3SBXA

Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
RWTVAVYCAAAPTHPELLELAGAVGAAIAARGWTLVWGGGHVSAMGAVSSAARAHGGWTVGVIPKMLVHRELADHDADELVVTETMWERKQVMEDRANAFITLPGGVGTLDELLDVWTEGYLGMHDKSIVVLDPWGHFDGLRAWLSELADTGYVSRTAMERLIVVDNLDDALQACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
total genus 68
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sbxA00
3IMKA 3O8OB 3PFKA 2PMBA 4JELA 2NX2A 4OHBA 5AJUA 3EHDA 2A0KA 4FYKA 2KHZA 4RH3A 5AJTA 4MEJA 4JEMA 1MTOA 1PFKA 4FYIA 4A3SA 1F8YA 4KXMA 5ITSA 4KXNA 4NPAA 2F67A 4U1RA 2IZ7A 2KLHA 3OPYB 4P5DA 2F62A 2F2TA 6PFKA 1YDHA 2A33A 4LJKA 2PFKA 3QUAA 4I4IA 3F5MA 4MCJA 2F48A 4OHRA 3O8OA 2IZ6A 4PFKA 2Q4DA 1WEKA 4I36A 3UQZA 2F64A 4LJRA 1S2IA 1RCUA 4WL0A 1F8XA 3O8LA 4KXLA 1WEHA 3SBXA 2IZ5A 1S2GA 2HIGA 3O8NA 3OPYA 3U39A 3MAJA 4JENA 3K2QA 4HX9A 4P5EA 1KZHA 3GH1A 1ZXXA 1S3FA 4FYHA 2Q4OA 3BQ9A 1T35A 4LJLA 1S2DA 1S2LA 4I7EA 3HNOA
chains in the Genus database with same CATH superfamily
2CJWA 2X7XA 4C0LA 2CYAA 1WABA 3D4NA 3YASA 4DMLA 3BJRA 4GU5A 2EQBA 4NH0A 2DQSA 2R9VA 4OOFA 3Q3EA 2WMOB 1B15A 1PKXA 2ZYAA 2DFTA 2Q6LA 3K35A 1M9NA 2OXRA 1SOUA 5BXQC 1F0KA 2MCFA 3G7UA 1OU4A 4RVGA 1GZ4A 5JMTA 4L9WA 5EHQA 2ZSEA 4DV3B 1C7FA 1ZMTA 1JQEA 3GU3A 4NJEA 2MR6A 1H23A 2IH2A 1Z0JA 1KETA 3KD2A 3S2ZA 3JAWB 4II7A 4DCPA 1AHNA 1GA4A 4FE3A 5DRYA 3MTQA 1FNBA 4UHDA 5CM9C 3VR4H 4BC1A 1YV9A 4OYHA 5FWXA 3TFQA 4TS9A 3U4HA 5C7OO 1FVHA 1P19A 1UQUA 2H4JA 2ZJBA 1PR6A 4HZUB 1NYRA 4WN9B 1YRLA 4PAGA 4QDTA 3T0GA 3U26A 2NMVA 1GQRA 4AS2A 1BN6A 2NTEA 1X9IA 1BOFA 2I2FA 2PWPA 3ANYB 3C7DB 3HUTA 2VNAA 2EGHA 3FRHA 4OL0A 4AYXA 1B8VA 1C0EA 3HXQA 4NAUA 1IK4A 4HDKB 4MQLA 3QEBZ 3UUEA 4EPWA 1UKVY 2W58A 3G5UA 3U6KA 3H2YA 3K15A 1XV5A 1XVUA 4MHSA 4YP1A 3VR2D 2X41A 4XWKA 1UUFA 4U63A 1J39A 2WAMA 5CFMA 1IBCA 1YE3A 1YZYA 1QC5A 5KVSA 3C3PA 4AECA 4P36A 2QDKA 1AC5A 4HCJA 4W5HA 5ENDA 4ZMBA 5KC9A 4HUJA 1GILA 1JPUA 1WCXA 2AFHA 3KALA 4J4BA 3O8OA 1E1QD 3WG9A 4Y6LA 5JXIA 3EMDA 4LHXA 4DPMA 1OYYA 1EVIA 2Q3MA 3CLVA 1C0LA 1RLTA 2CV0A 4M0KA 4AFNA 1NI4A 4IQ4A 4OGFA 4RHUA 3K0CC 5DNCA 3GFTA 2Q7XA 3FPLA 4TV8A 4DUZB 3WLMA 3IIEA 4NEGA 3AEUB 4FSDA 4HVAA 1P7VA 5DBOA 4TTQA 4D45A 5C3UA 3HMKA 3E22B 2BUCA 2XB2A 3DZHA 3ROKA 1WHTB 1GSHA 2J6HA 3IOCA 3PWSA 4MUBA 1SU6A 2C83A 1HDYA 3E3MA 4G85A 1NJ8A 4KBFA 5H02A 1VE1A 2YUTA 1V41E 2G88A 3EHEA 4FNAA 1SVKA 1SBIA 3CH4B 2NUAB 3RK4A 5CAEA 4F12A 5TB5A 3WFJA 5LUBA 4EVIA 4ZXPA 3PD1A 4EG4A 1BHSA 1GTG1 4M8NE 3SG0A 3GGJA 3UJ3X 5G1NA 4F93B 4TKMA 4G41A 3KUDA 4MQ4A 3GDFA 3R5JA 3COYA 5TF0A 4OY3A 3P0JA 2I8CA 1KO7A 1X7YB 1N6LA 4UM8B 4F11A 1IL0A 2C2KA 2JGRA 1E9EA 4U2GA 4BMCA 2ZM6B 5D3MA 1YE8A 1QMGA 3URMA 3BTUA 1K4YA 1M1XB 3FVWA 4FYHA 4KMSA 1KDVA 3KR1A 4Y6RA 4FN4A 4F3YA 5JRJA 2ONZA 4BMPB 5J2UA 3V1YA 1WZEA 3Q3HA 3B3FA 3EQ8A 1GADO 1HE3A 3EXIA 2O2XA 3FOEC 4E07A 3CE6A 3OESA 4KFRA 4WK2B 5K5EA 1Q12A 1W5EA 1QIMA 4ZAZA 3NDJA 2X0DA 2IT1A 5DP1A 