3SBXA

Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
RWTVAVYCAAAPTHPELLELAGAVGAAIAARGWTLVWGGGHVSAMGAVSSAARAHGGWTVGVIPKMLVHRELADHDADELVVTETMWERKQVMEDRANAFITLPGGVGTLDELLDVWTEGYLGMHDKSIVVLDPWGHFDGLRAWLSELADTGYVSRTAMERLIVVDNLDDALQACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Unknown function
total genus 68
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sbxA00
2PMBA 3HNOA 4FYHA 1S3FA 3O8NA 4U1RA 1S2LA 2F67A 6PFKA 3O8OA 4NPAA 3O8LA 2F64A 4A3SA 2KHZA 2NX2A 4LJKA 2F2TA 3O8OB 2F48A 1ZXXA 1RCUA 3PFKA 3OPYB 3GH1A 1S2IA 2HIGA 4KXMA 4WL0A 1PFKA 3QUAA 2IZ6A 1S2DA 3OPYA 4FYIA 4LJRA 4MCJA 4P5DA 1F8YA 1WEHA 4I36A 3UQZA 2F62A 3EHDA 4PFKA 4P5EA 1YDHA 2A33A 2IZ7A 4JELA 4OHRA 4JENA 5AJTA 1F8XA 1WEKA 2Q4DA 4HX9A 3SBXA 2Q4OA 4MEJA 1KZHA 3K2QA 5ITSA 4JEMA 5AJUA 1S2GA 4I4IA 4OHBA 1MTOA 4KXNA 3U39A 4RH3A 2PFKA 4FYKA 4KXLA 3F5MA 2A0KA 4LJLA 2IZ5A 3IMKA 2KLHA 4I7EA 3MAJA 3BQ9A 1T35A
chains in the Genus database with same CATH superfamily
4CM9A 1B3RA 2M98A 3F67A 4DR5B 5F12A 1I32A 3WKCA 221PA 3HUUA 5FUXA 3R2JA 4R54A 1QVVA 3VH1A 1H69A 1NXQA 2LD4A 3L1IA 1FSGA 1A9PA 1BXKA 1GRQA 4JGBA 1GL6A 4TTVA 1LNSA 1WWKA 4P58A 5IF9A 4HAVA 3REOA 1VDZA 2CNWD 4L2IA 4C7JA 2RARA 1BKSB 3K5HA 4QHSA 4PPFA 4R1TA 4S1NA 3W3ZB 3D43A 3SYRA 5BRJA 5HKAA 4WGFA 4ZQGA 2EKDA 3MJFA 3PC6A 4N65A 1IQUA 3CH7A 5B58T 5JZVA 1IOVA 3PC4A 1L4YA 5LDHA 3WMRA 4RD4A 1X13A 3AF1A 3QVWA 3T1QA 1AA9A 4OIMA 3HSKA 1NBMA 2OBBA 1FLNA 4FGZA 4C01A 4IO0A 4CR7A 3BF8A 1O2DA 3BJRA 4JOQA 1AS2A 3FFWA 2I76A 3UAYA 1HDZA 2GUWA 3FHJA 1B4DA 1I7NA 1J0CA 4TWBA 4XKJA 1IATA 2WJAA 2H2AA 2HJSA 3BF7A 3NDIA 3NONA 5JNTA 2E85A 3JTEA 1MAHA 3QXGA 4LWZA 2WT8A 2NU6B 3ROKA 3STXA 2ZSEA 1NVVQ 1I7PA 4AKTA 5IKMA 1OBOA 2WFAA 2RBEA 4X95A 3BGIA 5JSYA 5HS6A 4O29A 3IPRA 1Z17A 1ZC4A 3C4QA 3E9NA 2F17A 3AOEC 2EWWA 4BWYA 3L82B 1BGXT 1T2VA 2XHEA 3TLGA 1N6RA 3JY6A 3UM9A 2ZVDA 2XE6A 3FPEA 3UG7A 2Q5HA 4P4SB 3RT1A 2FEWB 3ZW7A 3AYXB 1AGPA 5F3WB 2PVCA 2EU8A 5JCJD 1XKXA 4DCJA 3W3AH 1KSGA 1ADGA 2EAUA 2HX1A 1B93A 3BD6A 3DEIA 3HO8A 1NSFA 2WUFA 2Z4SA 1ZUNA 1YRLA 3B9PA 3FOEC 1LC3A 1MP0A 1V1MB 4H6XA 1PQYA 2X0IA 3ZI7A 4Q1DA 4MCAA 5C5EA 2PGIA 3VZDA 1G6Q1 4FINA 1Y7IA 1EI9A 3H2KA 5FYDA 1EXDA 4IJVA 1X80A 3KTOA 2LV8A 4V0LA 2FXIA 1GLGA 3VR1A 3GCZA 3G2LA 1QE5A 1EWVA 4MUIA 3VHQA 3GLGE 4JSTA 1OLSB 3T5DA 1NMZA 1U2ZA 2NZ8A 4K9RA 4FX5A 1Z47A 4JASB 5LYJB 4S05A 4D8VA 3G2NA 4D3DA 1WDLA 1EFDN 3HJRA 1U8UA 3INGA 4Q5IA 4PZDA 2BEUA 2J9XB 5E8JA 3M3DA 4RCVA 1WTAA 3CLUD 2FPWA 4AF8A 1F51E 1ESDA 1U2PA 2HK7A 3KEQA 2VXYA 4Z4IA 5FUYA 1T9GS 3NASA 1VRVA 3H75A 1NBAA 3HFGA 2FSGA 3UJ8A 3ZJTA 4XOIA 4X1IB 1CEXA 5H4GA 3KQQA 3K71B 2QE7D 3U7RA 1XD9A 3E9QA 2HZ7A 4LOKA 3QVUA 2P0AA 3WGOA 4EGFA 3SS7X 3ADKA 3FSRA 2GAFA 3S2YA 2YW2A 1LBSA 1R5OA 3PYLA 4OY3A 2WPDD 2Q28A 4IVNA 3F2VA 1IC6A 1WZCA 5BOSA 3WE7A 4BP8A 4C7XA 1QOQB 3T34A 1D4ZA 4F5EA 5FNVF 3FFXA 1L3BA 1A5AB 3C3CA 3ELDA 4UD2A 4WSOA 4JCCA 2WZCA 3FLAA 2FJPA 3QF4B 4BQFA 1MAWA 4MI6A 2XIQA 4BN5A 1JE0A 2EOAA 3UO8B 4DLSA 5KQGA 1LW7A 3JS5A 3WRVA 5IBCA 2CK3D 1ZINA 3AL2A 4RA6B 5CIQA 3OJOA 4G3XA 2O23A 4XVCA 1GKKA 3CS3A 1ZNQO 1OOEA 4RE5A 1OZGA 2B4YA 2PSEA 4OXYA 5C9ZA 5KYXA 4Y6SA 4LWPA 1OJLA 2DQKA 4L8VA 1MC4A 3TIXB 2KWIA 2YIJA 3KZXA 4N01A 1FZQA 2GZRA 4BC0A 1Y4ZA 1R9JA 3R7NA 3SPXA 1P6QA 2X4DA 4O4HB 5CH5A 4HVLA 2RJNA 1F1BA 3TTVA 4XQ0A 1VRWA 1I4TD 1QYCA 3O9VA 4FOSA 4J1TC 2C4WA 3LDAA 4UBKA 5EQDA 2GWHA 2VHWA 5EMJA 1G6KA 2WYOA 1JJAA 2X7JA 3G2OA 3OT1A 4POOA 2DUUA 4PZPA 1Z16A 3TLEA 4XDGA 1QJ4A 3LLMA 4JLOA 3L6RA 4R8VA 1UZLA 2PE5A 4DLNA 3GNLA 2MR6A 4LDZA 3FYUB 3HA3A 4FZ3A 2N47A 4R83A 1W2HA 4ALJA 1BE6A 1X3SA 3M2PA 5C7OO 2XUZA 3VSCA 4CQLB 2C04A 4G2TA 2ADFA 4WK0B 2XNDA 3I9JA 2AFHE 4Q7KA 3JVDA 4KMMA 1ID1A 3PPYA 2W4QA 2OECA 1GFSA 4RHXA 1NU8A 1SOVA 1GZ4A 5TPZD 1AMNA 4JBIA 5L4LA 1Z4PX 2OV8A 4EVQA 2SHKA 2FUG6 3DUFA 3SYLA 2O8FA 3TKYA 2IU3A 4U7TB 4CKWA 2V1UA 5BN4B 5F9FA 2DBRA 4U2CA 4YDHB 1W5EA 1FTGA 1CCWA 2QKYA 3GHYA 2UVPA 3ZY2A 2WVHA 4KZPA 5GTDA 3ME5A 1T5HX 1D2MA 2AOTA 4ZU3A 1CUHA 2M6KA 5C8YF 4F06A 5JYDA 2DMRA 4X93A 1KH3A 1K68A 3VZRA 2IBMA 2XD4A 3IEXA 5DN6D 4LW8A 3U17A 4TQGA 1K4KA 1XTJA 2PZGA 3EF1A 1VBKA 2FVYA 4DE5A 1SCKA 2I6GA 4AJPA 1QZZA 2FVXA 3DE7X 4LX8A 4CM6A 2ZIVB 1I2DA 1WU7A 3E7WA 3H97A 4N1AA 4OQNA 5AH0A 1Z4LA 2E18A 1LBTA 1LQTA 4J0EA 5CBKA 1JV2B 4LXUA 4KK3A 2PUGA 4U8GA 5IX8A 2QT9A 3WYGA 4C0HA 4V2UA 4RJ2A 3GMIA 4GOJA 3V8RA 1VPDA 1OAKA 4A0SA 4TUYA 1P60A 4V24A 2Z6QA 1L1RA 4NU8X 1T2DA 2LE0A 1G98A 3BYZA 5TQ0A 2BMJA 3P2EA 4LZPA 4UEJA 2MINA 3OP1A 4A6EA 2PAFA 5D1HA 2VRWA 3DHNA 3I4FA 3T3EA 1K6XA 4D6PA 3SVLA 2H2WA 2G36A 1C8LA 2XUOA 1PQ4A 1YD7A 4XDYA 1SBZA 4IHAA 3MQ2A 1DXHA 5BWLA 1HORA 2HPAA 3H5OA 4H17A 2INGX 3BM5A 4MR7B 5HGJA 3L7YA 3WQRA 3IQDB 2WIFA 4OH7A 3QYPA 3I01A 2YFKA 4HXFB 1AUPA 2A4MA 5FA6A 1P7CA 1DQPA 4IDFA 1E3JA 1GEEA 1G63A 4IIVA 2GM5A 4INOA 3NUGA 3V7YA 8OHMA 1V9SA 1RJ9A 5K3EA 3JRXA 2QAIA 4L8GA 4U7DA 4WLNA 5G0TA 1RJGA 2G0NA 2R44A 1C50A 1FU7A 2IT1A 5JJKA 3W5VA 4I55B 2WTNA 4RUKA 4EF4A 3TPCA 2EZUA 1Y42X 2NAPA 3QEMA 1ULUA 3H11B 3LQFA 1JWBB 3J80A 