4PCKA 2P48B 5EC2B 2O6CA 4WK4A 3QJTB 4PLKD 5I30L 1V55B 3NJIA 3P1VA 4I3RL 1N64H 3T3MF 3ES6B 3UBXB 2AZUA 1ZTXL 1BZOA 4NO2B 3ZKQD 4AUUA 4DGVL 5E5UB 5KDOB 2KUTA 1C12B 1G7HB 2AQTA 3OB0K 5GSAA 1N0XH 2OSYA 4AVKA 3QNZB 1WC7B 5AALA 2QSCH 2X0VA 2XG5A 4L9LB 2AV7A 2C1PB 1MCFA 5DHYB 4HZAA 4JCLA 1U2YA 5L6YH 5IUSA 2P1YA 4UANA 4FFYA 2Z31B 4XE5B 3D2TA 2QLYA 3SYQA 4DK6A 4KV5E 4FI7A 4KMTH 4X8GA 3LNFA 4HJ0C 2CMRH 2RH0A 2W0KA 3G5XB 4C4UA 2HRLA 2NW2A 3BAXA 3CDZB 4UQDA 3RVUC 3HN5A 3BKYH 2MH4A 1A14L 2VR7A 2ZWYA 4OF5A 4UV4H 5GRZA 4W4OC 4XE0A 3L4OD 5BRPA 3ML8A 4HIPA 5HSFA 4ZUVA 3IDJA 3BVVA 4PXWA 4AC4A 2H0PA 4ANKA 1M57B 3U83A 3VXQB 3UC0H 1CIUA 2UY7A 1TQCC 4HQQL 4JFEE 5AB0A 4QLRA 1AMYA 1HHGA 4LSVH 1D5IH 1BFOA 2EDMA 2R4SH 3KPLB 5LBGA 2IPUG 4MZIA 3DX4A 1RFDL 4AMKH 5DJ2A 2OW7A 4XAKE 5E00B 1R3HB 3FDWA 3LH2L 4OGZA 5E00A 1JPEA 2H9PA 2EAEA 1OP3H 1ZLSL 5HYJD 4HUVA 5GRYA 3BPNB 3QULA 1IT9L 4KDVA 3T6XA 4FQXA 2BFVL 2K3HA 3O6MH 2ZYSA 4MCYB 5SWSA 1SBSH 4LCCA 2AJXH 1J1PH 5EWIL 5AB2A 1WO2A 3KR3L 4GRWF 1FH5L 1U3JA 4YFLI 5GGTA 3X13A 1FVEA 3SO3C 5DVLA 3I89A 5E2JA 3WJMA 1TBGA 1LP9E 2ZG1A 4QHNA 4NUJA 3E8VA 3MI6A 4KK6C 2LOEA 3DX6B 3RWFA 3CVHB 4OKVB 4R5VA 4BZ2L 2OR9L 1PCSA 3QFJD 2OK4A 4OD2B 2IV8A 4P48A 1G7IA 2CALA 3MXXA 2DYPB 1DDTA 1DSYA 3D30A 4Y1TA 3JWOC 2VO8A 4ZSOE 2BSCA 3SODB 4CC0A 2BS9A 4K7FB 3T3PE 1TO5A 1I1YB 2ZKXA 4P57A 3MV9B 3NTCL 2LFEA 4PRIB 4X8XA 3J2PA 1Q0YH 1ZWIA 3GSUB 2ADFH 4S0HA 3BJLA 3NCJL 5EC1B 4IU2A 1XBRA 2NZ9C 3P11H 4E9WA 3LZPA 4J4PC 2EVIA 5IJBC 4MRBA 2BP8B 5BO1L 3IAGC 1QBLH 4FFWD 3CE1A 4OZGE 3U4KA 2K0RA 3M17B 4U7MA 5FFOA 2IQAA 3FB5A 4YHMH 2XWJA 2ERJB 4X6CB 3HFQA 4OCXH 2ADIB 4JGUA 3KJ6H 2B0SH 4L1SA 1OP5H 1INQB 3C08H 5AW5B 3ZMEA 5CN3A 2A1WL 4KVCL 4L8BA 4EDWL 3VGEA 4UT7L 1AR1B 4YS4A 3DDGA 3QO0A 4ZFGL 3C9NB 1HWWA 3OX8B 1UJ3C 1S7QA 3TFBA 1O7SA 1OAKL 3GMNB 3VRLF 4AN0A 2YBRA 3VI4A 3O8XD 5CJOL 2B1HL 4RAVA 5TE6L 3BQUC 4PHXA 2IURA 5GSVA 1XTLA 3IXAA 4OZIA 2VW7A 4QRPA 3CH1A 5C3TA 5TE7L 3UGUA 1ED3A 3BSHA 2CPCA 3GXPA 3QIBC 5IEKA 4P3WA 2WBXA 5F7EL 3FYEB 4NRZB 1NCHA 1CXKA 2V3FA 5J5EA 2I26N 4HV8A 4EAEA 4JM2B 4OQTA 4PGCB 1OK0A 2QR5A 1JV2A 4R3SA 5C2VB 3BAJA 4OJEH 2PYFA 5DHEA 2O61B 2WPGA 4AQ1A 5CBEA 1L9OA 4IKLA 1JJUB 4NUPA 1OWWA 1S3RA 4GUCA 4LRNH 2EVFA 1A2YB 2EABA 3QUKA 1WIOA 2VGLM 3ZE1A 5DJ6A 3DPBB 3FZUD 3MRGA 1W72H 3MRKA 2AQRA 2CBTA 1XGZA 2AITA 1KDIA 4G6JL 4CDGC 3U30B 4ILDA 4BH7A 2AF2A 3N41B 4LCCC 3HE7C 4W9HC 5KBPA 3QUZC 4GFTB 5AAPA 5I17B 4MNGE 5DZOA 2NSXA 2EACA 1U91A 1UFUA 2IADA 3TXAA 5A2BA 3K0YA 4UINL 1AR1D 1D5ZA 1PTZA 2QQLH 3JT0A 4GAFB 1AC6A 1U8MA 3RA7L 4DP7X 3PNRB 2CHDA 4NAJA 1IEHA 3AXLB 4UIMB 4E54B 4P2RE 1NC4B 5DRWA 4L18A 4TQ8A 5CZXD 2VMDA 2IPTL 2WLLB 1WZAA 4WJ5A 4AQAA 3F8UB 1BQLH 3R4DA 2EEBA 1H2XA 1FNAA 2WC7A 3CIAA 4U3CA 3T2NL 4PTTB 1V8HA 1I85A 1ZT7A 3A67H 1ASPA 4NKMB 2J6EH 