3SBWC

Crystal structure of the complex between the extracellular domains of mouse pd-1 mutant and human pd-l1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
212
structure length
208
Chain Sequence
MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the complex between the extracellular domains of mouse PD-1 mutant and human PD-L1
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Programmed cell death protein 1
total genus 39
structure length 208
sequence length 212
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sbwC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sbwC02
2X1QA 5DRXA 1KEML 1YN7B 1GPOL 1OGAB 4WU7B 4DVBB 5DJ8B 4G3YH 1LVEA 3ZYZA 2V7HA 1LNUA 5L2KE 4U31A 1IEAB 2C3GA 5F9AC 4JY5L 5DUML 3WHXA 1JZ6A 3ZSSA 3IXAA 1F45A 4PR5B 2YD6A 2YS4A 4NQTA 5EUOA 4ZUWA 3VGAB 3MV11 3PDOB 4MJIE 3VG0L 3HLAA 3IAQA 1ZAGA 4ODWB 3BGFB 4MJIB 1RFDL 2A9ML 1EFXD 4HWBL 1XR8A 5FIEA 4KDTC 3C60C 2HT4C 1JPSH 5I8CA 1JHLH 5GGRA 1XF4B 4WDIA 4OFPA 4K07A 3VGBA 4Y4KD 1CBVL 4F8QA 5HHOA 2AK1L 2Y6SC 4G8GE 4RFOL 5E8DH 3I6KA 3RWFA 1EZVY 4TULH 1OWRM 3VD7A 4DW2L 3O3EA 5BS0E 1JNJA 3QUYC 1YMHA 4YQXL 4RX4D 2FH8A 4Q9RH 5FDWB 3O8XD 3MLUH 5LQBH 2F54D 1U3JA 5LKNA 1PKQB 4KXZI 2FGWH 3UBXG 2DMKA 2OS7A 3WSQH 1QR1A 4XMPL 1JFQL 1ZHNB 3HG1A 2QHLA 5KVFH 4UIKH 4PGEA 1D5IH 1OGTA 2VLRB 1QBMH 3LMJL 2ZSVB 3W0WB 1K5NA 3B9KA 4N5ED 2G75B 3TBTA 4YJZL 3IDIA 1D9KC 2ZNXA 3MODH 4GAGH 1OAUL 4EN3C 5K9OA 4OFIA 2VXVH 4NQEA 3WV0A 1TTUA 1FSKC 4Z7UB 4Z7UA 5K59E 4RGNC 2R1XB 4WW1B 4KRPC 5DHYA 4JLRB 5DVKA 1YPZB 5B4MD 1G0YR 4MNQE 4OD2B 4EVNA 2HT3C 3REWA 4JREB 3QFDA 5ICXB 4TVPH 4GXVL 1P2CB 5DMKB 5GS2D 3QO0B 1QHOA 4JRXA 1T1ZB 5ALCH 2D31A 3L6FB 1HEZA 5J57B 4V1DE 3T09A 1VEPA 4IRSB 4NO5A 4XPBL 4XCCH 3HNSH 4QRSA 2EIBA 5CD3A 1MAML 2XQBL 1KJ2A 4S1SH 3ZTJG 1ZTXH 1NSNL 4S10A 5HHQA 2L7UA 3VA2C 4YDIL 1UACH 2WLYA 4JN2A 4UB0L 5F1SA 1L9MA 3CDFA 2XTJB 5T1MB 1FL5B 1KLUA 2P46B 1XGYH 4PJXB 5FAAA 4APQB 4KVCL 3QEHB 1WITA 1LEIA 4HKXA 4Y4HB 5CILH 2ZUQB 2ZUUA 2OJEB 1QLRB 4K23H 2OK0H 4D9LL 2DI8A 1PGRB 2VLMD 3A6OA 3ULVE 4K7PY 4LLDA 2HKFH 2A9NH 3VW3H 3EJZD 5E99H 1QSZA 4CVXB 2LVCA 2P5WD 5J89A 5D7IB 3T0BA 1JYWA 1YN6A 3C6LC 3NTCH 5GS3A 3QIWD 5E6YA 4BZ1H 1X5LA 2XWTB 4UDTA 1OGAA 4WU7A 4XVTH 2UVFA 1NC2A 4P46C 4DVBA 3QUZC 4P2QE 1WFOA 2EEBA 4NCDA 5KS9B 3IFNL 4J4PC 1DLFH 4OI7A 5MP6L 4TVPE 1HCVA 3BWAB 2DQHL 3SE9H 4NZRH 4JM2B 4DOHE 1R5IB 5D1XD 1T83C 5C2BL 1NAKL 3DX9A 4P2CG 4JZJC 4PJ8D 3WXVH 4NKQB 3S5LA 1SQ2N 2BXYA 4M43L 2WP3T 3GGWB 5ANME 2QJDA 2BRRL 4P57A 1F4WL 3FQWB 1XF3B 4H26B 3UC0L 4K8RC 2XFXA 1RQ5A 2NR6C 3E1F1 2VIRA 4HG4K 1S3KL 5ESQA 1CDUA 2GSIB 3JWOH 2ZPKH 3K74B 1AQKH 5TF0A 5TH2B 3I6GB 2WBJD 4G6JH 2YK1L 3WIHL 4PRHD 3J7HA 3D85B 4HT1L 4PJXE 4AM0B 2IJ0C 5AZEL 2R2HA 3RGVC 1NCBL 1NAML 4AIZA 1SJHB 2HFEA 3MBXL 4LEXL 4UILH 1IT9H 4PJFF 5ID1A 1U8OB 4XC1H 1JZ8A 1MJ8H 3UZVB 4OJFH 4WCYL 1G7MA 4E5XB 1IGIH 4BQ6A 4MJ6A 4LU5H 1N0XH 3FQUB 5HGAB 3B4NA 5KN5B 4NHCH 1FL5A 2V7NA 4ODHL 1GPOH 2DLGA 5JPMB 1DE4A 4G43A 4HGMA 5IR1B 4M6NH 3VXUB 2XRAL 4O2FA 2QSCH 2H32B 2ERJB 1MI5A 4MMXC 4Z0BL 2QQLH 4HUXA 3HMWL 3S6CA 5H35A 3L3GA 4OD3H 4C58B 2AKRB 5ERWB 3D3VB 1WISA 1MHCB 3T08A 3S36L 3MJ9H 3W5NA 1WCQA 2FATH 1JWUB 3GJEA 3D9AL 4LCCA 3GRWH 1C5BL 5GSRA 4XCNB 1P2CA 1CLOH 4OZIE 4QTHA 2W9DH 3FOMA 4FZ8H 1B9ZA 3P0YH 3WXWL 5HVFB 4JFYB 3MV9A 5FA4A 1T83A 3HE6B 1OWWA 1DBMH 3K4AA 2ZUWA 1UZ6E 1ZVHA 4PJEB 4PP1D 3UEZA 3QUMB 3W9EA 1FFPB 1OTTD 3LQZB 2R2CA 4M1CD 4KHTL 2GUOA 1C7SA 5JORA 3NH7H 4S1SL 3OPZH 2C3WA 3U4EB 3RU8H 3MV8D 2J5LC 3O6FD 4PJ9D 2RR3A 4MAYA 1KTLA 3RVVD 1KJMB 3KJ6L 5CEZD 1U8PA 2O5ZH 3GMOA 1QSED 2AJXL 5FYJL 2VLRE 1LGVA 5TJWK 1F4HA 3MRGB 3NCYS 1BM3H 1BFVH 3UTZB 4X83A 5FDWA 2BMKB 2EXYC 2ORBH 1BECA 4YPJA 4MJ5B 2HLAB 1QPXA 2AJUL 3MV7D 1PVHA 3D39D 4W4OA 3MRRB 1D5ZA 1HHKA 2P5EE 1WGOA 5E5MB 1N3NA 3BIAX 3PGFL 4Z7OF 2V5YA 2KH2B 3O6FC 4D8PA 1TZIB 1AHWA 3EBAA 5E94B 1XR8B 2H3NB 3DVIA 1XF1A 2JJWA 3M8OH 4G7VH 5EUOB 4YZFF 3SE9L 1MFCH 1MAMH 3BYYA 1J10A 3BP7A 4U49A 4PJBE 4X5WA 3ZMRA 2JJVA 4GRLD 5IEKA 1A6WH 3OV6A 4QGYA 2M2DA 1JWSA 5C6TL 3CVIL 2VQUA 4LCWE 1EEZA 2FJGB 5DRXB 4IRSC 3WJJA 1S7SA 1AI1L 4MX7A 3MLTB 5HJ3B 2QKIA 3L95A 1IM3A 4IRJB 5IVXF 4BZ1L 2YD4A 4GLRH 4L4TE 1MRDH 2WAHA 3O9WC 4YEEA 1FFRA 3ZDZF 3Q6GL 4GMTH 3HUJE 1DQDH 1N64H 2I5YL 4OLVL 4KI5F 5KS9E 2DBLH 1R3LA 2PTVA 4ZFZA 2O61B 2CQVA 3JVGA 3IS1X 5I71C 3EO9H 1U8LA 3KPOA 1EO7A 4YO0A 1NUGA 1LO4H 4JFEE 4IS6A 4RNRA 3SGDI 4RFNB 1R3LB 4KJYB 4OTXL 4P4RA 4JQXA 2OL3A 2VZOA 3PWJA 4M43H 5EOCJ 3WJJC 4Y4KA 3MRHB 1DEEA 1RZJH 1T2QH 4BH7A 2Z35A 1I7ZA 5IMLB 2IMMA 3R4DA 4M7JL 1IGFH 1UCBL 3RZCB 2EC9T 3AREC 4MSWB 3M45A 4MWFB 2MCG1 4OJFL 3I6GA 4WCYH 4BQ9A 4FXKA 2FLRT 4Z7OE 3OKOB 2NXZC 2YD7A 3JWOL 2D4DA 4HJJL 2WBJC 2CIIB 1UA6L 1NGXB 5FHBL 5DMYA 2AJSL 2BSRB 3VFVA 1AKJD 2ZZUT 4CVZB 5IVXA 3CDCA 4XGZA 1CXLA 2PW1B 5LXGL 4G6JL 3KLAB 3CK0H 2R0WH 4PJIA 2PN5A 4P23B 4ZO9A 3ARDC 4WGVB 2NXZB 4LLVA 5I15H 3O4LA 2Q7NA 2UY7A 4FZEL 2WV3A 4YBLB 2GCYA 4I18A 5I17A 4I18B 3BPNB 2PO6D 3U30B 5F1OB 4ZFOA 3LOWA 5GS0H 1QD0A 2AJYH 3CLFH 3P11H 4EUPA 4IRSD 5BQ7B 1KLFA 