3SBPA

Pseudomonas stutzeri nitrous oxide reductase, p1 crystal form
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 168
structure length 581
sequence length 581
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbpA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbpA01
3AZUA 1KDIA 2EILB 3EH3B 4O3UB 4UANA 1ET5A 2Z2NA 3SFZA 2AVFA 5H14A 1EHKB 2HJBA 3JAMg 4Z8LA 4A2HA 5F7AA 1ADWA 4FAND 4XYHA 4ZN4A 4J0WA 2OVPB 4K3ID 3ORVD 4BDVB 5IY5B 2H6NA 4PBZA 3EI2B 4KO9A 2J56H 4Y5RD 3C75H 5IGOA 3BG0A 1WA0X 3H56A 3OMAB 5THAA 4ERYA 1PNDA 1U4CA 2I85A 2I0TA 3SJLD 1URIA 2IH8A 3OL2B 3NSYA 1BXVA 1OMWB 4NERA 5CXCB 2XU7A 2MRYA 2GI0A 4R7AB 1NIDA 3MZLA 3HB3B 6PCYA 1BQKA 2IAAA 2TSBA 4KNSA 5EARA 5I26A 5B7FA 5HQGA 1JZFA 2YNPA 4X3EA 4YSAA 1L9OA 2P9SC 3OTTA 3AY2A 2CAKA 1BEXA 4PBYA 1IKOP 3UVOA 2VW6A 3IN0A 3EMHA 2QPDB 3IN2A 4A08B 5LDUA 5I6KA 4AOWA 1NICA 1SFHA 3QJTB 2TRCB 1ZIAA 3CFSB 3TBCA 4GM8A 1V55B 1NR0A 1SDDB 2FWLB 4FAVD 4A66A 4BK5C 3X1NA 5IGQA 3DWLC 1J9SA 1WS8A 1FWXA 2J57A 4D0KA 2HX9A 2XXFA 3IEAA 4G7RB 5B1BB 3TBBA 4NB7A 3SBRA 5I6NA 2FNWA 4YSTA 2FT6A 3GFCA 2TSAA 2CUAA 1BQ5A 2I0SA 1WAEA 4KNTA 3UGEA 5GXIA 3V5WB 4A2LA 2IDUA 1ASQA 2XV2A 1SF3A 2EIMB 1CYWA 4GXFA 3SBQA 1X9UA 4BL0A 4CZXA 4ERZA 4CI1A 5GMKn 7PAZA 3DSMA 2XVBA 1CYXA 4Q89A 1T5KA 1ASPA 2IAAC 4E5ZA 2B5LA 2UX7A 3ZWLB 4LG9A 2GNQA 3C5MA 5TK2A 4KNUA 4N4YB 1ZDQA 2IDTA 2XUWA 5B1JA 2PM9B 4X63B 4A2MA 4QLWA 3V9EA 2AH1A 1NINA 3NP3A 3ASNB 2EBSA 1GG2B 1J9RA 3QJUB 4YSPA 3PXLA 4PSWB 2YAMA 3V9CA 2G9AA 2W8CA 1TU2A 3C75A 4O3TB 1PBYB 3S3CB 4BWUA 3FQ1A 3AH8B 5EMMB 4KFMB 3PAZA 3X1FA 4YSCA 4BXSV 3NJMA 3PVUB 1OE3A 2AH0A 5B1AB 1PLCA 1AZBA 3FU7B 4O9DA 4A0BA 2MTAH 1DYZA 3UVKA 2ZXWB 4KO5A 2BP8B 1UATA 2GBAA 2WO3B 4DP7X 2AGXA 3HEIB 3PXTD 5TEEA 3SVWD 1AG0A 2B4EA 4DP4X 2CALA 1CURA 4AKOA 3IJ0A 4CY3A 4ZOYA 2BWDA 2J55A 3B7FA 1BYOA 3P4FA 4E54A 1F56A 1NTDA 2H68A 4UF7C 3OM3B 3CIKB 2BW4A 2R7EA 1PGUA 3IBOA 5I5IA 1JXGA 1OCOB 3NJKA 3MKQA 2CBPA 2VM4A 1XMEB 1ZPUA 5I5JA 2Y69B 3QJRB 4A67A 2JFCA 4BXVA 3X1EA 3OW8A 2GB2A 4GM9A 4W9ZA 4P5RA 3SWSD 3WNJA 3X1BA 3NT0A 2Z2PA 3FU9A 4JKNA 1AS6A 3FM0A 1JZJA 2HX7A 3EI4A 4FHLA 4XEIC 4GGAA 5F7BA 3UAEA 4E9WA 5FKQA 3V7DB 4PCYA 1A8ZA 3NJLA 5EM2A 1E67A 3GXUB 3I2NA 3WNIA 2RACA 1VYHC 3RLMD 2P9KC 3OKYB 1JOIA 1AAJA 1J9TA 4E9YA 4CZVA 1ILUA 1JERA 1PZAA 1JMZB 3EI3B 2AFNA 4L3GD 2YAFA 3W15A 4JD2C 5HE2B 1S4UX 4DP8X 3G5WA 4PSXB 1ET8A 4JT5C 4G70B 2FQGA 2DWSA 2GSMB 3BQVA 1ERJA 3BWSA 4BH6A 5EAMA 3S8GB 2P9LC 2Q7QA 1OCRB 1NDTA 4J82A 5I5MA 4BUJC 3N2JA 1GR7A 2XU9A 4OZUA 3FPYA 2HKMA 4L1QD 6PAZA 1NEXB 5IJ7E 4GZ8A 4J84A 1FA4A 5PAZA 3EF4A 2E86A 1OE2A 2N0MA 3KW8A 4JHUA 8PAZA 2P9UC 4CY1A 4FB1D 3OKWA 4QKTA 4JSPC 1L0QA 3KRXB 3OL2A 4IMMA 4K3JB 4ESGA 3TA4D 4YSUA 2H6QA 3ZDWA 5CXCA 1DZ0A 1GP2B 3DKHA 5D4HA 1PEVA 4JSXC 3MX0B 4FA5D 4FAAB 1A65A 2BW5A 2GC7C 2WO2B 5C2VB 2QDWA 3UAAA 1SHXA 4L9OA 3DM0A 4ZOZA 1SHWA 3NVXA 2FT7A 3CDZB 3PVWB 4N8UA 1WS7A 4A2FA 1RZQA 4G71B 3OMNB 4DP1X 4GGDA 3FSAA 1JXDA 3GREA 4F2FA 2XWZA 2QT6A 4G72B 4A08A 4YVNA 4MFHA 1SQJA 3N0DA 4J86A 3NP4A 1OOWA 5B7MA 2Q5BA 1J9QA 1SDDA 4YSDA 5A7EA 5I6MA 1ASOA 2JXMA 3NJGA 2HRGA 4DP5X 5B3SB 2IUVA 5CYKB 4HCFA 5B1KA 1GS7A 4L0PB 3BG1A 4A0AB 2H47C 2PCFA 3AG3B 3FSZA 3T6ZA 3WG7B 3S8FB 3UKUC 5A2Qg 3KW7A 4JT6C 2YMUA 4E9QA 4YSQA 1V10A 3ZX1A 2XXGA 2H9LA 3UR4A 4FA1D 2XV0A 5D4IA 4LGNA 4YVDA 4J0XA 1JZEA 3OQRA 4X4KA 1HFUA 1GOTB 4DPCX 3FYIB 4A2EA 2HYEA 4CSZA 1I53A 2UXFA 3CG8A 3OMIB 3MZKA 3RSEC 1ETJA 4W1TA 1JZHA 4HCIA 3X2QB 4A2DA 2AGZA 4GQ1A 4IA9A 3ERXA 1JVLA 4DP6X 1JOFA 2PM9A 3RN0D 3RFGA 1PY0A 4AX3A 5PCYA 4AZUA 2QC5A 2YNOA 4GQBB 1JVOA 1NPNA 2GIMA 3SBPA 3RN1D 2IWFA 4YSEA 1OE1A 3AG1B 1BYPA 1IC0A 1SJMA 3QQXA 3RFHA 4CY2A 4M3HA 5TEFA 3RRMC 3FYEB 3EI1B 2HZHA 2PCYA 3EU7A 1XKSA 1L9PA 3ABKB 4CY5A 4J78A 3RYMA 4GY4A 4A7JA 5GXHA 3VH0A 1Q47A 1NIFA 5I6OA 5HYNB 1B3IA 5AKRA 5FC9A 2IURA 2BCJB 1JJUB 3FU7A 2H9MA 4MK0B 3JB9L 1OV8A 3F3GA 1JZIA 1YLBB 2BP8A 4KO6A 2J56A 2HJ4A 3FGBA 2IH9A 1NWPA 3U4YA 4DPBX 2BHFA 3IKOA 2IUPA 3I89A 2AZAA 3S3DB 3I7HA 1SF5A 4PC0A 3I7PA 4AEZA 1N70A 2YAEA 3JT2A 3MXXA 2P9IC 5SXMA 4A2GA 3N0EA 3NVQA 4E9VA 2OV0A 1GS6X 5KDOB 3ULEC 5FLXg 1AS7A 3QJSB 4GYBA 9PCYA 1GY2A 2H9NA 1ILSA 4WTQA 3OD3A 4AKQA 4H5JA 2OVQB 1QLEB 3ZBMA 1GYCA 1AANA 1IBZA 4HZ1A 3KRWB 2BO0A 5E9NA 2UXVA 2YXWA 3L4OD 3PE7A 2BZ7A 2H6KA 4G7SB 1JXFA 4NSXA 4GP4B 1TEFA 4PNKB 5H17A 2BZCA 1NIEA 3I7LA 5H1MA 4GP8B 1TKWA 3SHFA 5FKTA 4KOBA 1OF0A 3PAUA 3EHBB 3DXKC 1GS8A 4GMBA 3AL9A 4QT8A 4HIPA 3OKYA 1W8EA 3FS9A 2GC4A 3EI3A 2G99A 3CVBA 4E9SA 1OCZB 2I0RA 5HE1B 3NSFA 1GY1A 1AR1B 2HESX 3PXSD 5CXBB 4HCGA 2VMJA 3CVDA 1RKRA 4BWWA 2FQDA 4AI7A 3PAVA 5TK4A 3T9WA 4DP0X 1E30A 1NWOA 1BQRA 1NIAA 4CSPA 2HKRA 2PM7B 4U1EI 2GC7A 1PI6A 1AACA 2YNNA 5AFAA 2H13A 4EF3A 2PPAA 2NRDA 1QNIA 1XHMA 4ZOVA 5C9ZB 2OJYA 1K8KC 1N6DA 2IWKA 3F3FA 2PPDA 4Y7RA 4J73A 4HDJA 1GW0A 2IDQA 3QJQB 4NAJA 4E9RA 1ZIBA 3JZGA 5EMJB 3NYKA 2H47A 4ES0A 2I7OA 4DP9X 5EMKB 1SHYB 1P22A 4YSRA 3E0CA 2CJ3A 4F7KA 5AJAA 2FJSA 2BP0B 3WKPA 2EIKB 5B4WA 3NJIA 1XB8A 3N55A 4G7QB 2O9KA 2XYBA 1MG3A 