2VCEA 4I46A 4PR3A 4UU7A 2X0EA 1T91A 3DKIA 4ZC1A 2HXSA 5GJVC 3M6MD 5KX5F 3ACCA 4YAIA 3ANSA 4P32A 4RV4A 2DBQA 4I1PA 3Q0IA 5AUQA 3UMYA 4EL5A 1XXHA 3ZD8A 2BH2A 3V9PA 2O4CA 4DANA 2H8KA 1O0SA 4ENUA 1PJZA 3P0HA 1T9BA 3THSA 1E9CA 4Y3UA 1SOWA 2CNOA 3L9XA 3LPDA 4HTAA 2NNWB 1QRSA 2EZ4A 2B34A 2I2XB 5AD1A 2VF7A 4LNHA 5EJGA 1MB2A 3PFIA 3OFJA 3IO3A 1HYGA 2GHRA 1KU0A 4MUHA 2MWMA 2IHUA 5ALRA 1RXIA 4L3OA 3U81A 2GHTA 5JVDF 2Q4EA 4P5DA 5CW1A 3GZ4A 5AUPB 2W6OA 5IHXA 1U9YA 4Y98A 1DGQA 3IEKA 3BEDA 2W5UA 2CXQA 1RE0A 2B8WA 2FG7C 3OZCA 5CVTA 3HUEA 1OSNA 3JU3A 4OIFA 4S3MA 1SKYB 4CNBA 5C7LO 1Z0AA 3HUDA 1LVHA 2H5EA 3PZRA 5NULA 6Q21A 1E1DA 3VBCA 1EFCA 5LU9A 1W88B 1NKSA 1X15A 1K9SA 2O9JA 4H0FA 4BNKA 4W7IA 2YJ5A 4CLOB 4F46A 3JZFA 4FYVA 2Y0BA 3QPWA 4AROA 3U44B 4DABA 1RPTA 1DXOA 2YHBA 2RB5A 4RSMA 4U2DA 1OC4A 5H3LA 2F8SA 3D8SA 4OU4A 2RE8A 4NAHA 1JPNA 3GAAA 3PR1A 4G0NA 4COOA 3B1YA 4HQLA 2O2XA 1GCAA 2QM7A 4XPIA 1R8XA 2F4NA 4US2R 1B23P 1QO0D 2ZAGA 2HDWA 3DTNA 4CQMB 3VSAA 1T4CB 1XD2B 2I0FA 2ZRPA 4UKDA 4OYYA 2W83A 3D6NB 3U9LA 8AT1A 5L3VA 1JLSA 1PR4A 1OKKA 2AF4C 2Y4OA 3HPQA 3NG1A 1LRKA 3IR5A 4KW7A 4L08A 1KJWA 2GB4A 4IKOA 4K9MA 4PIPA 1DARA 3TI9A 1DQRA 4J91A 1T3ZA 1R4AA 2ZBGA 1H2BA 3ETJA 2ZTHA 1WZUA 2NV2B 4IP0A 2HMYB 2JJYA 3GLQA 1D7AA 4CHGA 1EX9A 3CCCA 3RK4A 3T15A 5T4BA 1Y1KE 2A59A 2D1YA 2QTLA 2I2FA 3LQYA 2BCJQ 3FRJA 4LXHA 4AIRA 4DT1A 5FTMA 1O5IA 4AY3A 5TQ2A 1A97A 3LTEA 2HIMA 4MQEA 5BQOA 3C7CB 4C0AC 2YZ7A 2V7BA 4PLTA 4G5HA 3TPZA 3A6LA 4QPCA 3HDTA 3TLAA 5KC9A 3C8DA 3S8EA 1W30A 3U3DA 4MJ7A 5EIFA 4FB4A 1P4SA 3FM9A 3UH1A 1I0ZA 2LKCA 2Z57A 2ILTA 1IPFA 2FZWA 3SY8A 4RIEA 4ZEOA 1DOHA 1Q2XA 4KRYA 3U4DA 1Q1BA 3EPHA 3EXFA 2DQZA 3B6MA 1E1RD 3QTLA 3U1BA 4O3FA 4OU5A 1FRQA 1XZJA 2ZWIA 1AE1A 1QIDA 3ZLTA 5GJBA 3DMGA 4FZ5A 2BDUA 4O2AA 4TXJA 1QHGA 3ZU3A 2AJDA 1SVKA 1T24A 1WNTA 2AKAB 1RABA 2E89A 5FUBA 3T5BA 4BNMA 2N3ZA 4WNCA 3UCXA 1H5UA 3N0TA 1AMOA 5ERYA 5EIEA 1GAEO 1U2DA 2X23A 3C6MA 4XDHA 1OFUA 2ONJA 4OQMA 3ET5A 4KQ2A 3QITA 4PU0A 4CFSA 5JOQA 4RA9A 2UYHA 2J48A 1HE2A 1Q0ZA 4BNDA 4PZEA 5HRAA 4WWHA 4RK5A 3AETB 2ADOA 2V97A 1C4WA 3UGKA 1F5SA 4UM8B 4X7MA 2PGLA 3QEKA 2C9YA 2JLVA 4UARA 3NGLA 5E3JA 1N5LA 3D3QA 3OTGA 4LF6B 1T1GA 4EBBA 3EOZA 2LBPA 4O0MA 5BQPA 4B0OA 1W8IA 2TSYB 4KN9S 1J0EA 2QUJA 2JAUA 3V4RA 2VWPA 1FP4A 4R8SA 2IZ6A 1UQUA 4O4LF 1RYNA 3U1VA 4D8WA 2QIPA 4DQ0A 1ISIA 1TYZA 2OOSA 3HYTA 3MJEA 4M22A 4NAVA 4WZAA 1GJRA 1L5NA 3L7LA 1QVRA 2ZJYA 3T7EA 2J5KA 4K3UA 1W85A 2OBFA 4OO3A 5EIWA 2QVGA 4PNZA 5CDFA 2HLHA 5IJAA 4TWJA 3RVBA 4LMPA 5IC5A 4QU0A 5K3BA 3UWDA 1HKHA 4C3UA 1C9KA 5HQTA 1E18A 4ZT6A 2A78A 1QFSA 2EXXA 2I54A 4UU1A 2A9JA 1NX9A 2ZRNA 1L8OA 3EGCA 3V80A 3SKVA 2JJ8A 2ZZNA 3HI6A 1DUSA 4J1NA 4QOSA 2OMEA 3BD9A 4FJ0A 3A1FA 2P8SA 2JIPA 2OBYA 3RVRA 3SJ7A 2ZTLA 3H83A 4ZYTA 5HDQA 1L7PA 4TMXA 1MENA 2XYRA 1JSRA 1N8SA 1PR6A 2WG1A 1N3IA 3KM0A 4KYTA 5B37A 1M75A 3DBIA 1G5PA 3VC2A 1OIVA 2LW7A 2FZLA 3GIWA 4R3WA 2YICA 2ATXA 4FHEA 2IHTA 1N2JA 2VUHB 5J40A 4YALA 3EC2A 1A0OA 3U2QA 2VDKB 4O2LA 4WBNF 5JXGA 5TDHA 1EUCA 1U9IC 3VOBA 3UJDA 4J0GA 1RI3A 1U7WA 4X3CA 4BVKA 2FRXA 4X62B 1PR2A 3RG2A 3RHSA 5CLFA 3NHKA 1CWUA 2BKEA 4Z9YA 4BXOA 5E1BA 3D0QA 3BX1A 1G20B 3BE5A 5C5DA 2RGDA 3FB4A 1AGYA 2J6BA 4DUPA 2P0EA 1RAIA 1K7FB 4QLOA 1GPDG 2PA0A 4MX8A 4NCHA 2V65A 2NO1A 4QQ8A 4RPLA 4JXZA 3VKGA 3O5AA 1YS2X 1X38A 3MBOA 2ECOA 2F6RA 2X2FA 4MVYA 3CZMA 1QG4A 2CKDA 1OY1A 4I5GA 3KAPA 1FF9A 2CUZA 2NG1A 3OX1A 4JD5A 1WDMA 1ZM4A 3RLFA 3DA8A 2C95A 4DUGD 1A7JA 2VQSA 4JVSB 3UMVA 3V46A 2Q2VA 1QAOA 2KM1A 2PH5A 2TMYA 3SCZA 2GRJA 1QP7A 2G8NA 2O50A 5AK5A 4BOYA 4PVDA 2F55A 1NVBA 3MJRA 4KIGA 2V59A 4TVSA 4D96A 2XWPA 2Y67A 2DFLA 3BJZA 4AJKA 3L7CA 1QIJA 4EJFA 2BYTA 2X5KO 4HGPA 1L8AA 1GPJA 1KI4A 1V4VA 3H17A 1WO8A 1YBVA 3B13B 2HU2A 3CVOA 3MJCA 5DK4A 3T5TA 2BR4A 1YZGA 5EIBD 5HFJA 1UBKS 3IERA 1ATZA 3COSA 4EW6A 3M6XA 3P4UA 5B3JC 1OXTA 3CH5A 4MKIA 1J07A 4RDCA 5KJEA 3AM4A 3X1MA 3QOFA 4ILKA 2H51A 1TX4B 2G1UA 1GTVA 4LMAA 5CNMA 1UKBA 3MWEB 4KPUA 4R6WA 5HTOA 4DEXA 3NDRA 3OOEA 3GGPA 2P7IA 3GXBA 2ZK7A 2GWRA 3A3PA 1FXWA 3H1GA 3H5IA 4UEQA 2OSVA 3SU8A 1CUXA 2ZWVA 3OU7A 5FTWA 1YCHA 4F45A 1OXXK 3ZXUB 5A9RA 3QEJA 4F96A 4LXIA 4CEJB 4HPXB 5HDBB 1ZXXA 3GC6A 3GLGA 4G65A 4G5YA 3WLLA 1FFXB 3LKVA 3INTA 3TF5A 4E5PA 1Y3AA 1XL0A 2ZYHA 4JMPA 3ZVNA 4C6TB 1BMTA 1R6TA 5B6PA 2YHIA 2PKRA 5A5FA 2IF2A 3OM0A 3ZXIA 4EJ2A 1G0NA 3PQ2A 4EK9A 1Y63A 3C87A 4MAAA 3HEMA 3U7QB 3EMDA 5DYWA 1KI6B 1NP7A 1VSTA 3HA7A 5JBNA 1LVGA 4JI3B 2Q5LA 2JF0A 1CR0A 1E2QA 1JKJA 3HP1A 4EI7A 2G1PA 2BEVA 4TQ9A 3FY4A 3PTLA 4E33A 1WV0A 4FWTA 3DDUA 4FGLA 4P5EA 4R01A 4CE6A 4MV0A 1C0IA 1NE7A 3HCCA 2WUDA 4Q1EA 4RVFA 5KEIA 5EEHA 4RLQA 2GHIA 4B6PA 5K45A 3G8DA 3KDAA 3OPMA 4FYJA 3B5IA 4B3FX 1XI2A 5CBPA 5I7FA 2ZAOA 5CVCA 1KAMA 2QPAA 1O77A 3GDWA 3KJQA 4S2UA 5FFNA 2C7QA 4F5WA 3QZUA 2QU8A 3U3KA 3PU6A 2VAWA 3B2QA 5IMSA 3EIOA 3KTAB 1XLWA 4FGUA 1O95D 1ZN8A 2GGSA 2QSJA 3S3TA 2NVWA 4HG2A 3GRUA 2NQTA 1GAJA 2HNAA 1ORWA 3DO8A 2PU5A 3DMYA 1VJGA 4LDPA 4WLUA 1WPXA 5JNLA 3S28A 4F6RA 1QE0A 3QMWA 4NPCA 5KCZA 1G6OA 5TV2A 1JR4A 4ID3A 2JA2A 