3ZKND 4CSTA 4ZN4A 1C1EL 1YJDH 1N8OE 5IW1A 3LEXB 5IB5A 4KZEL 3GBMH 4E9QA 1NKOA 4ONHA 4KX8A 4OLZH 3BSZH 3FH7A 4HWUA 4N0FB 3V6OA 2EADA 3LPFA 1MCPH 3EFOA 5LGHL 1SBBA 2IANA 1GR7A 3EI2B 3DJZA 4AMKL 3SWSD 4NWUL 1T6BX 2EYTB 6TAAA 2X38A 3PHQB 1I3UA 3CFDA 3T0EE 1BQKA 2Y72A 3AS2A 4Z7UA 3UJJL 5JWZA 2CJ3A 2BNRB 2XJKA 2DZEA 3IEAA 4XAWL 3BRFA 2BNQA 1TQSA 4BSVB 4Z76A 2WY3B 5CXBA 4L8SA 2XN9E 5TEEA 1WITA 2ZSWB 5DEGA 3W57A 1TR7A 4NYLB 4NCDA 2RB8A 4OF6A 2VKXA 3UPAA 5ABZA 1U0QA 1UGNA 1OIOA 1C1EH 4ODTL 1ZY9A 4WI5A 3MKQA 3M07A 3HC4L 4NLAA 2R0LL 1U8KB 3RWCA 2RAMA 4KQ4H 4GO8A 4ODWB 2WJ7A 3BJ91 4L4TD 3GMQA 4YUEL 4G7YH 3GK8L 3ZGIA 2XVBA 4CW1B 3MCLL 1FGVH 2QV4A 5EPMA 2E6JA 4ADGA 1HINH 5K39A 5JNYA 2F6AA 2XN2A 2BWDA 2X1WL 5DCCA 2GFBA 3ESVF 1IRAY 5ANMB 4YZFF 1ZOXA 2HRPH 3ZT6A 1EDYA 5IB3A 5BW7C 3ARGD 5FKAA 5BV7B 5F7NC 3OMAB 1GY2A 4HXAH 4XN5A 5FHAL 3IWVA 4U1HB 3DX9A 1J0YA 2B9BA 4AL8H 3I6LE 1TMQA 2FX8L 1L7IH 3U7WH 2F54E 5J11B 1NAML 4FXKC 1FLRL 2BVOB 3FRPA 1YY9C 3FRPB 1VERA 4YPJA 3QISA 4Z0BL 4DWHA 4D9RE 1EZVX 5A6IA 2EO1A 1AGCB 4KXCA 3C5MA 1UWYA 3WIHA 2JE8A 1BG1A 5FYLE 1E90A 3VFUA 4YHPA 4K7PX 3T8XB 1E27B 3RIAF 5FO2A 5ACZB 2NLJA 2AJSL 3QI9A 3ZJAA 1R5IB 3FQRB 3U2SB 1EHKB 3D25A 4OZFA 4FYRA 2XETA 4IBUA 3DMMB 3OTTA 4N6RB 4JN1L 5JW3H 5IMOB 4TYUA 3WE6B 5I16A 1ZD6A 5F6IB 5ITFA 4D8OA 1HCVA 2OMNA 4BSJA 1MKFA 3R8BB 3SBWA 2JJTA 3CDZA 3GTVA 4P46D 1AP2A 4OCNC 4FI6A 4MX7B 1I53A 2BVTA 3IJEB 4XHJD 3DWTA 2QJDA 4OCWH 4PBXA 4OGYH 2AGXA 4LLWA 3ARGB 4H1LG 1AXTL 4Z7QF 2Z8SA 4MSWA 3Q8AA 3RFZA 3RFZB 1XF4B 1AG0A 3OXRB 3ELAT 4JG1H 4X7FC 4L1DA 3ZRFC 4LCCB 2D8KA 1IFHL 3NIDB 1L0QA 3TU6A 5F7HA 2QTEA 3LPGA 3CQQA 4G9FE 4P5MB 5F2FA 4Y7RA 5GS1C 2APFA 2NUPB 5DUMH 3VM5A 4CI2A 4EN3C 1T04B 5D96B 1K3IA 2OVQB 5GS0L 3N44B 1QUPA 3HAEG 5MEOA 5DJ8B 1U3NA 3VNZA 1HH9A 2A0LD 1U58B 5ESQA 3WY4A 4F2ME 4CC4A 1IQWH 3UPCA 2FLMA 1H8OA 1SEBA 2OSLA 2GIYA 1JAEA 3QIUB 2HT3D 1KTRL 4HIEA 2H2PC 4HPYL 4JFOA 4U1LA 5EU5A 3BWSA 2X09A 2YPLE 3DV4A 5HDLA 5J6HA 4HWBA 4HZLB 4UDUA 4YR6B 2H14A 2R9HC 5I15L 2CCVA 1JHTA 1KXQE 3NJFA 2J8UB 5CEZL 4Y5XB 1G84A 2DD8L 2WVSA 3COOA 5IBTH 1UQSA 3V4PH 4J23A 4W9CC 3KEHA 4JFPB 4LU5H 4ELMA 2YB8B 2I32A 2W9DH 3LZFL 5JYMA 4A7QA 1LO4H 4AGQA 3QQXA 4GS7B 1DANU 1TXKA 4ZRGA 1KUMA 2PM9B 4YZWA 5A2AA 4QHLA 3EOTH 4YK4B 4GNKB 4HBCH 2KC0A 1G1OA 1QZNA 5FWQA 5I0ZA 4FLQA 2O72A 2VDRL 4LIQE 3JV6B 2EDJA 5AZ2H 1Z9LA 4IDLA 3HZVB 3U4EA 3NJHA 4E9LA 3O4JA 1AQDB 3NIGA 3A6BH 4GI9A 3P4OB 4MAYC 4BJLA 2YO3A 4BH8A 4A55A 4MJ5A 5D2LF 4L0PB 3OKNB 3EXJA 4E9RA 3J81g 4A08A 1KTLB 5CXCB 4I48B 5F7BA 4BA8A 4DP0X 1NCJA 3DDUA 1U8JA 4X9YA 4KRPC 4PJ6A 4Y7OC 3TA3B 4A7GA 4BCBA 2NY6D 2HT3C 3MFFA 1FYTE 1TUPA 1Z9SB 4KJYA 2FDBP 1QBAA 1SUHA 1JL8A 2YEZB 2OYKA 4J3OH 3VMOA 1KJMA 2DQ6A 3KPPA 1ZLVK 1UWGL 5DMYA 5I66B 2JJSC 4DN3H 3GLEA 1FLTX 3RKDC 2DQHL 4EN3D 1P5VB 