1LP9A 5EPMA 4X8XA 1ZHLA 1BFOB 3IFOB 1BEYH 4YXHH 2VSCA 4XHJD 1KPUA 1MJJA 1HE7A 4MJ5A 1NDMB 3VH8G 5TDPB 1NEUA 2EDTA 4JJ5B 5I71B 3MNVB 5BXFA 2XKNA 4APQD 4MWFA 3QJHA 2X4PA 4JQVA 4O2EA 5EU5B 1I7ZB 5IMLA 1EUUA 4RISL 4Z7UF 1OY3B 1DQLL 3PWJB 3GBLA 4JKWA 2R2BA 3QHFH 2XRAH 2HLFD 3L3JB 5CMAA 5HHPA 4OCNC 2B2XL 4QYOB 2R9HC 2E5EA 4K9EL 4ZAKA 3IVKA 5F96H 1H8OA 5M7QA 1A6AB 1OAXL 1EEYB 5E08L 4HZAA 3GSNA 2NY4D 4F7EA 5B8CB 1EHLH 5CINL 1DTUA 4XVSL 3QUKA 4OUUB 2X4UA 3KYMA 2WUCH 4Q9QH 3D3VA 5C2UB 4ODSH 5ERWA 3RVUD 2EKJA 3R1GL 1EFQA 1G7QB 2VLJE 1WFUA 4D2NA 2MQCA 1U2HA 4PGBB 4PJXF 1GOHA 1T21A 4FQXB 1CDHA 1UQSA 3NFSH 3PL6B 5T1KA 3VWKA 1WBYA 4R4BA 1FAKT 2I24N 2DOCA 5DFWH 4NNXA 3ULSA 2NMSA 1XZ0B 2R69L 2HAZA 1ZLUH 1HWGB 1RUAH 4NHUA 5C0BB 3SGKC 3CZJA 5DC0A 4KY1H 3SCMC 3SDCD 1QSFB 3QSKB 3PGDA 2VWEC 2LFGA 5J0BA 3FT3A 3DVNB 1F00I 1T3FB 4YHYC 1Q72L 3MLSL 5CBAA 3QUXC 2WLZA 5FUOL 4XPAL 4JGMA 1RUMH 1NGQL 3U7YH 3KR3H 3V6FA 1EMTL 2GJ6A 2HLAA 4CVUA 4JQVC 4YZFE 5HGBB 4FQHB 4OF5A 3NIDF 5E8NB 4MD0A 5KZCD 5TH2A 1DBKL 5TPWH 2HLFC 2X40A 3QI9C 3QIUC 5E00A 5J4MA 4I2XE 3OGCA 1W72L 1MF2H 12E8H 5KJRH 4KTDL 3F12B 1S9VA 3BW9A 2CIKA 4RBPH 1N8ZB 3ZO0A 5F7FA 5IMOA 3NN8A 3QA3B 2H6PB 3MRQA 1IAKA 3TCLA 4P57B 1KTDA 1DZBA 4QXGL 4OV5A 1BD2A 3DRTB 1AO7E 1C7TA 3TZVC 3QNXA 5ITBL 1OPGH 5D7KE 5FA4B 4MLIA 3P4LA 3CH1A 4OM0H 2D7OA 1X5IA 1D6VL 4X0KB 1RUPL 3MLPA 5DT1L 4ONFH 3DYPA 3GMMB 3LN4A 3E8UL 4U2ZA 1UWGH 2WQ8A 3BP4A 2P24A 1F58L 3BRDA 4Y5VB 3VXUE 2DQEH 3MLVH 2Q1EA 1JNHB 4WEBL 1MHCA 3BVNB 3ILPB 4UT7L 5A43C 3RVVC 1NAMB 5BV7L 3EO9L 1CYGA 3QWRA 3S4SB 2EDQA 1C16B 3CXHK 5C3TA 3CFJB 2APXA 3CDGB 3K1DA 5ITFB 2Q7YA 3QEQE 5C8JB 3DRTA 3BH9B 1Q1JL 5FYLE 1BVZA 5EZIL 2H26A 1JWMA 1G7PA 5H94A 4JHZA 4OT1H 4ZQKA 4IRZH 4KH2A 1P7QA 1SJHA 2HFEB 3TCXA 3DSNA 3U46A 4KHXL 1FLRH 3BXNA 4TUJB 1QBLH 3V5HA 3MV8A 3FQXB 4OCWH 4I0PA 3NOIA 4JZJB 1U8JB 4HCRL 4P9HC 4U1HB 5ISZA 4MD4B 3GIZL 1OSZA 2FECL 5B21A 1T1ZA 1ZVYA 3KPRB 4B5EA 5TGBB 4XNYL 2ZCLH 2Z93B 1OAXH 3OKEA 2VDLH 5I16B 1CIDA 4OD2A 1QNZL 4EVNB 3QUZB 3EYVA 2FZ3A 1I1AC 5D93C 3V4UH 2XACC 2P48B 4GKSA 4LLWA 3V5KB 3VWJC 1KC5H 4CDGC 3CSGA 4A6YH 3PV6B 4DUXA 4M6OL 1XH3B 1MOEA 4NM4H 4HPOL 3HZYA 5HDLA 4MLSA 4DGVH 3T3MF 3F7YA 5FO9A 1AE6H 2NCMA 4P2QA 4WY7L 3S5LB 2J8UE 3HE7D 2OTUB 1L7IL 1N0LA 2RBLA 3B9VA 2XZCH 3KPRE 1RU9H 4O9HH 1CVSC 2WIMA 2Z92B 2KDGA 4N0CD 1WIPA 4PRIA 3KPMB 4HH9A 4YNYB 5DK0A 4HK0A 5TE4H 2I07A 5HGHA 4DWHA 3WDJA 5DVNA 4LNRB 3O3EB 4RMVA 5CEZE 2J3SA 2EE2A 2P7TB 1P4IL 5D7IA 1U36A 2CRMA 1YEGH 1QTYT 2BCKB 4NFBA 4F3FB 5DLML 3RRQA 3GSUB 4QRUB 2VDRL 1N7ML 3MNZA 4PJGF 3M1BB 3NACL 4XWGH 5H2BA 3LSOB 2H2PC 2JCCB 4M48H 2JCCA 4DQOH 5DR5H 1P9MA 4J8RB 4PJCF 2FHCA 5DD1L 3ULUD 1MI5D 1B3JA 1MRDL 2YEZB 5I30H 5HY9A 2AEQL 3DUHA 2X1OA 1QZ1A 3QUYD 5D93B 1SY6L 1UENA 3BKYH 1RD6A 3EDKA 4Z7NF 3SJVE 3U83A 1ZLSH 2V2TA 3ROOB 2ADJA 4XNMB 3WHXB 4A6YB 5I0DA 1FSKB 2X9XA 4ORGB 5EH1A 2YD8A 5E8NA 3QIBC 4NO0D 4N5UA 2DQDL 1RZKC 4PJ7A 3UTPD 5J1AB 1KPUB 3BKCL 4NQED 1E6OL 1BZ9B 1ZEAL 4YHOH 4WUUE 5D72H 2HRPL 4PG9A 1A1NB 3GMNB 4Z7UE 5EPMB 5J11C 3I2CH 5DUMH 5JHDA 4JO2L 2AEPL 3QXDA 4Y19A 3IDXH 3G5YB 4YHKH 5EIIB 4YAQB 3HC3H 4UTAL 5D6CA 4TSBL 4LEOB 3GI8L 1XZ0A 5ADPH 4PJCA 5K9OB 1JHLL 1SJEB 2E7HA 3WUWA 5J6GB 4Y4FD 4B50A 4OFVA 3T0AA 3KLHD 4Y2DB 2EE9A 3V6OC 1OAKH 4L9LC 2OCFD 4L4VA 4XCEA 2YPLA 3GMRB 5BOPA 5LWYH 5ISZB 4FXKB 3DSFL 4MA8L 4GFTB 1K4DA 1XCQB 2C1OB 5I1HL 4KZDH 1IKFH 4OZIA 3FN0H 5JTWA 1HH6B 3TFKC 2V2XA 5CIPA 2XQYK 1T0MB 1FL3B 3MLWH 1H3XA 3P77A 5EB9A 5L88L 2KZ1B 1S7VA 1E6JH 3P4MA 4EOWL 4Y4KB 4I0PC 4GAYA 1TCMA 3TBYA 3WFHB 1R5VB 2ID5A 1MCOL 5EA0H 3BP6B 1MFDH 2M1KA 1FVCA 4L3EE 1NC2D 2CGRH 1NMCB 5HHMD 4LHUB 4NKOB 5ADOL 4GG8A 1HZHL 3QISA 4D3CL 1YEHL 3PIQB 3OR7B 5DEFB 1KBGL 1U3YA 1G9MC 4ELMF 4DKFH 3V95A 4ENED 4PLNC 4JPKH 3RL1A 3QJFA 2R0LL 1U6AL 1UEYA 5J6HB 4S1DD 5KVMC 3F7RA 1JHTB 5FOBA 1U3HC 3HI6L 2J8HA 4EUPG 3LPWA 1F97A 1OP9A 4FFVC 2AAVA 3WSQL 3VXPA 2VLKD 1JV5A 3ILPA 3BVNA 4U0RC 3ELAT 5IBUG 3I84A 1XGRA 4JFQA 1UXWA 5BV7B 3QDGB 3UTTA 5D1XC 1I7UA 4ISVB 3FB6A 3JWDH 4LIQE 4HHAA 4EI5C 3UX9B 1S7TB 5KSUA 2KQNA 4GH7B 5ENWB 2XZCL 1XF5B 2CDFA 4LARL 2DWEA 2WMPA 3P73B 5D71L 2FX8H 1NUNB 3S36X 4WHYH 3LV3A 3CXHJ 4XVJH 4IMKC 5JIHA 3JXAA 2ZUTA 3O4LB 1MJ7H 2ZSWB 2BJMH 4DFHA 3W9DB 1EEUA 2X41A 1CGXA 4HMEA 1P4BH 5ALCL 2Z91B 5DD0H 2LV4A 3QAZB 1JN6B 5ANMA 3FAXA 1NGQH 3VE0A 4N0FB 4RGOL 3BQUA 2VZVA 3S3JA 3IRZA 3EFDL 2NY5C 2A9NL 3EZ8A 2R2EB 4KKAC 3QQ3A 3TIDB 2HVKB 3IU4L 1I8MB 3MRKB 5HGBA 3NIDE 1U8IB 4K7PX 4YDIH 2XZQL 1I3GL 3PNWB 3MA9L 1A3QA 4HXBL 2XN9B 4P4KD 5B8CC 2Q8BH 5LGJA 4OZGB 3MYJB 4XPAH 1ZK9A 4WFFE 1H3PL 1AGDA 3QP3A 3WLWC 2XTJC 2DS4A 3P9LA 5MI0B 2NY0C 4KJQC 4XPHH 4MQ7B 3L3DB 1QFWI 5GIRA 3OG4B 4Z76A 5EIVA 3UTTD 3HE6A 4PJEA 1PY9A 3AU1A 4N1CA 2BVOA 2BNQB 5E4EC 1LEKA 3TYFB 4NOBA 1HHJA 1T5XB 4FQQB 4XBGB 2VTFA 3NMEA 3UAJC 1CCZA 3OR6B 3IAPA 1AFVH 4X9BA 3MR9B 3OF6A 3QFJD 1T22B 4EBQH 3WBDA 3HFML 5F93C 43C9A 2WBKA 3OKLA 5C0IB 1FRGL 4OCXL 4EN3A 3VDBA 4TUOA 4OUUA 3L1OH 4LSVL 3O3UN 2Y9RT 2NQCA 1T22A 4NZJA 1NGWA 5I8OH 1IEHA 1ZLVK 3D87B 1A7NL 4L4TB 2X4OB 