1JZTA 3OQNA 1XTVA 2X3UA 5BNTA 4P3PA 3IQGX 3MBOA 3OFKA 1EBFA 2VQ6A 4MGHA 3U17A 5IKPA 4QASA 1IPHA 3HYNA 4DV4B 3WLRA 5I9MA 4P7BA 1YFJA 3D8UA 3RHZA 3USCS 1DXOA 3CUWA 3Q5GA 5BW4A 2B1JA 1TUBA 3H11A 4M8LA 3HGTA 5E1BA 3JD1A 4QYXA 4MVJP 4D8YA 3AIOA 3W2TA 3WDLA 2FDXA 1QR2A 1YIAA 4KE8A 3S27A 5BO5A 2R7KA 5DYGA 1DIRA 2C2MA 2H2AA 2E4ZA 4ZAYA 1T3LA 4ZVKA 3U5ZB 1RKXA 1EP2B 1LBQA 3LU1A 4EPVA 4PRYA 3PEWA 1KK2A 2V8BA 3ZIAA 4TQ9A 3GNSA 4UZFA 4RJTA 4ESOA 4R84A 2KHZA 4DYHA 3S7TA 3BDVA 3T35A 5EPEA 1T4BA 4FYWA 3AWDA 4F2GA 4NDZA 5C8YF 5MGBA 2RAFA 2PKWA 3R5KA 3SJUA 4QNRA 4P0PB 3VYTB 3K6SB 2ERYA 2IYRA 3H2GA 1TK2A 4F2PA 2C5EA 3K0BA 5K8JB 5E7IA 3ROEA 1GUFA 2KPOA 4RMNA 4RABA 4BNXA 5FEUA 2VLBA 9LDBA 3LOUA 4X3CA 1QJ4A 4FILA 2JVKA 2YC4C 4IDAA 2IOFA 3SF0A 3LCRA 5BVHA 1YCFA 3CGGA 4TZTA 5AOVA 5C46F 4YECA 1KBQA 1NQWA 4KFTA 1HDXA 5KREA 3FMOB 3IX7A 5CD1A 1CUEA 2Y9PB 3GQVA 4C4ZA 2A9QA 3E5RA 1O87A 2NYUA 2XEDA 4UFPA 1ZRMA 3K0AA 1G4UR 3GMSA 1P6XA 1ZDMA 2BMWA 3EWAA 3HABA 3SQNA 1QBGA 4IDOA 5KBYA 3FHLA 3RYCA 4PZDA 4BL5A 3IESA 5CFNA 3DYVA 3E61A 3HI6A 4IXDA 3RHTA 3HZOA 3QU2A 3THXB 1KSHA 3H65A 3SJBA 3RWBA 3TMYA 5TPZA 5I7UA 2W2LA 1E77A 3RKRA 5ILQA 3DWIA 2BEUB 4GMHA 3LI2A 4RKRA 4KYTA 4RVCA 1AURA 4YR7A 1PDWA 3A9UA 3HNRA 2J4CA 2JPDA 4EUSA 4KFSA 1ZBQA 4CM6A 1JQ3A 3VU1A 4DTCA 2XXAB 4I36A 2OCGA 2GASA 1EE1A 3LX4A 3JR3A 1PBNA 3DZKA 3R0XA 1NE7A 3C5HA 1UKCA 3EOZA 3D3WB 4FBMA 1CZRA 3SP1A 2KB0A 1LC0A 3NHUA 1FP7A 2YHIB 3SR0A 4DLPA 1FUUA 2Z95A 1XRPA 4R1NA 2QZ9A 2H1LA 1QLJA 4PC1A 3I28A 3L0SA 2RGWA 1CJKC 1WZNA 4NR0A 2RGEA 2Z3ZA 1P18A 1Z2EA 3LA6A 4N5DA 4N3AA 2WV9A 4PZZA 2X0FA 4N03A 3G2QA 3HDVA 1SBCA 2VDOB 2HCTA 4YIHA 2I22A 3F73A 4JDPA 3U61B 1JFVA 1NSTA 3F6YA 4I4TF 4IKEA 4NJOA 1ILEA 4MR7A 4BNKA 3ZEIA 4CLHA 5DJ5A 1HPLA 2A9OA 3PYMA 3SQLA 3I9MA 2I4TA 3N1UA 1RMYA 1X7ZA 1W0CA 3M4JA 1RCFA 2X0KA 3OPMA 3R77A 2B34A 4WLFA 3TMAA 3ZCSA 4DDVA 3RK1A 5FRDA 4I8IA 3L7OA 3V4RA 1A77A 1BEUB 1TAHA 1AKEA 1WVGA 2JK1A 2X8AA 3TJZA 3M9WA 2D3TA 2R7MA 2ZRAA 4KUGA 5A5FA 1IXZA 2EBFX 4Q19A 2JEYA 1YBMA 4IM7A 5FPQA 3CUYA 4LWZA 4PQEA 2DXIA 2Y4NA 1U0SY 1R0LA 1X8LA 4R7ZA 5DCLA 4DY6A 1FDVA 1W59A 4G8JA 3U0BA 4DJEC 4V1CB 2J9FB 4URYR 1Z0AA 5DHPA 5H68A 1EIZA 3R7WA 4H7FA 1KH1A 3GJ7A 3VHXB 1NKTA 4WGFA 4L3VA 1C3VA 1M5TA 1NMQA 2ACWA 4FYJA 4KRGA 1HFKA 2IZOA 3JTMA 3ZWDA 1CSEE 3A4TA 1NRWA 1MX9A 4DEYA 2WWHA 4UCWA 1EDEA 2OECA 4XA8A 1XJWA 4JR1A 4Q4AA 2NQ8A 1NASA 4RTLA 1CDEA 3UYLA 5HKKA 3ROMA 1T6XA 2P2DA 4E7PA 4H18A 1QO7A 1ELOA 4X62B 3L77A 2AOTA 5EKUA 2XD9A 2XNDA 2A7QA 3WDMA 3IPXA 3AOEA 3MTJA 4R8SA 3VR5D 1F8UA 3L8ZA 2XW6A 1QR6A 4YRBA 1FFAA 4GOOD 1YS4A 2ZTUA 3Q87B 4FFVA 1VL6A 3KKKA 4JC5A 1SUAA 4LA4A 1R0CA 4OSOA 3UAOA 4DCGA 4QDZA 1JAIA 4ND1A 3OCWA 1LQTA 4TT3A 1KAMA 2QJTA 3N8HA 1MH9A 3BB1A 3O92A 1IVSA 1Q0HA 1FK8A 1DFGA 1L4YA 1F2UB 3CO0S 4PYMA 5CDYA 3E9DA 4MV3A 4X93A 4BB9A 4H1TA 2P1RA 3AKDA 1NC3A 4UE6A 3I76A 3TSCA 2V7BA 5BN3A 2MWMA 