2JELL 4F20A 1NOFA 1WAAF 1I8UA 1QR1B 4LDEB 3I7KA 5E9DE 1DQMH 1RQ5A 2VQTA 3CIQA 5DD6B 2ZKYA 3FTGA 4LHUG 5D8JL 4WNQA 2XY1A 1X9UA 3H9HA 4M7KL 3S2CA 3WMSA 4DKDC 5A1AA 1GZQA 5E6IC 1B6DA 1IEBB 5BO1H 5KSBB 5CLYA 4FQ2H 1K72A 4NT6A 3VXUB 1ZV2A 3H7BA 3HFML 3I7PA 2DI9A 3PXWD 4H26A 4LARL 2ENYA 5DVPA 5JW4R 5HVGB 4BINA 4XOBA 1U8IB 4QRSB 1VSCA 3HG2A 1Q38A 4PP1D 4PV8B 4H8WC 5T3ZD 4QRJA 5EU3A 2FWSA 4DEWA 4RH4A 5T1KA 2VAJA 2CUMA 3U7WL 5KW9L 4CGTA 5LVEA 1QHOA 1BVNP 2F5BL 3BVDB 3LHAA 2DQGH 4A67A 1QABA 1ROWA 1Y0LA 3D0VA 3GRWH 4FHBD 4FG6D 4ONGH 5IESH 2K7QA 3NYKA 5KSVA 2IMMA 3PHQA 3JWOL 4X5QA 1KB5B 4PD4J 4M1CD 1K4CB 2WO4A 4PYGA 1NGPH 1T5XA 4IMKC 5GXHA 3VRIB 2XKNB 3ELQA 5FW6A 3QEUB 1XIWC 5DR5L 4NQDA 4U1SB 3RX9A 4HGWA 3SPCA 2X28A 3BVWA 4NNPL 1JI2A 5E5MB 1YY8B 3MR9A 1KXQA 4F58L 4PGEA 4PJDE 3ROLB 4PJEE 3L3OA 4W6XB 4CGUB 2AHIA 3AFLA 5EORH 3V7AG 1QKZL 3TO2B 4F7MB 4YHOL 1F56A 2FTAA 2GT9B 3FPYA 1AGBA 1WS8A 2OYLA 4M02A 3BKML 3LKRB 1KELH 4TV3A 1WBZB 3UH8A 3RN0D 2BK8A 1FORH 5EMMB 4G6AD 3CFDB 3OG6B 4C58B 2LU3A 2AEPL 3BRDA 2R0ZH 1HILA 2GSGA 1RZIA 2WXRA 2Z31C 3MMEA 2H47C 1MH5B 1XGQB 2FX8H 2JKIS 3W15A 3O9WB 1PFCA 1QASA 2DMHA 3U9UB 4NGHH 3HG5A 1V3LA 1NUGA 1NMAH 4XH2A 3SPHA 2HTLC 1YEDA 1RUPL 5LUMA 4L37A 5DHMC 4WHTA 3KYNA 2D0HA 3TIDA 5F3BA 1Y7VA 3C09B 1QA9A 4MD4B 1TPXC 3F85A 3QZMA 2HYEA 4ODUA 1FL6B 5L4JA 4QOKE 4X50A 1UD6A 4PV9A 2EDRA 4FOMA 4RGOH 3O6FD 4XHJC 2V8MA 5CJ8A 3DVNA 3DBXB 4XVOA 3DBXA 2Y6SD 4OCRL 5HYNB 5BRZA 2YNOA 1K8DB 1UHVA 3OKLA 1JGVL 3DO4A 4NAMA 2EO7A 4BUGA 1HYSD 1QSFD 3KCPB 1R75A 3W11C 1M05B 5JIIA 1LWHA 4PG2C 2Z1PA 5KUKA 3GMPA 3V7MA 4FG2A 1JE6A 3ARFD 5HDQH 3RDTC 2F61A 4U1EI 3QCUL 4WKZB 5I8EB 5C86A 3CDFA 2N3JA 2X6AA 1EZVY 3BVNB 1DQDH 2QR0A 2JCCB 1XH3A 5T1LB 5D71H 4HOWA 3QCVH 5JQ6H 3TYFA 4X5WB 5IQOA 3SBPA 2X4PA 3E8UH 4MJID 3NA9L 5EIIG 1UEYA 2NUTA 1USZA 3AADB 3QHFL 1LK3L 4ZUSB 1QFUL 2ATKA 4FCHA 4K4KA 3ECBA 4M4RB 2IUQA 3SBRA 4F2FA 2W80C 3GHEH 4ZTEA 3OJMB 1FFNB 3IMUA 4ZD3H 2X1OA 1VZ3A 2MKLC 1N67A 3MV8A 4JHVA 4YBLC 3ZK0A 4F9LC 3PNWB 4PJIB 4MLIA 1OCOB 3H56A 2EDYA 5T1MA 1WBXB 3LKOB 3L5XH 3TWCH 3HOGA 4MXVF 2Z4QA 3MRMA 1IGCH 4NJ9L 4YDJB 1KG0B 3WD5H 4QO1B 2O93L 4JO1H 4NIKB 2BMKB 1YEJH 2Q8BH 3CC5A 4PCSA 2QMJA 1Q94A 4G6KH 4BCXA 3R7QA 3II1A 4X5XB 4BQ8A 1JIBA 1O9VA 3VFSA 1UT2A 1CR9H 2B1AL 2WNKA 4QHUB 4XBGA 4HWBH 3DX8B 4BSWA 4C55A 1U92A 3FZUC 1WRFA 2CO3A 3RURA 3HCVB 2YMUA 2XU7A 4NQVB 4XCFH 4Y4FD 5DGQA 4GKZA 4D2NA 2SODB 5ABDE 4IBYA 1RMFH 1FRGL 1NEXB 3KGUA 4PBWD 3D85A 4XNDA 3LS4H 3EKCA 1U4FA 3GMOA 4C47A 3RZCD 1M56B 2FD6H 2FE0A 3GS7A 4GKLA 2CCWA 3ARBB 4AYID 3PWPA 2OX5B 4GXUN 4NNYB 5IZ7A 4HOZA 2HVBA 1B3JA 4YLQT 1SVZA 4PB0H 4YGVA 1NCAH 4J8GA 4EZKA 3IURA 4JREB 3D5OF 5IVOA 2Y24A 3TBBA 2OTPA 3FOLA 3QQ4B 1OSPH 1XF4A 2O6PA 3OXRA 1ZIBA 5C07D 2VSCA 1QFPA 3IF1B 1P6FA 3OSKA 3VXRE 4CSZA 