2EECA 2CDGB 5FV2A 5BJTA 3BH8B 3CNKA 3FQTA 4HIHB 5BS0B 5KN5A 4U6YA 1J05B 2IAMB 3ARXA 5H37H 2QV2A 4ZYKB 1JUFA 3ZE1F 3RBSA 1G9NH 2AI0L 5IB5B 3GSXB 3BGMB 1HKLL 3WFEL 3IFNH 4NKIL 3H6JA 5H2BB 1U42A 3M1BA 4K55A 4ZTPL 4IRJD 5TF1H 1F3RB 4PRPB 2MCPH 3FRPG 3FO1A 1GC1H 3O4OB 3SDXB 1YEKL 4PJGE 4ZUUB 5CWSA 2AJ3B 4I4WB 1CD1B 5KVDL 1CGYA 2F74B 4YC2C 4JFDE 4AL8L 2EEDA 4R3SB 4XPGL 5GJTL 5GRXG 2XN9E 1MFDL 3NZHH 3MX0A 3MV7E 5DEZA 3UTOA 1WEJL 2NR6D 2A0LC 3LN5A 5C7XL 4Z0BH 4FMFA 3SKJH 3RTQA 4ELKB 1SMAA 5HPOA 3NA9H 2OXGA 1FN4A 4N0FA 4HH9B 3TNMA 5DRWA 4F80A 2DQIL 3T0EA 4OLEA 5AWNL 4ZFOL 2X09A 3HNVL 4NN5C 3V5DA 1O5DT 2Z31B 1LP9B 3VXUD 3BGFC 3F7YB 5FO9B 2PYEE 1GHFH 2H32H 5T33H 3ULUE 4LLQB 5IVNA 1ZHKB 5HI3C 1RI8A 2AV7B 4QHLA 1T5WA 3QHZL 3MBXH 5ISZE 2MQ3A 4TOYH 5D1QD 2IBZY 5EFIB 3VGGA 3KLAA 1C12B 2UZIH 4WUKL 1FORH 4EIGB 1S5HB 3S37H 4OCSH 3Q5TA 5DUBB 1B2WH 1A6ZA 4OCYH 4EDWL 5EA0L 5BRZE 3O6LH 3PG2A 5MEQA 2PXYC 3BZFB 3L3GB 5D5MF 1JZ4A 5E4EB 2PYFA 1JL8A 2WWKO 1DDHA 1N59B 1VPOH 3TA3D 5HDQH 3LQMA 5L2KA 4WV1A 1MRFL 4I3RH 1ZVSB 4WU5B 5CP3A 2V9RA 3WFCH 3SOBH 1RIUL 4LCWB 3JZ7A 1KULA 1S7UA 1H15B 4DKEH 2VZUA 2NY4C 1NCTA 3MBEC 4NQCB 2NY1D 4X4XB 2HFGL 4LHUA 4XMPH 3RP1A 2YD9A 5DS8B 2DLFH 2LVEA 1CL7H 1S7UB 4PJ9A 1I3GH 1I1YA 4PJFE 3DURB 3CDGA 1R5VA 5JO5B 5GGQL 2CLRB 1BBJA 3AMLA 3O8XC 3MO1B 1KIQA 2CKBB 2YA2A 4WW2F 3CX5J 2PKDA 2EZ0C 1MCEA 3QBTB 5DC9B 4JZNB 1A6ZB 3MLTA 3Q2CA 5L8KB 5JIKA 1QLEL 4NC1C 1JNHA 1D5BB 1AXIB 3OX8B 2CD0A 5EBWB 1B0RB 1WIUA 2X89D 1F4WH 1G6RB 2P24B 3BP4B 2AV1B 3T2OA 3SDCC 5ESQB 1YDPA 2AEPH 3HHRB 3QZWG 1JNLL 4UAOC 3VXSE 1BD2E 3I3EA 3MGTA 4JRYA 4CNIA 1ZMYA 2FIKB 2JCCF 3KS0J 1MREL 5AYQA 5EBMA 4DUWA 4PJCB 1P5VA 4Y4FB 1A2YB 3VJ6B 3IF1A 4PJ5B 5KANI 1OB1B 5BO1H 4HIXL 5KSVA 1JI2A 3GGWA 5I75B 4ZFGH 2E6PA 2EZ0D 3EYUH 3QXWA 1IM9D 4NBZB 2CSPA 3SO5A 1MIEH 1YEDA 3BW9B 4NNPL 3BUYA 4X6DA 3EYOA 4ACPA 1G1YA 3DMMC 5C6PB 1S9WA 4TRPL 2Z4QB 3KPSD 5CSZA 1B4RA 5FCUH 3RX7A 4XNUL 2OYPA 3W11D 4MA7H 3NFNB 4LHJB 4LASL 3IYLW 5KSAA 4NC0B 5INCA 2IANB 4QY8B 1ROWA 3MRMB 3UTZA 1A7PL 4RCAA 2P44B 3P9MB 2VLLB 3FFCD 3TH3T 3EAKA 2IBGA 3ARSA 2C1PA 3CFKB 3X12A 1IL1B 2EDBA 2NLJB 2ICWB 3ESVF 3SDXA 4TNVK 1SEBA 4OIBA 3D39E 4PRDA 2Y25A 1M7DB 2E8YA 5DJYA 4GW4B 4OGXL 3QB7C 4KAQL 4L4VD 2VUYA 5GGRB 5D7SL 3RX5A 3ARFD 1JZ3A 4Y4HA 5LGHL 3BP5A 3RZCD 3GZKA 3ZKSD 1OSPH 4H1LB 5HXMA 4XHQA 5CZVL 5BZWA 1J8HE 1ED3A 1IAIL 1WBYB 1Q0YH 4HWEH 3G9AB 5IEHA 1WVZA 4M61A 4IOIA 4EXKA 2VXUH 2PCPA 1T1YB 2PNDA 1AHWC 2DQTH 2XKUA 4JFXA 5BVJB 4D3CH 4X99B 1G9NC 4D9RE 5FHBH 3LD8C 2UZXB 1RAMA 4JDVB 2HRLA 3OKLB 5E2VH 43C9B 3KYKH 3V0VA 2BX5A 1XIWC 2I9LB 3AAZB 1F90H 4QRTA 2F15A 4HUXB 2B1AL 4OCLC 5FA3A 1H5BA 2A6KB 3DX6B 5JXAL 5FO7A 5C0JA 4B53A 4R0LC 5CCKL 3IDJA 4OBRA 3KNBB 1FORL 2R8SL 5C0RL 4U1MA 3FFCA 4WTZA 4YXKL 4X7CC 1VCAA 3U1SH 3KWWB 3KG5A 5HYEA 1RY7B 1J0KA 3KPSE 3HPLA 4KKBD 1EJ6A 15C8L 4RMQA 1VPOL 3MUJA 3QT2A 1TETH 4PRDB 5LGJB 3LRSA 1LO0L 4XNQB 3K80A 4BM7A 1K8DA 3FTGB 5C09E 4P4KB 1L0XA 1RSFA 4E0RB 3G6JF 1PJ9A 1JMXA 2R2HB 2ICES 2UZYB 3MCKA 5DMIH 5HGDB 3L5XH 4JQXC 3RWGA 1R5WA 4L29A 1OAYH 2R2EA 4ONOA 4YFEA 4GBXB 4PPTA 1N4XH 1NDMA 2ADFL 5F89B 2IADB 5KSAB 5J56B 4HWBA 1W2KT 3N1GC 1X4YA 2BNQD 4M5YH 2JLLA 3RI5F 1KN4L 4MZ2A 4DOHB 1FLRL 4XAKE 3E6HB 1T5WB 4W6XB 4F33B 2ESVE 3PXHA 3GO1H 4QRRD 4IHOB 1C8PA 2H26B 2JJSA 2F9BT 3LV3B 2NW3B 2V5TA 4X7TB 1M7IB 4DTGL 4NKDB 5BMFH 1P7QD 2J6EH 1S7TA 2FIKA 6FABL 1T0NB 5IFAH 1MIMH 6CGTA 3QDGA 2DBLL 2VDPL 3ARZA 3BZEB 3KPNB 3E3QE 4QHKJ 5T1LB 3O3DA 3SE4A 1BVKA 3FT2A 4MSWA 1QRNE 4U1JB 4EXPX 4NQVA 4P5TB 4KROC 5KG9A 2CMRH 3CU1A 4JM4L 4OZFH 5J12C 5TQ0L 4X98A 4XVSH 3RL1B 3KXFA 4LCCC 5FM4A 3F7VA 3D3VD 1ERNA 4BSWA 1D9KA 5MEOA 4KTEL 5F9OH 4KRPB 2YXMA 1E4WH 1J1XL 3BKMH 2FX9L 3TCLB 4MB4A 5DJXA 2JTDA 1ZWIA 3GSXA 4KRMB 1OLZA 1A7NH 4NQCA 4X4XA 5HHXH 2W65B 5CILL 4DGYH 2CIKB 3OKYA 4IM8A 1TIUA 4GAYB 1H15A 3DUSA 4KJWC 2NW2B 4UT9L 2R4RH 1NCCL 5DA0B 4PRPE 4ZPTB 5HHQB 3V6OE 4PJBA 5JNYB 3UYOD 1FVEA 2EE6A 4ODTL 2Z31D 3BE1H 3B3IB 1D5XB 2CUMA 4KQ4L 5CFHA 2QQKH 2ZOKB 4HS3A 2EC8A 3QUYB 3PWPB 4WEBH 1X5JA 1RUML 3I3DA 4G7VL 3I6LD 1KCUL 1RJLB 4I8DA 5E2WL 5KVGH 1IJ9A 5CGYD 3PF2A 1EHXA 1F11A 4F57H 4JGJA 5MERB 3HE7C 3MSPA 4NO0B 3W81A 3ZKND 4N9GA 1D6VH 3B5GA 3VG0H 3MLUL 2HJLB 1SM3H 4OGYH 5CHNB 2O26U 1SYVA 3LH2L 1N64L 2O5XL 4ZFFA 4IRZL 2ILLA 4G5ZH 4R2GC 3WYRA 3JV4A 4UT6H 3T0EB 2VLRA 2A6JA 1D5IL 1ONQB 3MRKA 1QR1B 3LEYL 4NRZB 3I50H 1IGCL 1UFUA 5F9JB 2IBZX 1LP9F 5F71A 3WFZA 4NN7B 3VXME 4AT6A 4V2CB 5LJYH 2ENSA 5FYKD 1WZMA 1GGUA 3LB6C 3I6KB 3HN3A 4Y16B 2DQEL 4WHCA 3HB3D 3TH2T 4ZAKC 4MNGA 3MXVH 2VN4A 4QRRE 2HFGH 2HN7A 3DUUA 1S9YB 4QWWC 3ARPA 1LO3H 3DV4B 1RZGA 3B43A 3GKWH 1CGVA 4JZOA 3VH8B 5CCKH 4P48A 1N0XL 4NJ9L 2AJZB 1RIUH 1NLDH 4RZCA 4NWUL 1FYTA 4KKBC 5E2TL 4AT6B 5FM5M 3T77B 3C9NA 4BUHA 5AYUL 1BQHA 1F90L 3FT2B 1BQUA 3CSYA 4HFUL 5FCSH 1MI5E 3IKCA 1KTRL 4JFQB 4OZHF 1B4JL 3QYCA 2G5BB 4M7LT 4N90E 4MHHI 1MSPA 3ALPA 1UB6A 4JFEB 2HMIC 3RY6C 3LS5L 2YKLL 4ZNCD 2YUWA 5CSGA 3Q1SH 1UKSA 1NFIB 5EIQA 5C07A 4KQ3H 2G2RB 2D3VA 3T8XA 1WBZB 4TNWK 5T3ZE 3O3BB 3BPLC 5DQDH 