3HY3A 4L1KA 2DPGA 1N57A 4OBWA 3F5MA 2QX7A 3CLHA 4G5QA 4YB8A 1QVAA 4DA9A 2B1RA 1GNTA 1FFDA 4BFVA 5FULA 1EFPB 3CJRA 3DZCA 2I34A 4ZMRA 2HA7A 4I1IA 1B0ZA 4D5EA 2I6XA 2Z2KA 4Y2YA 4B4VA 3F96A 3MQFA 2ZDGA 2PD6A 4H1VA 2JLCA 2CC2A 4WA7A 1GY8A 2HQ1A 4RH1A 5AKLA 4ZO8A 3V8NA 4AO6A 5F9HA 2JJQA 2ZVQX 5KTMA 1RRKA 1SD5A 1XTZA 2R1VA 4L4RA 5B3JC 2NU6B 1WPQA 5IH3A 2WT9A 1PZEA 4XQGA 2BFAA 1E9RA 3D6MA 3MWKA 3ZV7A 2E1PA 3PA6A 5E6UA 4IEIA 4GEKA 2HH9A 2VC2B 4K3UA 3M49A 1WCWA 4IZHA 4DSZA 2ZIFA 4PICA 5KQSA 5FYDA 1HE4A 1Z7WA 3UJ9A 3KHUA 4DS3A 1Z5ZA 4G09A 3HDHA 3DAGA 3SOZA 3MTEA 1IJKA 1NVFA 1V4NA 5DGIA 5E4JA 4BQQA 1EWYA 2RKBA 4NYJR 1JU3A 4ZKEA 3RSFA 3UKOA 4A15A 1E69A 5BT8A 1KHTA 1YDEA 2PGLA 3GJTA 2I66A 5CNKA 1L5LA 1M75A 3NTOA 3B60A 3GJQA 2PH7A 3O2SB 1QGZA 2V03A 1HI9A 1K7CA 2Z3WA 5CIWA 1X8JA 3BMCB 3ZK9A 1DDOA 3KXKA 1FNCA 3WLIA 2WJ3A 4CWAA 1K7YA 4BVEA 2QZSA 3GPDG 2P2YA 1FMLA 3PYXA 3TS1A 4UOZA 1E9DA 2P4HX 3AMVA 1GN8A 3BK7A 1R5NA 4G1EB 4QD3A 2C2OA 5HBGA 4D6XA 1AZSC 1HM5A 3CUEF 4TL6A 4JSYA 2HDWA 3B89A 3DBOB 3M1YA 1VPTA 2BM9A 1T2FA 4C06A 2GA9A 3UHAA 4DPLA 4DSTA 1QAMA 1SCIA 4ZGBA 2H4FA 4FGKA 5CYPA 5EXDA 4BRZA 5TNXA 4ZVNA 4K9NA 4MUFA 1J09A 2OBFA 1XZHA 2JFZA 3MCWA 2YY6A 4DXDA 4RZQA 2VK2A 4PLCA 2GPJA 5HIMA 2VRNA 4ARAA 4JL6A 4D82A 2FOLA 3DXZA 3B13B 5LLDA 3HJRA 4U39A 4HVCA 4NEQA 4QDUA 4UD2A 1CE8B 5EERA 5JCJA 4NMLA 5JLAA 3KKPA 4IJVA 3UC5A 1LJLA 4ESHA 5JTTA 4W8OA 3R9XB 3EQ7A 3BCRA 4DNQA 3KWMA 2IH5A 2Y99A 4L3WA 1DV2A 4REOA 3X2SA 3PNYA 1SQ6A 1OILA 4GBED 3UXYA 2RHWA 3EYWA 3S2EA 3E9RA 4DJAA 2R8EA 3IILA 3SZRA 1WHSA 4A0GA 1L8OA 2VXCA 1JAXA 4C7MA 1NW5A 1TO1E 2Z5FA 5I47A 2AC7A 1Z0FA 2ISQA 4G8CA 4MV7A 3T9CA 1KMQA 1VI2A 1X2BA 2FFJA 1ECCA 4X85A 5B7GA 1YWGO 2ZIEA 1QIJA 5F5XA 3HVIA 3VDNB 3R4CA 1WLYA 1PFVA 3AM4A 5DP2A 2YZ2A 1A5TA 3OF5A 1J90A 3QUAA 4FGUA 4GKBA 9ATCA 2VNSA 3P9PA 3NIWA 1Z0UA 5ECDA 1XNQB 4ZICA 1E64A 4IIVA 1V8FA 2NYVA 4AJ4A 3Q8KA 2F1JA 2RBEA 3GBVA 5FLYA 3ZX4A 1QHSA 1GRQA 2XNCA 3Q0TA 2BJVA 2C9MA 4UARA 1T8RA 1M8FA 3PICA 3NI2A 1VKNA 3HG7A 2W8ZA 4AF7A 4A82A 2QL9A 1GSAA 3I53A 1H8HD 5CR9A 2GPNA 3VSBA 2BJWA 5FPYA 3TI7A 4GICA 3H04A 2EGGA 2G9NA 2OORA 4D0LB 4YRNA 5LJLA 5JWHA 5FQOA 4EUEA 3OQPA 3FJYA 2Q2OA 1EBBA 5HZGA 1AIPA 1V8PA 5REQA 1J49A 3OJEA 1TEZA 3GH3A 5KQGA 4CCWA 1XC7A 2Q2WA 3I6ZA 2QMOA 5IC6A 4BX8A 4BYGA 4ECAA 2PX6A 3HS3A 1X1CA 2OXFA 1QAOA 3CW2A 3DMFA 3JYQA 1LDYA 3A05A 4JYPA 4YAOA 4A2WA 4DPKA 2NUBA 4JP1A 2B4KA 4WBNA 2HJVA 2PUTA 3M8KA 3L7AA 1ZSNA 3LG2A 5AHWA 3LSTA 4HDRA 5FTKA 4C14A 3K70B 2AR0A 1P2UA 1GFSA 4IWNA 4B2LA 2RB5A 4MUAA 4BP1A 4JNCA 5ED4A 3RAEC 3DMPA 4XOUA 1P6QA 3P1JA 1D7AA 4IZ6A 2B8WA 4EK9A 1PR3A 3V1KA 4BLWA 3DBIA 5NLLA 4OQPA 1ID8A 1K5DA 2XNKA 1MC5A 1H0HA 3HBJA 1CK4A 4XSVA 3BD6A 3F71A 4OAQA 3RTGA 4MW4A 4ITUA 5TLSA 1Z5GA 5EIBD 1DVRA 2VPIA 4LY3A 1Z2CA 1G19A 2MMCA 2WFZA 3D9QX 1QKJA 3NC1C 5ALQA 5I01A 1MEEA 4PYRA 2X22A 4DR1B 2Z1MA 1Y5MA 2LIVA 2PVCA 