4FA4D 2NW3B 3CDGB 4M56A 1DJIA 1CGSL 3EYSH 5DO2C 1BAGA 1QI4A 3ARSA 3RUGB 5F7DA 4OM1H 1V7MH 4ELMB 2IAND 2WN2A 4TS6A 3ABZA 3ZN6A 1E28A 1JG9A 5CSZB 4XC1L 1GIGH 5D1ZC 2N0KA 3ARRA 4NQCA 1KENH 3VXSD 1ETZA 4PRDB 2AK4D 3WIFB 5LQBH 1FHNA 4PJCB 2XV6B 3V7AE 1VZ2A 1FA4A 2GG1A 1MG2C 3K6SA 1X3DA 5IGXL 3RVUD 1YQ2A 4A6YA 5KTEL 2WCGA 2VKWA 5IM7A 1OTUC 4ZXBC 3R1GH 1XEDA 3ATAA 1U30A 3VW3L 2AJXL 4L4JA 3BDYH 4UT6L 3RJDA 3K27A 2DQIL 5KVGH 2DLGA 2CJSA 1F3JA 3G04B 3EYOB 4JLRB 3MFFB 3CMOH 4FFZH 5LBSL 2E6QA 1MRFL 3HI6H 3WS6A 4AH2B 5I6MA 3L3IB 4MS8D 4MMYB 5LGYA 1A4JB 2AW2A 5DWUL 1S4IA 1T5KA 2HTLD 3R06B 1BVNT 1OANA 4UQ2B 4QCIA 4IBLT 3V4PL 5BMFH 5BOZG 5DQ9A 3MZGB 3ZDYB 3VWJA 3VD2A 1ZK5A 2CCLA 4PJAA 2VDNA 1K2DB 1W0VB 4UTBL 5KOVC 5K9KB 3GREA 1NFDF 4TUJB 2B1AH 5ACMA 1U6AL 1JP5A 25C8L 1TOXA 1YN6B 2X89D 4L3CB 4PJCE 2QZQA 3RIAK 2A4EA 2NY5H 1S78D 2AV1A 3OLIA 5DFVC 4CY1A 1MFAH 1QRNB 3HMXH 3CFJA 2HX8A 4JFFE 4KZCA 3WKQA 1GXRA 4QXUL 3VTAA 4DH2A 3GO1L 4JZJC 4KZDL 3L3KB 3NSFA 1ZLUK 3K6DA 1REIA 4A6YH 5C7XL 1UD2A 2J25A 4P9ML 4RGND 2XTJB 1FDLL 4M8RA 1X5HA 1TJMA 4S10A 4LGRB 1XCWA 3S2AA 4E41E 3QHTC 5LDSA 1GOFA 3QRFM 2A4ZA 4YMPA 5DFWH 3NIFE 5J12C 2HJKB 2N7AA 4RMUA 4TUOA 1BX2A 5IJCC 4RAUA 3MYZA 1QBBA 3VI3E 1EANA 2DF3A 4DW2H 5CCKH 4NUMA 3TIEB 5J57B 1T4WA 1YEGL 5EEZA 1CFSB 3MACL 4TNGA 2AK1L 3WFBL 3LEYL 4L37B 3TC9A 4F8LA 3AGVA 1XSKA 3Q1EA 3VFNB 1AO7A 4N0YL 2QL1A 3RY6A 5INCB 5JIPA 3HRZC 3HS0B 4UB0L 1DVFD 1OM9A 4DUXA 3AM8A 4FLHA 4TXVB 1A3RL 4MWFA 4H8VA 3II2A 5F0JB 3QIBB 1BIIB 4AYFA 5IV2A 1H3WM 2Q7QA 3RIFF 4PNKB 5E8DL 4TNVF 4OZIE 2ZAIA 4N0RA 4WUUB 1T7YA 4OIBA 3LQMA 4GXVH 1XX9C 2OMWB 4PS7A 3K46A 2YOCA 4XNAA 2PTVA 3B83A 3O41A 3ZE2E 1VENA 5AW9B 2MCPH 3EG6A 4BDVB 1JDAA 3DKHA 2IV9A 3HN8A 3EJJX 4MAYD 4KO5A 2R2BA 3GD1I 4HGWB 5CSBA 3CSYA 2NNXA 4DW2L 3C5JB 4I4WA 1HFUA 4ETQB 5CCKL 3O6LL 1JMZA 3KPSA 1EAOA 1MHCB 5K9QI 4L4TA 1O6SB 4HCIA 2JCCA 1BFSA 2APBA 2TRHA 1ID5I 3TTSA 4OB5H 1HNFA 1YZZA 4H0IA 3RX5A 1E6JH 4JFYB 2VT0A 5FM8A 4BQBA 4F27A 4YDLB 1XF2A 1UXWB 2JSFA 1WFNA 4RDQG 5ISZA 3UABA 3W11D 5CD3A 5FB8B 4D94A 3GI9H 3KYKH 1IJNA 5KBMA 4BEIA 1J05A 4GG6E 3FQTB 3MCLH 1YCSA 1MHHA 1HHJA 2DYSB 1RIUL 3INOA 2P8PB 2D9QB 2JJSA 2OA9A 3OB8A 4DNVA 4NI6A 3N0EA 1ZHLB 2G2RB 2HG0A 1RJYA 2CBPA 3B2UD 5BQDA 4PG2A 1J9SA 1E30A 2TRCB 2OJEA 3MKKA 2XL3A 4M7KH 3MRBA 2QEJA 1CG9B 1BD2B 2RR3A 2WXJA 3V4UH 3QUYA 4IEFA 3UEQA 2VXVH 3CVCA 3AREB 5M61A 4H8WH 4AZ8A 5FYJE 5EF3A 3GEWB 1YEGH 2JI1A 3BEWA 5EBGA 2EEFA 4HKJB 1Q94B 1BMWA 2JB5L 3J7HA 4DZBB 2WBKA 2WXKA 1BPVA 2V6HA 2DM4A 4S11A 3PHAA 3T2OA 1WUNT 1IL1A 4NGHL 5I1HH 3HE6C 4F37F 2EXWD 3ETSA 4BFGA 5AKVA 2VXSL 4ERSH 3GHPA 3CN0A 5I1DB 1W0WB 1KPUB 2HT4D 4KHTL 3JBG7 1XO8A 2R69L 2WVVB 1KEGL 3NPZB 2Q76A 3WNPA 4AEIH 1HHIA 2PYEE 5EOQH 3DX7B 4ZNEA 2DH2A 1D7CA 1T6VN 1KB9K 2CUHA 1N5AB 5IB4A 1ITCA 