3NCMA 3QXAA 2VABA 1IC7L 3KYOA 1CLZH 4HIXH 4MQTB 3PL6C 1TETL 1CTOA 2RCSH 2W9EH 1FG2A 3ZL4H 2XG5A 5BRZD 4FQXC 4KMQA 3VI4E 4ZOAA 4GG8B 2CRIA 5DK3A 3QDGD 1S8DA 3DTXA 5F1IB 3KLHC 1VEOA 2IAND 4JPVH 4PJIB 2E7MA 3VDAA 5LAXB 3MOBH 3P9LB 1QVOA 1MCHA 4M1CC 1JFQH 4M7ZC 3AROA 4ZUVA 4TTGA 2YWYA 4GBXA 3TFKD 2ZOKA 1KPRA 5JQ6L 1XAUA 3VXMB 2J8OA 3OMZA 3O4LD 2JJTC 1U95A 1LO2H 2ENYA 4LLMA 5ESVB 2VN7A 4IJ3C 1N7MH 4U6XA 5CGYC 1AKJA 4MJ2A 1NCCH 5IHZA 3WD5L 1J5OL 1RURL 1U8LB 3KPOB 3HPJB 3Q6FA 1W0VB 4L8CA 5FYJU 1FG2B 4HXBH 1IC5L 1QSEA 2VDPH 4YHIA 5DZOA 4C4KT 1CF8H 1N6QL 4YHZH 4H8WL 2YD5A 1JGVL 1MWAA 5C08B 1I7TA 4OF3A 4ZS7H 5L9DL 2FX9H 5KG9B 1TQBB 2BNUB 4PLOB 5HD8D 1K3ZA 3EYFB 4KAQH 5JOFB 3FZUC 2HG5B 1FC1A 4MS8D 3HZVA 3PQYB 4M62H 3V79C 2EKSB 2IMNA 4F57L 3EGSA 3K4ZA 2DQJH 4YX2H 4GAFB 2X9YA 4K3EH 5C9KA 3BZEA 5BZDA 2HT3D 4GRLC 1JV5B 1HNGA 4PJEF 5HI5D 5L6YH 4YHKL 4YBLC 2APWA 3HC3L 3WEXB 3A6BL 3UYRL 1DQML 1KFAL 2A6IB 2ADGB 3V8CA 7CGTA 1I9IL 4HIIA 1ZV5A 2HT2C 2DIJA 1J8HB 5KOVC 5IKCB 3EDJA 4KK9D 4UMGA 3QCUL 4LBEA 4J3XA 4GO6B 9CGTA 2DKMA 1ZGLA 4GW4A 3N0PB 3TF7C 1R3KA 3MOAH 1E4XH 3E6HA 5CGMA 5EC2A 3J8F7 4MHHG 3SGKA 1U3ZA 4K2UL 5DXWA 4MNQA 3EYQD 2XQYG 2IAMD 4OB5H 3P4NA 1MJ8L 1CR9H 2ZCHH 5F89A 5K9QI 1Z5LA 1JE6A 2G60H 2GAZA 3S35L 3HI6H 2BC4A 4JKKA 3HAEB 3MLWL 4LPTA 3RWGB 5EORH 4HK0B 5EZJA 1MCBA 3D18A 3ZSTA 4P9ML 2AXFB 2AABL 4JRXB 1K8DB 3FTGA 2AJSH 1J7VR 1BIIA 3UTPE 3QI9A 4TVPD 2VMFA 4LNVA 4OSUL 2CR6A 1YEHH 4NN6C 1NPUA 2NY5H 3X13B 4D0CB 1T7YA 4KI1A 2C7UB 3ORJA 3TO4C 1T89A 2R1XA 3LQZA 3ZKXB 3MRPA 2Q6WB 1LQSR 5TQ2H 3FFCE 1VADA 2OSLA 4XWOC 2EIEA 5IK3B 2GTZA 1JTOA 3G6JB 4DUVA 1D5MA 2P5WA 4WGWB 2X5PA 4JFPA 1UM6L 4JN1L 4K7PL 4MQXC 4M93B 1OM3H 4ENEC 4BFGA 1J86A 3QRGL 5I1JL 4JG0H 1T04A 5F7MC 2WQRA 2VZ3A 4XCYA 3V5HB 1DANT 1Z5LB 4G8GA 5BMFL 1AH1A 3GNMH 4ORGA 5HHOE 2WM0A 1KIQB 1A3RH 2CKBA 2XZZA 4PJBB 4UZGA 4O02H 2FL5B 2ED8A 1VFOA 2CK0L 1ZANL 2I60H 3GHBH 3UDWA 4AYFA 4CUCA 1MCPH 1JGLL 2AXGA 4QEGA 3T04D 1H3TA 4WUKH 3LEVL 2YEZA 3BEWB 3STLB 4WDIB 2NY3C 4PY7B 1W0WB 3STZA 1FIGH 2D7MA 3N9GH 2K3TA 4K9EC 5GQBA 1S7WA 4LMQI 5KAQG 3ULUF 4Z18A 1LO2L 5ITFA 3TA3B 3RPIA 1S78D 3S4SA 5K9JH 2HTKD 1PG7X 1FVDB 2Y5EA 3O6KH 4XH2A 4HW6A 3BZFA 2HH0H 4L8DB 4UTAH 4ZODA 1NBVL 4ONHB 4AIXA 4GRMA 5EO0A 2W9DL 1EIBA 4MA3A 4HPOH 1BIHA 3QH3A 4X5XA 4IMLA 1BAFH 2WSKA 4UI2A 4UNVA 3F65A 3OB8A 4WY7H 1FPTH 4ODSL 4QHKI 4ZO6A 1N6QH 3MQIA 2L4OA 2NY3D 4IDLA 2DQFA 2WW8A 1GC1C 2GT9B 1ZTXL 3QUMH 2DMCA 3NZ8B 1YEDB 4EEEA 4MCYA 4OD3L 4PGZA 1N6UA 5LBSL 3SKNB 5L7XH 4ZFOB 3BE1L 4PRHA 1FDLH 4X7TA 3G5ZB 4OV5B 2XY1A 4IHOA 3UTSB 1HIML 5EUKA 1JBJA 1BQHG 1ZSDB 3LH2H 1I9RL 3QUZD 4LVEA 1S7RB 3NCJL 3HRPA 2DM2A 3FO0L 2BNRD 3VWJA 1CF8L 5D2LF 1CGTA 1FO0H 4C56D 4BFBD 1ZE3C 3KPPB 5A16A 5JPNA 2EDYA 2FBOJ 3O9WA 1D5BA 3EOTL 5ID0A 2GJ6E 1AGFB 5D7KD 4XBPB 4F58H 3LAFA 2DL2A 1NCUA 1PBYA 4JKLA 5FK9B 4WI2A 1QLFA 4XVTL 3TT3H 4XNXH 4ZUVB 5EU6B 4LCYA 4Q74A 3DXAD 1GH7A 1TTGA 1GGBL 4OB5L 4NKIH 1A6VL 4PJFA 5IBUB 3VMPA 4MXWL 1YYLL 1T1XA 1DBBL 1WTLA 4JCLA 4UBDC 5LGKA 3RGVB 3S88L 1WT5C 1OTUD 3L7FB 2VLKE 3FFCB 1DBAH 5INDB 1WZLA 3OL2A 1YEKH 1YJDH 3BH9A 1SMOA 3BT2H 5C8JA 3AM8C 4RQQA 3PJSA 2Q76B 3LRGA 2D03L 3MA7B 1HQ4A 3JV0A 1FYTD 5FA3B 4Q2ZA 3EYQC 4G8GB 1R6VA 2C5DC 4LVHB 4S2SA 3WO4B 1LK3L 1I1AA 3PWLB 1KIUA 3H42H 2A9MH 4RISH 3IKCB 1KACB 4JRYD 3C8KA 1B2WL 4F2MA 3ARDA 1FNSL 3B8YA 1FAIL 4OCYL 1RZ8B 3GMQB 3HNTL 3LN4B 4X7SL 2C4XA 2YUXA 2GTZB 1CBVH 5T5FH 4OLWH 5E03A 1N5YH 2YN3A 1MRFH 4I3RL 5I1LA 4QHUB 5CZKA 2A83B 1EHAA 3BP5B 3TJHD 4U6HA 5FUZL 2WIIB 4NRYB 1IEBB 2FO4A 5DJYB 2GI7A 3V6ZB 5GRUH 2DLFL 3TBWA 4RMSA 4OZHB 3QDJA 2VWEE 1I7RB 5CS7A 2DLTA 3C6LB 3T0EE 3RNKB 4OCRL 2A73A 1OCWL 2GY5A 1KN2L 2A77L 3ILQD 4FTVA 4LCWD 1CXHA 2VLLA 3P9MA 4I3GA 3LN5B 1ETZA 1JRHH 5J12B 1EGJA 1Q9OB 4NQCD 5F1NB 4JPKL 3ARUA 1FGVH 3BUTA 1UC6A 3FMGH 1OTTC 4JFDA 2ED7A 3PHOB 4JAMB 2XWBB 5GS0L 5IJVA 3P0VH 5IGXH 4JO1H 1RURH 4Z5RB 3AY4A 3MACH 5F6IB 4PJIF 1IKNA 3OXSB 4E42A 4GXVH 2GCYB 1FQ9C 2XY2A 5HI5C 4BUGA 4H8WC 1TMCB 4GBXD 5F7NC 5KSVB 3PQYD 5IB5A 4P99A 4HIIB 1F11B 2BNQE 1M6OA 1A64A 4L3AA 4QLRA 3ZE2F 5CJOH 5JHLL 3JV6B 4HGWB 3WEXA 4I5BA 5IQ7L 3RFZC 4RDQF 1FJ1A 4XCNA 1NDGA 1EXUA 1KXVC 4K71B 3MJ8B 4WJ5B 2A6DB 1XGPA 4XVJL 1G7QA 3K1KC 1YYMH 4P3DB 4QRRB 3FRPA 4XC3H 4DVRL 3GIVB 2Y06H 3VG9B 5H35B 1KENH 4Z78A 3BN9C 5CJXA 4X6DF 3EOAB 1JGDB 1NBVH 3L7EA 2BNUA 2GHWB 1BEYL 4HUVA 5I8EA 1DBJH 3PJSB 3SE3C 4BFIB 1TCRB 1T4KB 3FO0H 3IDMA 3KPSB 5INDA 1OPGL 2B0SH 5DEFA 4Q6IC 1K6QL 3RL2B 3IDGA 3TBSA 5GGTH 1OW0A 4LPUA 3QEUA 1KYOK 3RVWC 1FBIL 4JJHA 4MQ7A 4YDJA 5T1DL 1RZKH 4OAWB 5D7SH 5IW6A 1Q9LA 2AGJL 4X7FC 1FNEB 2NY1C 2R29L 4WIQA 4P2RE 4WI3A 5T3ZD 3IU3B 1KB9K 12E8L 3HS0B 1UT9A 1QHPA 4FTVD 1DQLH 1CQKA 1TJGH 4MAYC 3KAAA 4FXLA 5I18H 4PRBB 4ZTOL 1JPSL 4MX7B 1A14H 2V2WA 1A6PA 1GZQA 4KRPD 1XCQA 1YYLH 2XI9A 4WTZG 5T1LA 4HZLA 1JWSB 2PYED 1QBBA 2N1KA 5LG1A 3MUHL 3W11C 5IHUL 4HF5L 3P40A 5EZOL 5D1ZC 2DJSA 4Y88A 1NDGB 2BOCA 1KJ2L 1FZMA 4E41B 5GZND 5J1TC 4HLZG 4K7FA 4D94A 2W0KA 4H5SB 3N1QC 1AHWB 1Y6MR 1UJ3B 2Y72A 1KB5A 1I3RB 4DN3H 4J4PD 2XN9D 