2H3XA 2VM3A 4A09B 3CDZA 2GC4C 2PPCA 5FXYA 3ODTA 1MDAH 2XLLA 1IBYA 3JPXA 3NJHA 4KO7A 4J79A 2Y1AA 3QPKA 2MTAA 4UI9R 4N14A 2Q9OA 1RZPA 4O1QD 1CUOA 5I6LA 3IIWA 2DY2A 5CYKA 4X60B 1XB6A 1SQ9A 3JROA 7PCYA 4P5SA 4J8GA 4A0AA 1YFQA 3CZUB 4CI2A 1KBVA 3UVMA 1L9QA 5FKRA 2AZUA 1N6FA 2UXTA 1PLBA 3FSWA 2B3IA 4HHWA 3NJFA 3UACA 5I28A 2HRHA 1A4AA 1PCSA 2PBIB 1L9TA 4A11B 2CCWA 2HXCA 4J87A 4CZYA 2P9NC 2FQEA 1FFTB 3DIVA 2XL3A 2J5WA 3DXMC 1N68A 3GYRA 1HAUA 3HFQA 2UZYB 2XX0A 1MG2A 3AFCA 1JZGA 3I7KA 3MMYA 3UADA 4LG8A 4UAHA 1R5MA 3JRPA 1B9XA 2YARA 1AZUA 3J81g 3WI9A 2I3SA 3VGZA 1U2VC 2AGYA 1NIBA 3SQRA 5EMLB 2H3XC 1MG3C 3DTUB 1RCYA 4CC9A 2YAHA 4YSSA 3I7NA 3AL8A 2OK4A 5EALA 4PAZA 4E9TA 3ABMB 5IC7A 3SMRA 4ERQA 1E5YA 1M56B 3AW5A 1PMYA 1ID2A 3NSCA 1N6EA 2B5MA 3V9FA 1GSKA 4TXVB 2PLTA 2OIZA 3AG2B 3IE9A 1M57B 2WSDA 4E9XA 2HXAA 3H4FA 5D4JA 3EI1A 3EG6A 2QXVA 5ANHA 2DYSB 1TBGA 3AL8B 2UXGA 1KCWA 4TZ4A 5AFU3 2OJ1A 3EH4B 1TEGA 1A4BA 2PPFA 2J55H 4D6VA 5K19A 2W18A 1BXUA 2CO0A 1BXAA 3FQ2A 1AZRA 1WA2X 3PCYA 3CFVA 2Z2OA 2IWEA 3UVLA 2X87A 5JWZA 1AOZA 1PLAA 1MG2C 3FSVA 1KDJA 2P9PC 2YBAA 2XV3A 1MZYA 4BWTA 4K9JA 1MDAA 1WA1X 1W6WA 3FPXA 2HX8A 2JKWA 3BVDB 1SNRA 1PZCA 4WKXA 5AZUA 2UZXB 2W88A 3TU6A 4HAKA 2OVRB 4G56B 4DPAX 5TF2A 1AIZA 3AG4B 5TDHB 4I79A 3NVNA 5EHFA 1PAZA 1L9SA 3ZIYA 3RMZD 1L9RA 2DWTA 1KBWA 2FQFA 3K26A 2P80D 4O45A 1A3ZA 2CNXA 4J81A 3T6WA 3SXTD 3OKTA 4FWWA 3C99A 5FA5B 1PZBA 2A3TA 2ZWNA 2YAQA 3S3BB 3IJ1A 3NSDA 4PXWA 4JXMA 1BAWA 2OCCB 1V54B 1XB3A 3T6VA 1W6LA 2QPEB 2VW4A 4ENZA 3I8EA 2CO0C 1HAWA 3NJNA 2P80A 4KOCA 3MKSB 4GGCA 4E5ZB 2EINB 2IUQA 3D12B 2XL2A 5CXBA 2GHZA 3U25A 2I7SA 4U7AA 4YL4A 3NJJA 1PNCA 1KCBA 2VN3A 4CI3A 2XX1A 3ABGA 4OWRA 4AKPA 1AZNA 4JHVA 4EWRA 2CE9A 3L45A 4H5IA 1K32A 3PSCB 1SFDA 1XIPA 3A0FA 1AS8A 1NPJA 3SLED 2VSKB 4CI8A 2QDVA 2PM6B 1KGYE 2PP9A 3FU8A 2CE8A 4QRJA 1AQ8A 5FQDA 2YAOA 1ZDSA 3T6XA 1KYAA 3X1GA 4YSOA 3EH5B 3SN6B 5GSAA 1TYQC 2PP8A 2I3TA 3IJCA 4X61B 3WKQA 2XYIA 4JSNC 3VA6A 1J5DA 1NZRA 4FA9D 5EAPA 2H14A 5B1JC 4J8BA 2EIJB 3TASA 1KV7A 3T71A 4ZK8A 4FA7B 4A0BB 1E65A 1B9YA 4YVUA 2LLNA 2BP0A 3I8CA 1E5ZA 4GQ2P 3ABLB 3JTBA 4ZOXA 2ZOOA 4DP2X 2YQBA 5IJ8E 4A09A 3F3PA 2PPEA 3JZNA 5HE3B 2AGWA 3J80g 1IUZA 4E54B 4XYIA 2DYRB 5HE0B 1AG6A 1ZV2A 3H4HA 1RI6A 1CC3A 2YXVA 5I6PA 2R7EB 4GM3A 3CVCA 1R1CA 5C2WB 4L3HD 2J57G 5B7EA 2CN2A 2X88A 1X9RA 4FA4D 2YB8B 4GP5B 3C9CA 2DV6A 1OLZA 1EZLA 2AGLA 4F2EA 2PP7A 3PPSA 1AZCA 2IDFA 4HALA 2H9PA 1A0RB 3EWEA 3PSLA 5IT9g 3PXWD 2FTAA 3PLYA 3EI4B 3K27A 4A11A 3UVNA 2FT8A 1QHQA 1GXRA 1ET7A 3UABA 4QQEA 4HHGA 3JZHA 3WIAA 2ZONA 4Q8BA 1MZZA 1A4CA 2AANA 4QL1A 5AMSA 5EM2B 5K1CC 3GDCA 1OCCB 1PF3A 2VW7A 3FT0A 3MBWB 2CN3A 3FQYA 3IIYA 4J77A 2HLEB 5FKSA 3ASOB 1M9WA 2YAPA 4A68A 2BWIA 1J5CA 4JSVC 2IDSA 4RH4A 2H5UA 2VSMB 3QJVB 2OK6A 3UKRC 4M4RB 2AQ5A 3SCYA 4BDVA 2BBKH 3FRXA 3I7OA 1VLXA 1JMXB 3L4MD 3EI2A 2B08A 2B5NA 2UX6A
chains in the Genus database with same CATH superfamily
3EGSA 1T2QL 1MVUB 1MCQA 1VESA 4CSSA 1ADWA 1UASA 5BZDB 5EV7A 4WFGD 4BFBD 3GK8L 2BNQA 2I60L 1VB9A 5EBGA 2H6NA 4P4RB 15C8H 1OAYH 3NCMA 2HKAA 2XI9A 3ZTNL 1AMXA 5I23A 3MV7A 2VOTA 3WMQA 43C9B 4O2EA 3D0AA 1LEIB 3PP3H 5C0BA 5EARA 4CW1B 4KQ4L 4BFIA 4NDMA 3RA7H 1HVXA 3DXAD 1GOGA 3SPVA 2WSKA 1MFDH 2YMXL 4FFZA 2ODIA 2WZ6A 4YXKH 4NO0A 1QR1B 3T2NL 4DUWA 2C4XA 2Z7YA 4P9HC 3TV3H 5GGUA 1KCRL 5DEGA 2BM3A 3Q6FB 5HGBB 2WZ5A 3DXAA 3LQAH 3KD4A 4FYSA 1HOEA 1NGYA 1XVSA 1Y18A 3FTUA 1DBAL 1NGQH 4F2ME 4BSVB 1N7ML 3P0VL 2NY2B 3B9DA 5E5MA 4WNQA 1UXLA 5EU3A 2A9DA 4MX7B 4YZWA 3VGEA 1MHEA 1Z9MA 1KFAL 5H4ZA 4WUKH 1U8HB 4PJ8B 2I9LB 2APTA 1P2CA 5AOKA 3ZWLB 3MJ9L 1UZ8A 4XO8A 3SQOH 1A7BA 5IEKA 4LF3A 5DWPA 3F12B 3ABZA 3IMVA 3NP3A 4R5VA 1YR2A 1KB3A 4AYSA 4Y1AB 5MI0C 4FFWD 4Q6IB 1R3LA 2P48B 4PSWB 1YMMB 2O26U 3I9GL 2D73A 4XWOD 3FHAA 1O6TA 4BFEA 4PJXB 4BRJA 3BPCA 1FZKB 5KVDH 1ZT1B 5DC0A 1NBZA 5JOFA 4O58L 2NSMA 2XKSA 2E4TA 4D7BA 1P6FA 2J21A 1KBPA 4LKXA 3K2KA 4CVZB 3II2A 2J55A 1D9KD 5D6CA 3VNYA 1PLGH 4L1BA 3JVFC 1AKJA 1MXGA 3WEXA 2CBPA 4ODTL 3UOAB 1J10A 1MAJA 2IV9A 4O51B 2X4TB 4W9ZA 4I2XA 3ZE1B 3QZBA 3IGAA 2MKWA 3EJCA 2Q6WB 3CHPA 2G3ZA 2VZTA 3FT9A 4R97B 4GGAA 1ZJBA 2VQUA 3RX9A 2FX9L 3UPRA 3EYSH 2N1TE 4Y9EA 2JKXA 3CBKB 3H7LA 4QRPD 4NQEB 5L4IA 3UYOD 1MCHA 5C08E 3WYRA 1KTDB 4W6YB 5CMAA 5HE2B 3C09C 3SGJC 1N10A 2NQ3A 1BZDA 1ET8A 3TBYA 1QI5A 2LTQC 3T3ME 1ECYA 3FC8A 4Q74A 4HG4J 4XN5A 1EXGA 3VACA 5HVWA 3ZE2E 3S8GB 2WP3O 5DZNA 1RK1B 4QRPA 2VDOB 5DJDB 5ID1B 4JY5H 1IFGA 1BMWA 1MNNA 2HT4D 3FFCA 1QO3B 4C47A 5K9JL 2C3GA 3O8XC 3UC0L 3QHTC 4X6BB 5L0QC 4FB1D 1NUGA 1WAAE 3DGGA 4NRZB 4XMUA 32C2B 3LIZA 1JI1A 4AQ8C 2ZAHA 4FJYA 4FA5D 1KB5L 2O1AA 2JJWA 3V4VA 4LE8A 5LB1A 4JFZH 4EVNA 2Z7ZA 3BOVA 2BZDA 4FL4C 5LAXB 3DROB 4OIFA 3CDZB 5JA8B 3WS6C 1IGFL 4G71B 5I1GL 7TAAA 1HHKA 2VJ0A 3QC5X 2O61B 2CJSA 1A21A 3CMOL 2Y2WA 4YDIH 3P4MA 1CVSC 2BFGA 4JPIA 4K9EL 2WQSA 4AK2A 1Q0EA 2HRGA 2NY0C 1BJ1H 3HZYB 4AEHH 2DEXX 2RMNA 5DHYA 3T4YB 3AG3B 3FSZA 3VXSE 2W80C 4HJUA 3WEOA 2V5RA 1XH0A 5DURB 2F54B 2R69H 1R34A 2AK4B 1BA9A 4PJ7B 5CSBA 1NPUA 