1JZ8A 2GTWB 5EO9B 2L7QA 3V95A 1L4IA 1INEH 5FO8B 5L7XL 1O0VA 5FKSA 1SN0A 1JVKA 5LB1A 2O61A 2AEOA 1NEZA 1I9RL 3I8EA 5DGRA 5FWRA 1FNSL 5HDWA 5B7MA 3AS1A 3KVPA 5E1AA 4OZHF 1WS7A 5B3JF 4ZPTA 4KJQD 4XCYB 1HH6A 2QMKA 3S4SG 2O5NA 4WJG3 5E9DD 4Z7QE 2JKSA 1T20B 4AT6A 3MLPA 3OHXA 4I3SL 5FYJD 1CVRA 4NRYA 5CYKB 4BKSC 3WHXA 3DETC 3SE8L 2VDPH 1FFRA 4XMKL 2AJ3B 3RRMC 5E2UL 3S3BB 4RZCA 3D3VA 1PX8A 2XX0A 5HGBB 4B5EA 2NYYD 2Y1VA 3AW5A 1DSFL 2I7OA 3VFSB 4ZMVA 1EJ6A 1EFQA 1BZEA 4M8VA 5T3ZE 4X7SL 3MRQA 4FNQA 3KPQA 3VGZA 2LV4A 3BQUD 3OMIB 2EIZA 4OLWH 2NY4B 1QZ1A 3OKOB 4JDTL 2VOTA 1CGYA 4DEPB 4DNWA 4A11A 4I85A 1P7KB 3RU8H 2FR4B 1QX1A 4AJYV 4K9EC 3SE9L 4YDZA 3O8XA 4M62H 1MCBA 1GJUA 1MPAL 4QMEA 2WZ5A 4PJXA 2F7RA 1JXGA 3O3DA 3MRPB 4KNUA 4M1DH 4QRUA 4ZI8A 2OL3A 5D5ME 1WCQA 4D0BB 3BPCB 1A64A 3X14B 4R83A 4A09A 4FFWC 1DVUA 2QVTA 3QJRB 4LHUA 2Y7SA 1KGWA 5KVEH 5FYLH 1Z9OA 4PJHA 2NOYA 4M7JL 4CKVX 5EA0L 3ME0A 1PZ5A 4LASL 3L3GA 2EH7H 4PRPD 1J86A 2W0PA 4AQZA 5H35A 2C3VB 2XXFA 3BKJL 1YRKA 2F18A 3NGBC 4FQPA 3IGLA 4QF1B 1LEKB 1A66A 1YPZE 2HUHA 4R7DB 3BH4A 1RHHB 2KPWA 4AL8C 4KVNL 4NN5C 1CYWA 4DTGH 5HVWA 5EZLA 1X4YA 4D0DB 2YSSB 2G75A 3ZZQA 2CE9A 1HDMB 1NFAA 4JM4H 4N2EA 2DWYA 2RHEA 3K2UL 4G5ZH 4PY8I 1DQIA 3GZPA 4P2QD 2UWEA 1OKEA 4XP4L 2M1KA 5FYKU 4ICXA 3SVWD 3EDJA 3LAFA 1YDPB 1E8XA 3OKYA 1RUMH 3ULVD 1OB1A 1D6EB 2F5AH 2VAAB 3UBGA 3U7AA 3PFQA 1NPUA 2HKAA 4JS7A 4UQ2A 3FCTB 3MNVB 4WEBL 3SJVD 2EXTA 1JFQL 5C0BB 1O7DE 3ZKNC 4BUQA 1F58L 1XFPA 1BAFL 2MSPA 4QHMA 4HVBA 3AZUA 3REWA 3D39B 4KNTA 1LM8V 1ORSA 1PZDA 4KKRA 2VLLB 1D7BA 1S7UA 3PDDA 3QDGD 5B1AB 3L9EA 3TVMB 1JPGB 1G7PB 4WCYH 4FQXC 1JMXA 1Z66A 1ZXKA 4MS8C 1ANUA 2R1XB 1UWXK 3HE6B 2W18A 4ANUA 4POUB 5FCUH 4HPYH 4MMYA 3GLDA 3H3KA 1QI3A 2Z35B 5J3HD 3GHBH 5HGGS 3GXTA 4UTCA 2HKFH 2VXUL 2ADJB 1A6AB 4H8UA 2ISDA 2C9XA 4NRXA 3IETA 1J88A 4UQ3A 2YD9A 5DJZB 5C0AB 3MN8A 1GW0A 3I2NA 4AX4A 2OL3L 2VMCA 3MRIB 2NNCA 3RWEB 4LB8A 2CLVB 2DMCA 2NY1B 4FNRA 4HUXB 1IKOP 2W8CA 1TLKA 1QTYT 1SOXA 4R8WH 1LHZA 2EQDA 2FATH 2OMWA 4IJ3C 2PTTA 4G43A 4L8SC 5HHPB 1GJIA 1YMME 4LEXH 3HNTL 1PZSA 3IU3A 2ZUYA 4Y1AE 4KO7A 1ITBB 4NM4H 5DJ0A 3SXTD 3QE5A 3OKMB 1PY4A 4OCWL 1TZGL 4KROD 4AV4A 2JKJA 4X6BB 1HI6B 3OJ2C 2BIOA 3AXHA 4ODWA 4XMPL 4HQQH 1SYVA 3L3JA 3NQIA 3APDA 4HEPA 2GBVA 3PQYB 4EI6B 4FABL 3BYTA 3FUFA 2Y7QA 2H9MA 1YG9A 2V2TB 4FXGA 3MFGB 2RQEA 3Q2CA 3DURA 3MUUA 5A2JH 2C26A 2BIQA 4IBTA 3RPIB 3U0TB 4AK2A 1K9TA 1NKRA 4LRIA 4C4KO 4M8QA 2IBBA 3DX9B 3L5XL 3TWCL 3ZMRA 2EP6A 4F2MA 1HIML 4P5MA 1BZ8A 1DL7L 1ADWA 2IBZY 1R3KA 4DETA 3ZZSA 4TSAH 4HJIA 4E42B 35C8L 3OG4B 3MUZ1 2EDHA 1N19A 4G8GD 4ZZFA 3QUMB 3U9PH 2QT6A 1DUZA 3N0AA 4YHIA 4YHIB 3O2VH 3MKGA 3ENEA 5E6IB 5E6IA 2BP3A 1UM5L 3N40F 4XAWH 5ECJE 4N2OA 1T6WA 4XMPH 4YZFE 5FDWB 5HHVL 4NFBA 3ARXA 5IMLA 4M03A 1LK2B 2UWEF 3H9SD 4V33A 4E0RA 