2WPNA 4AY4A 4QXMA 1YL5A 4HEJA 5THQA 2I1QA 2WWFA 4CGYA 3FLMA 2OO7A 1ZCAA 5BW5A 4JUBA 1W1UA 3OM1A 2QZ9A 1P5ZB 4OP2A 4WCVA 3SQOA 3FVVA 4ZVOA 2V7QA 2PRSA 3EVBA 3IKVA 4BRUA 5AFSA 3OPQA 2Y0EA 1UK6A 3TD2A 4R68A 5EZ5A 4JBWA 4G1MB 3ZI4A 1D5CA 2ZIWB 5A0FA 3T1YB 5I9SA 2BRUC 2FDRA 3RROA 5ADUS 5BP7A 3OU2A 3DKRA 1TT5A 1GSOA 4BB5A 1OLXA 2AFHA 3Q6IA 3GPBA 3ETEA 4UTZA 5LR6A 4K2HA 1Y1LA 2VNJA 2P4HX 1G2PA 4DW8A 2JHGA 3ZHBA 2C94A 1SEPA 2FXVA 3ACBA 4FYHA 5TY0A 1VBMA 3RGWS 3TNDA 5T4HA 2O1XA 4E88A 1P29A 4D9IA 1XGKA 3UAZA 3W8RA 2EQ5A 3CMMA 2HUNA 4ZZ2A 4U7GA 1SCBA 3H1TA 3DQZA 2FPPB 4B75A 5KMGA 2POQX 3A9RA 3EZNA 3GBPA 4D57A 2DEUA 4GNRA 1JALA 4LJ9A 3EASA 1PZFA 1N7JA 3PJFA 5DSXA 2CMFA 1R0SA 2ZP1A 2QX6A 2BSXA 1Z6QA 3F46A 3AL0C 5DZSA 4ZIRA 4PBSA 4HN2A 2AOWA 3ZE9A 4BQOA 2YYAA 2OBLA 2D5LA 3FA2A 2SKEA 4NZYA 4Z1MD 3FWHA 1THZA 1GGEA 3FYDA 3IMCA 2JGDA 1JU3A 2XEDA 3L1VA 5A4AA 4WVLA 3LI2A 4N39A 4TSRA 3UANA 3LBAA 2AR9A 3HHEA 1JEQA 5AXBA 4M0KA 4ZJYA 2RK3A 1CUVA 2OV6A 1KYZA 4YPOA 3UUFA 2LDBA 1QZTA 3EB9A 1JJ7A 2MIIA 3GLTA 5FBLB 3DLPX 4Q66C 1CNFA 4AL4A 4FP9A 5E2BA 3PPXA 3QLJA 5CT8A 2YZ2A 4L3WA 3DR3A 3ZVLA 3WNQA 1XTRA 1IBKB 2H7YA 1BX3A 3DFFA 4OQPA 1K89A 1SCQA 1CKEA 2Q6KA 1U7DA 1ZKMA 2P1RA 1R0LA 3P9SA 5FJIA 1RTKA 2WJYA 4AMGA 4YP7A 3TZHA 1FRNA 2VTBA 3M9XA 3RS7A 3HR8A 4LSGA 1ZJ5A 1KR5A 5SY9A 1ZKDA 2GVZC 3KB6A 3MFQA 4YLEA 1LGYA 1K8QA 4F85A 3UK7A 4TWIA 1Q5PA 2VPTA 1GU1A 3HO6A 3LA6A 4MKZA 4PLPA 3ZE7A 2C9DA 3NM5A 2GF9A 2I99A 1WEKA 3E9EA 4OQLA 1YTLA 2BGUA 5HR5A 1POXA 5JJIA 1ZH4A 2IS4A 4IGIA 2WICA 1QTRA 3M2TA 1JHUA 3EFBA 3CTPA 3FZGA 5FWAA 5DGTA 2V3VA 2AFIB 3BKWA 1AKTA 5K6TA 1TEVA 1L5WA 5IPFA 1W46A 4RXTA 1T2AA 3JATA 1XG5A 3P96A 3EUEA 3R6TA 2FPIA 4KN5A 3JD4A 3ANXA 1NRJB 1YK1A 3HM9A 3K9BA 3KAKA 2EBWA 2OILA 1EZ1A 3MM4A 4KE8A 5H4HA 2UZ0A 4MYDA 3NO4A 1V1JA 4Z2AA 4ZI7A 4V0KA 1DJOA 3BGWA 3LX8A 4OAQA 3TYXA 2WHPB 5KYVA 4RY0A 4WLOA 1KNXA 5L3SB 5C80A 1PS0A 2ZAIA 3K30A 2VAPA 1X1TA 4KXUA 5C5IA 1U0NA 3BIFA 5TX7A 4DDHA 4JSYA 4HZGA 1R00A 1P7ZA 3JASB 1COZA 4GZ3A 1C0PA 2Y1EA 3MPUA 4IAOA 4IZIA 2WFMA 3IBCA 2GCGA 3NEJA 3NNSA 4I8IA 3L84A 3TS1A 5IJZA 5FO0A 4CF7A 4RMHA 4HYTA 4KGVA 3BWYA 3I42A 5AOAA 3O8NA 5EY5B 3ZHSA 3O38A 4G5GA 1PUJA 1FXSA 4L6AA 4UUBA 1T8YA 1U2QA 1ZOIA 2QYOA 4RPIA 1ANKA 1U5CA 4KVGA 3CH4B 1FU8A 4ZQEA 5C4IA 4PGHA 1AMUA 1S89A 5HVNA 2CLKB 2WWHA 1N8TA 4A1OA 1FCJA 1L5VA 1GGJA 4N7JA 3IBSA 2VO1A 3OCYA 4GKVA 1TUBB 3SZGA 5C8VA 2WIJA 3WNCA 4QJ5A 2VP6A 2R11A 4R7TA 1LA2A 1O6CA 1XLTC 4RJLA 3HCRA 3DULA 4XD7A 1H23A 4RC9A 4Y0AA 3CWCA 4BGDA 5HKKD 2QG4A 3JWIA 3WFIA 3T38A 1B15A 1DRVA 4JKIA 1PL0A 2EF0A 4EZEA 3EIUA 5AW0A 3GH1A 3L79A 4LVNA 2ETVA 3D7NA 4TTAA 5FOTA 4QU9A 1Q0TA 2IITA 4YWHA 1C9EA 4CRWB 4R41A 3VMMA 2EG9A 4YS6A 2CMDA 3JYQA 3AHHA 4NJMA 1GQQA 4PCUA 1OA1A 4Y1RB 4DQKA 2EL7A 2WV9A 4RLSA 5DLYA 4BVBA 2JA1A 4BLSA 4UHFA 3FD8A 4KRFA 5EJ4A 1S4QA 2P77A 4LCJA 3EWAA 2HQOA 2OYSA 3JQ9A 4B2LA 1RBMA 2WYHA 2NZJA 3BMNB 2QQGA 4I36A 5DISB 3V7NA 4DC0A 2HDHA 2A5GA 3Q7IA 3H9GA 2JJ1A 3EZFA 3C7KA 1QU3A 3NEAA 2VNAA 5BUZA 2GN8A 1JE1A 3BFVA 4Q6BA 5L45A 2K7FA 1D1PA 3C5VA 3OOYA 2C2HA 2YCLA 4L8YA 4QUGA 3EZ2A 4IHJF 1WW8A 3U0BA 4HH3C 5AVTA 2IY9A 2ZI6A 3PF8A 4EKEA 3CH6A 3MA0A 3RASA 3WZLA 1X39A 3T61A 3PD0A 3KKQA 3L0IB 4ILEA 5ES4B 3BTSA 4XIIA 3FDFA 4GO1A 3H9BA 2OCIA 1M76A 4FD3A 1N7IA 1NRXA 2B8EA 4WCFB 1BQ3A 2R8OA 3NWBA 4BFSA 3L04A 1N92A 2P3OA 2ZJ3A 2WJJA 4X71A 4CM7A 3A4YA 1ZUD1 5UKDA 4F4IA 5IWAB 5JAOA 4FR0A 3KQOA 1IB0A 4MIOA 1P2VA 2NVUA 5DHFA 4XVRA 3BD8A 3STHA 4N5NA 3MJTA 4HNTA 5E7QA 2DHEA 3CJQA 3QMMA 1R66A 2PYZA 3A1CA 3OIDA 2ICAA 4M8SA 1FYDA 3ZIAA 3ZLVA 8MHTA 2WTEA 5FO1A 2LPMA 4XUEA 4CCYA 1FUUA 1KFJB 2LDXA 1RRPA 1D09A 4BQRA 3PDIA 3DEFA 4GC5A 1CJUC 1GKIA 1PN3A 1SCUA 2QRLA 1SXIA 3DM5A 3F5MA 4YRQA 4U2BA 1J22A 3WBJA 3OMLA 3ZDEA 5LB4A 4BE4A 4P1ZA 5KINB 2BTQA 2YXDA 3GLKA 1G5TA 3PRKE 4BX0A 1PS9A 1UK7A 2W0MA 1YQXA 3SS8A 4U3JA 1MXFA 3GRZA 4BUZA 3O8CA 3FI0A 1JQBA 1FTSA 1XXLA 4N3AA 2JBWA 5DPMA 3WZ2A 2XLBA 3O90A 3TRFA 1A5TA 4OB6A 5BWNA 3FWKA 1ZD8A 1L7OA 3DEKA 3TDKA 2GN0A 3R40A 4LJ7A 4BNUA 5IRCD 3BKXA 2HMSA 3FTNA 1UZUA 5AHRA 2A0XA 3UENA 3ZG6A 2O3QA 4EJSB 1C3OA 1Z73A 3JD3A 1S2LA 2PT9A 1TYBE 1AXGA 2X6QA 4R5MA 4XEHA 2FFHA 1AH2A 3H16A 3W5CA 2PJDA 3CFYA 3FWPA 4GYYA 3USCS 4HH0A 1JG4A 1NRWA 1AKWA 4J7AA 2JIBA 4X3OA 3RC3A 1NBMD 2FZEA 2CSXA 3MGCA 2VSOA 3PDUA 3KQSA 3AEUA 1NP6A 2YYZA 3DB2A 1ETUA 3Q12A 2DUJA 2F7SA 1DX4A 4FX2A 1IMJA 3NH6A 4WMLA 5HWSA 4OFWA 1WY5A 5T6MA 3KDSE 3CPJB 4O2BF 3PFKA 1R4MA 3V1YA 4FC7A 3BT7A 2FSSA 1CF9A 4R2WA 1JEYA 3BXHA 3GOHA 2VUIB 3JRWA 3OA2A 3K0KA 1GGVA 2D74A 1FRZA 1X7YA 4D6XA 1CK4A 1G9XA 2FPLA 4KIWA 3AR3A 2ZM5A 3THXA 2ZT7A 5G02A 1GVNB 1J06A 5LLDA 5JFGA 4QECA 1ND5A 1PJCA 4Y6PA 4EVIA 4NHEA 2VK4A 4AK9A 3K1TA 5GV7A 4FEEA 4ZN6A 4S0ZA 2QQEA 3S2FA 1MUUA 3FHLA 3WB0A 1WUKS 2FB9A 5ALYA 3X1WA 3RARA 2QT1A 2OLKA 3QFFA 4QA9A 2K87A 2Q6TA 4MGZR 4GZ5A 4ZOLF 4PXSA 2FN4A 3GFSA 4CIWA 1QH9A 4UZEA 3PNLA 3W8EA 1N5MA 3SIRA 3V4SA 3VR5H 4RV9A 1W4LA 3I5AA 3IAHA 5FPKA 3IKTA 2QQ5A 1SFRA 3CWQA 3L8EA 3J7TA 4HB3A 4MB6A 3DCJA 3QH4A 5IEJA 2PRZA 