4FN0A 1T2JA 4F7PA 4M00A 5FGSA 1EAOA 2H1PL 5D70H 1C08A 3M45A 4CSZA 2EEDA 3WFBL 3UZQA 1LE5A 3H7BA 5IGXH 4M02A 4ZO6A 1BECA 1JVLA 1RU9H 3RFRA 1UB5B 1CICD 5IWLC 1PY0A 2F2HA 2IWFA 3TH2T 1MFAH 4F80A 2ZCZA 4FQ2L 3EYOB 4ZS7L 5AB9A 3NH7H 6FABL 5L88H 1E5AA 4WKZA 4JPWH 4HP5A 1T4KB 3I84A 1CICA 3PJSA 1VF5C 1Z3GH 4G3YL 5TGBA 2ZSVA 4WO4B 1S9XB 3PABA 1P53A 4UQCA 2ETWA 4NQUA 1BVLB 4G55A 4LARH 1V7NL 1SY6L 1NWPA 3D69A 5D2NC 3ULAB 4DPBX 2FR4B 1DEDA 2DQTH 3EJYD 4PR5B 5KANI 4AIXA 5ICUA 5DWUH 3UTOA 2WLLB 4F91B 1HEZA 2BC4A 4R3SA 1HYSC 4AVKA 4PRAA 4WSJA 3ROLB 3WY4A 1U3HB 2ARWA 2NNAB 3FCSA 4HZ1A 1E4WL 2EAEA 4Q4IA 1H3VA 3EYQD 4HJEA 3VJ6A 3CH8A 2QTVA 1NIEA 1UWXK 1TKWA 1FLRH 2F19L 5F6IC 1YJDL 3IDYC 3P11L 1IEHA 5CEZH 2XA3A 5INDB 3C6LD 1P6WA 1DFXA 4PRID 1NL0H 2GC4A 3KJ6L 2IJ0C 4Z3GA 2HESX 1F2XK 1SMOA 2D7QA 4HUCA 1AIFB 2H7WA 2VMJA 4AZ8B 4XCYA 4JG5A 3C6EA 2HKRA 1QFWM 3BP7A 1XGUA 5DZ9A 5C09A 3L17A 1I1FA 5E8OA 3TT3H 2VJ8A 4S2SB 5IMKA 1K8KC 1VKXB 3ATDA 1MFNA 1WV7T 2Y7MA 1HU8A 4AIZA 2PPDA 3CQFA 4FQXB 1KIRB 4HH8A 1CBVL 3QJQB 2CRYA 3ARGB 5EO9A 3MRHB 4ZAKC 4DN3H 1H6UA 1OTTD 3WL9A 4RX4A 3QO1B 4MQSB 4RA3A 4EIGB 2O9KA 1ID5I 4KUZH 2K1MA 2ADIA 5ILTL 1ORSA 1GTFA 1HQ4B 5I0VA 3DO3A 3S6CA 3P30H 1I7ZA 4OLWL 1MW0A 3SDYH 3ZR6A 2WYTA 3QPKA 1C5DA 5IMLA 2FEEI 4Z7QF 2AQQA 2XA8L 1EFXB 2IQ9L 3HMWL 4DKTA 3LXBA 5KSAA 4O1QD 2DY2A 5ID0B 1SQ9A 4MDIA 2F53D 4J3BA 4R96A 4HBCH 4W9JC 3RPIB 5KYXA 1T03H 2WUBH 1IC4H 3E3QC 1FV1A 3VWJD 5KSBA 4ZO9A 5CFAA 3N44B 1G6RH 3VCLB 3U2SB 1I7TA 1MJ7H 1CBJA 1ZWIA 3T3MB 3ZJAA 4A7UA 4MKMA 5ICZA 1DR9A 3RVXD 2AVGA 3MYZA 3D0VB 4FYTA 5CNHA 3UADA 3HC3L 2I3SA 1K2DB 1S7VB 2EDFA 1CGVA 1UG9A 4DAGH 3EO0B 4N0FA 1RJYA 2ESVE 2IO5A 2HLAB 3A24A 2F5AH 2P8PB 1KIUB 4E9TA 1L6PA 3BKYH 2VDKL 1M56B 4G8IB 1N6EA 3GT6A 4M62L 5E6UB 3ZKND 4Z8FL 4PJAA 2MNWA 2GAZB 4HYTB 1MY5A 4NO2B 2HYMA 2QXVA 1FG9C 2DYSB 2E27H 3HCVB 2R2CA 2OZ4A 4ABWA 4C56E 4TZ4A 3TN0D 1TQSA 4S1RL 1KELL 4PM1A 2OK0L 1D6EB 2BY1A 2FJFA 4QPEA 4FLOA 5JNYA 4POZC 1YYLL 3VXSB 1CXEA 3RB5A 4MCNA 2UYLA 5FQDA 1URLA 3N41B 3PWNA 1T7ZA 1JK9A 2BSRB 3QJOA 1TJMA 4P0DA 2YRLA 1YEDA 1OD7A 1TZHA 2CLZA 3QQ3A 1FYTE 2EC9T 2VDLB 3ARDC 4W70A 5F97E 2P4AB 5AZUA 3VYPA 5CJ8A 3X14B 4DPAX 4EO5A 2O6FA 3WFDL 1FAKT 2H0JA 2VDPH 3IJEA 5IJCC 1TQBC 5F9JB 1T89A 1PD6A 3B6SB 5CN1A 4O45A 5KN5A 1OPGH 2VZUA 2W38A 3A67H 1N59A 4NM8H 5JIHA 2ZCKL 2YKLL 1HL4A 3FCTB 5ALBL 1QRNE 1DBKL 2APXA 5JQ6H 1PYWA 2YWYA 3DX4A 3FB8A 1RHHB 2VDMH 4RZCA 2V5YA 3FN3A 3GKZA 3D85D 1H0DA 4P4KC 2Y7OA 4QAWA 2EXSA 1HC1A 4L0YA 4XODA 1IKNA 4Z0BL 3PYCA 2QV4A 3UAJA 1K9TA 2EE3A 4IK6A 1PNCA 4NQSB 2A6IA 4YL4A 1QSVA 2P46B 2XX1A 5E95B 3OKDB 5ABZA 4YXHL 1HN1A 2PW1A 4NBMA 1GAFH 1M05B 3DJ9A 5B3JE 2I27N 3IUMA 4YR6A 3N1MC 3RA7L 2VLKD 3D85A 2Z8VC 4JKMA 2FIRT 1DQJA 2X4QB 2AKRA 2Y2TA 3KWWB 4ZMWA 2EDHA 3NA9H 5IIEA 5JW4N 2PKDA 3O4JA 5TDPA 4YXKL 2HFEB 1CS6A 2XZQH 1KGWA 4MA7L 4JSNC 3OC8A 3U7AA 2KZKA 1L5GA 4TKWA 3T71A 4ZUUA 3D0LA 4IBQA 1DN0A 3LQAL 4NNYB 3L95A 4Z3FA 1A6PA 1EQWA 1UA6H 3POHA 1ETB1 4E54B 3KH3A 2WJ5A 1CC3A 2C26A 4JPSA 5I6PA 1NOLA 2OW7A 2VRKA 4NQXB 5JW4Q 2YB8B 1I8LA 1S7QB 4JR9H 1EEQA 1YMHB 2FO4B 2GIYA 2WQVA 3DX9A 3CVHB 4H7VA 4N0UB 3DUSA 3BW9A 2EUZA 1I8UA 3DOHA 3SQOL 3QNXB 1FSKC 4GW4B 4HWEL 1QHQA 1NBYB 3BJLA 4IBLT 2F8XC 2Z31C 1JNHB 3RWIA 5B21A 3VFSA 1S46A 2OZNA 3PGFH 4OTXH 1ROWA 4PJFF 5EZIH 4MASA 2G75B 5DXWA 5F1NA 1JSYA 2A99A 2CLVA 1GGTA 4X9YA 1M7IA 2HMIC 2ZSWA 3F65A 4PP2B 5SX5K 4M4RB 3UIYA 1P7QB 2VDRH 4WU7A 3WSQH 3LIUA 5FYKU 5KVDL 2DQIH 4JHZA 4UANA 5DFWH 4XMXA 2WB7A 4RQQA 5F7FA 1KBKA 1IEAA 4MXVE 5H35A 2AC0A 5IY5B 4GI9A 2F1BA 4IEFB 3KVDD 1VZIA 1FG2A 2A5UA 3QXAA 1OKEA 4GMTL 3N1GC 3RNQB 1AO7E 2WXIA 5D2NE 3HB3B 3NIDE 2VN7A 5IJKA 5BUPA 3SJVA 4X6CB 4PBYA 1NSNL 3MGOA 2OW6A 2XICA 4PJHE 3O2VH 3O9WC 4XTRD 5GGSB 5EUOA 3T8VA 3E7JA 2HN7B 3FO1A 4ABVA 3VFMB 3S48A 1R24B 2JXMB 4BK5C 1NMBH 5E6RA 4A7VA 2LVEA 1R3JB 4JPVH 1KLUB 3F3HA 3F83A 4UIMB 5IG7B 2CR0A 2X38A 2ESVB 3D08A 4GKSB 3V5WB 4A2LA 4FQJH 4G1MA 5E0FA 1SF3A 4WEBH 5CZXD 3HG1B 4UV7H 4B9FA 2VABB 1WWWX 2JCCA 3HPJA 1KTCA 3WN5B 4BHUI 3DSMA 1FN4B 2QLVB 4JY5L 2B5LA 2DRUA 4I77L 4MA8H 4FA8A 1AFVH 3QRGH 2YEQA 5DD6A 4ZMQA 3MXVH 1KXVC 4PI2A 3BLBA 3PQYB 1E2WA 5CR8A 4QHMA 1RSFA 4WK4B 1QHPA 3LXUX 1T6VN 4JFZL 1VHPA 3PXLA 5BQDA 3HA0A 3CUPB 4N90E 4WHYG 4PLKC 4I85A 4H40A 4LLVB 4ERSL 3AH8B 5EMMB 3X13B 5FV2A 1B0GB 1I4FA 1F42A 1U8IB 5C97A 4B9PA 1EEYA 4OFIA 2BVPA 1GZPB 3VH8A 2MTAH 4AEHL 3FRPG 4PREA 4WUUB 4KI5D 5DO8A 2J20A 5FDWA 1EJOL 1KSRA 1OM3H 1BGXL 3I6GB 2JQMA 2R69L 3NPZB 1J05A 2YGNA 3SZKC 3D52A 4K8RH 1EV2E 1QRNB 4IKNA 2BW4A 2QTEA 2R7EA 2GKIA 2R1YA 4FG6D 1T5XA 3NJKA 3RTQB 2NTSP 3C09B 2E59A 3E3QE 5T5NF 1U33A 2NR6D 2JFCA 3HS0A 2EIBA 2IGLA 2LTQB 1V05A 4XNYL 1PCXA 4Z7UA 4WZ9A 1PIGA 1JYVA 1HXYB 2BX5A 4AUJA 3QPQC 3GJEB 4OF8A 3MV11 1MFAL 3F04A 3GXUB 3WNIA 3O8XB 1JOIA 2NR6A 3NH7L 4HKXB 3MBWA 4M8QB 5L0QB 4CZVA 1KULA 4FZEH 2EEBA 5DRXB 3TP4A 4A7GA 2WYHA 1NEUA 4JPWL 3MRNA 5CIPA 3IPEA 4F7EA 1UM6H 2EYSB 3MNDA 3QFJB 1Z3GL 3CJJA 1LE9B 4OZFA 5HY9B 4PSRA 1IT9H 3WCYA 2DWSA 3BQVA 4L0ZA 