4RWYH 3ZKMC 2Y5TA 3ARED 2K1MA 4V1DD 4XI5D 1HHGB 5IROA 5JHDB 5DHVA 1QEWB 1C1EH 2R56H 3NFSL 4NO2B 1WBZA 4U6VL 5E5MA 5J9PB 1FNGA 3IFPB 3F6IA 2F8VA 4X8JA 4XP4L 4OZHE 2P8PB 3OJDA 3HMXH 2IADA 3P30L 1NMAL 4ISVA 3OTTA 1KELH 4OLXH 4XNXL 1W72H 5DZLA 1EBPA 4Q9BA 3MRFA 5GZNC 4GKOA 4ZMAT 1BOGA 3GJFK 4PJHB 3QXUA 2CLVA 4OIIH 1MCFA 3PP3H 5I1HH 4KZDL 3ROOA 4TTDD 3RVXC 2AK4A 4E0RA 1J0YA 1RUKL 3R0MA 5JW5B 3QDJB 3DHJA 3O6ML 3BESR 2VXQL 1E6JL 4GRWH 4PRAA 1IEBA 2FO4B 4YHNA 5C07E 3GJFH 2C9AA 3C8DA 1F6FB 3GBNH 2J8UF 2GUOB 1P7HL 3TT1H 3DRQA 4OKDA 4IS6B 2X9WA 1IQDB 3OKNB 1BLNB 3O11A 4PS4L 3MV9B 4PLKD 4LLYB 2FO1A 1MF2L 4HWZB 4U1NA 4XBEH 3GHBL 4GW5B 1I1FA 3JWDC 3BZ4A 5F9DC 2OBGA 3CVHH 1H5BB 4JO4H 2FRGP 2A2QT 1CFNB 1ZA6A 4LNRA 2GSGA 1E28A 4AH2B 3B8SA 4XAWL 3AAZA 4QRSB 5JDSA 1EFXB 1WAAE 2CPCA 1JRHI 2LU4A 1KEMH 3JTSA 3BSZH 2VDNH 1JHKL 1FV1A 3SDAA 4JG1L 1J0ZA 4ZDHA 5B39B 4ZSOE 4KTYA 5ICXA 4XI5C 1IZKA 5FFLA 5F7EH 4EZMA 1DVFD 2IFFL 5HI3D 4N90D 2NX5E 4ZUSB 5E7BA 4PV9A 5I30L 4H1LA 1GGTA 1ITBB 3ZE1E 5CEZL 1YUHB 4FP8H 3O8XB 4X7EC 4X9GA 2HVJA 5E9DB 1NJ9A 4WNQB 1ACYL 3U4AA 3SDDC 1DQQA 5TDNB 3U9UB 4WFHE 3EKCA 3N1MC 3BDBA 4LGSB 3UTSE 1CQYA 4TPRH 2QSQA 5DLMH 1JZ5A 3O6FA 3B2UD 5EU6D 3VXSD 4H1LG 4ALAH 3O3AB 4JFOA 4NCC1 5KAQF 3L3HB 2P5EB 4M48L 1E27A 1PW3A 4KFZC 4S0TD 3FQNA 3ES6A 2X4QA 2X42A 5F7HA 3A6CH 2A73B 5KVEL 4CMMA 3BWUC 4I77L 1MCQA 1R3KB 2FECI 4WWID 3IGAA 1XGQB 3HC4H 1ZLWK 2QADD 5E2WH 5KVGL 4XRCB 1CE6A 5I8CB 3ZLQC 5LCVH 2JK5A 4UU9A 4R97C 4UINL 3DIFB 1MHHB 3S36H 5C92A 5I1LB 5D96B 2AXHA 1KB5L 1A6VH 1INQB 3RIAF 5DD5H 2CDFB 5DJ2B 3MZTA 3IDYB 1PX3A 4F2MB 1I7UB 2VDKH 1PLGL 3GSNH 4HFWA 2D2OA 5E2UL 4WRLA 1F8TH 3JV5A 1CGSH 3ZE2E 2OR7A 4HMDA 1S5IL 1Q9WA 5E99L 3MRBB 2NY7H 4U6TA 4GXUN 3ZYOA 4F7PB 4F37F 4JKPL 1KCRH 1KNOB 1P5UA 3O2WH 4HWNA 4CW1A 4HX1A 2CLZA 3EW3B 1BBJB 2AVGA 4FOMA 3TA3A 2J8UA 3ARRA 4BZ2L 5DS8A 2E27H 2ZOLA 4YC2B 4AJ0A 3NN8B 2VE6B 4DGIH 4TNVF 1XGQA 3TM6A 4FABL 1XIWD 3MXVL 2OI9B 1CLOL 3WDIA 5GS1A 4NO3B 3CPLB 1F13A 4J1UA 5TE7H 4CMMB 5SWZB 3L3OA 2WWKT 3EO0A 4ZO7A 4RX4A 3S34L 3O2DH 5C0CD 3MRLB 2ATKA 4G6KL 5IW1A 1FG9C 3X14A 1AR1D 4Z7NE 1HDMA 4FQ1L 3LIZL 1KGCE 4OZGF 4AEFA 4FQHA 4J4PA 3PABA 1R5WB 4P2OA 5AG8A 1J0IA 3GB7A 2AEQH 1YQVL 5CBEA 5MEPB 1HDMB 4GMSL 4JRXE 4WEUD 4PJDA 1U8KB 2FD6H 1J0HA 5FUCE 4OFDA 3P0VL 5IGXL 4WUUD 3Q3GA 1DUYA 1AC6A 5D7JD 4J3OC 1A6TA 3D6GA 4P3CL 2E7BA 1PQZA 4RMRA 2WINA 3AXLA 3LQAL 1SYSA 4O51B 1G9ML 4PV9B 1AR1C 5HYSB 1NLDL 4RGMC 1HXMA 1KELL 4OLXL 3QNYA 3TZVA 3CAFA 1IAIM 5T1KB 3LY6A 2Y07L 4M3KB 3SJVD 3ZHDA 3QG7H 4P2QD 1CL7I 3NZ8A 4LFHD 3OF6D 4QRTB 5GRWA 1BZ9A 3RTQB 2C3XA 4OF0A 4PTTA 5CP7B 3FN9A 2BJML 5HYJA 4KQ3L 5HYSG 3ZKQD 1Y6KR 5EWIL 3TC9A 5HI4D 5F1KC 4OZIF 2EEAA 1AD0A 4MDIA 5F9WB 3T4YA 3GIZH 1E0OB 1HINH 4XX1E 4NZTL 5E7FA 4P59L 4UT9H 3ZDZE 1L7TH 3RPIB 2X1WL 3FB8A 4XC3L 3O11B 4AG4L 1BLNA 1Q38A 1MPAL 1D3CA 2CKBL 2Y06L 4TSAH 1ZGLB 4L3ED 3U0TA 1IC1A 5EOCH 1KG0B 2XTLA 4POUB 5IVZB 2IFFH 3LKPA 2B8OT 1J8HA 1QFHA 4MDJA 2QQKL 1DBJL 4PJ5E 1G7LB 1WIOA 3Q6GH 1TJGL 5T3ZH 4MJIA 1CLZL 4KJPC 3KYNB 1MCOH 5I18L 1A7QL 1CG9A 2CRYA 3L1OL 2BVYA 1A02N 5I1DA 5DD3L 2PO6C 1I9EA 3CK0L 1KBGH 4QY8A 1RZKL 1SY6A 1UJTA 1B88A 1NGPL 3HE6D 1T04B 5GZOD 3S96B 3GHEL 4FQLL 4MD5B 2DM4A 3HMXA 5L2JB 2HG5A 3OB0K 5J06A 2F53D 3L5IA 1T3FA 4QKXB 1S9WB 4RDQG 4DFIA 1IGFL 1UCBH 4K23L 5DHVH 1A6UL 4KDTA 4JDTL 1VB9A 2P8LB 1LEKB 5DHYB 3GMPA 2IG2L 1J88A 5E2UH 3GSWB 4LSVH 1K2DA 3RGHA 1A0QH 2XKSA 3ISWA 3U6RA 5I1CH 4R4BB 4L4JA 2IPKB 3PGFH 4P0DA 4S1QL 3DGGA 3LKSA 4NN7C 3MV7B 3RNQB 3PDGA 1NUFA 4CVZA 5I16A 2APBA 1DQJB 2F54E 4LLMB 5CLTA 1G7IB 2V5RA 4FZEH 3D48R 1YZZA 3B3IA 5MEPA 4JRYE 3GK8L 3OX8A 3UDWC 1I8MA 4HIEA 1T6WA 3LKQB 2DQUL 3U36A 1P4BL 5D2NB 4NJAH 5I1AA 3RY4A 3RI5K 1JN6A 1AC0A 3PGCB 3ECBB 5T5NF 5SWZA 3DETD 1ZS8B 1HHHA 2F54B 4C56B 1AXTL 5HYQA 1I1AD 1H8NA 1NC4B 4XPTL 3VFOA 4GS7B 3KXFB 1YQVH 1V7ML 4ELMA 1T7ZA 4YDVA 1FRGH 2MJWA 1XF2A 1H3PH 1KCUH 3DXAB 1MY5A 3WIHH 1QSVA 3ALXA 4HHAB 1BVKB 4ZNEA 3O3DB 5EORL 1KCRL 3O2WL 3SO3C 1QKZH 4ZS6D 2IALA 3BYTA 5B22A 3ZE0E 4K9EH 4NGHL 4X9FA 1FH5L 4KKLD 4HFWB 3SQOL 2F53E 3M17B 3QRGH 4LGPB 1ZLVH 1GXEA 3LKOB 2ICEB 4JKMA 1HSBB 4JANB 1BFOA 1MCJA 5I66B 3DXAA 1FYTB 2GFBB 2VXSL 4YHPA 2B7DT 1A7RL 3PUCA 1PG7W 1BVLB 2Y5TB 2JIXD 5CD5C 3QRFM 1D6EB 1DFBL 3H9ZA 2HMID 1QFOA 4HKZA 1KCVL 4C56A 2H6PA 3MRQB 5I9QB 3VFUA 1MFBL 1JZ2A 1NCWH 2Z31A 5H8DA 4R4FH 4E41E 2VQ1B 4ETQB 2NYYD 1U6AH 1S7VB 4LSTL 3P77B 3CDYA 5I1AB 3G6AA 3KPLA 2YC1B 3W2DH 4WW2A 4LVNC 1URLA 5E00B 4Z7VF 4NKMA 4HZLB 1WCBB 4LPXA 4BZYA 2NXZD 3TN0A 3P4OB 3OXRA 1TENA 4D9RD 5I6XC 2YUVA 2NNAA 4D0BB 1UA6H 1DR9A 1NEZG 3JV4B 3QEGH 4XNQA 5GGQH 1N4XL 2ADFH 4RMWA 5CJQH 2Z35B 1KUMA 3SGJA 5I8KH 1BZ7A 3NIGF 4PB0L 1MH5A 2DJUA 4G3YL 4LVNB 3MV7A 5FGCE 5JORB 2AQ3A 2P8MB 3U9UA 1B0GA 4LARH 3O9WD 5DWUL 1NH6A 1XGUA 3E6FB 4MS8C 3QG7L 5D71H 4ZUTB 4Q9CA 3KJ6H 1UWGL 3T65B 4PYHA 1E4XI 5GRJH 5C0JB 2ADIB 1HXYB 1J9CT 4YAQA 4XXDA 4D9QE 5IM7A 4MA1C 5EOCL 4GRWF 4MJID 3L7EB 4HDIB 5ALBH 2CXGA 4XXCA 4FS0A 3QG6A 4PJ7B 5SWQA 4U7KA 1FIEA 5CLWA 1WWBX 2VDMH 3S5LG 1T20A 1JGEB 1KPVA 