2UX6A 2UZIH 3ZYIA 1KULA 1TYQC 1IBGH 5IF0A 4UNIA 5HHQA 1PKQE 2ICES 3IJ1A 3MA7A 4I3RH 1AAJA 1CIDA 4JY6B 3MLUL 4WDIA 3TESA 4IOFD 1KELL 3FQTA 2QPSA 1MZYA 1N68A 2EDQA 1P5UC 5DEFB 2WQXA 4N2LA 2ED9A 2Y6SC 4N2DA 4KKCD 5A40E 3P2DA 2UUDK 5FHBL 4GMSH 3GK8H 2PO6C 1M9WA 1N18A 2ENPA 1L9SA 2XZZA 5DHVH 2J6EL 2PKDA 1Z5YD 1J9TA 2VCOA 1C5CH 2YK1H 3B6SB 5EAMA 1VF5C 4H7VA 2XX1A 3CDYA 1MIEL 3HZVA 2ZP8A 5EZOH 4J3BA 3SQOH 3U4EB 3HG3A 2WWKO 4L3EB 2IQ9L 3NZ8A 1QPKA 5HJ3A 4JJOA 1SEQH 4UQAA 2P45B 3TO4B 5ID1B 1MG3A 3DSFL 3VVVA 2J1WA 1KIRA 1ZPUA 3QDHA 3FT0A 3L81A 4PJGF 2F08A 4PBYA 5TEFA 4QRRE 2XTJE 3DIFA 4LHJB 5I74C 4ZK8A 3UR4A 4S1QL 4JDZB 3SYAA 1OPGH 3N42B 4P59H 4JUTA 2R23A 1T03L 1CT8B 4AEFA 1C8QA 3UVOA 2GJPA 2WQRA 3JYBA 5G5DA 3T6VA 4BM7A 4TTDC 4KKLD 4F8TA 5C0FB 2OMXB 4KY1H 4Y2OA 5D2LA 4O9HH 1CL7H 5ALCL 4LEXL 4G80B 1T7WA 4QYOA 2I85A 4RETB 4XMTA 1CK0L 2Z2PA 3GXIA 2ZWKA 3LN9A 2R2EB 4BFIB 1PNDA 3G5YA 2DMBA 5EZJB 1I1RA 5ICXB 1A7RL 1AO7E 1L9PA 4AQEB 1MDAH 4J77A 5KBKA 5CR1A 5JPNB 4Q58C 5CJQH 2FK9A 4HUUA 2F74A 2D4FA 5CNHA 5J1SC 1TFPA 4Y1AA 1BQSA 3G6JF 1AE6H 5KSAD 4YXHL 3QUXA 1MJJB 3HRZA 1ZRUA 3HTLX 5F21B 5I1GL 3BXNB 4N2GA 5C0CB 4YBLB 2VABA 4QUOA 3L7FA 3SDDB 1S5IH 5ANME 5IEKB 1EIBA 1NEUA 4WI0A 1HE8A 3AU1B 1IGML 2W9DL 2ARJB 2ZYIA 3ORJA 4J8RB 5HVHB 3VA6A 3VQ2C 43CAA 2IAMD 3MTRA 2XZAH 4YE4L 4XX5A 3CAFA 1A9BB 3CTTA 4X4XB 4XN1A 3U79A 3UTSD 2O9KA 5GHWL 2WAQA 4RFEB 1I7TB 1MHEA 2LQRA 3D6GA 1X7SA 1PW3A 4Q6IA 4TVUA 4JANA 4Z0XB 3P3TA 2HVKA 5TF1H 3LKPA 2EEXA 4PJBF 4XNXH 4TNVK 2XYCA 2G60L 2Q86B 2Q3ZA 3WXVH 4ES9A 4KKQA 2OK6A 4K71B 3MRGB 1ND0B 5IMMA 3I3DA 4G5ZL 3OW8A 4C54A 4TSCL 4H1LA 4K55A 4NS0A 1E4XL 4GAAA 3GSRB 2PCYA 2VSDA 1H3GA 4B9JA 4NPJA 4CMHC 3MRPA 4QKXB 1MAML 1NIAA 4RZCB 5IMKA 3VXRB 4PW9A 3X14A 4RFOL 5J3HC 4FWWA 4R0LB 1UTDA 1T0OA 3ISWA 2CO6B 3GRWA 1HTYA 3SE3C 4Z7VB 1BYOA 3GINA 5LQBL 1WLHA 1L9RA 2EZ0D 2JELH 2XG4A 2YKKA 4LLYA 1A6UL 3BPOB 2OZ4A 1QFSA 3FU8A 3MNVA 1HILB 3MMEB 4JFDA 5BOJA 5LHDA 1DJWA 4P46C 1NMCC 2NNRA 3KPSD 3FT3A 3VAEA 1AGEB 2B14A 3MOQA 4AJ0A 4QXWA 4CDHA 4OZGF 4URKA 2JXMA 4Z77B 2HMIC 1GRWA 5IWLC 2EYSB 1U8PB 4ERZA 3S3SA 3HLAA 4MJJA 4J3OD 3LKSA 4M1GH 5D7IB 4Q74A 4O4YH 2DJMA 2VJ0A 4GUQA 4TVPH 2XV3A 1NCWH 1YEFH 3Q8BA 3Q44A 1IAMA 2VZ1A 3IM1A 2G3ZA 4M3HA 3L2MA 1J8HA 3IAQA 4MAZA 3MRRA 4ODVH 3EADA 2EDFA 1KLGA 2YN3A 5E8OB 1A7QH 2FJGB 3P77A 5I1CL 3SDXA 1Q0YL 1ZLSH 4FX5A 3ARPA 4AGMA 4DKTA 2G0KA 4LEBA 1CLVA 4IMKA 3WJJC 2YRZA 3CN1A 3BVUA 5CXBB 1TTBA 2B1OA 3IDNA 5HHNA 1NC2A 5L2JA 2HT2C 2R4RH 3LN5A 4NHCH 5EOTB 3ZY7A 3RWDA 4DVBA 4JY4A 3I02B 3I02A 4TPRH 5SWSE 1CI5A 3QQ3B 4HXAL 5KJRL 4P5TA 3UBXG 4NENB 4A7UA 1LYQA 1X5YA 4AIZB 3QIWB 3D12B 3AXLA 2SEBA 4KKCC 1X5KA 12E8H 2Q7YB 1F3DH 1UM4L 2GBUA 3K72B 2QVIA 5JPMC 1I8MA 3OJDB 1YEJL 3OJDA 5IQ9A 5IQ9B 3P40A 3SQOL 3U0PB 3GBEA 3V2AR 5DUPL 