1RJDA 4E5KA 1SCNE 2XCUA 4ND8A 1TT7A 1G3RA 4MLDA 4LC9A 4P34A 1E3MA 1Y4SA 3OC6A 3N3BC 5AKIA 3BDAA 3LXMA 3OIUA 5E9AA 4NPHA 1Q1ZA 4ITVA 1FUIA 3SS8A 3TNDA 2YUIA 2MTBA 3X2FA 3S68A 3VSCA 2XT9A 2C9ZA 3EWSA 3FSGD 5DBIA 1DFHA 4Q4JB 4J29A 3W2EA 3ZD7A 1D03A 1O8CA 1A2OA 2AMFA 2CN1A 2RK4A 1PFUA 2QRMA 3OWXA 4PYOA 3QMWA 5F7XA 3F7OA 1GDDA 2W4MA 2WZDA 2CXTA 2QN3A 3CPEA 3KOYA 1LQ2A 3TW4A 4D3DA 4F5EA 5JXGA 5JD5A 3AK4A 2DF8A 4RGBA 1UP4A 4F1WA 3CZPA 1OLSA 3UB2A 1F4LA 3OIFA 1F6BA 3SHTA 3RVQA 1XQVA 3D8NA 3SYMA 3C3AA 2XGMA 3B3QA 3MT9A 4IHJF 2QR3A 4NS1A 2C7PA 1Q77A 3T1YB 3GB9A 4RKFA 1E9BA 1C30B 4O2AB 2YZKA 3EEOA 1EE2A 1L5QA 2GJSA 4UM9B 4NCXA 5THQA 5AW9A 1EWQA 2B8NA 2JFXA 1KOJA 2FMKA 4Y6OA 1IN5A 3JPYA 3KZVA 4XQ0A 3TLJA 5ES4B 2F8LA 1GYQA 2B2NA 2QD5A 3WYBA 2IYWA 2H7YA 2ZPAA 3GJYA 1VIVA 3SYLA 1IXYA 1H4QA 1TYBE 1BGWA 2Q1WA 1U2RA 1TB4A 3UV7A 2IYEA 4OSPA 1N7JA 1HURA 5DIFA 1MQ8B 1RW4A 3KZXA 1X19A 4BX9A 2G17A 1Y6QA 1BHO1 4S24A 2O5RA 2I78A 4EQZA 3H9JA 4QJ3A 4KITB 2FW1A 2Z04A 4MJ7A 5GVRA 2VJKA 3PPVA 3SC4A 4MW0A 1WZCA 1IBSA 2OCBA 3C74A 3P9RA 3COPA 3BBLA 3NGXA 4YJ2B 1QHHA 2Q28A 1J99A 4HAUA 4TLCA 4WOCA 3DOJA 1NQUA 1L3BA 3R7BA 4BXOA 2VDWA 4AAYA 1UJCA 3HBFA 4RJJA 4OXQA 3NRCA 1AO3A 4DLBA 2AFIE 3WDKA 2XB9A 4B3BA 1XTJA 4RIEA 1IOWA 3VR2A 1DKLA 1X3LA 2AFHE 5DTJA 2C2HA 5DCUA 1GCAA 1PL6A 2WBLC 1QK5A 2GM3A 1JR4A 2I3AA 4TMVA 4WPGA 2VYVD 3JTEA 4JA0A 5EUQB 4TYNA 1XR3A 1FP6A 3AJ8A 3NASA 3STUA 1BWSA 2PZEA 4ENQA 5TT1A 2B78A 3K8YA 4YJGA 1OGJA 3OOWA 4ARUA 1CT9A 4ZMSA 4Q7EA 2CVPA 3MINA 5A3SA 2J41A 2VKTA 1Z12A 3QLVC 2J7KA 2FRDA 5K8VA 2TSYB 3SFVA 2PWZA 4R41A 1ARZA 2IU6A 3OJWA 1XX6A 1GN9A 1UL1X 1AQUA 1VTKA 1Z5PA 3HCDA 3N6RA 3DZIA 2BN4A 1V8BA 3I73A 4Q02A 4RFLA 2YZGA 1FX1A 1T36B 3A4VA 2QN7A 2XOEA 1FXWF 1T24A 1ZOPA 3M81A 1EUQA 4PAQA 4N6OA 3GLKA 3T9DA 2ZIXA 2QSZA 2OO5A 2FW7A 1KMHA 5TJ9A 1FFBA 2BBSA 4BIMA 2WIKA 4EEZA 2F17A 4RHYA 4OHBA 1KHHA 1YT5A 4AJLA 1IMOA 2WPNA 1XVLA 4KH0A 1YE5A 2O9JA 3AFNA 3TI9A 4OLAA 5KOHB 5CB4A 4QSHA 1ODCA 2OVFA 3AOEC 5AJTA 5DNEA 2ZJAA 3UMYA 1G2OA 2J6BA 3UICA 2UXDB 3GY0A 5D86A 4DJTA 1IDOA 3S5UA 4GC9A 3S3TA 3WQHA 2G07A 4GSLA 4BX3A 4OP2A 3N53A 1K89A 1ORWA 3H5OA 1RXUA 3FR8A 3PUJA 4KXNA 2Z5VA 4TTTS 3ZXYA 5B7PA 5C8ZA 4B4DA 3W5JA 1JHMA 1OXTA 3IELA 2H1WA 4EX7A 3ML1A 2QPAA 2FP4B 2WNHA 4RADA 4S3MA 3A26A 1VL1A 3AW9A 3PC6A 4D9IA 7MDHA 5IDWA 1AE1A 5A4KA 1QH8B 1A96A 1NVVQ 3DNFA 3KP1A 1DJLA 2ZUEA 2ZE8A 3HDJA 1FDOA 4OUDA 5K3FA 2BGUA 2I2AA 4ZCQA 1LLQA 2ZCVA 3GP5A 5ERYA 2EXXA 4C5AA 3PFIA 1OTXA 1PIWA 5LZ8A 1G5PA 2IJGX 4BMVA 1YSCA 2GN9A 3QW2A 4X54A 5KU1A 1RWOA 4CRWB 5FPSA 1DI0A 3A1WA 3WX0A 1FVFA 1U2DA 1DOZA 3A11A 5GJCA 3V4ZA 4MPPA 5ETJA 1Y6JA 2YTZA 5E7JA 4B4UA 3K9CA 3UHOA 3WV5A 2WZBA 3KQHA 3DOFA 4KK3A 4JD5A 5AVWA 1ZD2P 1E3SA 2GZDA 1GP2A 1Q22A 3OUZA 2Q3JA 1EUYA 3QLTA 3ID6C 1TJPB 1AQJA 1M0SA 3GBPA 3GFRA 2O3JA 3NC4A 4LJRA 2REQA 3V7NA 4ML3A 2ZM5A 3QBEA 4JLOA 3IBSA 2WP0A 4G56A 