2C4NA 1Z4MA 1RYEA 2EKZA 2P6MA 2VH2A 2XWSA 2J3LA 2YN2A 3I23A 3LECA 2C1ZA 1Z38A 2QI9C 2D2FA 2I4OA 2YOFA 1MV8A 3HACA 1T1RA 3CO0S 1X7ZB 3S40A 4AZ3A 4C5BA 3JWHA 3H87A 1GUFA 1F14A 3TB6A 1ISPA 3RTGA 4X97A 1C9DB 1K86A 2IUTA 3KKZA 4ND3A 4NESA 7ADHA 2V7EA 4K40A 2XZOA 3G9ZA 4UCQA 5CNKA 4WN9A 3FUWA 4I8XA 1XROA 4ZEWA 3NHRA 2ZRLA 1PVOA 2HSZA 1BU5A 5C1DA 2YV5A 4PYNA 1EG2A 5LMUB 5CTAA 3Q98A 4O4JA 5DWVA 5CM2Z 3R77A 5C5CA 1M0TA 3RF6A 1H2AS 2OP0A 2OY0A 2PL3A 3GMTA 4PF1A 1XQXA 4JAVC 3ZY5A 5KQRA 2ILVA 1GL7A 3EXHA 1KF0A 3VR6A 3M5WA 4CT4B 3NTUA 4OI0A 4J0DA 1LY1A 2ZREA 3QP9A 2NACA 1XJWA 4J2OA 2BP7A 4ROTA 2GCNA 4IH9A 1YE8A 4QTTB 5CJJA 4GX0A 4IDOA 4OBBA 5KNBD 2FETA 3CVVA 3MCUA 5LQKA 1JZTA 3NDBB 1U80A 4WZBB 3ZNQA 3JAMA 1Q1EA 1HE3A 3V8VA 2DC1A 4OCZA 3OQ6A 4L1KA 2DLDA 4X00A 2E21A 1WMBA 4ZT2A 1FFSA 2RC6A 3ANNA 2WYVA 1JPVA 3L02A 4FC6A 4BMVA 4D9MA 3REGA 3BS4A 1MABA 2FF5A 3ENVA 1P33A 5ULLA 2QDXA 2ZATA 3ETDA 2V6MA 3H99A 4O4IF 4TL8A 5C7IO 3IP8A 3OETA 4U1RA 2GBFA 3QMPA 3SC3A 2YRFA 1J1ZA 4PX3A 4MW7A 2ZT5A 2XVZA 3OE1A 4F9EA 1SIWA 5L7TA 5JQWA 1Z9BA 4KQFA 3TD9A 3L40A 3TIVA 1QIMA 3MNFA 1F6BA 2JIZA 1W7AA 3GEIA 4OHOA 1MO5A 2B61A 1VYUA 3IHTA 4WY2A 5LDGA 2B1QA 3G1UA 4I08A 2R1VA 1QXSA 2WQZA 3AR7A 3ZLJA 2HWYA 4UE2A 5SYMA 1R4NA 4F7WA 4D9JA 1GCUA 4YRPA 3BXXA 5EIXA 3ETHA 3ODGA 4L9RA 1YBFA 2BUCA 4Y6GB 1J8DA 2QR5A 2VTEA 2H9YA 2EFHB 2YBDA 3P27A 1UWLA 1E32A 2BJWA 3KSUA 4J0CA 4LYEA 3UMJA 2XB2A 2Y1OA 4KG7A 1OBCA 1ZCBA 3RLIA 3V8MA 2J4CA 1AURA 1UBJS 4PNPA 4F3KA 5CA0B 3O83A 2P9JA 4L9WA 5GONF 1OYWA 3CZCA 3HMKA 2W6PA 4G8BA 4EGAA 4AICA 1DFHA 5BRNA 4FN4A 5IS2A 2XGGA 5LOVB 1II9A 3VYSB 3ZW9A 2NMVA 3E9ZA 2AOXA 2H4FA 1QWSA 3I2JA 4HYEA 4I3GA 4PO8A 3O1HB 1G4AE 4FQ8A 3EXIA 5ECWA 3SJBA 5A6SA 1ZJ6A 2DE0X 4ID9A 5LZ7A 4K28A 1TQ2A 1FRFS 2AZMA 3M3HA 3ITKA 4KAAA 5BPHA 3RS2A 4EABA 1N2ZA 1BE0A 1HG0A 1UFOA 3D6MA 2ZJOA 3FDIA 4M0DA 2VJYA 5EJIA 2FEXA 4AO6A 2E5LB 1Y82A 3FYHA 1NJ2A 3IOEA 1U2RA 3HJNA 4PLCA 4M36A 1EUZA 3RYHB 1HV8A 4ZRNA 1UMCA 2RG7A 4WERA 1O87A 1IEWA 1TW3A 1KAOA 2RG1A 4LBZA 4BNNA 5JH7A 1NQVA 1P3Y1 3VDXA 2ODAA 2BZSA 1QIIA 4L15A 3BIWA 3UK2A 3N2GB 3NYIA 2AQKA 4KHZA 4UTVA 4KPEC 2HI0A 2QMHA 4FZVA 1U0FA 3IP6A 2X76A 3OFSA 3UN1A 3PC7A 2FN9A 5L3RA 4XCQA 2OCXA 1L5YA 2BR5A 3TW8A 3WDKA 1AA6A 1FDRA 3WFZA 3ELYA 3NVDA 3U37A 1WB9A 2C59A 4WUTA 3VR4A 1YFJA 1PZGA 3ZV6A 2X9LA 4NZ9A 2VHCA 1UC4B 1T3HA 2A7QA 2OP1A 4MVJG 3AVWA 1O94A 2IZ1A 2X0RA 3MLEA 2RHMA 4JVNA 4UQOA 3G0DA 2PO5A 4C2TA 4CEIA 2GUGA 4HNAB 1ZLXA 1K5PA 1G9TA 3I9FA 1HY3A 1NYRA 1CDEA 1COWA 1RRGA 2BDEA 2Z1NA 3DHEA 2PZJA 3MIIA 3LO8A 3CC8A 4CMKA 3VA7A 3L8MA 1JQKA 3V33A 1ZISA 2C9ZA 4JY7A 4AXXA 2CL7X 3ZHQA 2IDMA 5FBWB 1W1WA 1SIUA 3P97A 3AVVA 1X1QA 3T3IA 1YE5A 2PANA 3CKKA 5ELLA 2BFDA 4ZHQA 1NAHA 1RWBA 2BFFB 2CUNA 3RVNA 1ZNXA 2AH5A 3U4GA 1M1XB 3Q11A 4FFOA 2X2OA 4EAAA 1KTIA 4G5SA 4TMWA 2UZAA 2Q9BA 1HNNA 2M6SA 2NZVG 4DPLA 2VDWA 4D4KA 3RSOA 2O5EA 3RTAA 3M9WA 4IJ6A 3K3PA 5LSAA 3CT4A 1KGDA 2ZJZA 3KUUA 1PYDA 2O0KA 1MPTA 1S01A 2FZ4A 2O6LA 2PMFA 2G3YA 2HSGA 3GX1A 3PT5A 3GJ0A 3OX4A 3P2IA 4K87A 3DE4X 4LHVA 3T4XA 4D6YA 2FJUA 2A14A 2JDIA 4KCGA 4LG1A 3IRVA 2WD7A 2JRLA 1LFDB 1A8SA 1GNLA 4ENVA 3ZGYA 1BKYA 2VF5X 3UKJA 2RHBA 3NHJA 3LCUA 4HN4B 1G17A 3F0TA 2FCRA 5BURA 2EW8A 3ANLA 3ZHYA 4UHCA 1TEHA 3UMMA 1EK0A 3ABZA 1XTKA 2BELA 2WB4A 3PR2B 1BX0A 4NMMA 2CCGA 3F7TA 3PFNA 3R0QA 4D1YA 1DE0A 4LMBA 2J85A 4J3JA 4LHSA 4Q1FA 4BV3A 1WP4A 4QLBA 1G6HA 2DPGA 5FAKA 3EXHC 3MZ0A 5EE5B 5F7OA 1X94A 3KJNA 1YAHA 2IXFA 5GP1A 2J30A 1Q7RA 1TQ6A 4ALMA 4NOLA 1UANA 1T6BY 5T67A 3SBOA 4N8SA 4FGSA 3OJLA 2GF2A 2E4ZA 1L5OA 2NYRA 1BGVA 1RM0A 2PX3A 2JAHA 3COVA 4JODA 2JD0A 3DTVA 3S6JA 2JH8A 1QHSA 1YL6A 3BPSA 4WBXC 4X8LA 4RHCA 2FW7A 4ZFNA 1NVXQ 2SKCA 2AN1A 2BFMA 5SV2A 5B2FA 2X8JB 1UKCA 2PMWB 2UKDA 4AN1A 3ONDA 3TLJA 4D8XA 5ELXA 1V6AA 3HYCA 3E9MA 1V6CA 2VRBA 1W2WB 3MCTA 3OOWA 3QG5A 3T7JA 3H2GA 3HGMA 1TQ8A 3K70D 1FFDA 3AFGA 3ZHCA 3RSZA 2B83A 4BMSA 5TLSA 1W44A 1PG2A 3DHYA 1YNSA 4Z9AA 1NP3A 3PP8A 5ALQA 4TZ0A 1FYWA 1CF4A 5FD8A 3K94A 2CLEB 5JXJA 4JJFA 4DYHA 4PBRA 1KH1A 3PHLA 2C9OA 4M98A 3M6LA 3P19A 1W0KA 3JQ8A 3VR3A 4RGBA 4EELA 1E6LA 2BFPA 2GSWA 4NZZA 3KR2A 4REQA 1NN0A 1XAHA 2R6HA 3P9IA 5F3RA 1MHTA 3MCAA 3GVPA 5K0EA 1KPGA 1XWIA 4X20B 2CCJA 1CYDA 1E79D 1SG0A 2WTMA 3FLBA 5D5PA 3GGOA 4DR4B 4Q3AA 3D54D 4CEHB 1IB6A 1HT3A 3GT0A 2NO4A 3VNVA 2ZB2A 3GG9A 3GZJA 1CU1A 3TBKA 3EXG2 4BO0A 4KPYA 3FNHA 5DNCA 4I4IA 1AXRA 1EVYA 1MJ5A 2DBVO 2QD5A 2YL2A 4FOTA 4FNMA 4NRDA 1LBHA 4V0NA 3OWOA 1DCTA 1JHZA 1GPMA 1DAGA 3TQCA 3PD7A 1I4EB 1R5BA 3ONEA 2D00A 3ELUA 2FN7A 3DNPA 1NN5A 4RF2A 5D3MB 4B5KA 4UFPA 4DV6B 3KSRA 2CF5A 1A7KA 2I33A 1AK2A 3CW8X 3K0HA 1WQ1R 3DPUA 1IEVA 1TJ3A 4PWZA 1V7PC 5IDQA 1FB5A 1WSDA 5F51A 2J0UA 1UODA 2JKVA 1XOIA 2QOEA 1D0VA 3C7DB 3ICVA 3PRYA 4HMPA 3NIFB 3SQMA 4JDUA 1NUQA 4DQDA 1BWSA 2ZRFA 1Y6GA 3CLRC 1ND6A 1SBIA 3CUKA 4G0ZA 4U9HS 3ND9A 3LC2O 1QDLB 3QELA 1VL8A 4AMVA 1HYEA 3M3PA 4DHWA 4HXGA 2C82A 4PTZA 4JGGA 3KPUA 1DLIA 5EUBA 3T35A 3KOWA 1G19A 4B3SB 3IKJA 1DJPA 1E3SA 2ECPA 2QZPA 1U98A 1UKAA 3HJHA 3CVXA 3MD0A 2C84A 