3G5VA 5C0AB 3D2UD 3UTSD 3CSYB 1T03L 5L7XL 1M7XA 4I5BB 2UUDH 5IM7B 1UXSB 1ED3B 2BVQA 4GW5A 4BQBA 5CEYA 2E7LA 4Z0XA 5GHWL 3VH8A 4E5XA 1I4FA 4JFED 3ULVL 4UT7H 1AQDB 2YPVL 2R2BB 3WO4C 4NSKA 3TH4T 4LKXB 4LVHC 2YPLD 4N8VB 4HJ0C 3U7WL 4DAGH 1EPFA 3PXJA 3AY4C 4R0LA 1FFOB 1S9XB 5FYKE 4QTIL 4XCFL 2CH8A 1VKXB 4WUUB 1AJ7H 4WFGD 3MNVA 2IQAA 1DQDL 2AJVL 4ZXBB 4HK3J 3S35X 5C0BD 1TZHA 3ZTJH 5GS0C 4UNUA 2VAAB 2RFXB 3UJJH 2NY2C 3OJDB 3FHAA 1LO4L 1AE6L 3X3FH 2HJLA 1TVHB 3FFDA 4NO2A 5I1GH 4OM1H 5D1ZA 3RDTC 3QPXH 4P2QB 2EDDA 1DANU 5AD0A 2FCBA 4PYGA 1JGUH 1TQBC 4GUPA 2WINB 3AXLB 5DRNB 5TE4L 5EZOH 4JFYA 1S7QA 1JNLH 4R4ND 2DQCL 3EYVB 3QUZA 1DEDA 4KVCH 3BWAA 1U93A 4LKCA 3NCCB 5DUPL 5IP4A 5TGBA 3WN5C 4EKXA 4HUUB 3NVQA 2VXSH 1U8KA 3OBAA 1GC1L 1V7MH 3S7GA 3CXDH 1UXWB 5E6IC 2B20A 5I1EH 4GXUM 4K3DL 4YR6A 1D5XA 1DFBH 4L8DA 4HC1L 4OQTL 3O41B 3HRZA 3NAAH 4U7SA 3VXPB 2V9QA 3CC5B 2KKQA 4U1SA 5JHDD 3VD9A 5BVPH 1UB5B 1RZFL 5FM5O 2F5BL 4OKVB 1HWHB 4TULL 5C0NC 2J7LA 3C60D 2QQQA 5DURD 3MRHA 4I13B 4K94L 4BKLB 3VRLF 3VRIB 2J88L 1M4KA 4LL9A 1IQWH 4QOKA 3WFBL 4X6EB 3QHTC 3C6LD 1LEIB 3MGAA 1RMFL 3STLA 2JB5L 1JWMB 4IBLT 2ZOLB 4U1MB 4KJQD 4GKZA 5EUOF 3VRIA 3RL2A 1AD9B 4XVUC 5C9JB 3VFWB 5FO7B 3ECBA 3DX6A 1DLHB 2PXYA 2BSTA 2BY0A 2Y6SD 5DA4A 4PRID 4NNYB 3O6MH 3VFGH 3SKMA 4P46A 2CKBH 4F7PA 5CD3B 2CJUL 2F53B 4PJ8B 2ZWLT 4OZIB 4GOSA 4JDVA 4HMCA 4KPHL 2CMRL 3RIAK 3S37L 4YIQA 2JB6A 1MUJB 2YKLH 5DQJB 4Y5YA 4CU7A 1SJVA 1H5BC 3RNQA 2D7NA 1IFHH 3SE8L 3MNWB 1Q9KA 4PJAB 1Z6JT 5I0ZA 5E8DL 4HGKC 4MQSB 3B9KC 3GMPB 1UGNA 3RA7L 4XRCA 1RJYA 2D0HA 5JW3H 2ZCKH 4I0PD 4C55A 1JYVA 5DSCB 1BP3B 3LCYA 2ZSVA 3BHBA 4JPVL 1OP3K 2AXFA 3GMNA 1V05A 3K0WA 3EYSL 1TJIL 3MOBL 3TJEL 1DVFB 2NLJA 4Y5XC 4G7YL 4U3XA 2D7TH 3EHBD 1BQLL 4TTDC 3RVXD 3SKUD 4Z8FL 3TPUA 4M6NL 5JHLH 3MROA 2BY1A 4CGTA 1CD1A 1U3HD 4I4WA 2AJ3A 2OXHA 3ARQA 3UJTL 1D7FA 3RDTB 2R23B 2X7LB 1NC4D 4Y19E 4YE4H 1RUAL 4BH8B 4LKXA 3EJYD 3NTCL 2NY2B 2DTMH 4K3JL 4GG6F 1R3JA 4TQEL 1KIRA 1NJ9B 4WNQA 4BK4A 3HPLB 4YGVB 1UJ3C 1KC5L 1PYWA 1W0WA 3MV01 4HS8H 1RZIA 3UO1L 1OB1A 5CIPH 1C08A 4C4KO 3H42L 1P84K 4M5YL 5JMRA 5L8JB 3Q48A 2H1PH 1NL0H 3SDAC 4HWUA 4NRXB 2VLJB 5I2IA 1IAII 2QL1A 4E41D 1IEAA 1JMZA 1OAQH 3HZKA 4H0IA 1B0RA 5HHVL 3MJ6A 1JWUA 1TFHA 4DKFL 1OTUC 2LAAA 1CZ8H 3S8WA 1G7HA 2NX5B 4JZNA 4FFYL 1EFXA 3MR9A 5HPMB 3UC0H 3MUGA 4KKCC 4LDEB 4KTEH 3L3KA 3S3PA 4AZ8A 2DRUA 1EEYA 2G5RA 1U8QB 4NNYA 1OGAD 1T5XA 3AMKA 3WE6A 4QGTA 5D7LB 4HPYH 1X5GA 5F7LB 5IK3A 4U1NB 5TDOB 2YBRB 1KN2H 2VDKL 3GSNL 3Q6FB 4L8CB 1FP5A 1H8SA 3TVMC 2BK8A 3DRQB 1C1EL 2R56L 4NQEE 1UWXK 1NFDB 4YFLF 5MENB 1NMBH 1T1XB 4D0CA 3X13A 1V8HA 4P9HH 4PRIE 4PUBL 4R7DA 3CSBA 1BZ7B 1C5CH 3PWUA 3VI4F 25C8H 5A3IC 5JW5A 4AEEA 3GM0A 1YECL 3QDGE 4U1SB 5JUEH 1U8IA 1OQOA 3RDTA 5F9OL 1JF1A 3UTQB 2JJSC 3OKKB 3C5ZB 1U8NB 1VESA 4KGLA 1AGFA 2RB8A 3O9WB 4Z7WE 1CDJA 5ID0B 2GAZB 4NFCA 4LIQL 2YWZA 3VD5A 2VRAA 4P5TC 2WUBL 5CKAA 3INUH 4ETQA 5EU4A 3DBXA 1EAPA 5IB4A 2B1AH 1KCLA 4JR9H 3WLBA 1HHGA 4PP1C 1RK0A 4OSUH 5DRNA 2C3HA 5DRZA 2GJ6D 1UJ3A 5F6IC 1IBGH 4QRQB 5I1IH 2VABB 1JNNH 3KYOB 4Z7WB 3MUZ1 4PGDA 1QFPA 3MLRL 1IQWL 3WFBH 2EYSA 2IGFL 2Q7YB 2EIZA 1T6VN 5IOPA 5I74C 1XF5A 3DXAE 4ODWA 3ZT5A 5C86A 3HLAB 4JANA 1Z3GH 4FZ8L 4QXTB 2N56A 1F42A 5ADOH 3HR5A 4CRPA 1R3HB 3VXRB 1LO0H 1OAKL 5FYJD 5BZDB 4QHNB 5HDQL 1YMME 5C09A 2VXTL 2WNGA 3ARGD 1G6RA 3VFGL 1NC2B 3AUVA 4XC1L 4YIQB 5E4IA 3WJLA 3H9SD 1LDSA 1QRNB 4Y5VA 5D7LE 1GZQB 4G8IA 4Y5XA 1MQKH 3C9NB 2FEDC 2O5XH 4M6MH 1EHLL 1GL4B 1AP2A 1LD9A 3AGVA 3MO1A 4K3GA 5MENE 2OL3B 5FYJH 1XCTA 5IV2B 2CDEB 4LVOC 3ULVH 1I1YB 3UMTA 1XT5A 2W07A 2VDOH 1VGKA 4L8BB 1CE6B 1I4FB 3SE8H 2UVEA 3DX8B 3NH7L 5FYLL 1N8ZA 4YXLL 4E9LA 1WC7B 3OGOE 1R0AH 3TBYB 3WFHA 2VNCA 4M1DL 4PJ7F 3CUPA 5C0FB 2EE3A 5L2KB 1MWAH 5F9JA 4N5EC 5AWNH 4YPGB 3O6KL 1OD7A 4MNHB 4MAUH 4F7TB 1D9KD 2AJVH 1K4DB 1HI6A 1J1OL 4KI5C 3VXMA 1MNUH 3V6FB 1CFSA 2GK0A 3FL7A 4NM8H 2D7TL 1DQJA 5CHNA 2LE9A 3WNNA 2Y36H 3QO0A 4OM1L 2EICA 5J1SC 3H9SA 2E9JA 3P3YA 3WFDL 3HMXL 2F5AH 3TNNA 2XA8H 3AU1B 5FGBA 3L5HA 4ODVL 2BVUA 1BX2A 2W9LA 1MAJA 4M4RA 1I3VA 1H9VA 1RVFL 3IJYA 4TUKH 1NAKH 3FFDB 4LPVA 3T8XB 1HHKB 5HSFA 2CO6B 3PHOA 5TE7L 5FYKU 4PJBF 3S97C 2VITA 3VFSB 4XNZC 2IPTH 1GAFH 3GKZA 1ZHNA 3OXRB 2FEEI 2HFFA 4U2YA 1FVEB 4JO2H 5EU6E 3LIZH 4CKVX 2EDLA 2ADJB 1VKXA 5IFJA 1UYWL 3CUPB 2AQ1A 4M7LH 2Z8VC 3HFMH 4K2UH 5CWSB 5FF6A 1DQTA 2I5YH 5TQ2L 1WC7A 3QNZB 4YHZL 3HZMA 4LLYA 4J8RA 5HHOB 1KG0A 5IVZA 3TV3L 4EDWH 5B38A 1RUQH 1X4XA 3G04A 2R1YA 1DL7L 4W6YB 3AS2A 2O5YL 3JTTA 5LWYL 4YHNB 3HZMB 1OW0C 2XG4A 4UBDD 1VEMA 1P84J 2PXYD 3B5TA 4QCIA 3WL9A 1MJUH 1MHPL 5L6YL 5IBLC 4LU5L 2D9CA 3ARTA 3QWOB 4W68A 5HYJE 1CL7L 5C09B 2CR3A 3MXWL 1VFAA 4J3WA 3KPMA 1MCPL 3KXFD 3VG9C 3QG6B 3SDCB 3SCMD 3SY0A 5C3LD 5HDBE 2EYSB 1BFSA 2IPUG 2JELL 3NCEB 5D1XA 3SKJL 4NQXB 2BY3A 4DKAA 2ADIA 3K46A 4LLUB 4WI7A 4ZPVA 5EO1B 4GG6E 5EN2B 2NTFA 2VXTH 1K4CB 3L7FA 3NABL 3RGVA 1TVBA 1FH5H 2BVOB 1A6TB 5KZCB 1VGEH 3GSVB 1X6NA 4BJLA 5JW4N 5FHAL 2X70A 3OKEB 2PTTA 4RMTA 3VWJD 5EO9B 3LVEA 4G80B 1B0GB 2P8MA 3RKDD 4AENA 1U41A 4U1KA 