5BRQA 4J3SA 2X2UA 3OPUA 2C9UA 3N2JA 4LARL 1DE4A 5HVFB 5K59E 4FQ1H 4L1DA 5L2KE 1EWHA 1JXKA 5ADOL 3J07A 3VFPB 4JHUA 2RFXB 2NY0B 5AVYB 1X6LA 3ZZSA 2EICA 2P9UC 4BKLB 4K3JB 3UGXA 4WK0B 1TPXC 1L9MA 4JFTA 4ZMVA 3DX8B 1A65A 4HIEA 1YNTF 4OM0H 1BFVL 1FHNA 2EJ1A 3ML8A 4IRZA 3VXME 1U93A 4KROC 4DO5A 1A9BA 3M1OA 3QEUB 1WS7A 3NRQA 1BVKB 1G1KA 1J0KA 2MHAA 3G6AB 3NFPB 1JI2A 1IAIM 4LGRB 4W9KC 4P9HL 4TV3A 2F15A 2GY7B 3LKOB 4W6XB 4HC1H 4OQ1A 4EJ1C 2V7NA 4Y4FD 4PJ5B 1MUJB 3NCYS 1NL0L 4L1SA 3QDHA 4IHBA 5HGAB 4A7QA 1UWGL 1NCAL 3PIQA 3L4YA 4E9QA 4YSQA 3IXTA 3ZX1A 5FFLA 2V2WA 1H3XA 1QFWL 3MQIA 5DZVA 4L9LB 2L0DA 4GSRA 4A2EA 2PW2A 3N9GH 4HK0A 3TT3L 2FDBP 2UXFA 3OMIB 3C2SA 3GINA 4G8GB 4K71C 5AOJA 3MZKA 5E00B 2AGZA 2EE9A 2VXSH 3EOBA 3LB6D 3NCXA 1HJBC 2YQGA 3UTZA 4KWUA 3LHPH 1ZT4A 2DM4A 4X6EB 5PCYA 4M7LL 3T04D 4UZSA 1AO7B 3TTYA 1S9VB 4EI5C 4JG1H 4M3HA 5F8QC 1QWHA 4U2ZA 1CFTA 4AW4A 1N2RB 1DJGA 1F00I 2VMEA 4PJHB 3DK0A 1FL3B 3P30L 2F6AA 3VH0A 4CNIA 1E5BA 4EZMA 3GXDA 3CPLB 4HG4K 5I76B 2BCJB 5E94A 4UM9D 1CDCA 4L5FE 1B6DA 5FYLD 4HV8A 1E4XI 4YDJA 4HBCL 2ORBH 3VXNA 3GSWB 5HHVH 1T03L 2WUBL 3PL6C 5F6IB 3IDYB 1G6RL 3BXNB 1W80A 1MJ7L 5DJ2A 4XXCC 5IZ7A 1ACXA 3NVQA 3DVGA 1R6VA 5EEUA 4UM9A 4XHQA 3BAJA 1G5GA 1VFBB 2O6PA 4NPJA 4MYPA 5AYUL 4J8RA 1O6VA 4ZNEA 4DN4L 4JFFD 4YBHA 4TNWF 1X9QA 2I5YH 3OHMB 3VI4A 4A6YA 1DVFB 5FYJU 4ZFFB 5DVMA 5IJDC 1EXHA 5IB1B 2F5AL 2BZCA 1HWHB 4GP8B 2NYKA 2V6HA 3BKYL 3TJEH 1MIML 4WI8A 3GD1C 4HIPA 4ZTEA 2B5IC 4PS4H 2HFFA 4JFFA 1G43A 1K3IA 1R5WA 2ZUUA 1MCEA 2CIKB 5B38B 1H5BA 3VFVB 1XGYH 2O6DA 2WW8A 2XTJD 4H8VA 3TIDB 5C0AE 2GC7A 4AMWA 4ADIA 2YPVH 4O2CB 1IGJB 1ZEAH 4FHBD 4QYAA 4R2GC 5IVXA 3IRZA 1F13A 1ZHKA 2PPAA 3FKUS 4KBPA 4OCRH 1WZ1H 4WY7L 4Z3JA 4WFHE 1P4IH 5HHQA 1R3IL 4JJ5A 4ZI8A 3WBDA 3TO4D 1HTYA 3JZGA 3GXNA 1AR1C 1UD6A 4W9HC 3V5HB 4LMQE 2VDPL 3HZKA 2CJ3A 4ZW5A 3WKPA 1W9XA 3BH8B 4OGXL 4OGZA 3AY4A 4N2AA 1OPGL 4NM8L 3A67L 4P5TA 2WTPA 4X6FB 3RVVC 3V4PH 4P05A 3DX7A 3BEVA 3KXFB 3TO4A 1IBYA 2DICA 1EZVX 2GK0A 3U1SH 5EIVA 5JQ6L 1RZPA 1C9IA 2P47B 2VDML 3LZPA 5FOBA 2D7MA 4YWGH 3JROA 4KRMB 3JWNG 4PGCA 2E74C 2YBRA 3N3EA 3AJ7A 4GEJA 5FKRA 4DUVA 1NAMB 3SDCB 4H44C 4AYGA 2PBIB 3V0EA 2Z65C 5SX4I 2CCWA 1HKLH 4N0RA 3PE9A 1IO4C 3LPOA 2VB5A 5AKVA 4DHLA 5E8DH 1XCWA 2OMWB 3B2UC 4XN9A 1RVFL 1K5NA 4G2AA 2E56A 1G7MA 3FONB 1HHJA 1NGPH 2D0GA 1SMDA 1UD8A 3F7RA 3NA9L 4P2RE 4POUB 3H9SA 1KTBA 2XZQL 4NSKB 3AL8A 1AZZC 3OX8B 3O4GA 3OKMB 2AV1A 1F3DH 1F0LA 5GGQL 4ERQA 5HHXH 1E5YA 5CLXA 1PKOA 3VRLE 3VXQB 3ETBJ 3O4LD 2Z34A 3VXMB 3WLBA 4FNRA 1UA6L 3ARDB 4XZUA 2Q76B 4HLZG 1U41A 4L1HA 1TG8A 2J8UE 1S78C 3CZFB 3D2TA 2ZWYA 3JV4B 1MEXL 3VD3A 1U91B 4JR9L 3H6AA 3QO0A 1JWSB 3T65A 4X7SH 4UZGA 2NNCA 3TYFA 3NK3A 2HX8A 3R4RA 4TQIA 2W88A 5TF2A 3OJ2C 3HRZA 4YHNB 4P4KB 1NC2D 4LGPB 1QSFD 3LQZA 3PGFL 4OTXL 4PRHD 3NVNA 5EZIL 2GJ6D 1U42A 1L9RA 2HJLA 3C08L 1ZVYA 5KVFH 4UU9A 4U1KB 4XCNA 5HPMA 4KK5D 2FYYA 2DQDH 4TNVK 1PZBA 1U8JA 1MFEL 2BNRE 3WSQL 3BN9C 3WNPA 4B7LA 4G83A 1PZUB 3MV8E 2BPBA 2JJTA 1T7VA 1MWAH 1NC2A 2DQIL 4LHUG 1QSFA 4FTDA 3G6JB 4J27A 3MLYH 4PRHA 2GJ6A 3HE6D 4Y2DA 1F4WH 2EDMA 2FEDD 4GW1A 4F8LA 4AOFA 2EDJA 3ECBA 1ITCA 3QXUA 4G42A 4LLQA 2V37A 4BFKA 3HJ0A 4NUQA 3VFRB 1KCBA 1XCQB 2WGNB 4V2BA 2UY6B 3LRLA 4E41D 1DBBH 2JB5H 1AQHA 5J6HA 1IGYA 3VFUA 2DAVA 1ZDSA 5GSAA 3EH5B 3DUUB 2BCKB 2I07A 3O2VL 3ZLQC 1BYNA 4I5BB 3V5KA 4WEMB 4C57C 1MI5D 1N8ZB 4E41A 4OQTH 3WELA 1NMBL 3VGFA 1FSKB 2BP0A 3HUJE 5E1QA 4WU5A 2WLIA 1HWWA 2Z31B 2A9BA 2W59A 3BKJL 4FQJL 1S5HA 1SJEB 3QUXB 3CC1A 5B39A 4WEBL 1MI5A 4I3GA 4KKBC 4ZXBD 4GM3A 3CVCA 1DQIA 1ZLUH 4IHOB 3ARBB 1WT5A 1MLCB 4NKMA 1YPZF 3THML 4ABQA 2ZCHH 1LP9E 3L4TA 2H9PA 2PP7A 4MA8L 3GLEA 2BXZA 4GG6F 1AFVL 2FECI 1QRKA 2WBJD 2FTAA 2ZIDA 3PLYA 5D93C 5KYWB 1YY9C 4D9QE 2BHUA 3MXVL 4GRLD 1E8MA 1FRGH 2ZUSA 1ZSHA 4ZDHB 5C0AB 3JZHA 4ZYKB 3TBSB 3TBWA 2PYED 2VDQH 3P4OB 1OT2A 3IMWA 4HSCX 5EM2B 2UZYA 4LHUA 3L4XA 5EA0H 4GW5B 4WJ5A 3HI1A 4JQIL 4NZUH 3RWDA 4AV5A 4NPYB 2CN3A 2OSYA 1J5CA 4ODSL 2IDSA 3B7TA 2WBJA 4PJEA 2RBLA 1H8NA 2WV3A 4GRLA 3IDIB 2APVA 2L7UA 4U1HA 3U1PA 2UX6A 4L4VE 2ZAGA 1P5UA 2ATAA 3COOA 4HKZB 2OR9H 3SD5A 5A7BA 1A64A 4NXSA 4BCXA 4AMYA 1KNOA 5BZWA 3CCHA 5D5MA 1OM3L 1YEEH 4PBZA 3ISYA 3UTSE 3H56A 1AD0B 4MZIA 4HT1H 4AE1A 2BSTB 1EJ6A 5CXCB 3SPCA 5HI5C 5IFHH 3WU1A 1A9EA 1FGVH 4RDQG 6PCYA 1M6OA 4LEBA 5ECGA 1JZFA 2P24B 1P4LB 2H2PD 3SZ6A 3VX0A 3L3KB 5LG1A 5AW3B 2QHRH 2FIKA 1P4UA 2VW6A 5DQDH 4GS7B 3AQZA 4AH2B 2Z4QB 4FHKA 2RD0A 2ZKWA 2WLKA 3P9WB 3SE6A 1RZ8A 2YD8A 4MQTB 5FKPA 4A37A 2P8MB 2ZX9A 2QSQA 2Q7YB 3HKZA 1FVDA 3MRIB 3HHMA 2A6DB 2HJKA 4HH9A 1EZVY 2YPKA 4G7RB 5GS2H 2LU3A 1KG0B 4FZEL 4P2RB 3AWGA 4YO0B 1UM6L 4OZ4B 2YRPA 4TUKH 2JJUA 3UROR 4YHPA 3L9YA 5FHBL 4NNXB 1IKFH 1JDCA 4YH6A 1R3KB 1MJJB 4UQIM 4DVRH 4EXPX 3D25B 3IU4H 2G0KA 3GMMA 3O11B 3DA0A 2JKTM 1RIVL 2ICES 3JVGC 4LG9A 5LBSH 1NM4A 4MDJB 3ILPA 2J8UB 1P7KB 4JFEE 3TPUA 1HH6B 3ESPA 4KK9D 2BVUA 4QY8B 4NN7B 5IESL 2EBSA 1QASA 2EDBA 1USQA 5MEPB 2KLSA 1BPOA 1ZHLA 4M1CC 1EFQA 3VQ2C 1PAMA 3CC5B 3Q6GL 3STZB 1HH9B 5H2BB 