1X1EA 4R8LA 4IMJB 4NV1A 4QJIA 4YUXA 1AQJA 3Q6MA 1UMBB 1JJBA 1BTOA 3SHOA 4KYIB 2FA9A 3BDVA 4UCWA 1E9AA 4K46A 4UNRA 1GNTA 1P44A 1RS0A 3MCZA 2JFYA 3K6RA 1XE3A 4PSKA 2I9KA 4M53A 1JSXA 4Y9SA 5AW6A 1KEEB 2EF1A 2WK1A 2V6IA 1NR1A 3AYZB 3K0BA 2DWQA 4NOMA 1VJRA 3WV4A 1T9GR 3D3WA 1OYVA 5M7EA 4C0QC 3W7VA 1DO8A 1UPFA 2X13A 1DHRA 3FXAA 3LC7O 1ZA1A 2M6LA 3KETA 1KJYA 5CP8A 4E5VA 4RPHA 1CTQA 2ZJ1A 3O21A 4C43A 2NZ2A 4OI2A 2FWPA 4ECEA 1E5VA 3QKSB 1LW6E 1P45A 5I9NA 1X8XA 2QD1A 1VI5A 3LHFA 4QG7A 1B73A 1YJ8A 2ZS7A 1P3DA 1P0MA 2JW5A 3IUBA 3M4YA 1XPRA 2DPLA 1DO2A 2C5GA 3FWZA 3L7KA 4FONA 4M83A 2VK8A 1T8PA 1J6UA 1H8HD 2EFJA 5IW8A 4AS2A 4E5NA 4DUYB 4JIGA 2GH1A 2D06A 3NORA 4EY3A 4MV7A 2GYUA 2WJPA 2C7VA 3TL6A 4ZWNA 1U63A 2W22A 4BNYA 1LPNA 1OWNA 2O07A 4RLFA 1YHNA 1KA9H 4QRHA 1S3GA 2N1BA 3SZ3A 4PGAA 5LLSA 3LW7A 2GEBA 2E48A 3NHUA 3VOTA 2AEJA 4RULA 2PXHA 1NW3A 3MAGA 2XQFA 4K9OA 4DLKA 3S27A 3RSFA 1C3JA 2A1UA 2AMLA 5DM1A 1KJQA 2XUGA 2AOUB 2A9QA 3HUTA 2BJHA 4O02B 1T43A 1VIDA 1FFHA 1P2SA 4QDTA 1JS1X 3OQBA 4HDKB 1NBOA 3OZFA 4B9AA 2I6TA 2IS2A 1CQIB 3AFNA 2MCFA 2JVJA 4MO9A 2ZBDA 1P4HA 2WOJA 4CMIB 1HSZA 4F60A 3I32A 2VTDA 3LHSA 1QHIA 3ER9A 1JYSA 2WHXA 3GK3A 1PFUA 2VPYA 1NVDA 3KJIA 1BD3A 2Z5VA 3YASA 5CEJA 1T5BA 3ZIDA 2WHQA 3CR7A 2P6RA 1KNQA 3AM3A 1HX7A 4EA8A 3JQAD 4INZA 1HT1E 4MQUA 3ICEA 3H3FA 3JD2A 3N8DA 1MTOA 2B92A 2NNLD 3BWEA 4ZQFA 2IYUA 1YULA 4FW8A 1RQGA 2WF5A 4BO3A 2J3QA 1KYIA 3BTVA 1OX5A 1Y9AA 4UJ3A 3VAAA 5J1SB 1EWQA 2GEDA 1HGXA 4XB2A 3QX7A 1MO6A 5ERGB 4N03A 1JVSA 2CHEA 1XTTA 5HZGA 5CAEA 1J90A 4L2IB 3OTWA 5TGTA 2B7LA 2WFLA 2WSSD 5DFAA 2Y0CA 2O8VA 1ZJZA 1EFRD 2IYWA 2RI6A 2Q1UA 2H17A 1E5LA 1ZL2A 1FLAA 2ZBVA 3D4LA 2YWXA 2J31A 3RUAA 3H5RA 1UP7A 2ARKA 2I7XA 4ZCLA 3KHUA 5CLLA 1KRHA 1MFPA 5JS2A 3EXEA 1E3EA 4ZKDA 1XX6A 1GNPA 3NWOA 3WLJA 5EIAA 2VPPA 3BMQA 5CB4F 2WKSA 3LQQA 3GLFE 3N1UA 4KQJA 1N2IA 4JOSA 4UU0A 1JUDA 4AURA 2I67A 1PVDA 4PO3X 4UPEA 3IS3A 1HH4A 3L4JA 5LZ2A 1XVTA 1OUMA 4JU9A 4GR5A 3IHLA 1IJKA 1EE2A 3M7IA 4MUNA 4HCJA 5AK3A 4DCOA 2WWYA 5LMNB 2EL9A 1OAAA 1SXPA 1M66A 2X1MA 5AQ1A 1RPNA 3CPSA 3RHZA 3N6VA 1N8NA 1JIKA 2GSDA 2UYCA 4AX4A 5AUNB 3M89A 1ZIXA 3PGMA 1B0PA 2Q1SA 4NV3A 1JIQA 1KE1A 3KZCA 4E3WA 1EHCA 3DCIA 2J1LA 4QUJA 4RH1A 4IDHA 5KVSA 2W2VA 4QTYA 5EIOA 1L6IA 3B3QA 5FOWA 4I1SA 4LSMA 3C8HA 3TLGB 4OA8A 3O0DA 4IX9A 4YXWD 4ZEVA 3SIXA 4GT1A 1J0AA 4FIDA 2LUOA 1XQWA 3DHVA 5E1DA 5FADA 4Y2GA 1N1GA 2PS3A 2V4MA 4PTYA 5BSWA 3CPEA 3R5TA 2RDMA 4PQFA 1F8YA 3O3NB 4FFRA 3KQTA 4C4YA 4CVNA 3BILA 1ZUNB 2AJTA 1E92A 1I7SB 2ZW9A 2OKGA 1U7TA 4FE7A 1M1UA 1VHQA 3BWVA 3CV3A 5CVVA 5DCUA 2I71A 3OPXA 1F3LA 4MARA 4CDGA 3P5BA 1UDWA 5EHQA 7REQA 1U2GC 1D9ZA 1NL3A 1R6AA 1X80B 3GT4A 1YDHA 3CYFA 3A7DA 4XIYA 5CT9A 4YMUA 1CY2A 3OIWA 5DEIA 4DSOA 5BNIA 3QBJA 1RE1A 2H63A 1P4JA 1O5TA 1G8FA 2HLDD 1L6RA 4HTFA 3ZHRA 4CLRA 1KAEA 4ZCQA 3IPCA 5AJVB 2BEUB 3Q10A 4UQPA 1NFRA 5IXJA 1ADFA 3IODA 3CRZA 5AKJA 2JGFA 3UY4A 2YJNA 1DELA 4P3OA 5IJWA 1LEHA 3JD0A 5J43A 1ZRHA 1XVVA 1KZHA 4G4SP 1A9YA 2UDPA 5G0WA 1AJEA 4B4VA 4N41A 4LZOA 3W5HA 3R7WA 3QV1A 1WETA 3HJCA 1LCIA 4D9CA 1GLNA 1VLHA 3S8MA 2HAEA 4P31A 1QFXA 2ZIFA 2IIVA 3FN4A 2OEPA 1C9MA 4NL4H 4UVEA 2DTEA 2V7QD 3CW2A 3C0KA 2YJ3A 2Z6UA 5G4KA 5TC4A 1GILA 1J1UA 5BOSB 3ZTWA 1AUVA 1CQWA 1LSJA 3SNHA 2C2GA 5I51A 3DM9B 4XE5A 4U7PB 5CFRA 3CY6A 3S2IA 1EJ0A 4IGKA 2WAAA 5K01A 3ETNA 4A0GA 3ZCRA 5ESDA 2KBFA 1UADA 5BN1A 4LX0A 1F0YA 1DT3A 4FOOA 5DXJA 4YJHA 4MQ4A 4RGYA 1ORHA 3D4NA 3QPVA 3CISA 3UB2A 1J99A 1K5GA 2GTIA 2I66A 4H59A 3OHMA 3UW1A 2IH4A 1UDCA 4FMDB 5KYXB 1E2JA 1S1MA 1CUGA 3DBRA 3JR7A 2X8AA 1BVHA 4EPXA 1DTEA 4BUCA 5LYJF 4HUQA 3EYWA 3TK1A 5IULC 1JB1A 3KKPA 1AQYA 3FUXA 3KYIB 1ZW1A 4PSCA 1X9HA 1HEUA 4UBNA 3H04A 4EQZA 3X3HA 1WKVA 3VSBA 1OZ0A 1ZJ4A 2B1RA 4B1FA 3DG9A 1MF7A 3UJHA 1SXGA 1SHTX 3OT1B 4MLDA 4BCBA 1V3UA 1UM8A 3KJGA 1G66A 4MV1A 3IBYA 4IIJB 5H82A 2RGYA 3TL2A 5D7BA 1NI5A 3UWSA 3HS3A 5IN4A 1E9RA 1GG2A 5JSZA 5A6VA 1WCXA 4ZAZA 4ETWA 3THWA 5IVPA 4B8ZA 4UTNA 2O0HA 4KKXB 3B2NA 3HV2A 4Q9LA 4D0RA 2DAPA 2Q9CA 3INYA 2CVFA 3EF3A 1B0ZA 3PUWA 3S29A 4YXFA 1WVMA 5BVGA 3L4KA 2XXBA 4U4AA 2W6ID 3NHYA 3H1PA 4BE9A 4G0UA 1XDGA 4R8KA 1TVMA 4V1CA 3BQMB 4X90A 3DUFB 1X8LA 3IXLA 1KS9A 3HGTA 2ZYTX 2O8FB 4CKWB 1W29A 5IBPA 2ECFA 3H4TA 2PUBA 1NR7A 3RFTA 1U0OC 1SC9A 1SOUA 1IBSA 5K3DA 3DFUA 2UVPB 5H70A 1A4RA 2UAGA 3S99A 2QLBA 4ZGBA 2AOTB 5D1NA 2XPCA 2H7VA 2P5SA 4G0XA 3RIGA 5KSOA 1NVWQ 1AY0A 1D7OA 3V32A 2QM8A 5ALEA 2V7PA 4H7PA 4Q03A 4V3BA 5LA6A 5SYAA 4O4HF 2XDQB 3TSYA 3DFZA 3K9WA 5T8KA 3PHBE 1YB6A 4MKFA 3L3BA 1LS1A 3KL2A 5B3AA 2ZTUA 3Q0EA 1N6PA 2OENG 2GM4A 2QF7A 2Q6IA 3G5AA 4MINA 4N0PA 3H9JA 2YC4C 4MPPA 1FP6A 1A8PA 2BMEA 4MWCA 3FROA 2HSJA 1ZSVA 4MVCA 1Q83A 4R6XA 4TUYB 1HDOA 4EYSA 1XZNA 2YIVX 1CP2A 3K9NA 4MV8A 1T29A 4WD3A 3MGGA 4G4SO 1Z75A 5TQ0B 5LP1A 1UINA 2FI1A 2MINB 5DBOA 3HN6A 4M0PA 4ZVRA 4YRGA 3HJUA 3E9RA 1ZBQA 3L5KA 4Y9UA 1RC8A 4NBLA 3ENNA 4DMGA 4EY4A 1IUPA 4EFKA 4CIAA 1IK4A 1U2SA 4R40A 2LKDA 3ZLBA 3VAZA 3C74A 3DQPA 3DMTC 4AY6A 2D3TA 1G16A 2G9RA 4XPZA 1VJ1A 3WGVA 2D0PB 4TLLB 5HKOA 3WL8A 2H0AA 