2BOCB 3P4MB 4NJ9H 1JGLH 1OSZB 3F7PC 4NYLB 4ONGH 2QHRH 5CBEB 4RGNE 1NGXA 2B4CC 4H88H 3MRIA 3TYGH 2V2XB 3T0WA 4ZFGL 5IF0B 3LKQA 5GRYA 3OAYK 1V3KA 3BEVA 1PAMA 1V7NL 4M93C 3OHXA 4UINH 3WNPA 3GUTA 1F4XL 2R4SL 2UWEB 4XBEL 5IW1B 5FCUL 1EVTC 4C59B 3MRIB 2AP2A 1R3IH 1JF5A 4AEHL 1A21A 2H8PA 1IAOA 1U3HA 3FB7A 32C2A 5C1MB 3CPLA 4U1KB 1DCLA 3O45A 3S9DB 3CFEB 3V7AE 1Q9LB 5IW6B 4ZQKB 1MWAL 3C8HA 3U6RB 1X5HA 5SV4A 4LCIL 1ZWIB 1NANH 3GSVA 3LEXA 4TVPL 2X89A 3D39B 1JPGA 3RUGF 3OSKA 4BSWB 4G6AC 1JCKA 3D69A 2X4NB 3ARBD 1I3UA 2YUZA 3EJZC 1ND0B 3DGCR 1C16A 4HX1B 4X6CB 4DW2H 3MUY1 4XCCL 3QUML 4HUVB 4K3JH 3VFNA 1EERB 2GT9A 1SBSL 5ENWA 3MODL 4GAGL 3OZ9L 2XZQH 1Q9WB 4LSRH 5DDHA 4ELME 5KS9A 5J1AA 4JPIA 3CVHA 1WF5A 4Q9QL 4JFEA 3ARBA 5EO0B 1Q0YL 3EOBB 4HWEL 1XGYL 3GSRB 3RJQB 1T1YA 1YN6B 1CFVL 4GG6B 4DZBA 4XH2B 2BNRE 1QBLL 1CLCA 2NPLX 3LB6D 5IEHB 5IMMB 4OZFA 4NM8L 4NKDA 5FUOH 2H3NA 3K4DA 5F96L 4MCZA 2DQDH 5JLZB 1JVKA 1T80A 4L8SA 3GHEH 4ELMB 2JK5B 4C83B 3STZB 2GJZB 2EIDA 3QA3A 2ZKHL 3VA6A 4KY1L 3O4OC 4XMLH 5K9KB 3FQRB 5DI8A 5C0AD 1S9VB 1MREH 1ZS8A 2VZ1A 1B6DA 4JAMA 3WS3B 1UVQA 2X4QB 2C1PB 2VOTA 4JHWH 5HHMB 1INEH 4R96B 1EMTH 1UH4A 3IJSA 5HYJB 5CIPB 2P5EA 2IANA 4NQDE 5I1CL 4RAVA 4NJAL 4D9LH 2N7AA 4S1QH 1BWWA 3C60A 4HKJB 3I02B 1ONQA 1U58B 1HEZB 4DAGL 1IM9B 4YDKL 4JFPB 4UB0H 2WWMC 3WFEH 4H25B 3DVNA 1KIPB 4LMQE 3REWB 4ONFL 1HK6A 4WO4D 1CICC 4R7DB 2OTUA 4X80H 1RIVL 2BP3A 3TZVB 1ZGLM 3DO3A 2IPKA 4WHTB 1Y0LA 2A83A 2VR5A 4HIJB 3H3PL 1FNAA 3MLVL 4M4PA 1MCWW 4O51A 3ESUF 4WENB 1A2YA 3VJ6A 4WI8A 3TIEA 4N1HB 2X4RB 3IDJB 2YN5A 4OLUL 2NXYD 1DSFL 1UQSB 3PL6A 3OAZH 1HKFA 3H9SB 2DQGH 2YD3A 3B9KB 1K5NB 4QTHB 3X3FL 1BIIB 3GMQA 4YWGH 1WFTA 3QIUB 1AXTH 1UZ8A 43CAB 5D2NE 3MV9E 4JE4B 2QADB 1AXSB 5IMKB 2PO6B 4U1HA 4MD5A 1PKQA 4PJ8A 4Z95L 5IB2B 1LE9B 3S35H 2JIXB 3ARFB 3WNMA 1E4WL 1MI5B 3SKMB 4NUJA 3NCJH 2ATKB 2AK1H 5CUSL 1QBML 3LMJH 4WFHD 4RQQB 5JPMA 2XTJE 3V9FA 4TYUA 4QYOA 2FJFA 2GTWA 2OQJA 4NPYA 4F58L 2FYYB 1KCSL 4CU8A 1GOGA 4ODBD 4Q0XH 3DECA 4KV5F 4OUOA 2M26A 1H3GA 1KIRB 4PJFB 4CADB 1RZFH 3F7VB 1U9KA 2YSSB 3RHWK 2RQ8A 4QO1A 2DKUA 1GVIA 3T0XA 1WBXB 3UPAA 5L0QB 2I25N 3FB5A 4P2RD 2EXYD 5HVWA 4JDTH 4N0RA 4LCIH 2XWJA 3MRFB 4X7SH 3BQUC 2CO7B 1EZVX 5F7UA 2Q8AH 5HGHB 3LN9A 4QOKE 3QPQD 2C26A 2P8PA 5ACLA 4KI5E 2MOVA 1JHKH 2X1XR 3D25B 2NY4B 5GS2H 5HTSA 4PRIB 1ZT7A 1CFBA 1T0NA 4RGMB 3OAUL 1YEIL 4LF3B 2FX7L 3WMSA 5F8RC 1I7TB 1ZSDA 3HI1A 3IU4H 1ZA3A 2FIRT 2AV7A 1G7JA 2XPGB 2XPGA 3GJFB 4YXKH 4PBWD 4I0KA 4G42B 4OCRH 1KENL 5JA8B 3IF1B 1FAIH 1ZHBA 1QP1A 2D4FA 1MCKA 2HT4D 4WI6A 4ODXA 3BQUD 4QHMB 3AS3A 3K3QA 5CD5D 1RK1A 1ZT4B 1MQ8A 4JM2A 1ACYH 1H0DA 2V5SA 3SBWA 3D2UB 5MHSD 2IH1A 5FOJA 4PB9H 5TE6L 5E5RB 1MUJA 3MJ9L 4UIMB 4LSUH 3FZUD 3WUWG 3WO3B 2VDLL 1X6LA 5FO8A 3NIFF 3TJHC 2VH5L 2DI7A 4GRMB 1OAYL 2ICWJ 3ZHKA 5IF0A 1GGIH 3N1FC 4I0PB 3B2UC 1OGAE 3K2MC 1PDKA 3TBVA 1DEEB 3U46B 1YEGL 3N06B 3P0YL 4Y2OA 5EOQL 2CLRA 2MWCA 4JY6A 2C3VB 4I9WE 3PGDB 5TDNA 2H2PD 4CADA 4NQUA 5BW7C 4J1UB 1MVFA 4F9LC 4ZS7L 5L9DH 1WWCA 3NCFB 1C5DB 2ZUSA 4HXAL 3M8OL 1VERA 5DYOA 4KHTH 5JHDE 4FQIH 3O8XA 1W72A 1KT2B 1YUHA 2VDQL 3GM8A 4APQA 4P23C 3ULSB 4X6EA 1AR2A 1FE8H 1TCRA 1MCLA 4HIHA 4P2OC 2J4WH 1I85C 4BFIA 5JZ7C 4JPWL 5C09D 1LEGA 4RGND 4M8QB 3O81A 2P1YA 4OI8A 1A6UH 5DJAA 1P4IH 1IGJB 5JA9A 3SJVA 2QQNH 5SWQB 2EXWC 4PP2A 3UO1H 4IRSA 4NO5B 1CU4H 3QUKB 4OLVH 5IEKB 2VXQH 4ZD3H 5ADPL 4MYWB 4WJ5A 1CGSL 5I1GL 4HC1H 4OQTH 1CFNA 1ZA6B 5KW9L 4QTIH 5LGHH 3JV6A 1Q0XL 3ARDD 1ADQA 2Y7QA 4JRWA 3RWJA 5ICYB 2A0LD 1HXYA 4XMLL 3V7MA 1G6RH 5A3ID 1NAMH 3V2AR 2BNQA 3CCHA 1KLGB 1PX4A 1VADB 1TZGL 2OTPA 3MXWH 2EYRB 3OKNA 1NGZB 2IC2A 2VERN 4Z77B 35C8L 4HKBB 4UU9B 3QCTL 3I75A 5KSBA 1M05A 1A7OH 3HUJB 4MNGB 3AB0B 4QRPD 4XAWH 5IMOB 3E2HC 1X7QB 1OTSC 3MFFB 4LDLB 2YZ1A 1OOAA 3CFCL 4U3HA 3RIFK 3F12A 4K71C 3WS6C 3KYKL 1FO0A 2HTLD 3PNWA 1OGTB 1HOCA 4BA8A 2D03H 3D18B 1YEJL 2LQRA 4N0YH 3CFKA 4HSQA 3ES6B 2HVKA 5E56A 3X12B 3FO9A 1LHZA 2DQCH 3HAEA 1GJIA 5DO2D 5FGBC 1AGBB 3W39B 3HG1E 2MPAL 1AQKL 3SDDB 4G5ZL 2VITB 5D70H 2DLIA 3H0TB 1KTLB 4DJMA 4GQ9H 3V6ZA 5HVHC 2BERA 4H88L 4OZGE 3TYGL 4FFWC 4F9PA 2Q87A 2I26N 4U6HB 2QSCL 2ZSWA 5DSCA 2ZUVA 2L7JA 4LBEB 3QUMA 3QXTA 3BFOA 3FRUA 3MLYL 1VACA 4LIQH 1BVLA 1KLGA 3BD5A 3T3ME 5IKCA 3DNKA 3B5HA 3ABZA 5D5MA 5JLZA 4A2MA 4KK5C 2NY6D 5JOEA 4G8FB 4E41A 2ZNWA 5H37G 1M71B 3MV8E 5DTFB 3WCYA 1S78C 4RA3A 1NEZB 1LMKA 3VFVB 1KFAH 3WXWH 3PWLA 4W4NA 1I1AB 3UJIH 3KJ4C 4J7RA 3GSOA 1M1SA 4CBPA 3GBML 1A22B 1Z9LA 1X4ZA 4LCUB 3JTSB 4Q2ZB 3WN5A 4RRPG 4XP1H 1B0WA 4ZPTA 1SBSH 3LS4L 2Q76A 1LEGB 3UCRA 3SE4C 4MQXD 5EUOE 1FNEA 3BZ4B 1A3LL 5JO5A 1A7BA 3F5WB 3F62A 3QEQA 3RUGB 4EI5B 1KV3A 1NCAH 3VFWA 3KHOA 3U9PL 2APVA 3OAUH 1OHQA 8FABA 8FABB 3P11L 2XA3A 4Z76B 2UUDK 1T1WB 3NCBB 5GGVH 3T2NH 1OP3H 1U8HA 5DO2C 4FNLH 1WLHA 4CMHC 5C0EA 1FL6B 1JYXA 4U6XB 2F58L 1U3HB 1VSCA 3OAYH 4WU5A 3F6LA 5BO1L 2X05A 4OKVA 3WS6A 4NQVB 5DWUH 5HJ3A 5JOPD 1EBAA 3ALWA 4L3EA 2FDBP 3RWEB 2YPKB 4QNPE 4HXAH 2X4TA 5E1HB 5DEGB 1NBZA 4JVWA 2DLEA 1WCBA 4A2LA 4JJ5A 4G9DB 5DD6A 2EDXA 4POZC 3BP7B 3MFGB 4FQLH 