4LLMA 4PIBA 3W2DL 1Z9SB 3QORB 1R0AH 4I0PD 4AYMC 4Z7WA 5EC1B 2GJRA 3PVUB 1OE3A 5B1AB 3BZ5A 1BD2A 4HC1L 5EBWB 3X11A 1KJVA 2H6OA 3UEZA 1UURA 5I30H 5IHZB 1SN5A 2WY3B 4QRFA 3D4CA 2QMJA 1MDTA 1OAUL 4L5FL 2IH1B 2DEYX 3GHEH 4I0PA 1XMWA 2BNRB 1BF8A 4HMDA 3MV8B 1ZHNA 4C4UA 1MREH 2IALB 4AQ1A 3MKQA 4FNUA 4U6XA 3HLAB 3N9GL 3GHBH 4OF6A 4NZDA 2KT6A 2GJJA 2R51A 5CILH 1DUZA 2VXSL 3QA3B 2E7BA 1JF5A 2W07A 3RWHA 3T09A 3AU1A 1WSST 3NJLA 1G1CA 4JG1L 5FB8A 4AN1A 4FXTA 1IC1A 1MCCA 3GBMH 3PWJA 8FABA 1VRSA 2BP3A 1S6NA 5ICYA 2ICWI 4ZZKA 1PX4A 3SDDD 4AV4A 4ORZC 2CIIB 4KROB 4L1MA 4LBEA 5FYKH 3IFLH 2Q7QA 4MS6A 1ZY9A 3Q8AA 2JJSC 3VG9C 2WCPA 2OXHB 4ZUSA 5IKCB 2ORBL 1YAZA 1UTCA 2MQGA 4DKDC 2QKSA 3KE0A 5MENB 4OD2A 2E86A 1OE2A 4L29A 5GS1C 3KW8A 5GRUL 2WBWB 5AL8A 3SDDA 5JW5B 4I1PA 3E6FB 4PJIE 3FH7A 3DKHA 3KPSD 2AITA 1EUTA 2DQ6A 2J8HA 4PP1D 5HYIA 1XGPA 1V3KA 1OQOA 5D7EA 2IQAB 4U1JB 2QVKA 5DHVA 2VR5A 3L3OC 3TZVA 3KPSA 1INDL 3L7EA 1HSAB 3MV7E 4K71B 5A7EA 2WQUA 1EXUA 3TJEL 5C0BE 5KSUB 2YFNA 4M7ZC 4N22A 5IBTL 3QUKA 2X5PA 4Z7OB 4RMBA 5IUCA 5AQ0A 2XXGA 1KJMB 5FYKE 3QJFB 2VJXA 3KYAA 4L4VB 2P42B 4FXLA 1K8IB 3MRJB 5DD0H 4YMPA 4LGNA 4GIOA 4MSWB 1KF9B 1ZEAL 1Q90A 4J0XA 2DWDB 4PY7B 3V55A 4M61A 5DYOA 5DK3A 5ETUA 1FZMA 2ZKXA 3D18A 4OCRL 3RSEC 1WZ1L 3KPTA 4NJAH 5KSAC 4GINA 1P4IL 5AAMA 3O3DB 3IB4A 4JKKA 3ZKSD 1OSEA 3CFNA 1LK2A 1VSCA 4HFUH 4LCWB 4NQVB 3UTSB 3BIAX 4AE0A 1P5VA 3GSNH 1GVIA 4RFEA 5AVXB 1T1YB 3KWTA 5I8CB 4N2GA 3PL6B 3WKYA 1QVOA 3HBZA 4ELKA 2EACA 1UOLA 1JWUA 3V4PL 1MWOA 3L3JA 5JHDD 4B9IA 5GXHA 4H1LG 3L3DB 4NQTA 5FC9A 2E3VA 3TEYA 3D4ZA 5HVGB 2H9MA 5G2NA 1TYRA 3EDFA 1EHXA 2ZKMX 2BP8A 4HIHA 1ODUA 3QDGE 4PRPB 3ZDYF 5BW7A 1J87A 5T5FH 5TDOA 5E6ID 3PDOB 3W81A 1BF2A 4AEZA 3FUNA 5JHDA 1MCFA 1HKLL 1U8LA 3GI9H 1OVZA 5IQNA 3VDBA 2OL3B 1R33A 3QK0A 2N3JA 1AS7A 3B8YA 5E8DL 2YD4A 1AXIB 3GSUB 1MCIA 3WO4C 4D8PA 4H5JA 1MPAH 3WIIH 3CXDH 1NGPL 3SE8H 4TRPH 5D6DA 2Y4SA 4AY0A 5DJYA 2E6JA 4PGBB 2CCVA 4AEFA 5F3HB 2H6KA 5DS2A 4KVPA 3U4EA 3QFDB 3ZKNC 2AJSH 3HAEG 2FO8A 5FKTA 4RAUA 1FJ1A 1MRDL 1G7PB 5IOPA 3V79C 3UZVA 3VMNA 4QT8A 1TNMA 5FO7B 1YEFH 3SYPA 1CK0H 4Z7NE 4I2XE 2NW3A 5HE1B 4NKOA 1AR1B 3MBED 1T89C 3V0HA 1X5FA 3NZUA 2FQDA 2OJEA 4Y1SA 1U8PB 4CSPA 1BQRA 1W8NA 3MRGA 3PDGA 1VFAA 3VO0A 5FECB 2WOBA 3UTQA 1T5WB 3STLA 5FV1L 3FUKA 3QS2A 4WV1C 4UIKH 4MA1C 3QRFM 3GQFA 5CJXA 4X7SL 5TQ0H 3IDGB 5CXCA 4DNWA 2RR3A 3MBEA 3RJDA 4MCZA 2Q8BH 3BP4A 4MBOA 1RXLA 4HPHA 3CFDA 4HEME 1WC7B 4TQHA 4N9GB 4P04A 3UAJC 5AD0B 3ZO0A 2ZXEB 2XWJB 4FP8H 4LP4A 3ZPDA 4F3FA 2R23A 2H3XA 1CFQA 3FFCE 3OGOE 1HOCA 2FUTA 5SWZD 1AP2B 1AGCA 4HISA 2QGDA 3RHWF 1DQLH 2Y1AA 3IFPB 4JUTA 1WBXA 1RJLA 3FB6B 1U8NA 1QX1A 4KK6C 3CVIH 4M7KL 4UAOB 1BCIA 1JPEA 1XAKA 3GBLA 5IHBA 5IV2A 2AZUA 3BGFB 3SYAA 4ZZFA 3NIFF 1F1DA 5SWZA 1KTLB 1L9TA 3FUDA 3MJ7A 4NIKB 2VERN 4LEOB 1VFMA 5HDBE 2J88H 3WNNA 1FFTB 4MAYA 4NBXB 1COBA 3DTXA 5MEOB 1DBBL 3E6HA 4JQVA 1EHAA 2JJVA 5IB5A 4LG8A 3KLHC 3QUMB 3WNMA 1U3YA 4QRUA 2X3CA 3KPLA 2H3NA 1XF5B 4P23A 4KHXL 3D09A 3B9KB 3DTDA 3DTUB 1S7UA 4MB4A 4XXDB 4IS6B 3DV6B 3RP1A 3EIFA 4PAZA 4ZMPA 4YOKA 1P1VA 4N6QA 1TT6A 2BCMA 2DBJA 2EP6A 2OIZA 3DGDA 1G9NC 1KIQA 1CE6A 1YUKB 3MV7B 1SYVA 2W18A 2W9EH 4O2EB 4YDVA 5C0BB 2MMXA 4BFIB 4NDMB 3FUEA 4CBPA 2X87A 2ZCHL 3BWAA 3PUUA 4HK3N 5DC9B 3SPVB 3SGDI 4L9DA 2WYIA 1FGNH 5EIQA 4NBZB 4NO0B 1FFOA 1M6UA 3NCWA 3S2AA 1NCDL 2CR6A 1FRGL 5GGUB 1E7UA 3S9DB 5F21B 5DEGB 4WW2A 4OGAC 3ZN6A 2VDQL 3AS0A 2HTKD 3CIAA 4BSJA 1L6ZA 4XVTL 5BZZA 3DXAB 5EA0L 4TTGA 1KBWA 4QXUH 2NZ9C 1NGYB 1Y18B 4G9FD 5HDLA 3S37H 1UUNA 5HYFA 3A4AA 2VXVH 4H25A 5ESAA 1S7TA 5IJKC 1PSKH 3VTAA 1UFGA 4XPFH 4QT5A 4LIQH 3ZL4L 5FYJH 4JPQA 1UT1A 2FX7H 5E5MB 4WNQB 4YK4C 2G9HA 5F6HI 5EU3B 2CU9A 4UUJA 4JDVA 4JXMA 4XX5A 1MHEB 1J8KA 1K5WA 1EO8H 4PBDA 5JXEA 3NJNA 2VC2A 4G9FA 4PJDF 1P2CB 2E9GA 1UZ8B 5E56A 3KYKH 1HT6A 4YUEH 5IEKB 5JO5A 4GG8A 4LF3B 4HEPG 5FA4A 1LYQA 1TVBA 3BVXA 3OSVA 4HT1L 4XXWC 4Y2OA 2XZAH 3BQUC 2MKLC 4DEWA 5IFHL 1FGVL 1R3LB 1CMOA 3K74B 1NPJA 1IAOA 4NWUH 1QUNA 1ZKAA 5HHPA 5DD3H 1K72A 4MCYA 2V5MA 3S3JA 4WNSA 3WXVH 2QHRL 4OIAA 5EH1A 5DQDL 4YSOA 5AZ2H 2ED6A 4UOQA 3E0GA 1JTDB 3KYNA 2XYIA 5J0BA 2XN9D 2DJUA 5TH2A 5C09E 5F9DC 5E08H 4G82A 1NBZB 2WXPA 5JOFB 1NH6A 4ZTOL 2GI7A 3P4NA 5FO2A 1B9YA 5D93B 5IT2H 4GQ2P 4JM2F 5BPPA 2FWOA 5FYJE 2HPTA 4LKXB 4A09A 5D6CB 4FXGC 2ITEA 3G5YA 1ETZA 5LDSA 2DYRB 3Q1SH 4XYIA 1J1XH 4NAMA 2XN9A 3FB5A 3BPNC 5DJZA 1IKFL 2D8KA 3NIGA 1AKJB 2O30A 2VR9A 3WEXB 4DVRL 4PHZA 5CEYB 5ITBL 3IU4L 4WTZG 1OGAD 1ZK9A 4LVNC 3C9CA 1GJUA 4JFXA 4Z7NB 4I2XB 3BPOC 3L5JA 3N06B 5IT9g 1H3GA 3IGAB 5LBSL 3UTTE 3VI3E 5BJTA 1YDPA 5F9AC 4ZS6C 4IU2A 1EMTH 2Y3AA 1BFOA 2E5EA 4Q8BA 1MZZA 2P28B 2MQ3A 3UPRB 5M5TA 3EUUA 1L4IA 5D7LD 3BGMA 4MB5A 3ARED 1OGAA 4MXQC 4NBYB 1NGWA 5C0NC 3IIYA 2YN5A 3FQYA 4P49A 2WNGA 2BLFA 4GBXA 4GAAA 1R0AL 4MJ4A 2BBKH 3EFOA 1ICTA 1N5YL 3HS0C 3EI2A 3TBYB 4EDWH 3L8QA 4TVUA 2KQMA 1JV2A 5ELIA 1TOXA 1KDIA 1Q9KA 3QR1A 5CD5C 4GUPA 3AREA 3FTZA 4QRPB 3RLSA 1GGCL 5I0YA 3E2HC 3FFCB 2OVPB 1J8HD 4MNQD 2J56H 4JLRA 2D7OA 3GHEL 