5C9ZA 2J4DA 4D80A 3AKCA 2VF2A 4L0QA 5EEGA 2RK3A 2GFQA 2XAUA 4F6RA 3LXXA 2JKVA 3PXXA 4IIJF 3MILA 4I1OA 5DHRA 4U2EA 3RNOA 1XAHA 4YV7A 1R6VA 2AMLA 2YWCA 5D5PA 2WVHA 4BP3A 4DXHA 2NAPA 3OZBA 5AOCA 1MG0A 2QKYA 1G7TA 2WYHA 5TGTA 5JAHA 1TIPA 2DB3A 4DTIA 1GA1A 1YDGA 2WF8A 3CF0A 2FEPA 3IIKA 2I6GA 1AS0A 5EWLB 3U3KA 4DR7B 3HU2A 1P0QA 3GUHA 4N5HX 2GXQA 1H85A 2BCJQ 3OJLA 3VUEA 3ZZUA 2JFYA 4MP8A 4QBFA 3GZNB 2I6TA 1J7JA 3CG0A 5IWCA 1VIYA 3MJEA 4DLUA 4HDNB 4YDSA 5IANA 2XKKA 4GX1A 3QXGA 3VKGA 4OYLA 3G2MA 3DD1A 2YASA 3NV7A 1SUFA 2FWMX 3PEEA 1CWUA 5ICSA 3AG5A 3E18A 2AG5A 2JG3A 5HIIA 1V7PC 3GN1A 1Z83A 3O73A 2F3TA 3G1WA 3DL2A 2X76A 3FFXA 4RCYA 1FRVA 2FWRA 2L82A 4WLUA 1ADGA 1UP6A 4D8TA 1RE0A 1JKJA 2FJPA 4QDKA 3FCSB 2Z6UA 1VHQA 4HR7A 5CH8A 2JVIA 1YVEI 4GM0A 2V97A 4YRDA 2IE8A 1BHQ1 5CNMA 1LBIA 1EK1A 2OP0A 1EX9A 4ENPA 2FMHA 2PMBA 4Q24A 3L6CA 3RWOA 4YP7A 3PGJA 1VLHA 4QVKA 1QONA 1Z2PX 3DGEC 2VTEA 4KTTE 5CCEA 1C7EA 1LNQA 3MSCA 1L7VC 3LRTA 5LQKA 1XQ6A 1AQLA 2C88A 2QN2A 3BXOA 2IL1A 2YYZA 3EIFA 5CFZA 3D81A 3DDOA 4FTWA 1OQAA 2YWXA 4IHJB 1G42A 3L7JA 3PIIA 4LYYA 4K87A 5GIOE 5E9JA 1CVLA 1HH4A 3VO2A 3EIXA 1VLQA 1LVGA 4PX5A 5ECWA 3PF9A 1EZZA 3C4JA 3C1OA 5HKLA 4COOA 1XZGA 2EV9A 3W5BA 1KXJA 4AS3A 3ZS8A 3WWPA 5CVUA 1WNTA 4ARZB 2Q41A 4LVOA 4Q01A 1J1ZA 3VKVA 3NNNA 2X6RA 1B4DA 2DMRA 4HWGA 1SIOA 1YZHA 3CNHA 1F2DA 1OVMA 3HUEA 3RO7A 3WLQA 3H1TA 2I80A 3QYAA 2PSHA 2Z56A 4RCZA 1N7IA 2G5CA 2QTAA 2DHCA 1C7QA 3OIDA 1HETA 1M2KA 1H94A 2PRKA 2A5GA 4P7GA 4A23A 3P4XA 4I50B 1VE5A 4KLZA 4P4GA 4YRIA 2BMFA 4JXXA 1V6CA 2VDPB 4Q3OA 4XX0A 3W7AA 3SFZA 2IS2A 3A2NA 5I8WA 4OXXA 3I2JA 2F1IA 3ACBA 3AVVA 3WGJA 5HTOA 2EKQA 2ZBQA 3FAKA 2Q7DA 2XWSA 4F46A 3GAAA 3QWBA 3RC7A 3T1QA 1K68A 1JR3D 4ZC8A 4CKEA 4JYCA 1Z3CA 4HMPA 3ZU2A 3LHSA 5LXTB 4GWLA 2BGNA 1DFIA 2OORC 1O57A 3EGXA 3AQIA 3VR5A 3WI7A 1GUBA 1UJ6A 1C4XA 4XCQA 2YIMA 3UMGA 5ADUS 2CVFA 2QRHA 3NATA 4NYMR 3ASUA 1BFDA 5GOTA 4E94A 2WICA 3EGOA 2VR1A 4MKFA 3HBLA 2PE5A 2Y67A 3LE8A 2BMVA 4WK6A 2JLAA 4KQHA 4PVCA 1TCCA 5IXSA 4MJXA 3PDCA 4D9MA 1A1SA 4Q34A 4NPCA 1B3RA 4QAQA 3E23A 1LEHA 3KSAC 4G67A 3AIKA 2OILA 3OZFA 3O8QA 4MWBA 3WGMA 2DE0X 4X5OA 2P9EA 1DL5A 3CS3A 2YXLA 3IBGA 5AMXA 1UM9B 2C9BA 2W6CX 3PR1A 1NG9A 5I9TA 4K6HA 2HO4A 3HJFA 4Z3DA 2PQ0A 1L3IA 2ZTVA 3ZZNA 5K45A 4K8RB 1RMQA 1XFAA 1LBEA 2X6TA 3BGVA 2QNIA 2GPAA 3D7KA 3SQMA 1U7UA 1TLFA 3IRUA 2OK7A 1FSSA 1HYQA 3CIFA 1U2SA 3NAZA 4L9RA 3RFTA 2E48A 3ESQA 3RUPA 2PUVA 3U81A 4CM7A 3GK3A 2LKDA 3NB0A 2V4MA 5G1OA 2NU7B 4FKZA 3Q7IA 2VTKA 2FYTA 5BUCA 1JHZA 3B9PA 5IXJA 1CUDA 2GM4A 4KBGA 5AJWA 2ZR9A 2F7SA 1PGPA 2IIPA 2WUFA 3CXRA 3U9TA 2EF0A 1J8YF 4TSFA 3A04A 3AEZA 2W6IA 2Q2NA 2VNIA 3HO8A 3LYLA 4XJTA 3HSSA 4LZNA 5HW0A 1P31A 3BRWA 2IXGA 3KB1A 4KO4S 2JF0A 1W93A 3T4EA 2R66A 4UMDA 1T3SA 4F06A 1E66A 1IXRC 2CNWD 3L6DA 2QEQA 5TE9A 1JR6A 4JX9A 3WXBA 3DXXA 3IIMA 2FPIA 1DAPA 2YJ5A 2GPBA 1ONSA 3AHEA 1CZKA 1HBJA 