1EUTA 4NYLA 4NC1E 5DTFA 3QR2A 5J6GA 1GCFA 3LKSB 1RK1B 1ZT4A 5GZOC 2R0ZH 4H26A 1KF9B 3PP4L 4Y4KC 1XMWA 4PBXA 3VMNA 2YPLE 4HUMB 2X4SA 1BJMA 1S8DB 2E6QA 3DTXB 1UCTA 1EK3A 4QHLB 1JPST 1CU4L 4IOFD 3VXSA 1RJZB 2KPNA 1T66C 4Z5RA 3U7YL 4MCYB 5GSVB 5HHNA 1MEXH 4XPFL 5M94B 4PJCE 4JKPH 3NFPA 4UQ3A 4QXUL 3PWNB 5A1AA 3HE7A 4NQSA 1RIVH 3V5DB 3KHQA 4POZD 1BJ1J 2XNAA 1FZJA 4LAQH 1YQ2A 4U1GB 5IVXB 2BSSB 1RZ7H 1FN4B 2NZ9C 2G5BA 4J3SA 4PFEA 3JWNC 3BAEL 5KBNC 2KUTA 3OKKA 1DSFH 1WBXA 2ZG2A 1BQHB 4UDUB 3RZCA 1MLBB 4TUKL 2PTUA 3WL9B 4R3SA 1A6WL 3S34H 2IANE 4NQDA 2RGSA 4FFWD 5C08D 1IZJA 5IROC 1MVUA 4MXVF 1CXFA 4AL8H 3INUL 3FO1B 4WFED 1FL6A 1NBYB 3LKRB 1CZ8L 5CAYB 1R24A 3MRCA 4N0YL 1WZ1H 4NPYB 3T4AA 1AGEB 3OJMB 3QULB 1X9QA 2AXGB 4OCXH 5KVEH 2DQIH 4JFFB 5J3HD 3WIFB 3PGCA 4OV6F 1JGVH 2IQ9L 3DVGB 5FXCH 5JOPE 4CJ0A 4Y1AE 3ROLA 5MP6H 4HCRA 3I3BA 2PR4H 1Z0NA 2B1HL 3N9GL 8CGTA 4PJ5D 5GS0D 1A9BA 1SEQH 2VB5A 4HUWB 4HAFA 4MXQC 5D7IE 1AXSA 4P59H 2YPLB 3GMRA 5BVJA 3VFSA 5DMKA 2ED9A 1YECH 5KJRL 3UZEA 4JFFE 3C2AH 5LVEA 5IR1A 3VXNB 3D0LA 4HGWA 1F2QA 2HT2D 4F15B 1LDPL 1BQLH 1EDQA 3O2DL 5E2TH 3G5XB 1Y0LB 2BY2A 1PQZB 3X11A 5MERA 4MVBD 3MLXH 3NAAL 3QO1A 4GW1A 3ARGB 4YGVA 4S1RL 2VR4A 2OR9H 1DUYB 4PD4J 1XGUB 4Z7QF 2FX8L 1TXKA 2OJZL 2K7PA 3LZFH 1RJLA 3UJTH 1JRHL 2DWDB 1P6AB 1A1NA 3WIHA 2XZAH 3PDDA 1NFKA 1U58A 4CL7A 2J88H 1PEZA 3HG1B 2YRPA 1U8JA 4Z9KB 2ARJB 3PABB 3U9PH 4Q9RL 3B9EA 1AO7B 3UPRA 5JPNB 2JJUA 4LGRB 5E5UB 3TPUB 3CH8A 5DJDA 3AVEA 1Z3GL 1IGML 5I1DB 1OAZL 1MIML 5E6IA 2Q20A 3VWJB 1GSMA 3C87A 3EO0B 3EFDH 2GY7B 2EDWA 2MFNA 3KVQA 4DGVL 4NZDA 2Z91A 5K9KA 5IG7A 4RGNB 4MDJB 5AUMB 4JDZA 4HLJA 5L2KD 1RJYB 3REVA 3SO3B 1S7XA 5AEAA 1D9KB 5MEOB 2Y4SA 2QTEA 1S9KC 4EN3D 1YMMB 4FFYH 4QRUA 3K2UH 1LD9B 1AP2B 3P73A 4F7CA 4GG6A 2BHUA 3U1SL 4XP9H 5DQJA 1Q72H 1CFQB 1Q8MA 3JSSA 4LHQB 3ARDB 5SX4H 3SOBL 1X5XA 2VL5A 5E70A 1YN7A 4M1DH 3PQYA 1WK0A 4R90L 1HYSC 1FZOA 2AKRA 4J6RL 1MHEB 4PUBH 4DQOL 1IVLA 3TWCH 3SDAD 4ODTH 3OPZL 2VKWA 5IOPB 3CMOH 5J6HA 3OJVC 4PJ9B 1BAFL 3RZCC 1QFWH 4QRQA 1RZ7L 3JUYA 3CLEH 5D9SA 4WWKA 1EO8H 4HUNB 5F3HB 4KKAD 1MFAH 3BEWA 4Y5VC 3O45B 3IDNA 4LCWA 2AEIT 2R1WA 4RFNC 4Y16D 3GO1L 1NGPH 4K3HA 1EJOL 5F88B 5D1QA 3BKCH 4PJDB 2AXJA 4OBSA 1FL3A 3WLWD 3C2SA 3TPKA 4PBVC 4X7DC 4RIRA 5IT2H 2ZKHH 3C5ZA 2HWZH 1YEEH 3HTLX 2W92A 3QZWA 4CU6A 1UZ8B 3GI8H 1P7QB 1UZ6F 4Y0GA 3QFDB 1U93B 3MC0A 4LKCB 3UJJL 4HS6A 4X5LA 1YNTA 3I9GH 3WUWB 2F8XC 2B4CH 3FOLA 3PHQA 4Q6IA 4FQ2H 4R26H 4PREB 2OSLB 1MFCL 2VAJA 3D1MC 1K2DB 5EN2A 4LASH 4LLQA 1CS6A 5FYKH 5MI0C 4YHMH 3RDTD 4GQPH 1CFTB 4K8RD 1OP5H 4XX1G 2IF7A 4MZ3A 4PD4K 1ORQA 4YFDB 5EULV 4KV5E 5B39A 3SY0B 1CD8A 1H3WM 5JXAH 1F3DJ 3U82B 5EU7E 4G6KH 5C2BH 5D8JH 4IIQC 1P9MC 1RHHA 4OM0L 4UAOB 5FGSA 5JW4R 2IQAB 4PB0H 3QIWC 4RAVB 4EI5D 4NDMB 2XV6B 4MXQD 1CFQA 1GIGH 2VLJA 3ZTNH 5I2IB 3T77A 2OJZH 5AZEH 2QQLL 4ZUUA 4GMSH 3DO7A 1FYTE 3QIUD 3VXQA 4NWTH 2YSSA 1TNMA 3DPBA 1U92B 3T4AB 4G9FA 4RAUB 3IDUA 2EDFA 2EYTB 1T2XA 2SEBA 4HKXB 4MNGE 5AUMA 1GGCH 2QADC 2VZSA 4Y16A 3PV7A 4HBQA 4EOWH 4M02A 4U6YB 1KLUB 5DJ6A 2A6IA 2ADGA 4JG0L 5EU5A 5D7LD 3D0VA 2P5WE 3NPZB 4NT6B 5E6IB 2FL5A 4R6UA 5BXFB 3FCTA 2DIBA 3JUZA 4JPIB 1FC2D 1LE9A 2ZJSL 3C5ZC 1FZJB 4RSVA 3C08L 3G6DL 5AZ2L 3DLQR 3CFDA 3HCVA 5J9PA 3NIGE 5EC1B 3PWPE 4NQSB 4L9LA 5CSZB 3BHBB 4LRIC 1WAAF 4S11A 2P5WB 1A14L 1TQCC 1QR4A 1RJZA 4RFOH 1CT8A 3ARGA 3SDYL 4Q97A 4NHUB 1QYGL 2BSED 3P30H 4X4YA 4LSTH 4ZUTA 5IHZB 4P23A 2R15A 3W2DL 1OL0A 4GSDH 3EDEA 3DX7B 4PJ9C 3VXNA 4F8TA 5KSBE 3IDIB 3TESA 4XGZB 4R2GB 1AJ7L 7FABH 1T21B 4FQXA 2RJMA 3DI3B 4FG6C 2Z31C 3WHE1 5EBLB 1NBZB 3DV6A 3N85L 1DN2A 3BEVB 3WNOA 1LE5A 4XP9L 1MFAL 4KUZL 5IVXE 3EDDA 4MGXA 4Y2DC 2E7LC 4TUJA 3BDXA 3GSNB 1QA9B 4FN0A 4XP4H 3AC0A 4LP4A 2JCCE 2VC2H 1II4E 5A2KH 5EDXA 4JFFD 3K2UL 3MRNB 3CVHL 1IRAY 2ARWA 4PRNB 1CTNA 1MJ7L 2WBJB 5CMAB 4Y5YC 5EZLB 3H2WA 3IS0X 5HYJD 1R24B 3MRCB 2W0FA 1ACZA 1K3IA 3D85D 4O2CA 1G6VK 3EIFA 3BSZL 5GISH 1A0QL 1MVUB 3CFJA 5IQ9A 5D96C 5KSUB 3HA0A 3OKMA 1NFIA 5DR5L 5J13C 4DZBB 2V5MA 1QRNA 2IEPA 2OP4H 1OP5K 1OSPL 3QIBB 3PL6D 1EJOH 3TZVD 5GGSB 5GGSA 5GRJL 4PJAF 1XGPB 3KLSA 1I8IB 1YY8B 3WKML 2VL5B 3IAGC 1RZJL 1T2QL 2VXUL 5B3JF 4H1LH 3OJ2C 4WFFD 5DDHB 1JHTA 4RAHA 2EH7H 1RMFH 2YPVH 4X0KA 4XP6H 5HI4C 1IGYA 2HTLC 3HC0B 1L0YA 5TF1L 2MKWA 3QJFB 4G8EB 2H9GB 5I19L 4H0HB 4JZOB 3FONA 3MLXL 2X4NA 3D69B 3OR7A 5DGQA 4M1GL 2HN7B 3DUUB 3HPJA 3LEXB 3WLBB 3HMWH 4KK6C 3C2AL 1T03H 3EUUA 1TVHA 4KJPD 5IB3B 4YBQC 5FF6B 4CAGA 1U8MA 1PZUB 1YEEL 2RFXA 4F7MB 4JQIL 4JFZL 3D9AH 1HSAA 4FMKA 5DJ0A 5JIPA 4ELKA 4QOKD 2NXYC 2N7BA 4PG2A 3VFPB 5F8QC 2CUIA 4M7ZB 2HFFB 1IGMH 3BN3B 5EBGA 1KEGL 2B4CL 2X10A 2P42B 1UADC 3P2TA 4NBXB 4PJ8C 5IHUH 1REIA 3LQAH 3O6FB 4NWUH 3MREB 2WUBH 5FKPA 4F37K 4PTUA 4YX2L 3CD4A 3TEUA 2DICA 3V0WL 2LAGB 3NZHL 1NKOA 4AENB 1M05B 3LRHA 4JY5H 1AIFB 1HNFA 2WWMD 1FFPA 2HVJB 5DT1H 5FECB 4QWWD 5KSAD 1G9EA 4NO0A 3EFFA 5IB1A 3LS5H 4JREC 3SEPA 3Q1SL 2I60L 2NTFB 3QQ4B 1A5FH 1J05A 2IAMA 4I1NB 5IJKC 1NGYB 3VFRB 5GJTH 2X4OA 2ORBL 5DQDL 1GHFL 1P4LB 2J5LB 4ZDHB 3FMGL 1NMAH 1EGJL 3MRJA 1HI6B