3MRDA 2R9HC 5CWSA 3ZTDC 2I85A 3DGGB 5F9WC 3OKOA 1URIA 2IH8A 2XJKA 2ALWA 5LN4A 3QULA 1NIDA 3V4VB 4OR1A 2TSBA 4QOKD 4Y5XC 1ZS8A 4EVNB 4KZDH 3GHBL 1JIBA 4Q0XH 1VE6A 1L9OA 1J8HA 3BVVA 3AY2A 3OTTA 5CILL 5F1SA 2X4PA 3DMMD 4MNQA 5EBMA 1HHKB 2EDEA 4PCKA 4OLXH 1F11A 2QPDB 3RVTC 1GGBH 2QR0A 3P4MB 5T33H 1QSEE 2C8NA 4F9PA 4JPIB 4LSDA 5EF3A 4ADGA 4MD5A 5FCSH 2CPCA 4HUUA 4QOKA 3CQPA 2F61A 5DHYB 2YC1A 3EJTA 3Q2CA 2VN5A 3GBML 4JHPC 2XXFA 1NOAA 2FNWA 2HRPH 1P4BL 4HOMA 2GTZA 1EHLL 4OCSH 3LZNA 1G9MC 2H3KA 4DO6A 1RUQH 1SVBA 5DC2A 1Q0YH 2VR6A 3IFLL 5FYKL 3LNEA 2LE9A 3TURA 3A6CH 3Q8EA 1C08B 3LXAA 4PG9A 4YEEA 4R7DA 1FFNA 4CKVX 3UZQB 1LE5B 3QVAA 3GNML 3JWDC 3WGUB 3H7BB 4OFVA 4K7PH 4FFYL 4RISH 4B97A 1RULH 3LZOA 5HVHB 1A22B 3SOBH 3VTTA 3TA3D 3WOVA 1N26A 2DI9A 3FO0H 2VSCA 4XP4L 3GSOA 4WKZB 1DQDH 3LNGA 4GQ9L 4NN5C 3VXUE 2CM6A 4XOAA 3IMSA 3PJSB 3APFA 4K3EL 2Y7QA 4D8OA 2W0LA 3T3PF 3HKFA 5E1HB 3S88H 2ZSVB 2AH0A 3HPLB 3ZSTA 3KVQA 3PABB 1PLCA 4M3KB 2VTFA 3RFZA 4A0BA 4TVPD 1DYZA 4MCMA 5JPMC 1KEGH 2AGXA 2OQJA 5D2LE 1AG0A 3D69B 4MBRA 4WI6A 4ALAH 2QPUA 2LVCA 1G9NH 3NZSA 1U4FA 2BWDA 5JIDA 4UF7C 1J48A 5DD0L 4AMXA 4UTBA 4ZJ9A 1WK0A 4LRIA 1HEZB 2BC4B 3NAAH 1H8LA 1SOSA 4R3SB 1U0QA 4F93B 1FFPA 2NY4C 1NCOA 1TJHH 4PRAB 4WJG3 2O6CA 4NJAL 4BRVA 2GB2A 3FCSB 4J3WA 1BVNT 2MH4A 1P9MC 4ZPVA 1BQLL 1WUNT 2X0VA 4FHLA 4HFUL 1BWMA 4NKQB 3VJ6B 1ZLDA 1J86A 4Z3EA 3QISA 3UAEA 5FKQA 2J2ZA 1TKWB 2FEJA 2OP4H 4U6YA 4PV1C 2B9BA 1UM4L 3TX4A 1AAJA 1J9TA 5GS1B 1PZAA 2KPNA 3TEZA 1E27A 1U2CA 3MREA 2EEFA 4RVBA 5F1IA 3ZDXE 4CC4A 1TYEA 5AUMA 3KYMA 4PRNA 4XCYB 3KLSA 2WLJA 3BP7B 1D5IH 1XGUB 2VMCA 4QHKI 5C09B 3K7UA 1I1FB 4PCTA 2BSSA 2P9LC 5L2JA 2EABA 4J82A 5TFSH 2FL5A 2F1AA 5E8OB 3QDMA 4F8QA 2XIIA 4L1QD 5IMKB 1NEXB 2Y6SC 5EO0A 3SKJH 4AIZB 1E8WA 1M3IA 1WWCA 5M7QA 2WWKT 5EO9B 4M7ZB 5FCUL 2YA0A 1PEVA 5SWSD 5HJ3A 2OX5A 4JFDD 5IQOA 1LEGA 2GC7C 4K23H 1C5CH 1MPAL 1JGUL 3CXDL 5FHAH 2IWGA 4TRPL 5AB1A 3SE8L 2ADIB 3VI3B 1JE6A 1ORSB 1X44A 3K5SA 3OMNB 5KS9F 3LRKA 1VZ2A 2FAUA 2BXYA 2AJSL 4APQD 1I7ZB 1E2VA 3FU0A 4YVNA 4MFHA 2QVMA 1C5DB 5IMLB 4NHUA 2PETA 1JPGA 3FO9B 3QHZH 4TSBH 5SWSA 4J86A 3FTYA 1UJ3C 4JFDA 5KSAB 4WTXA 1ULVA 4MDIB 3BG1A 3LIZL 5ISZD 2DTMH 4R96B 2WO4A 4B60A 4BA8A 1II4E 5KYXB 3UKUC 3SJVE 5A2Qg 1FV1B 2QQQA 4DKEH 4HS6A 1Z7JA 5KSBB 4N1HB 5BRZE 2QJDA 4P5TC 4D0BA 1ZWIB 5D4IA 5ICZB 3CSBA 3HNVH 1EBAA 1JZEA 4V33A 2IH3A 4NP4H 2CGZA 3QQDA 1DVYA 2M2DA 2KDGA 4TVSa 3SCMA 1SPDA 1I9IH 3AT9A 3CU7A 1QTYT 2QQKL 4DP6X 4N0FB 1RJYB 5I2IA 3H9HA 2H26A 3CAFA 4AZUA 3OAUH 4HPOH 3AFLA 2FATH 3D3VD 1N12A 4PSPA 25C8L 2HKFH 5AENA 1UCBH 5IHLB 5AYQA 2A73A 3RRMC 3IWUA 3OLGA 4FP8L 4PJAB 4U3SA 1DUYA 2WWNA 1MHPH 1T04A 1GYVA 4XO9A 4FI6A 1LO3H 1QSEB 1DQLL 2ZOLA 4QLRA 3D3VA 3A5VA 3TEUA 5DMKA 2FJFB 5DYFA 3CVIL 4Y19E 1OV8A 1RZGA 1RUAH 1DSFH 2UYLB 1FIGL 1I1CA 3LZQA 1I1AD 1CDIA 1TZHB 2CLZB 3PG2A 2EH7H 4DK5A 1YCSA 2J88L 4HHAA 3LNDA 5JXAH 4GYBA 1Y6MR 9PCYA 4FABL 3GTNA 1JZ2A 3DSNA 3PWUA 4BFGA 1A4KA 4QTIL 3EW3B 3G5XA 2X41A 1K8DA 5KN5B 3N42B 1N59B 2CDFA 3L4OD 1KCVH 3PE7A 1UXWA 4LL1A 5CXPA 3SDXF 1V5JA 1MELA 5I66A 1ZVHA 4MA1B 3OKKA 3TV8A 1E4KC 1PYWB 1U8CA 2LAGB 3U9UB 1HESA 3FB8B 4RZCB 4YHYC 1W8EA 4EN3D 1H0DB 3IF1A 3LRMA 1OCZB 3VXUB 2A6KA 2WXQA 3HI6H 3MLRH 3N43B 3KWVA 2FEEL 4NJ9H 1WYJA 2A6IB 1Y1UA 3DVFA 3GRWA 3LRGA 1G9MH 2PW1B 2YN3A 4IOFC 1E4XH 4L3CA 3JWNC 4OVUA 5HI4D 1TYJA 3G6DH 1E50A 3AQDA 4HUWA 4YR6B 1G0YR 3FQTA 3D85B 4EN3A 2JJTC 4IRSD 3TONA 2ZP8A 1VPOL 1DQJB 4YHZL 2AKRB 5IIEB 1FGNL 2EH8L 4Y2DC 2V7HA 5TDPB 4XGZA 2WVTA 4HDJA 1GW0A 2YWZA 2NY3D 3VDCA 3NYKA 2K4WA 4N0CC 1L5GB 4ZUWA 4ZUUB 2K78A 4ZW6A 5A2BA 2K9FB 1DN0B 1JZ3A 4IRSA 2EIKB 3HZVA 3L95B 4QXUL 4Z3HA 1A7RH 3I6SA 1MG3A 5CCKH 5FXCH 2B14A 12E8H 3I6LD 1PSKL 5IJVA 1KCLA 4XPFL 2FD6L 1KWGA 1BX2A 2XLLA 4GSDH 4RGND 3ODTA 4JG0H 5FYJL 3NEOA 2FX7L 2MOGA 3NJHA 1X7QA 4A1RA 3OKLA 1T0OA 3AUVA 4N14A 3IT8D 4I18C 1CPUA 2NY1C 4X60B 3JWOC 1EO8L 3DX9B 4ACPA 3JTTA 5D1QD 3BW9B 2N59A 1N6FA 3FSWA 3KYKL 4CDGC 4YUEL 1Q9LA 2P9NC 4R4FH 4FS0A 3TWCH 3DIVA 3E9TA 2XZAL 1PD1A 3VFSB 3DXMC 5KBDA 2IGTA 2V8MA 5IB3A 3CK0H 1BJ8A 5F1NB 2O5YH 3BWUF 4KY1H 4NWUL 3BSGA 5DD3L 5FWQA 1TTGA 1AZUA 1M53A 5EWIL 2CLVB 3WXVL 1M7IB 2ZSWB 1A7QH 3I85A 2QV2A 4WU7B 1ZTMA 2VYRE 2MNUA 4FFTA 4MD0A 3OXRB 3RKDC 2PTVA 3SYQA 5E08L 1VACA 4AVIA 3QR2A 3UYRH 2B5MA 4XH2B 5IVOA 1DO5A 5I1IH 1GSKA 4U2YA 1TLKA 1IEAB 2PLTA 1OK8A 2WIIA 3ECVA 3MC0A 5H35B 1RUPL 4BINA 1NCCL 2C9VA 2Q1EA 1FG2B 1J1XL 5D7JC 1PDKA 1IGIH 1TEGA 3QXAB 4UDUA 5EIIG 5F7UA 3DI3B 2Z93B 3CGTA 1JJUA 1JK8A 1AZRA 3SODB 3CFVA 1MHHA 2Z2OA 1SM3H 3CXHK 1PJ9A 3MJ9A 1FZOA 4JFHD 3V6OA 1MG2C 4JMNA 3TOPA 3FZUC 3QZMA 5SX4H 4YK4B 3SJVB 2ZYSA 3LJ3A 3PGCA 5FUOL 3MGOB 4Y9GA 2A4CA 1XCTA 4GSQA 5EUOB 5EZOH 3K71A 3WTSA 3FO1B 3ZT7A 2KERA 5TDHB 3H9ZA 2OZ4L 5E24E 4FNPA 3NK4A 5E6RB 5HP5A 1HZHL 1W0WA 1RP9A 1YC7A 4J81A 3DRTA 4PVMA 3SXTD 1AVAA 4MWFA 4EDWL 3GZKA 5E8EB 5ESQA 2JCCB 1LDPL 2OCCB 3HPJB 2GPZA 4WNJA 4P2OC 4P46D 3QUYC 1UXSA 4GRWF 3VD0A 3KPQA 1RK7A 5DD6B 4ETYA 2MSPA 4FZ8H 4HIJA 3K2IA 4OLYH 3CNKA 4QHMB 