3OZVA 2HIHA 5JPDA 2XUHA 4I81A 2WU0A 5HZKA 1DADA 5U1PA 2ERCA 1ZICA 2IH2A 2XAAA 2YWBA 2HHAA 2XWBF 3ZTTA 2BEWA 1J97A 3DFKA 4OXXA 5JCOA 5HX7A 3H1BA 3ZCPA 1N1DA 4NYMR 3PPVA 1MNQA 4RYLA 4U5QA 5HK8A 3QEMB 5KB3A 3KOOA 3R6GA 1CY1A 4P8RA 1EGVB 3A32A 2PEZA 3QUSA 4LV5B 4OQ4A 3MRXA 1ZY2A 1CFJA 3H18A 3D7LA 4PYKA 4YASA 3PHHA 5CFZA 3GRVA 1C7IA 2XCTB 1N33B 1H4VB 4B3BA 5GJCA 4I4TA 1Z07A 3OE7A 3OO1A 3IUQA 3I4CA 5DSZA 1V71A 4EITA 5CT6A 1TADA 1N6NA 2GPJA 3ZNNA 3BVPA 3RJZA 3ZZ1A 3CVJA 1XXHB 2ZITA 4BLUA 4LZLA 3I5XA 1WUIS 3RTCA 1HSOA 3QLVA 1MO4A 1CJMA 4OHPA 4BX9A 2DYKA 1GFIA 2P75A 1W5FA 2Z4TA 2XYGA 2PR7A 2QW8A 3O3MB 4X7RA 1T8RA 4FFLA 3NGMA 4QUEA 5DNAA 2IF0A 2NSHA 1RPJA 1P62B 5E7MA 4M0EA 2HDNB 4CM8A 5FOQA 1QQ5A 4TLEA 2CYCA 2PTHA 4ZT5A 3IP5A 3MUOA 2VYQA 4JLAA 1SUDA 4MYTA 4DIKA 3G88A 5EWMA 5J2UA 4RD3A 1U0GA 1ZDMA 3DFMA 4E5MA 5C8DA 4IXDA 3GN1A 1BXGA 1GTJ1 4QC2A 3T7AA 2J45A 1F8GA 1N7HA 3OLZA 4JROA 4M37A 4IO1A 4LC1A 4FW9A 3CE6A 3O1IC 4ZA2A 3TEMA 4DSZA 5M04A 5T4FA 1BWQA 5EVJA 2L18A 1XK7A 2VYNA 3ZHVA 2B6NA 3LGAA 4LRSB 2VEDA 3K31A 4OJTA 4DA4A 4XFDA 4HLDA 4I55F 1OT5A 3QFRA 1KPIA 3W9YA 4ZJUA 1PT9A 3IQWA 1UXGA 2ZJ7A 4MI3A 1ZH6A 5J4VA 1VHTA 1Z33A 4Q4LA 2IPNA 2A5LA 3QBEA 2RHTA 3ZXYA 1T2UA 3WLTA 2IXGA 2OBMA 3VYWA 4UC0A 1V4NA 3QUQA 2E1RA 2NSJA 1KYTA 1POWA 2F3UA 1FVHA 3K6KA 1IXSB 1T6ZA 4WDQA 3JXEA 4JX9A 2R8BA 4MGIR 4XPIB 3ZV5A 1I1OA 1TMKA 2HU8A 4E4TA 1IUOA 3WLPA 4Y0NA 2R8EA 4R16A 3VYRB 3TQFA 1CLUA 4NX2A 4CJXA 1L3CA 1M1NA 5M3BA 1HWYA 2XVXA 3QTTA 2XMGA 1QE3A 1XTVA 1HDRA 2J0QA 1OXVA 1RLMA 3F6BX 1EDBA 4TV8B 4GLBA 4EHHA 1BG6A 1BJRE 3ZS9A 3N86A 4HX9A 1TCAA 2BBWA 3IB6A 3N2KA 2A1TS 4HAWA 4HWSA 5KNCD 2AMFA 1QIFA 3M81A 1OTXA 4YC7A 5H02A 4B6GA 1Q14A 1M8GA 5KTYA 1S1CA 1LSOA 3K1JA 1E2DA 3N6RA 3PZBA 3PEYA 3K32A 1B6RA 1BH2A 1VPWA 3LQRA 2VJBA 5FWDA 5JO9A 3L41A 3WWDA 5JW6A 4OFXA 1Z3CA 5A05A 1TTHA 3PWTA 4DT1B 4E2ZA 3PFGA 1KK1A 1TYAE 2BMAA 3MLAA 4MQEB 4HQFA 4KUEA 1A72A 4TXHA 3G82C 1B8NA 1VL2A 2AMVA 3VPGA 2QJOA 4Q7JB 1RLUA 2CFCA 3LNTA 5HF5A 4TLBA 1HZZA 1RC0A 1WS6A 1YOBA 1DAMA 1LV7A 3LT4A 4LBYA 1WX1A 4YONB 5G0VA 3T0FA 2XTNA 2XUQA 4CG2A 1CNEA 1I6KA 1K6JA 4L6CA 4WN3A 1ZOLA 1P4RA 4M9CA 1GYPA 4JQYA 2V96A 4GQBA 1R8JA 4O2AB 3C41J 3HJGA 1EBBA 2FPSA 4MUXA 5DW3A 4BBPA 5EHIA 3IMEA 3WJ7A 4B76A 4TTJA 4IIHA 4DQXA 3ZCQA 3HCNA 1LRJA 4HAXA 4EFNA 3KD3A 3DVRX 3ER8A 1QHNA 4WK4B 4D9NA 2H1OA 4NE7A 4RA9B 3BHJA 3STVA 5E2AA 4F92B 5JANA 4BNDB 3HZHA 1TM2A 5BNFA 5ESXA 1V11A 5EE3A 1GUDA 2DY1A 4LS3A 3O47A 1IPHA 1H9AA 2WJZB 3HB4X 3OFNA 3W6UA 4B45A 1DC5A 1NURA 2WABA 1N9KA 3AHDA 4II2A 3QA9A 4Q3EA 3NOQA 4X66B 1HOTA 2VDLB 3FF1A 1WIWA 3KUDA 3MJSA 4CL0A 3UFBA 3GZTB 5EKTA 4YCSA 3VJLA 1BVRA 3RPEA 3REQB 2YWDA 3TW6A 2Q6LA 3W1VA 3ZDYB 1OR8A 3HCDA 3Q88A 4WZAB 4PN3A 3IXQA 1MRZA 3FNRA 1W36B 2QG6A 3GYGA 2RIRA 2WU3A 1W85B 2HMWA 2YFYA 3DJYA 3O93A 4HPJB 2PA3A 3EYAA 4XJTA 5GOZA 3PUYA 1YZYA 3DDWA 4MUYA 4HRAA 4QRDA 3D8UA 4BQQA 4BFXA 5IAGA 1H4QA 1WUTA 5JNRA 2YWFA 4RZUA 3PHCA 2OZLA 1NUAA 2WM8A 2ZVPX 3F49S 1MD9A 1JDBC 1J09A 2B37A 2QX8A 2R6DA 2PPVA 3O3CA 1LPOA 4GAEA 3MBKA 3DZKA 1I3CA 1Q1QA 4P81A 2VAMA 1P5JA 4KRXA 1TC2A 2WZBA 3A28A 3ILVA 5TT1A 5DBGA 3THYA 1AZSC 5BQ3A 4IJQA 3NBMA 2AJCA 5DOZA 3R74A 3UBMA 1KRWA 4DV3B 4QGBA 3O7MA 3M0EA 2L82A 2JCGA 3FG9A 2PNFA 1EUCB 4INJA 3F8TA 1S4MA 3ZE0B 2ZI7A 3BH7A 2C54A 2QMYA 4IMPA 3FDZA 3UAWA 4A82A 4D0GA 1K88A 1PDVA 1SVIA 2WD8A 3DWGA 2P9BA 4BXOB 3G0BA 1U2EA 3ECAA 1VJTA 5F1OA 2VQEB 4BQNA 2XW6A 5BMOA 3T54A 4E3ZA 3K72B 5ADVA 4Z0TA 4MVWA 1KVRA 4BNHA 5A4IS 3HV0A 2WMYA 5ALSA 2ID7A 2VP0A 4IV8A 4LXXA 1HEYA 3GRAA 2JFZA 3ZGLA 3ADBA 4U0KA 1RSZA 4TTSA 1KI9A 2N75A 4RESA 2XB6A 4HRXA 2PD4A 3CKMA 1SKYE 4GSYA 4KYVA 1V8ZA 1K6IA 1WPQA 1QIKA 4KUHA 1SKQA 1HFEL 1SQFA 1Y1PA 1Z2EA 3O8BA 3ABRB 5IDXA 4C7OB 4GYWA 1G8YA 4DTCA 5C37A 3U13A 3KKOA 2FRDA 2QY6A 2JGEA 4N9QA 3EIHA 4KRGA 1AQIA 1TF2A 1WCWA 3SYTA 3VR2D 2XCIA 1U0SY 3NFYA 3H1FA 3IAFA 3IALA 1GZHB 2OMKA 2XR1A 2Q50A 3SYNA 2QN2A 3Q5DA 1JN0A 2FLWA 1XZBA 2XOEA 3NETA 1HZJA 1QYWA 2HNKA 4I7EA 5LUAA 2MYNA 4QEKA 5KTSA 1TM5E 4MICA 2PWPA 3LY7A 2J7PA 1MVOA 3B9BA 4V39A 5BSGA 3OTOB 2QMEA 1UDBA 4KPUB 2A58A 2PK3A 1YQGA 4ZGGA 5BR4A 3DE3X 1JL3A 4CMCA 4EMTA 1NG9A 4FCVA 1CZOA 4CQNA 2BGNA 5JTTA 4LVUA 121PA 2E55A 4L4UA 3OCUA 3OQ1A 4M88A 5DLQC 2B8NA 2D4AA 5H3HA 1U7PA 4FNOA 3IQIX 4N6OA 1NI4A 3AR9A 4B82A 4NSNA 1QONA 1RR6A 2BE7A 2GD0A 4QUIA 1J70A 4IIBA 3N0XA 1U90A 4MUGA 2P9EA 1M7HA 4IDAA 1PU2A 5B2EA 1UPXA 2HHLA 2YHIB 5KVQA 1T6NA 3AKZA 3CLSC 3O7WA 1G8PA 2JAPA 4R1MA 5ALOA 1Z0UA 5JEDA 3QU2A 3UJNA 2FEOA 2GBLC 1XMVA 3EVFA 1KKLA 1U7UA 2C42A 4I5EA 1IN5A 2VKQA 1PF7E 2P2CA 1UWCA 2E4VA 1B3BA 3QVTA 3VPCA 1Q6YA 5J4HA 2VIIA 3QWAA 1ELOA 4BNJA 2FQ1A 1M8JA 1YKGA 5THKA 1MX1A 4ZVPA 3MS2A 5SZJA 5A3JA 5EJ8A 4Y67A 1JKJB 5DSTA 4NCAA 2BEVB 2C4UA 3OPVA 1C3LA 3IUPA 2I80A 2BJVA 2JIRA 3MOSA 3DXXA 3PVZA 1W5TA 1A27A 1GKYA 1C81A 1YB5A 2W7TA 5C7YA 4ARAA 3L01A 4GYJA 3OPYA 4UEOA 1J0BA 3B89A 1XJCA 2X6TA 3U0VA 2EBUA 2ISSD 4RPJA 4CM5A 3PDWA 5JRJA 5KSWB 2ZDHA 3UQZA 3ZCTA 3N7UA 3I6QA 5CBPB 2OCLA 1JYEA 4OHZA 5BV8A 2AEFA 5EINA 