3IP3A 2WB2A 2BI8A 4X92A 5IDYA 2GM5A 5LZ4A 3PQ4A 4Q05A 1OIXA 2IIBA 5AW5A 2CLEB 3BFVA 1O97C 2IEIA 2GK3A 2H11A 1XRRA 4JBLA 2P9TA 3FNIA 1SWVA 3L6UA 3QV1A 4L8VA 4F04A 4DLTA 3EVTA 3EXEB 3DEJA 5AM4A 1AKVA 1I51A 3OCUA 5F1OA 4YLYA 1IZ8A 2R8RA 1P73A 1GQQA 1PYDA 3Q10A 4N7RA 3SMQA 5ICMA 1YDFA 2CNBA 1TYCA 3CZ5A 4IDNA 4W5QA 4HWTA 1Y82A 3DKPA 4P4LA 3LX6A 3A6FA 4M0CA 3RVLA 1YDWA 1LK7A 5CP8A 1AKNA 1TE2A 5EFOA 3Q0EA 4NULA 3LF1A 1N0HA 2VJNA 3EVFA 5JFOA 5LIPA 1H65A 3EVEA 1T6BY 2PKYX 4G5GA 4NWIA 1NL3A 1AZWA 3DKKA 4ANFA 3BKWA 4BN5A 4O4LF 1A4UA 1P8JA 1SULA 4UUBA 1Y81A 2G25A 2HWWA 3LUDA 3C45A 4FP9A 4JQYA 4YMHA 3TCXB 3OLXA 3ZDEA 3TG8A 1LU9A 2FFQA 1P7PA 3C97A 4IIJB 2YC2C 4FZJA 4F4FA 4IH9A 1BX1A 1BJKA 1NX9A 2W6JD 4JP5A 4I8XA 4IX1A 1BDMA 1ZL2A 1A7JA 4IQ8A 1I5EA 4QLAA 4RX1A 4ZU3A 2F64A 2CUKA 4LYJA 4H2DA 3G59A 4NICA 3O31A 3IEMA 1K4MA 5IC5A 3LY8A 4Z0TA 5JJLA 1C29B 1JUDA 3MTGA 3BF8A 1I7SB 2O2DA 3GF4A 4C4RA 3KLBA 4CNBA 1IUOA 2O8BA 4JA2A 2O8EA 1QX3A 5F7JA 2JFHA 4H6PA 1XDWA 3MG9A 2AXNA 1Q83A 3D4BA 5IKEA 3DL4A 4KQ2A 4M1MA 3DB2A 3EFBA 3R2JA 4KW7A 3T7EA 1ILWA 1CS4C 1AKMA 3ONWA 1JEEA 2VO1A 4UHEA 5IABA 1JX6A 1FYVA 4KODA 3REQB 1CUAA 5C8DA 2IHNA 2CUNA 4FZRA 3TX6A 4LF6B 2WNIA 1UDCA 4OHPA 4Z4GA 1BG6A 3AFGA 3X1KA 5MFPA 4ND6A 5KO2A 3C48A 3C7TA 1ZXXA 3QE3A 4R1LA 3NVAA 3SEQA 1ISJA 1MC8A 1Y8QB 2LP4Y 4IBOA 1KBZA 2ZU0C 4M83A 1BX0A 2AZXA 2HA2A 2ZS7A 5SY9A 3KEGA 3UJAA 4ZT7A 1YAHA 3RS0A 2FRDC 4O02B 4ZI3A 3E2IA 5DM1A 3QHPA 4J0IA 1TFUA 3W9YA 4UM7A 4UEOA 4PHGA 3U3DA 3UAGA 5HIJA 3IOMA 5CT4A 3Q85A 1JQAA 2EGUA 2XEXA 3D6UA 5HF5A 4KYIB 1ES9A 1KC3A 3A6JA 3DTVA 1V9CA 3LXRA 1UXOA 1AQYA 1GCUA 1V26A 2BEWA 2PMWB 4UPVA 4PSUA 5BURA 2R11A 1GSOA 2OO5C 1NBMD 3FLMA 1RNLA 2V3CC 2WIJA 3CZQA 4LMAA 1KDZA 4YY3B 3C6KA 2HREA 1U5AA 1EEHA 3H75A 4MZDA 3SOPA 4CKXA 5CLFA 3LF2A 1N4AA 5K6RA 2C2ZA 3TQIA 3ZJYA 1XG5A 5F4BA 5DNYB 2HSJA 2ZBPA 2PZFA 3DOEA 3NHPA 1UK8A 1M66A 4I5GA 6NULA 3IDSA 1QHEA 2AN1A 5C80A 3BTSA 2DERA 3LL7A 1DKRA 1HL3A 1TK9A 2XSZD 4PZPA 4BMZA 2I5PO 4DANA 3I9OA 4MWSA 3N0VA 4QYWA 5JASA 4D97A 2V65A 5FYQA 3LNCA 1NFQA 2BMDA 2VJOA 3OE5A 1CQZA 4M9XA 5CLQA 3RYHB 4C3ZA 3DP7A 3O47A 4C3OB 4INAA 3ORSA 4CM4A 1U8EA 3WLSA 1WMDA 2OG1A 4Z99A 4DSOA 5K8UA 4Q3KA 4US1R 2VRBA 3M6WA 4FVTA 4DLLA 3ZDAA 1ZI6A 3QRWA 4GYJA 5FBRB 3WKDA 2GKSA 1NVAA 2W6PA 4RHCA 4AYTA 5LDHA 1W4AA 2G0NA 4N39A 2E55A 1YJXA 3FYSA 3Q8WA 3R23A 4WERA 1MJNA 2C5HA 1BD4A 1N9ZA 1O96B 4MWDA 4Q3CA 4EKNB 1JXMA 1NONA 3RRNA 1U2DC 1DC3A 1QVWA 3GLVA 4B48A 5HTKA 4U3JB 2EJVA 5C1BA 1MMFB 1ODSA 3AR7A 2CKDA 3EGDB 1QRDA 4S1VA 4HWOA 2A1UB 3H6GA 1UPCA 2GHTA 3I1JA 3NBKA 2YFHA 3R7SA 4YUXA 1B2RA 1R4MA 3PGXA 3ZW7A 2B92A 4C88A 2LR0A 1V1MA 1JIQA 4JOQA 4FOLA 1U8TA 4EEXA 3LDHA 4Y2RA 3ZVMA 1R9MA 3P4YA 4B35A 3O9MA 2PTHA 1CERA 1ECLA 1G0NA 1HT1E 2PGIA 1T2DA 4DV0B 2F9FA 5AESA 3L0CA 1GXSB 4RELA 3OCVA 3T7SA 2YW9A 3E81A 2FE1A 2ZSJA 2HQBA 5CG2A 1AUVA 2HT1A 4P33A 4LQLA 1UMDB 