5IHUL 3BAEH 1XSKA 1DVSA 5CBAA 4H5IA 1SFDA 1JTOA 1KT2A 1IIIA 2CHXA 5DI8B 5H37G 3D6GA 4P46A 4Q0XL 4ENED 5ANMA 4QRJA 1X5JA 2EO1A 4KJYA 1E2ZA 1HEHC 4B3VA 3VNZA 3AXIA 4OLXL 1I4FB 1TYQC 2XE4A 4TULL 1EEYB 1RZFL 2GTWA 2O72A 2BVPB 2H14A 5CGYD 3BPOB 1KV7A 3VH8B 4MZRA 4IKLA 3CZLA 4Z0XB 2XJLA 5FDWB 2NLJA 5EFIA 4LCCA 1SEQL 3MRQA 2PPEA 2HRPL 1J05B 3J80g 1IUZA 1ZXKA 1R47A 4G5AA 5D1ZI 3MRLA 3A6OA 2VAAB 2R7EB 1RUQL 3EFFA 3I02A 2CNYA 2R1YB 3MA9H 3NFNA 4L3HD 1SZNA 1RIHL 4FA4D 4N2MA 4GQRA 1HHIA 3GIVA 1KGXA 1X5MA 3HS0B 3QAZC 2OJZH 3TS8A 4RISL 2EEXA 4Z7UB 4IIQC 4WWOA 1KB5A 4HHGA 3SOBL 3VE0A 1B2WH 5DO2C 4GIAA 3RDTC 5DMGC 3MBWB 1M2VA 3FO0L 2Y5TA 2X2JA 3F05A 5F9WB 1DQDL 5BZDA 4FTVA 5CCHE 5CIPB 4AQZA 3MRNB 4V1DD 3WDJA 4F7EB 3SCYA 2QADC 2VLRD 2AJZB 3S88L 2HT2D 4Y7MA 3MPCA 3QIWD 3GGWA 1DE4B 3QCTL 4FAND 1IZKA 2Y72A 1TENA 1VZ3A 4K3ID 5H37A 5IQ9B 4MJIA 4V1DA 1G9NL 2ZXQA 1CXFA 3H9SE 4EUPA 3BG0A 2VLRA 4UQ9A 2APBA 1U4CA 2DJMA 3QDJE 1U3NA 4X5XA 4Y2NA 1OMWB 3FB7A 2NY2D 4PJGF 3JWNH 4HIEB 4GOSA 2XPZA 1TJHL 3QIWA 5HQGA 1RP8A 2KZ1B 1U93B 4YSAA 1A9BB 4HBQA 2J43A 4DZ8A 3T0WA 3BRFA 3ZE0A 3FTVA 1QBMH 1Z3RA 2MHAB 3A4FA 4F8PA 3CFIC 3JUYA 1KTKE 1RPKA 2OP4L 2XY1A 1OTSD 2D3LA 2E8YA 1A6ZA 2FWLB 2G0LA 2V7NB 4KKCC 5IGQA 3AQYA 4K3DH 1F5WA 4F27A 2Y7SA 5C3TA 1LHZA 2ATKA 5CM1A 4OZGA 4ZFZA 3PIQB 1RH8A 1ODAA 3IXTB 2H2SD 2K3HA 1JZDC 4PS7A 2V2WB 5E4EC 4LLUA 4H88H 2IDUA 3SPIA 3M07A 4CZXA 4NUPA 3WFCH 3QZOA 5TFSL 4XBEH 2F7QA 3APNA 2MFNA 2PW2B 3FL7A 4HK0B 2EZ0D 1T5KA 1W91A 2CH8A 3QHYB 2IAAC 3BAYA 3TZVC 3PDDA 5LN8A 1LTXA 3SKJL 3A21A 3EOBB 4NUJA 1NGZA 3UTZB 5IQ7H 1MIEH 3JWNE 4QLWA 4PRBB 2AV7A 3PWLB 2ADGA 3B7RL 5EDSA 4HCRL 1KY6A 2KBGA 3E80A 1NFDF 5I19H 3GPEA 4Z7VA 2ZYIA 1BBJA 1C5CL 3BDXA 3Q0HA 5FHAL 5HDQH 5LNDA 3IGFA 5KJ4A 4S1SL 3FQ1A 1XH3A 3D50A 5TE6L 3NABH 5AAMC 3SD2A 5GZOC 4CNIB 4TSBL 1AZBA 1JYWA 1WPCA 3V0WH 1QPXA 5E94B 2JQAA 4HV8B 2EKSB 3PXTD 4YDJB 5CUSH 2DTML 5CS7A 5EOCJ 3EYVA 3SE4A 3VXNB 5C07D 2CALA 3QH3A 4NQED 3GFUA 1X5LA 4OZIF 1KYDA 3FAWA 4FQHA 5DJ2B 1QEWA 2ZF8A 5K9OB 1PGUA 3VGBA 2DQCL 4UM9B 3LPGA 4FMKA 4QXTA 2Y69B 4J8RB 3U30C 4Z78B 1I9IL 3ARWA 5C07A 4P5RA 4NQEA 3VD7A 3VI4B 4A6YB 2IAND 4JO3H 3RPKA 4GUOA 5BW7C 1KTDA 3KGTA 4IKKA 4ABUA 2CRMA 5F7BA 3OAUL 4HPOL 4WFFE 2FATL 1VIWA 2R1WB 2HKFL 3N5AA 4MVBD 1TVDA 1UCBL 2Y5QA 4HXBL 4UB0L 3QI0A 2KMWA 2HFFB 2WSPA 4MYWB 5GS0C 1R5WB 2LLGA 2YS4A 3KPPA 5IVNA 4N5EC 1H5BB 2IANA 2YAFA 3FQXA 1G94A 4UOJA 2YK1L 5GZND 4KKRA 4NS0A 1LO3L 4X6BA 4ZG1A 1Q72H 2A0LC 4N0YH 1KLFA 5IVXB 2L4OA 1EVUA 1NDTA 3B83A 4NZRH 2W0FA 1ZHKB 5IW6A 2CGRH 1WDAA 1RUAL 2XU9A 2AEQH 4GZ8A 5HHQB 5E2TL 4JJ5B 2XTJB 5GZNA 1UJ3B 4QXGH 3F7LA 3RAJH 4Y8AA 2F54D 1L0QA 2NDGA 5ADPH 2R2HA 4UI2A 5HI3C 4B5EA 4YSUA 4XCEB 3BIBX 2AK4D 5JXAL 3HZKB 3HG0A 2X53A 3ARPA 4L2LA 2Y7LA 3ZTEA 4BE5A 4FAAB 1D6VL 2WO2B 4MNGE 5D5ME 3NCFB 4I3RL 4P5TB 4XNAA 1QLEH 1GSMA 3DX7B 3BEVB 5AVRB 3TO4B 1BIHA 3TT1H 5CJXC 5D71H 3TBVA 2VDKA 2GK0B 2AK4A 2NZIA 2WWMD 1QG3A 2Q5BA 1KBBA 3PV7A 4DP5X 5FOBB 4RFOH 2V9QA 5B1KA 4UMSA 4JM4H 3U4BL 3HI6L 3MLRL 1E28A 3PGDA 1LGVA 4XCFH 3BP6A 2CO7A 1G7IA 5IROD 1G7QA 1Z0NA 1G9ML 1XGZA 1XGRA 1HFUA 1O6GA 4WO4D 1K5NB 1IQWH 2MQCA 3VYNA 1G7MB 4U1IA 2JELH 1HHJB 5G4MA 4BZ1H 1XF4A 4LVOB 3JWDL 1B90A 3H9SB 4LFHD 5F8RC 5JDSB 1L0XA 5F7DA 4IOSD 4AX3A 2YNOA 3CTTA 2AV1B 3O6KL 1ZGLA 1M7UA 1TTUA 5FO8A 1CGTA 2OI9B 4MAYC 3WLBB 1A7RL 4LESA 1NDMA 5CCKL 5F1OB 1OP4A 4XZUB 4JQVC 4Z7AA 4F2MA 1CQKA 4GSDL 4IOSA 2GBVA 3UERA 2X89D 4JGNA 2J6EH 1B3IA 3UJIL 4P23C 2R39A 1JNLH 2X42A 2HH0H 1QNZH 3QO0B 4X0KA 3ALXA 3T65B 3B34A 3FGBA 1T3FB 2RALA 3NG5A 3QZWA 4LNRA 3ROLA 3D5OF 4H13C 4LSTH 3TYFB 1YA5A 2VZ3A 1FCCA 3BKCH 3DDGA 3FH5A 4FQCH 4NRYA 4Z7WE 3HRZB 3MOBH 1BD2E 4YHYB 2XT1B 3LQZB 4Z3TA 2BY0A 2O5YL 2P5ED 4HA1A 4JL2A 4KY1L 1QW8A 4OAWA 4YHOH 1OW0A 1THCA 1I75A 4OT1H 4UU9B 4O4YH 3KRWB 4XCNB 5HPMB 1A7QL 2X0WA 5E9DA 2FYYB 4TNGA 1U8JB 4FQXD 1AIFA 3IGUA 3TL5A 1E5UI 1NC2B 3QG7H 4PRHB 2NUTA 2GJ6B 1I7RA 5BO1L 4Y2DB 2P5EA 2CO1A 5I1IL 1CDYA 4GW1B 5J89A 3ECBB 4G42B 3TO2A 3EI3A 4FNTA 2J71A 3BUYA 3KNBB 3WIHH 3VFNA 4M8RA 4IKJA 2PTTA 5IBLC 4K73A 4FQXA 5HHME 2GT9A 2PM7B 1NBQA 1XF3A 1QTSA 3MBXH 4J5VA 4M1GH 1QLFA 3MRHA 1XHHA 3ET9F 1U8QA 1SM3L 2IADA 5J6HB 3W9DA 2OR7A 4TTDD 2LR4A 1IGYB 3VFUB 3SB3A 4PD4J 4QHLA 3UCQA 1TIUA 4JRYE 2I07B 5C08D 5JXEC 3FU5A 5EZOL 2NY1B 3V5KB 4E41B 2I32A 2DM7A 4JY4A 4F92B 4NLAA 5JIMA 2VERA 2XETA 2YSSB 4PJFE 2GFBB 3AXLB 4XC1H 2BP0B 3PRZA 4KJPD 5EBLA 4WU5B 3AAZA 4MS8D 1EO7A 3QARA 1KXTA 5C08A 2HTLC 5EDXA 3HS8A 3SIKA 2VUYA 3FXIC 2GTQA 1S5HB 3JPXA 4MLSA 4KO7A 4N2CA 3K0YA 5LGJA 1UC6A 5BRPA 1CUOA 3T3MA 1TTBA 1XB6A 4NKMB 4J8GA 3ZE2A 3VUAA 4KXBA 4OKVB 5HYSA 4LL4A 3GSRA 4NFCA 4O2WA 2YPLA 4M7JH 5BVPL 5I1KH 4F15C 2VC2B 5EU4A 2HXCA 2G5UA 3EO0A 1EK3A 3IAQA 3TBWB 2EDWA 2OFQA 4E42A 4M43H 1FORH 2UZYB 4LHUB 1FNAA 1MKFA 3HI1B 4WJ5B 3I2CH 1R5IA 2K8MA 5D7JB 3FQ4A 3P40A 2WKOA 4FX5A 4DCQA 5I1DB 2WBJB 4ISVA 5M94B 5EMLB 4GRLB 1PZ5A 4U1HB 1QUPA 3HCVA 5I17A 4ILDA 1P5UB 5KSVA 3K2UH 2DW5A 1O0VA 3Q2WA 3TCXA 3A22A 4CDHA 1ACZA 1D6EA 1KNOB 