3EJZD 1DL7H 4PUBL 4RRPG 4YDMA 3HW7A 1T83C 4QHMB 3TBCA 4AMWA 4RLDA 3RX7A 3MV8B 5AVRB 3KXFD 5BZDB 4A0AA 2VWEC 2X70B 2BVPB 3Q13A 1AD0A 2W60A 1M3JA 5I8CA 4CU6A 3QDJE 4WZ9A 4FC3E 4XCNB 5DD5L 4HX1B 2J1ZA 5ID0A 4MXWL 1FL6A 2FX7L 5HYSG 4OV5B 1EO8H 5J7CC 1EVTC 3IGAA 1NBVL 3I6SA 4G72B 3VXNA 4W9JC 2OJZL 2EYTA 2BDNL 4JE0A 4J3VA 4WWKA 4WFHE 3A0OA 3V0VB 4BD4A 1LQSR 3UBXA 3ES6A 3FTSA 4PJ9D 2BS71 3ZQWA 1GYAA 2YD0A 4FRWA 1AGFA 3BH8B 1KLUA 3MROB 4UMSA 1WUZA 5BRZD 1O7DC 3UC0L 3ULAB 2QSQA 4OZGA 2IDQA 5AVVB 3F3HA 3MA7B 3MDJA 2NZ9D 3OZKA 2VZUA 2ZSWA 3CJJA 4RRPM 5SWSD 4P9HC 3Q7JA 3QARA 3VD4A 1CCZA 5I6PA 2X4OB 4X6DB 4KDTC 4RGNE 1A6WL 3EJZC 3MRJB 3VFRA 4Z8LA 3HG1E 4EI5A 4LCWD 2QVMA 3LNHA 4WFEE 1WZLA 5F72S 4Q9QL 2VZOA 1X5XA 1HN1A 2VN6A 3PWNB 5AZEL 3KHQA 3WUWB 5EPMB 3B5HA 3QRGH 2JKNA 1BOYA 3B7UX 2DPKA 4NUGL 3UX9B 5IWLA 5J1TC 4Z0BH 3CUPB 3LKNA 5D1XD 3VD3A 3FB6A 3C5ZB 5ANMA 3SY0B 5L6YL 3RVWC 3GSOB 3MRNB 2EECA 1KCSL 4EZMA 1NM4A 3U0TA 1CFQB 1FFPB 3PNWA 2C1PA 1XHMA 1QTPA 2ROYA 1NLBL 4EI0A 3AITA 1ORQB 1ZHBB 1ORQA 1ZHBA 2YR3A 1YEIL 2ZOLA 1OTUD 1GGIL 1JTPA 3FTVA 2I0SA 2AJVL 3MV7B 4R7VA 3D2UA 3O6KL 3BP7B 2GK2A 2B77A 5C0FA 3GGWA 4RRPA 3HLKA 1C5BL 3B56A 3JB9L 3RTQD 1URIA 1U58A 1TU2B 1R33A 5MEQB 1O9ZA 1RI6A 2FRGP 1GVIA 1TKWB 1XV8A 2ZG2A 3UO1H 4A68A 2W0LA 2A9AA 4OD2A 4LG8A 4AMYA 4LNRA 3EZ8A 4P4KB 4WGWB 1JYXA 1G0XA 1OEZW 2XHNA 3HB3C 4PJDA 3SCMD 4C56B 3ULUD 3DO7A 1BVZA 3VUAA 5JPNA 3DXMC 1IV8A 3MJGX 3CHSA 3OKKB 4MNGA 3RRQA 4B9KC 5HYSB 4EIGB 4AKQA 1GGCH 3L4YA 1T1ZB 3FUEA 1UD3A 1R47A 3D85B 4OZIF 1CJYA 3IPEA 2WSPA 2QPDB 3UMNA 2VRKA 4M43L 4JHNA 3X3GL 2GI7A 3GKZA 4U6XA 1EV2E 1KBVA 5E2TL 4O2EA 4H1LH 2QZPA 4Z7OA 2QQNL 2X1PA 5BV7H 3SQBA 2BC4B 3MJ7B 2H9LA 4MX7A 5CWSB 4L29A 4Y19A 3OQ3B 5D1XE 1PYWB 3CBRA 4JQVA 3BC9A 1CD1A 4RIRA 4AYBA 1I9JH 1TETL 2OJ1A 2GSIA 1JVLA 7FABH 1SQ9A 3L3HB 3QO1B 4M9PA 3EI1B 4GO9A 3PWUA 3CXDL 3CWGA 1A4KA 4XC3H 4IDJL 1KIRB 5EZJA 3RWGA 4OI9A 1FDLH 3K6IA 1P1ZA 5FUZH 2E74C 1U3YA 3SDAD 1XXDC 2IOOA 4PLNC 3KM1A 1AZVA 4WEMB 2NR6D 4RA3A 4JM4L 4JRYB 3QDMA 4RAVB 2AJUH 3ALXA 2X9WA 5HTSA 3VA2C 4TVPL 5G5DB 1J7VR 2XPGA 3WTTA 1ZGLB 4KVNH 4DTGL 1T1XA 1H8NA 3NJXA 1FE8H 4MBOA 3D18B 1E4WH 1JRHH 3NG5A 3ATDA 5D7EA 3FN0L 1CBJA 1KN2H 5AOIA 4FA1D 3MLZL 4R90L 2R2EA 1U36A 4BFIA 3MO1A 4NKIH 1G7IB 1HL8A 5C0DB 5D1QE 1YNKL 3F5WB 2XXGA 1FO0B 2FSDA 4B96A 5JW5B 3C75H 4Y8AA 1T1WA 1YYCA 3ZTEA 5JHMA 4ZXBA 5E2VH 1DO6A 1MJUH 3FCSB 4J87A 4LSSH 3K4AA 4YPGA 2W38A 4UT7H 1VCAA 3ALPA 3E38A 4F7CB 3S5LG 1JNHA 3WFCL 3EH5B 4NFDA 1E4WL 2H8PA 2JJWA 4MASA 1Z9PA 4QRBA 2H6NA 2VW6A 3QR0A 3B9KB 2CR0A 5CCHE 1CYXA 3EYFB 3ARUA 4OQTH 5D4JA 4X4YA 2XWJB 4MZRA 1HQRB 4KJPD 3T3MA 3ZYZA 2KL6A 3GLAA 2BSTB 2PXYD 5JHDB 5E9AA 3SPVB 2AI0L 5FYKE 3SPIA 3RDTA 3QDAA 2EKJA 1G7MA 5JW4M 4Q6IB 4Z0XA 4ABUA 1KEGH 3JROA 1CUOA 3C9NA 3IGFA 