4FHGA 1KQPA 1JILA 2CWWA 3A3NA 3EQ7A 2YXEA 4IV0A 4TM8A 4ZODA 1XEXA 2ZYVX 5JD3A 1KE2A 3GEHA 4X1KA 1F0NA 3M6WA 4QQNA 1E6MA 1TJ4A 1TK2A 3CQ9A 4IDQA 4KOAA 1ACMA 4YCNA 1KMHB 2O2IA 3LY8A 3NH9A 5ALUA 1UBLS 4BZQA 4P2BA 3LL4A 2ZSAA 3HJBA 1Y8AA 1AV7A 1XRMA 2WWGA 1QIHA 3BCHA 4GPEA 4F6RB 1GDTA 1AVTA 4POAA 1BDBA 4WJKB 3GPCA 2CXOA 4X6LA 5E1MA 4QE3A 4N5IX 4IDEA 5JS6A 1PT8A 1NQXA 4D74A 4Z7QB 2FUNB 3WJAA 1T9AA 3KTFA 3N3BC 3VR4D 4B43A 4M54A 1X87A 4CV1A 1B14A 2XE4A 1WCYA 2ODTX 5AK0A 2Z6AA 1MAUA 1H8ED 2G08A 4ETNA 2XODA 3LW8A 4F9GA 1O94D 4MB2A 2VAVA 3BJIC 4Q4HA 5BWOA 1IFXA 4IVRA 4JP8A 1Q0SA 4QODA 4MI1A 4PAOA 4PLWA 4WA7A 4YRIA 3V8EA 1Y6FA 4NV0A 3DF7A 4YAEA 1XLUA 2DP4E 2D5IA 2QP3A 1MQ9A 4Q16A 3SE7A 3HVRA 1XFDA 3R7SA 1HTWA 1ZONA 5GJWC 4PINA 1TT5B 1CE8A 1PGOA 3MWJA 5LNK6 1OLXB 2AFHB 4B3MB 1PR3A 5AHWA 3NOXA 4EI2A 3DP9A 4H3SA 4MS1A 3MJHA 3T3NA 1IIBA 3AUXA 3H6HA 4TS9A 3BTUA 3ROFA 3RJ5A 3DPIA 3A6FA 3UNXA 3W6ZA 4JLPA 4D7AA 5I7EA 1EP2B 1NMXA 3OQIA 2W58A 4OHCA 5B58C 4M1TA 4DV4B 3BBLA 1IWOA 1HFJA 2XXJA 3GJ6A 3F4BA 3Q1KA 4NQZA 4CM4A 4OGWA 3ZWWA 1XDUA 1UIRA 5KMGB 1V2HE 4RKYA 4TX1A 2HLPA 3KBOA 1EGMB 1C5KA 3PRJA 4UBJA 5E4JA 5ELMA 1JAXA 1VE5A 2PVSA 2IEIA 4MVJD 3V00A 3SF0A 3IVAA 4FJ1A 2PS1A 5COQA 3TWOA 4ANFA 1Q6ZA 4G5RA 4ND1A 5HILA 2B0CA 3RBXA 5ENDA 3DDHA 2BKAA 3SLRA 4ZIRB 4IDDA 5TGZA 1SY7A 1RWVA 4I9HA 4HDSB 1JWAB 3G2IA 2RAUA 4DJJA 4V02A 1B8VA 1LK7A 1BDIA 4C88A 3RU3A 1V8PA 2OVFA 2QUHA 2FLVA 2ZDGA 3I9MA 4HGQA 1VFPA 1IZ0A 2HA0A 4QNNA 5DXFA 1USWA 4ZOAA 2JGDB 1KAHA 2X58A 3B7WA 3OU6A 4Q9JA 4C7KA 3SXUA 4QDOA 1N9GB 3V1TC 1JEQB 4M86A 2NU6A 1OJ7A 5HSGA 3IE0A 3RC8A 4DLPA 2G8LA 3H8VA 3LIIA 4I4CA 3O8OB 4RCYA 2WWVD 1DC6A 3EODA 3E1SA 3H6KA 2TMGA 5G0SA 3BJMA 2MTBA 4GBMA 5B1HA 3U4CA 1C4OA 3AF0A 5FH9A 2GPNA 2ODWA 4OL0A 1YUMA 2R7LA 2Z2XA 1MORA 4C4SA 1IIRA 2TMKA 5FEUA 5FL7D 2FRDC 2X8BA 1P19A 2Y4NA 2JLUA 1AZWA 4Y1GA 2C97A 3BXFA 3BRWD 2IYNA 2BHNA 2ZYUX 3CRRA 3GFQA 4F71A 1WP9A 3DTVD 4X6YA 4LHWA 4GOLD 1OREA 2VTBB 2AWNA 3BG5A 1AT1A 1WXEA 2JLQA 2ZQYA 2V3CC 5CITA 4Z7OB 1TYCA 1XEWX 3KLPX 1DZIA 3PC3A 2CL0X 2BT4A 4MUBA 1H3FA 3IAS6 4X7BA 4EQ6A 4G9BA 2ZSDA 3GARA 5DNYB 1GXSB 2H54A 2VCHA 2X4GA 3HXLA 2GEFA 3F9RA 3Q7RA 3KQYA 4IS2A 1KEUA 2VJLA 4R9RA 1Z6YA 4W8GA 1ZMBA 4TLMB 1ZK2A 4C5CA 2EBFX 4GRIA 2XTMA 3VQTA 2RGRA 3I0ZA 2VXBA 1IBLB 1QBKC 2GRAA 3DVLA 5U4XA 3B52X 2FPKA 1L5KA 5A9SB 3HBMA 4L75A 4F6CA 1MJGA 3JATB 4DPKA 3HMQA 3LDFA 2GARA 4UREA 2VT2A 2FPIB 2FUCA 6ADHA 5K0ZA 1Y6JA 5FWNA 1SCNE 2Z04A 3DVSX 3NBUA 1EX7A 3L8FA 2XXAB 4OQFA 3VR0A 1QP0A 1A04A 4ZI7B 4OEHA 3ED5A 1OAOA 3D5QA 2XUFA 3FKSA 5DVZA 4N0MA 4E11A 2UXDB 3IAXA 1C1HA 5FBVB 1XVAA 2JC3A 1G5RA 4CMEA 4KPGA 4BWVA 3KO8A 2QAGB 1EFHA 4FEAA 3RVQA 3TCXB 2VK2A 1LDEA 1USUA 4O25A 3UBTA 1K97A 2G5GX 1DBVO 4AJOA 2OR3A 4HAZA 2GJ8A 5KYKA 3TMKA 3GYBA 4P3XA 2O7NA 1DJLA 2JI6A 2VT6A 3CRNA 3LLUA 3QF4A 4HO1X 4Q3OA 3X2EA 5KREA 3RWBA 3WS7A 2ZJAA 4DV2B 2J6IA 3AGPA 1WV1A 3BWBA 3CBQA 3BIXA 3BL6A 4R9NA 4WZ6A 3TTTA 2A30A 3ZX5A 3LLVA 4RA6A 16PKA 1STOA 4LOIA 5K8JB 1AIPA 1KMCA 4B48A 4IF4A 1IN6A 1W9HA 4R98A 1JDTA 3UJPA 1WOYA 3O4GA 5IYZB 2GXQA 5GM2A 1GZ3A 1HLDA 1TPYA 1SK9A 1ZAKA 2H1HA 3AHCA 3ELBA 3L0PA 4C0LA 4YQFA 3D6UA 1T4MA 1KBOA 4UUMA 1TO2E 2XGSA 3FX2A 3JQFA 2VJKA 4INPA 3JVVA 4GHWA 1EQ2A 3H13A 3L5OA 4XIGS 2OK7A 4B4DA 1PGNA 1T10A 5CJPA 3ZWNA 3ZV7A 1I9CA 3QIAA 3WQBA 3MWFA 5KOJA 4P7JA 4A6PA 4DYVA 5FJJA 1E1KA 1CUYA 4OP3A 1DWOA 1G2IA 2GR9A 3QXJA 1S5PA 1YDWA 3IHWA 4WPGA 1T2FA 2FJ0A 3P2MA 1MDFA 5JAPA 2WG2A 4RD2A 4NJMB 5CVJA 1UXKA 1XELA 4F56A 3QKTA 3FPAA 1VPTA 4DSUA 1VG9B 3DD5A 6AT1A 3PUKA 2I2BA 2JFNA 1CB7A 2WKQA 3IFSA 2ZANA 4NJEA 1RD4A 5A4JA 5GVSA 3KQLA 3OCVA 3T99A 2XUIA 5L3QA 1PFKA 5LLTA 5SICE 3GFOA 1PJTA 1V4BA 2Y3IA 3AIMA 4JVMA 4WBSA 2AHOA 2CZGA 1Q84A 4YHBA 1VE3A 2C2MA 3Q9UA 3WWOA 3ZNOA 4JYCA 4EKIA 3HO1A 5BN4A 1QGED 1PDOA 1XRLA 1JQJC 1VHJA 2CHQA 2VEOA 4LIPD 4LQDA 4N6GA 1E0AA 1L7QA 1OZAA 5LZ5A 2GHQA 5KDOA 2JLRA 1A2KC 3WBFA 2ID8A 4RK7A 3T9CA 2IXAA 1OX6A 2ZR7A 4UHBA 4KIJA 5DTQA 1DTSA 1QC5A 1VL6A 2I2DA 2VYVA 3PNSA 1ES9A 1UMDB 2AEEA 3QUCA 4J0JA 4NENA 5FORA 3UG6A 3UHOA 5E3HA 4D97A 3MS7A 6REQB 4ZEMA 4Q4CA 3FGOA 2IZ7A 3GXOA 1GZDA 2IPAB 3R20A 1JAZA 2GT1A 3M1LA 4ME6A 4QGHA 1JQEA 3AF4A 4ZD6A 2OFOA 3NCHA 4PY2A 3HU5A 4LV6A 1EFKA 1YR7A 2NVUB 3LPCA 4S2EA 3LG2A 3L1JA 1YR9A 3GA0A 3C1UA 4BCCA 3N2EA 1O8BA 5EWJA 1ECGA 5CX1A 3TZ6A 3ZY4A 4F7DA 1WBBA 4KXFB 4PSAA 5D2CA 1PWHA 1YR1A 2F43A 4L5JA 4WOJA 3T4EA 3VPAA 2VHYA 5GADl 1RTTA 4CCYB 1BWPA 1BW9A 4IICA 4BTVA 4H0NA 2X86A 3W79A 5LQMA 4KDFA 4QBIA 1ZCZA 1H3NA 2WHRA 3PDIB 3WR5A 1RZRD 1MCZA 3BCRA 3NATA 5AKEA 1SCUB 2XVMA 1PD0A 2I34A 3W90A 4TZ6A 1EQUA 2ZOSA 3H0KA 3L43A 1XZPA 3K0FA 3VC1A 1ZK3A 4N48A 2AZXA 3EFOB 3FCCA 2PMDA 4WLEA 3PUJA 3AFHA 1GYRA 4U3JB 4YECA 4E7OA 3LAWA 4FDLA 1CY8A 3R3ZA 4EB3A 2PUVA 3ZU5A 4PV7A 1EGQA 3I09A 1CS4C 3SZRA 4DMCA 5M34A 1RKVA 1VPVA 2Q0SA 3GVXA 5BQFA 2JASA 3TUJC 4Z7JA 5DBFA 2Z08A 1GV0A 3NXKA 1C3OB 2W2KB 4ATNA 2ZRHA 3PD1A 4H3VA 3TXYA 1K7CA 2Q41A 3H11A 4K9KA 2NO9A 2BHSA 4J9VA 5G1PA 5LDDC 1R0BA 4P36A 1SURA 1XK6A 2AFIE 3FCYA 