3FT1A 2CWRA 4LT7A 5D5MB 5BZWB 5GS0H 1OXYA 2ENQA 1XBRA 3FSOA 4B9CA 1HHHA 3FBKA 4GBXC 1EIBA 4PH8A 1SLVA 3OAYK 1YUHA 2W9LA 1KZQA 2V2XB 1A9EB 2PCXA 3X14A 1M6OB 3IETA 3R7QA 4X7FC 1DFBH 5CU5A 2OJZL 4S0SD 1KZYA 3BVWA 1MZYA 2FIKB 4OUUA 5DHDA 2ITFA 5D7IF 3VFOA 2A7BA 1RHFA 3TU6A 1RZ8B 5FKPB 2X1QA 3ILQC 3TCLA 3ZKQD 1FVDB 4XT1C 1L9SA 4IGBD 3AU0A 2FB4H 2HJKB 4HH9B 1REIA 2YPKB 4M5ZH 4AGLA 2ROXA 1KUMA 2A9MH 3T4AC 4GAJH 5LXGH 3EH1A 4YHPB 1T7YA 2NPLX 5MP6H 3OWEA 4PVNA 1DLFH 2J25A 4WLCA 2QPEB 3GMMB 4IGBA 5ALCL 5JW4R 5LHDA 1HAWA 4F9PC 1ML0A 2R69A 1JL8A 3I6KA 1AC6A 1AE6L 1HX0A 3EZ8A 1Y6NR 4K94C 3ILPB 4L37A 3TPUB 4CI3A 1X5IA 2DQEH 3IDJB 3EGDA 4JHVA 3LKPA 4XNXH 2CE9A 2J44A 4TQPA 3SGDH 1ZHLB 4WGVB 2FECL 2KKQA 5F7KC 3FU8A 4LVHB 4ANWA 4EKJA 4G8EA 4IQHA 4DERA 3GBEA 4LLMB 3T6XA 1QBML 3UP1A 5DEFB 1U4EA 4Z7WB 4LLYA 1NUFA 1BD2B 4P3CL 3X11B 3DBSA 5CJQL 5CR1A 1KJVB 1RURH 4A7TA 3QAZB 5LCVH 5E70A 2ZXDA 1MQKH 4UBDC 4HKJA 3EHBC 3HAEH 4OCNC 4ZMNA 2FO4A 5C0RH 4FFZH 1NFKA 4JANA 4I0PB 2DF3A 2EVIA 3QNXA 3RDTB 1ZHNB 3F01A 3LZFH 2X1PA 4NC4A 4YXLH 1JNHA 2UWEF 3INOA 1CFSB 4AQ1B 4U6XB 3JWOL 3H85A 3N85L 1ZT7A 4AL8C 1YO4A 1E3ZA 1MIEL 1YQVH 1FNHA 4DEUA 1UWYA 2VAJA 2W07B 2DWYA 5IFAL 1MCPH 3AU1B 3H9YA 1THAA 5AMSA 5I19L 1K6QH 5FB8B 1JFQH 5DUJA 1U9KA 8FABB 3PWJB 2KS0A 1M9WA 3S98A 4A68A 2R8SL 5DGQA 1FDLL 3KM2A 3BUPA 1P84K 3QJVB 1MAMH 4UWQB 3RBGA 1ZTXH 5ICYB 2K7PA 3L4MD 3NCCB 3NABL 3KL0A 3MDJA 3RZCC 4LBEB 4PVLA 2VC2L 3BI9X 1ZA3A 2AEPH 2UVFA 3ARVA 4ZMXA 2HJBA 4YDLB 5F7AA 4DUXA 2XYCA 4UCFA 4RMUA 1M71A 2D7TH 4LPVA 4OD2B 1N3NA 2AI0H 3EOAA 4L29B 5DJXA 1WA0X 5F70A 3SDDB 3QIUC 2VE6A 3GZQA 2ESVD 5CF3A 4NOFA 2MRYA 2HN7A 4C4KO 4M5YL 2WPGA 5JW4M 1XGPB 4ZW8A 4U6TA 5E4EB 3BO8A 1F90H 4JO3L 3IFOB 1A14L 2FJHA 1WTLA 2XBDA 3QJXA 4Y1TA 5DHVB 2ESVA 4LRNH 1SFHA 4L23A 4C56D 3TZVB 1V55B 3KPSB 1E3XA 1J5HA 2NY5C 1XD1A 1EXUB 2WKGA 3BFOA 3PY9A 3QWNA 1FWXA 1ZTXE 1KPUA 3QUKB 5I6NA 1FN4A 5IJBC 3GFCA 1BQSA 2FT6A 3ECUA 5LGYA 1DQQA 3MROA 2B59A 2FVNA 2MCPH 4C56A 4H5SB 5C0CE 1FYTD 3KVPA 3BT2H 2GJZB 4NZRL 3UCRA 3K6SA 4M61B 5DYOB 3IS0X 3VG0H 5ETUB 1FZMB 3D18B 4WK4A 3FN0H 2JKLA 1LWRA 5GIRA 3DHPA 2AEQL 2GNQA 5TK2A 5EF2A 3CUPA 1G6RA 1WH0A 1DJZA 1ZDQA 1LK2B 4QXGL 3WJMA 4NZTL 4RGMC 1CIUA 4X8GA 1P5VB 1AHWA 1FYTA 1LO2H 4RMQA 3ZR5A 4RFEB 3QEGH 5TQ2L 1QRND 3VSQA 2Z8RA 3B8SA 3QJUB 1O7DC 5JQHC 1F02I 4DEPB 1QVOB 1WFTA 4QRAA 4JJHA 4JVPA 1JWUB 3MTRA 3OAZK 4J3VA 4WK2B 1IE4A 3VD2A 3L3JB 1KBGH 3TT1L 5E7BA 5I74C 1Q38A 3S3SA 3SCMC 3X1FA 3GJFH 5D71L 3VQLA 2AQPA 4ZD3H 3RRQA 1PPIA 2V3DA 4RFOL 2BP8B 4HIHB 4EI6A 1TTCA 5M5SA 4KKQA 1SBSH 5TDOB 3O8XD 3PXJA 3V0GA 5J12C 1A0QL 1VERA 4FRWA 4NHCL 1WIUA 3MCLH 5JHDB 1U8LB 1F56A 3ZHNA 2FUQA 1XAUA 5M95B 3MRMA 4NRXA 5G55A 3IBOA 1SN2A 3A6BH 5F7WC 1XMEB 1IQWL 4D8PB 4W9DC 3WFZA 1W2KT 1CQYA 1TQVA 2JELL 4GM9A 3SWSD 4M8QA 4HKXA 5DJYB 5CZVH 4PLNC 4ELMF 2CLRA 2HX7A 4X4YB 1PTZA 1IGMH 2VO8A 4AQ8A 3RWGA 2VDPA 1SDAB 4OZHF 5EU7C 2NY0D 1LL1A 1IM9D 4PN6A 1FJ1B 4RAUB 4N1CA 1CFNB 3UZVB 1VYHC 2P9KC 1HKFA 1NCUA 3WS6A 2MPVA 1F2QA 4UDTA 2ZKYA 1EAQA 2NW3B 5I1CH 3SQBA 3ARFC 4NKOB 4XMVA 1H6FA 4JJOA 1L0YA 3G5WA 4LLQB 5IHHA 2OJEB 4LGSB 3B9VA 3MRGB 2CK0L 1VFAB 4RBPK 4G70B 5AOLA 1U6AH 2RFXA 1ERJA 3UTQB 5CLYA 1IM9A 3Q05A 2VDMA 1JNLL 4L2YA 3STLB 1F6LL 1Z9PA 2VMDA 4BKLA 2HH0L 3HI5H 5M61A 2JNZA 1QFMA 6PAZA 4J84A 4JX0A 2HAZA 4G43A 4K94H 4LSTL 3BKCL 4MCZB 2DIJA 1N67A 3BP4B 4CY1A 4O9HH 4ZQKA 4FQCL 4XC3H 3OL2A 3CFDB 2DM3A 3MOBL 4JHWL 4ESGA 5E6SA 5C9KA 4PV8A 1BZ7A 3CFBB 4P07A 3GM8A 4H1LB 4Y4KC 2ZOWA 4PU2A 3G9VA 3C2AL 4U0RC 2VDNH 1SN0A 3LEYL 4YHOL 4NUMA 4F3FB 4L9OA 4M5TA 2R23B 3K5RA 1CFQB 3P9LA 4O4YL 4OT1L 4DP1X 5IWLA 1HOCB 1JXDA 4TS6A 4PWFA 1AGCB 2PWEA 3BMWA 5DCCA 2K4AA 5CLWA 3N0DA 1WBXB 3WUWG 1F4XH 1RJLB 5I6MA 1U8NB 1UYWH 5I73C 1GMEA 4MD4A 4Q7DA 2IC2A 1AO7D 3OSKA 3HNSL 4H2AA 4WSKA 1A8JH 1J8HE 3GTTA 3L3HB 2DDQL 1P7BA 2E4FA 5SWZB 3MJ7B 4UZUA 4DFIA 4B7IA 4YAQA 4AMKH 4Y88A 1B4JH 4MAYB 1HYSD 3DTXB 3EJZC 4X6EA 4ZUTA 1J0HA 2OXGA 4ODBD 1I9RH 3E6HB 1AO7A 4KX9A 4TSCH 5D2NA 1EPFA 1OHQA 5J11C 1H2XA 1RUML 3MCG1 3NIDA 3RE0A 3KPLB 4H0GA 2H3NB 4A2DA 4AL8H 4P23B 3ERXA 5F44A 4IA9A 1S7UB 4OJCA 4PJHA 1NANI 2P44B 3SBPA 3S3PA 3G5ZA 4WWKA 2WXRA 2GITA 4NNPH 4XC1L 4YZFF 4EBQH 2HZHA 2VDRA 5EORH 4PJXF 3BLKA 4GAGH 2ICCA 1KIQB 1P6AB 1TZIA 2VN6A 1CE6B 1UOQA 5HYNB 1M2OA 2X2IA 1SYVB 2ZAIA 1FCGA 3H2WA 4YDVB 3O0RL 2XQYG 2B2XL 5C0FA 3FULA 1A4JA 1LDSA 3BWAB 4I0CC 2G4GA 3L2LA 1OAXH 3L9BA 4QHNA 2OKMA 3ALWA 1RUKH 4N90D 2JK5A 5F7NC 4M7JL 1FFOB 5I1KL 3CHSA 3V6ZB 4ZAKD 4L4JA 4OFYD 5SXMA 2PTUA 4CADA 4WW2B 4CRPA 1QFOA 3CX5J 2WOYA 1FVEA 4IRJA 4PLOB 1FORL 2CHWA 2F1EA 4HIIA 3VM5A 4RRPG 3WUWA 1B6UA 1D5MA 3GDBA 4RSYA 1XD0A 2BO0A 4H25B 4M6OL 5ESAB 4RFNB 4ZAKA 4QT5B 4OFYA 3V6OC 1XL6A 5I1AA 1MRCH 1ONQB 2G9HB 4ZMOA 4M1DL 5F7HA 2BHZA 5BO0D 4UUJB 1MCSA 4JDVB 2NY5H 4O2CA 3UBXA 1S9YA 4WWNA 5GS0L 2I0RA 3NSFA 5D1ZC 5JO5B 3HFMH 4GG8B 5FA4B 5GQBA 3MJWA 2JLPA 4X5QA 1TVBB 1CD1A 2LFGA 4GAFB 4Y2OB 2BMKA 1CVRA 1AACA 2NX5E 1BLNA 1NFAA 4MB3A 4KZCA 1GC1C 4XPHL 1IAOB 1XXDC 1QUNB