4QXTB 1E4KA 1GAFL 3QEHB 1U3HC 4WWKD 2AJZA 5M5SA 4NSKB 4KTGA 4Z78A 4HULB 1N7MH 2HH0H 4QRRA 5HGAB 5T5FH 1T0PB 5DD1L 3OQRA 4Z7UE 3TL5A 2O5ZH 1Q0EA 4PJHF 5LO7A 1I9EA 5ISZE 2AC0A 4M43H 4WJKA 3O81A 5ESAA 4BK5C 3NPSC 2VN3A 1IBDA 4BHUI 2P5WA 2SEBB 3P69A 1MAMH 4JFYA 2ZNXA 4XI5D 3GI8H 2DQFA 2ZXDA 4Y4KD 2DQCH 3MZKA 1MFEH 4TUOB 3KPRA 1DN2A 1Q9OA 2HT2D 4KPHL 3HUJE 5CU5A 3KBHE 5FHBH 5IK3B 2ICEB 2GC7A 1AIFA 1FWXA 1A6PA 5IW6B 2UZPA 5TQ0H 3LXUX 2O30A 2X6VA 2PWEA 4XMUA 4PY8J 5AYQA 4WY7L 1NDGB 4WI8A 1JPFA 1FAKT 3MXVL 1GGIH 4FLOA 4LQ1A 3EIFA 4LOUD 4RISH 2PP8A 2EIMB 1P4IH 4PN6A 4PV9B 2WLJA 1IBBA 3S5LA 4FMVA 4EZLA 3VRLE 3HC2A 3U7YH 5KSVB 1V27A 3ABGA 4WWKB 2Y6TE 5D6CB 3IDGA 5D7JC 2Q7YA 4WI6A 4Z5RA 4KJPC 4Z95H 5TFSH 4PJXE 5M5TA 4N6QA 2IGLA 1KGIA 2GKIA 2Y2YA 4BQ9A 4HK3N 3QAZB 2EC9T 2G5BA 3OHMB 4PREB 1FNSH 2P43B 4PREA 3IMTA 4AJVA 4YBHA 5AOLA 3CPUA 4GP5B 4A7GF 3VX1A 2ZUUA 1OZUA 4LMQI 4AGNA 1SN5A 3ZKXB 1T89A 2BVPA 1AFVL 2PP9A 1JZEA 3AT9A 3DX7A 2E7DA 4WKZA 4WGKA 3BUYA 3NRPA 1F45A 4RGOL 5G4NA 1KXTB 3RWCB 2VIRA 4FP8H 4K7PH 3ZTNH 3RTQC 2L7UA 4M48L 3LEYH 4P07A 3KYOA 1BYPA 4OVVA 5FB8A 3ZTCC 1BOGA 5F1NA 2H32B 4JKLA 3QXWA 4M4RA 2HVJB 3O3BB 3HB3D 1GYVA 3SCMC 3HEIB 4JRXB 4NZRL 3S37X 3V5KA 4AGOA 4S1SH 1GL4B 4WF7A 4F8QA 3UTTE 1A6VH 5HYJB 5JHBA 1RK0B 3JVFC 3C5SA 4CSSA 1QEXA 4S1QH 5D72H 1LNUA 1FIGH 2HRPL 3Q3GB 2PABA 3E2HC 1CICD 1I7ZA 2BNQD 4MD4A 3OPZH 1E5TA 4DAGL 3WNNA 2NR6C 3MV7A 5CUSH 4JT5C 2YPVH 1ZANH 3F7VB 2APWA 3GO1H 4KAQL 1BZ9B 3D7PA 2WLIA 4FFYH 4X7TA 3SGEH 3GTTA 1XH0A 4LAJH 4FNSA 3KLHD 1HHHA 2EIZB 5FECB 4C57C 2C3HA 2ZOKB 3BZDA 5CEYB 2DQUH 2X53A 2AVFA 3A6CL 3L5JA 5I2IB 5IP4A 1FBIH 2NNFA 2YGQA 1S7XB 1V7NL 1G9NL 4OZFB 3RBSA 4B9PA 1NANI 2GJJA 2DYPD 4OVUA 5DJAB 5EEXA 2BOBB 5FKQA 4BP8A 1CLOH 4JFZL 1FNEB 5FYJU 1D2OA 4YHYC 2B20A 4CKQA 1N5AA 4X5PA 1A6VL 4XVJL 3UAAA 1AZCA 1Z32X 3G5ZA 3D1MC 3L17A 4X61B 1UD8A 2BDNH 2R4RL 3D9AH 4U1JB 3STLA 4QKTA 4JHPC 4P23C 1TTUA 4R0LC 2FH6A 2WINB 4ODBD 4X6EB 3T77B 3B9DA 1JGEA 1JGEB 2DWXA 3W0WA 3LPPA 1UA3A 1CD9B 2WYZA 3K8MA 1UH2A 2NTFA 1WFIA 3QWRD 1OMWB 4XXCC 2VDRB 4NQSB 4JMXA 4OF0A 5INDA 2GJ6A 4LL4A 3O3EB 4MKMA 1CDUA 3EMHA 2JV6A 4WFGD 2LU5A 1FGNL 3H0TB 4MNGB 4QXUH 2OKMA 2ESVB 5KTEH 2H6UA 1GZHC 4XN7A 1NGXA 1F4HA 3C8DA 5C9JA 4P3CH 1MHPL 2KZBA 2HJBA 3AQZA 4PJDF 3MCKB 2F7IA 4Z7IA 3I7HA 4GQ2P 5IBLD 4JMNA 4Z8FH 2IJ0C 4DFHA 1VLXA 2FJSA 2HG5B 3L45A 3IJEA 2GQHA 4MNQD 2AH0A 4FG0A 4MAYA 4OLXL 4Z7NB 1I1AD 5HE1B 2X4RB 1KV7A 5CJOH 1I4FB 1SDAB 1IGJB 4APQC 1N6EA 2MMXA 4J39A 1P7HL 1CFBA 2ZXQA 4MCMA 4OLUH 1HKLL 2WWOA 1UG9A 2A74C 1S7VB 3GSXB 5EU4B 4P57B 1Y1UA 2AAAA 5IVZA 2MFNA 1OW0C 4HMDA 5T3XD 4O51A 4WWKC 5C70A 4GG6B 4U0RC 3T04D 3ZDZE 3QNXA 3EYOA 2CUIA 1QEWB 5C7XH 2P24A 1AGDB 1IAKB 2Y23A 4PJ7F 1R5WB 2X12A 3JUYA 2FJHB 3U2JA 3MMYA 3AT8A 5FLUA 3LZQA 2P49B 1PZAA 3KPN