5B3LA 5LQJA 1RXYA 4QJ4A 4Z99A 1IZ9A 3A2LA 2V98A 1PJBA 1PUXA 3AEUB 4X3PA 4BJHB 2VF8A 2WJ3A 2AZ4A 4L0DA 2W6JA 1KFBB 4YMWA 4B40A 1PV4A 4BRSA 4WXEA 4CNQA 1NUPA 1R4MB 1W2GA 2V4ZA 3M6UA 3I6IA 2QRUA 1JEYB 4Y2YA 5HQJA 3BFXA 1BJKA 3HJTA 1P31A 2AVNA 2B9VA 5DT9A 3PUZA 1Q15A 4HB4A 1U6IA 1TRKA 1LRLA 1X7YB 4YMLA 1I80A 4QDXA 4N40A 3U26A 3MMZA 1O96B 1NVAA 1SKMA 1P2DA 1FFEA 1IN4A 1V3VA 1Y4UA 1YBAA 1KQOA 2P5TB 2PGOA 1GSAA 3JX9A 4YJFB 3RC9A 4ZZ0A 1XTQA 1J0DA 2H1SA 1NASA 3L7MA 1KZYC 3OI7A 5JE8A 3HHPA 2XITA 1GG5A 2ZJ5A 3PEVA 1VCHA 4RY2A 5A5GA 4GP9A 4CT0A 3RCBA 3VO1A 4XVUA 3B8EA 4RPCA 2ZGVA 2P2SA 5ALJA 2G80A 2H9IA 1ZU5A 2NSDA 1NHWA 1L4FA 3MEQA 2Y8EA 3A58B 1YWGO 4LOLA 3G2QA 1SU6A 4E31A 4BEJA 2LVBA 2QUAA 3LV8A 2ZKIA 2ZSJA 3OX2A 3PGXA 4BVLA 4CLOA 5C1PA 1SH7A 4RANA 1BCSB 1TC1A 4LGYA 4IPTA 3ZUPA 3PQ5A 4AZ3B 1K6EA 1CEQA 1ZI9A 2F9FA 3G85A 5AK4A 4C6HA 3OUUA 5JLJA 1G2OA 1Q50A 1JQAA 2NIPA 3O26A 4WA8A 1G3MA 4GG1A 2XSZA 3EA5A 5CYFA 2IY7A 3KFXA 4LPSA 3S2ZA 2IZOA 2F1OA 2GD6A 3BAFA 4ZT4A 4DNOA 4EUSA 2NP6A 1YR8A 4WN9B 3ESQA 1B8OA 1LS6A 3QXCA 5CB6A 5KTKA 5L9AA 5F98A 3NT4A 4B3GA 2TYSB 3AHJA 2QENA 1W0JD 2P9YA 5FUQA 1P0PA 1QCDA 2ZSHA 2ZRKA 4O4JB 5HF9A 2H4ZA 4YLGA 1KRXA 5AVXA 3FYUC 4TYWA 2ZWAA 4HMOA 4UVHA 1BE1A 3G8YA 1XZDA 2ZUWA 3I83A 5LQSA 3KALA 5HEKA 3EK2A 3GLHE 1TECE 4HBGA 3OF3A 2I3BA 3BUSA 1DIRA 3LUBA 2P79A 2Y77A 3KPYA 2BP7B 2X2EA 2P65A 4TVKA 3SEQA 5K0FA 1E61A 3FMFA 4KWTA 1CJVC 2EHJA 1EH5A 3QVOA 4HB0A 5F2OA 3W7AA 1AKRA 3SZUA 1AG9A 4D3XA 2IS6A 1B6SA 1C4XA 4TQAA 2G83A 5JS1A 4FWBA 4D9GA 3FSJX 1WDWB 1UDAA 4JJ6A 4UE3S 4ZCPA 2QW1A 4QKQA 1XZ8A 1SCDA 2XGJA 3UOAB 3FPCA 2BC9A 3P2YA 1XA4A 3UQYS 4RORA 1QS0A 3W9SA 4EYGA 3C3WA 2R87A 1JLMA 3PKZA 1S2NA 3AJ8A 4BO8A 1MABB 3VZSA 3WLAA 3ZBTA 4E07A 4H60A 2YR0A 4G37A 5CHYA 1RRMA 4ZOCA 4HQ0A 4GI7A 3M9LA 1A2OA 5ALNA 5A3RA 2H85A 4M0CA 1O0CA 2D5BA 2Q3MA 1LI5A 1DJQA 2PMCA 2WUGA 2YV2A 3NTLA 4H7HA 3WRYC 3DEHA 1E0SA 1IU9A 1U3CA 3I28A 3H8WA 3IQZA 5G53C 4D56A 2VJMA 3LCMA 4DEYA 1RPZA 2XQVA 1G2QA 2PH1A 1DIBA 5EPUA 2PDAA 2J9FA 4MW2A 1SKAA 1Y1QA 3S1SA 1XU7A 4MCIA 1T4BA 1VGRA 2CBGA 1UAYA 4M1ZA 2QD4A 4KVZA 2HSDA 1JLLA 1U4NA 3ABQB 3OLCX 3HKDA 5TS3A 1GIAA 1YAJA 2CXPA 1C4KA 3RJMA 4B5LA 3JWGA 2JLAA 3FPFA 3AETA 3EEBA 2AC4A 3LBHA 1XMPA 3NPMA 3JVIA 4WEOA 5ETJA 5FBZA 3RIHA 1A2BA 4HRVA 4YGXB 2RHCA 2DHDA 2XQJA 1USIA 2J9GA 3KEOA 3FYTA 2X1LA 3ZYCA 3C2QA 1C7JA 5LNK1 5K20A 4LBWA 1LDMA 1PYOA 1EA7A 3FCEA 5MGNA 2HFJA 4XAQA 1E2MA 1OFHA 4F6LA 4YRBA 1TD1A 3CN9A 4Q4DA 4PQGA 4D9FA 2XWJI 7GPBA 3PQEA 5FPSA 1RJWA 4CLEA 3T9BA 2UZIR 4PN7A 2OO3A 2IPMA 3VKFA 2XCUA 1VKNA 4M7OA 3AF6A 1UR5A 4PZ9A 3UW3A 3FNGA 2RGWA 3QM1A 1D2GA 5E4YA 4AJ1A 5C81A 3FYCA 1Z4OA 3CX7A 4YUVA 5ITWA 3HB9A 4AKEA 3K6SB 5IKEA 5DKFA 5GWXA 1UMCB 1FYVA 1QQ6A 2G7ZA 3SYMA 5B3KA 9LDTA 1JHVA 3K1YA 5EJ6A 3IQXA 3DE5X 2QTNA 5JH7B 4ZMRA 2ONZA 4PGMA 2G9NA 2RGGA 2X8WA 3SSMA 4IY1A 2HA5A 3MYYA 3IX7A 5KJ1A 1D0IA 4IXTA 4KNVA 1RMQA 3OKPA 3UGTA 2JFUA 3H19A 1GA1A 2CXHA 3H5LA 3I4LA 4TSFA 5IJ9B 2FY8A 1SC4A 3RQSA 4AO7A 4JXXA 4PC1A 5I45A 2X5JO 2CSUA 2NQ8A 4OHRA 3TW8B 5EEGA 3U3MA 3WLHA 4YI5A 3UHJA 2G82A 4F2DA 4Y9RA 2PZAA 2REOA 1GNSA 2XBUA 1JMVA 4AQDA 3ZEAA 3PXXA 3QXHA 3KYJB 4IFEA 821PA 4ZDKA 4AQYB 5TEVA 1Y9DA 1N2CE 2P6NA 1TZCA 2R8YA 3FTQA 5D6OA 4ZAXA 3I2GA 4BLOA 1JSLA 1TFRA 3EG5A 4JB2A 2H5JA 5EQJB 4C21A 4LF8B 4P0QB 3F6CA 3GJ7A 4UHKA 3ABIA 4RIFA 2QJWA 4ZOEA 2R66A 2K5UA 4HWOA 3ZJ5A 4LF9B 3A27A 1EB9A 1BA3A 2I03A 5CR9A 3D2CA 1MA3A 4CR6A 2H1IA 4DLAA 3AHIA 3IAS1 2AZTA 2BFDB 3I92A 2Q1WA 4RSRA 3W2EA 4ZHQB 5JHHB 3G6WA 3PHJA 1ZJWA 1QLHA 2WJHA 2PS9A 1LLDA 3NHMA 3V1UA 3FGPA 3IDQA 4FE3A 1NJ8A 1LNQA 3CZ4A 4DZTA 3ZDRA 3TRKA 2GVDC 2NO6A 1A7AA 2IW3A 2ZSKA 2V3WA 2CNWA 3HUFA 4R8RA 2V6JA 2VDWB 5BR8B 2AD5A 2ZU6A 1I36A 3NIDB 3SMQA 4B35A 3HNPA 2ZE7A 1H6BA 2E3JA 3C4VA 4RWEA 2HWXA 1XVLA 3BSFA 1ZN9A 3GEPA 4E51A 2OFXA 3TUIC 2XVYA 5DM0A 2CLDX 3S2UA 3G89A 3OE7D 4QPPA 2IOFA 2PCLA 1BRMA 4R9VA 3FI9A 4U00A 2QTTA 2WD7B 4JJ4A 2DBZA 1IBRA 2XTZA 1K66A 4X61A 4BNWA 3SQDA 3EGDA 3SD7A 2XF2A 1YJQA 4GKBA 5IT0A 3RC7A 4UDNA 4M1QA 1MOQA 4J0KA 4PZUA 4EHIA 3ZGNA 3HK2A 2FFJA 1UQRA 1SVSA 2HRZA 2OUKA 2FFBA 4DG9A 1FA9A 3B82A 3STTA 4DSTA 2XQIA 1DDGA 2RHOA 2DHQA 4OQDA 3ZS8A 1S6YA 5K3OA 2WJVA 4NU5A 2MSNA 2BMFA 3LT1A 4NCKA 1WG8A 4TT3D 4C07A 4CR8A 4ZVVA 2QTAA 1TGYA 3OVMA 4NQRA 4C1BA 1NMYA 4UUPA 3LBNA 1K8RA 1KJ8A 4FFWA 4ND7A 2HMUA 4OMFG 4RXUA 5AJZA 5AKLA 5B53A 4WZBE 1I9GA 3TEFA 4YO7A 2Q45A 3GJYA 4ZU6X 5K5EA 3LOPA 4W5HA 2FAXA 5JCXA 3OIUA 2ISCA 4BJ3A 3DTVB 4EPRA 2DCMA 1PZXA 2O5VA 2XDWA 3CCFA 3W5SA 4B73A 2Q8PA 5JSHA 3U3RA 2PUCA 5HMMA 5GZ6A 3ISTA 1NONA 5JCJA 1NT2A 1ENYA 2IZZA 3Q3CA 3QG1A 5F1YA 3W05A 3F6YA 2GPYA 4HGOA 5A5DA 5KDDA 2P9QA 3UJCA 3P4XA 3KKEA 4LXGA 2BFWA 1NC1A 3HXQA 2PY6A 3WV5A 3OCZA 1QOPB 3E6AA 3R5XA 3ZV4A 4DBZA 1M1ZA 1DVRA 1XTIA 2FQWA 3QXXA 3TQRA 4L7VA 3CLTC 4H4EA 4W1QA 1SELA 3DMRA 4H7EA 5LQAA 4HLQB 4YMTA 3K7EA 1XF9A 3I9NA 1ABBA 1O6BA 4ENTA 1NR5A 1P74A 1LDGA 2A9PA 1YQUA 3EH2A 5EMMA 1R7RA 3CSDA 3KTAA 2H4JA 1I5OA 1NA5A 3JQ8B 1R6UA 3D1JA 3ND8A 1E64A 3WYDA 1Z36A 3AF3A 2OZPA