2ZAOA 3LMKA 3QUCA 4D6YA 5JALA 2WF6A 3DCIA 4LQCA 5JS1A 1M2EA 3I2IA 1TADA 1ZGBA 2QZ4A 3AR3A 2UYGA 4N3BA 2NSDA 3VPDA 4F3NA 2HIAA 1TVEA 3FHJA 1GZSA 5GGYA 1CUIA 1EM8A 2A0UA 5GADl 4G5XA 5SZKB 1C1YA 5FNVA 2Q2VA 4GOND 3TK1A 4EHNA 1SD1A 2WDZA 1P8AA 2DT5A 1GG5A 3AWIA 2V8OA 2FW9A 2INGX 2JH9A 1JLHA 1UAGA 2EL9A 3U1TA 4AQDA 2JB9A 5JEEA 5DX0A 3W1VA 4QJ4A 1R2QA 1LSJA 4DCVA 3FTCA 1XQ9A 1A4XA 1MAWA 3FLAA 3UTDA 2FPRA 3L1UA 5K6TA 3BF7A 5C5CA 2AQ8A 2ZB7A 3UC9A 1ESZA 5TMEA 3HCBA 3P32A 1OWPA 4H7IA 1FP4B 3TEFA 3HYLA 4F6LA 5A0FA 1NTRA 4JJGA 4ND4A 5CDGA 1NF3A 2AVDA 2H51A 1LD3A 1RQRA 1RLOA 10MHA 3RS5A 2OV3A 3GVPA 3JD4A 4CDGA 3CISA 5K01A 3PBKA 3P96A 1J0EA 4MS1B 5AKKA 1OE0A 4MI3A 4DSNA 2W6ZA 2CZGA 1PTKA 3A1NA 2DT8A 3GLHA 3O74A 4NYIR 4G8DA 2WMYA 4Q6WA 5KYXB 2H4YA 1I4LD 2FPOA 5BV0A 2QQ0A 4MSUA 4QLBA 5K99A 3RF7A 2CLKB 3OT1B 2ZBEA 1WG8A 3LRXA 5ALGA 4I08A 5DW0A 4P3KA 4BFUA 3F49S 2GLTA 4JLMA 3EHDA 4D02A 5EJ9A 3PFNA 4HX2A 5IT9A 4EOGA 5BQXA 1ESDA 3RJ5A 2IHJA 3CBGA 4IIGA 4F91B 4H15A 4N5MA 2EZ8A 5HRCA 3OZTA 1KBOA 3QMPA 2NZXA 3LAWA 1P77A 2VDUE 2ZLBA 4DYDA 1ULAA 1VBKA 3T3EA 2HMAA 3MGCA 2WVJA 4JB2A 1GU0A 1A5BB 4KACA 4RD2A 1BKSB 5EE1A 3PF8A 4IIXA 5DLYA 4M9QA 5HKAA 1JECA 2PZ8A 4NNOA 2F55A 2FV8A 2GD0A 3ILSA 1FP1D 3JQ6A 2Z3VA 3EQ9A 1KYZA 3SEFA 5ICEA 4V0QA 1LKZA 3ZI4A 4K2HA 5FIUA 4EHLA 1BW9B 1Z2OX 3PGLA 1OV6A 1YQ9A 4EGJA 3GJ8A 4MS4A 2AT1A 1GR0A 1QCZA 2HBRA 3LP6A 4E4YA 3HB9A 3T7TA 5JNWA 4HH4A 3K9HA 2K4MA 2XVMA 1IBMB 3SR4A 5AVZA 3BKXA 4OFXA 2CL7X 4D9BA 5A3RA 1VQ1A 1D1PA 4CV0A 1IB6A 1K63A 3AETB 4GZLA 3CBQA 5JI2E 1VL2A 3FYUC 3JATA 4HMOA 4RHFA 5E1MA 2ZTSA 5ADVA 3FWHA 4CN8A 1AMNA 2AA3A 1P7CA 5FBZA 2NYRA 4H1HA 5HCNA 3V8EA 4K81B 2BGRA 2GGSA 4LFAB 2HK7A 2EP8A 4BNWA 3QE4A 3TZQA 2ZYTX 3EXFA 4QODA 2DHDA 4X94A 5TEWA 1QV6A 3TUZC 3UANA 2II6A 3SPXA 5FBWB 4B6GA 2WHPB 3TBKA 1SA0A 3ZJUA 1F60A 3IAM1 1NJ1A 4PLHA 1Q3TA 2D1FA 5E4FA 4E31A 1LSUA 4I9HA 3NIFB 2FSIA 3PI7A 1FSFA 3NKFA 4QBKA 5E8JA 4AG3A 2R5FA 1MF7A 4PZYA 1BVYF 1SIUA 2VK1A 3NTVA 5LQNA 1UJ5A 4JUBA 3AKEA 2O8FB 1GPDG 1M5UA 3PDIB 3C3WA 4L4SA 3WNZA 4TVKA 1PSZA 3S2IA 2XUKA 4DHWA 3VR6A 3KLOA 2C3UA 3RS2A 3A36A 4YMIA 3RABA 4DM3A 5L3SB 2POQX 4OLJA 4TS1A 2YJGA 3AZQA 1KO8A 2CUZA 3BHIA 5FDFA 1KIMA 3BE5A 4PWZA 1EJBA 1E7WA 1M2WA 3FUVA 3NX4A 4ICIA 1PW7A 2VH1A 3NEPX 1M10A 5SYNA 2CW5A 2NIPA 2UUOA 4AKGA 3CHYA 4JBGA 5KNCD 2FG5A 3H9EO 2X8JA 1NPYA 3H1GA 3TKYA 1DJOA 4TZ0A 5HVNA 3HM2A 4LHWA 2O8CA 3WTCA 3R7DA 1D1SA 5ADHA 4DQUA 3G9ZA 1GA6A 1X2EA 3P0IA 2VA9A 1E7RA 2O8NA 3KLMX 1A7KA 3ZQ4A 4EJMA 3BMXA 3MNFA 4X8OA 3WZ2A 1UZUA 1SURA 1ODFA 1U7ZA 2SKDA 2FEAA 2W37A 2WTAA 2ZAIA 3ED5A 3LLMA 5EPOA 3WICA 4KQ6A 3TVTA 4EI8A 2QI9F 4QULA 4RA6A 3CJQA 1Y8CA 4Z9AA 4C6TB 4KR0A 2ESRA 4EW6A 1DRJA 1KI6A 3H86A 3RIEA 5JSFA 3ZXXA 3N6VA 4ZQHA 5K3CA 4NXNB 3CSDA 1A9SA 4PO1A 1DAEA 1YNOA 1Z4OA 2A4KA 2DKNA 1Q0PA 2JAWA 3BHMA 4MPTA 2JCSA 4KVZA 3ZKAA 1FVOA 5JO0A 1KEWA 2C92A 2QDXA 4K0RA 5LBTA 5BW5A 2UZ0A 1KJWA 5B4UA 1T4CB 1NXPA 3IPYA 4EA6A 2RHRA 3IQIX 5JYDA 6AT1A 2BDEA 3OU7A 3SSMA 3I2KA 4NYIQ 3UA3A 3WL7A 3FB1A 4HQLA 2H5JA 4FW9A 4RD4A 4BN4A 4CEJB 1HSOA 1XRNA 2M2IA 4MI1A 5JS6A 1P7YA 4KXYA 4OM8A 1WV0A 2V0GA 3BG5A 5DM0A 3VTKA 4G0VA 2TECE 4NCKA 2YJ6A 3K20A 1VSVA 4G5OA 4P5DA 4KIJA 1UBMS 1XAJA 4CCYA 2BP7A 1LW6E 3L2OB 1JTEA 2GTPA 1G4HA 3OA0A 5FBKA 3KKNA 5DNDA 4CTNA 5AQ1A 1NRIA 3ZY5A 4YMTA 1CHNA 1UEIA 4FC7A 3U2QA 1L7RA 3W90A 3ADDA 4AZ3A 3GRKA 2ZYSA 3TTXA 1LGYA 2WWTA 1J2YA 4OO3A 2XE8A 2WKQA 3Q3CA 4WINA 4I3HA 3U31A 3GLIA 1RM4A 5GINE 3LUFA 1I1NA 1ZK0A 1SZDA 4J9VA 3NM5A 4K0KB 3QWFA 3C4VA 4D3SA 5C0OE 2ZDQA 1L7MA 2DUUA 5G0UA 1GZHB 4EATA 3HYSA 4F72A 4DUGD 5BWOA 3OZCA 3PS9A 1HE5A 2EG5A 3TZLA 3O4FA 1MJGM 3PU6A 3SJZA 2D8AA 1VZ2A 1PLLA 1M34A 1EFRD 1FU7A 2CXOA 4XR4A 2ALJA 3V34A 3DSRA 3ZHZA 4D3YA 4EFDA 3R40A 1TLLA 4EF5A 1Z6AA 4QO8A 2IH4A 4ZAXA 2G82A 2WV7A 3I2FA 2WF7A 4HB4A 5FUVA 1YDMA 3OWHA 1FYEA 1V3UA 4H4EA 1J1UA 1L6IA 2BKXA 2I33A 4JP8A 4KDCA 4UCXA 5BOVA 1Z9BA 4EO7A 1GTL1 3KR2A 4NJEB 4MVCA 4HDCA 4E3ZA 1DWOA 3NHSA 3QHAA 1MIOB 3GRUA 4AYWA 4DJ5X 5JATA 2HF2A 4NU5A 2ZDHA 4BX2A 4FXPA 5FWXB 3OEHA 2OCKA 3O1LA 5TC4A 2J32A 4RY9A 5H7XA 4PZAA 5BR7A 5HS4A 1LBSA 4KPUA 2QUKA 2D5IA 3AEXA 2REOA 2EJUA 3QKRA 3ZWQA 2I8AA 1G8GA 4GP6A 2QS9A 4X7RA 4P7FA 2NXCA 1G3UA 3N2IA 3NM4A 3ILHA 1MB3A 4FX5A 1VIAA 1ZZEA 2DY1A 3Q7PA 4LJ9A 3W8FA 2OFWA 2H7VA 3A7DA 3AESA 3E7PA 1ZM3A 2XADA 3FR7A 2DBRA 3GUYA 1V5IA 3M33A 3CX6A 3MUOA 1XROA 2AFIB 1QC5B 3KBBA 5AD1A 3UFBA 2XAAA 2PTGA 4PLVA 1ZM9A 3OHMA 1XMQB 1TM5E 2AFHB 3K0EA 4RF3A 3O8OB 1HOTA 4PQFA 5DNUA 4QJBA 4DM4A 1X1SA 3BGDA 1GRCA 1SUIA 4C4OA 4LG1A 1JMKC 5HJ7A 3TDKA 3K0FA 3X1DA 1FMFA 1UOOA 3AT1A 3RFVA 3C7AA 4JBHA 4TV8B 3ZU4A 3ONNA 1LDGA 1IHPA 5FA5A 1FS4A 4CIBA 3UJ6A 1HX7A 5KKNB 4RY8A 5A7HA 2BDTA 4JLUA 5GZ3A 3IP8A 1Z0KA 5DTQA 4AZ0A 4BBAA 2GM9A 3A1VA 5GIPE 3IVXA 5BYJA 1XTKA 1H2WA 4QQRA 3I0MA 4X44A 4W5NA 2IXAA 1DAHA 4M87A 2XDAA 5CHEA 2R5WA 1IXKA 5AXCA 5TX7A 5EIBC 3AF2A 5CAEB 1Z73A 1F0NA 1G60A 1ETHA 2NUPA 2W5UA 3DAPA 4OHOA 2R85A 3Q8LA 4OU5A 4XJSA 3G8YA 4JLVA 3RYIA 3UTCA 2ASEA 5EIFA 1JXAA 3AKYA 4FIZA 1XF9A 2DC1A 3SYKA 4I5FA 2W2NA 1L8AA 2WG1A 2PT7A 4EELA 5FAKA 4Z0HO 2IEBA 1M6NA 3VJRA 5E6RA 5D3MB 5JPCA 3JQ9A 5DK4A 3B6IA 4I1UA 3M1LA 1VLMA 4JI0B 2FRVA 3EEIA 2V7UA 4FHCA 4LDPA 1E6WA 5TQ0A 4WVFA 2ZRIA 2CNKA 3EZ6A 2GFIA 2SKCA 3EXIB 2JC3A 4AUNA 1RACA 3FETA 5JC8A 4YPOA 5E8RA 5A0TA 2CNWA 4IJMA 3RRJA 3IULA 2F1RA 3TLAA 4LE1A 1YVPA 1GZ6A 1BMFA 1JLKA 4B3DA 3UN1A 3OFNA 1AKYA 2WJ6A 1CZNA 4IDDA 3ZCQA 1J00A 1EWVA 3JAKA 1JSZA 1Q44A 2IYZA 2O2HA 3O1IC 5AM0A 1HT2E 1NR1A 2YV1A 3E6AA 1TUBB 3ANTA 4P98A 4S12A 5IYZF 3SZ3A 5B36A 3CVVA 1W47A 2Y66A 4I9FA 4FEYA 3WSVA 3LQKA 1F3OA 4GGOA 5E3JA 1RDFA 1H6AA 3S28A 1ZRHA 4KZKA 1HFJA 3ZDYB 4CKCB 2ONCA 2XGOA 3RUEA 2FEOA 2EJTA 1GFIA 3PUWA 1RVV1 2PR2A 3A3OA 5LP1A 4TVBA 4OK3A 2RI6A 5FWNA 3I58A 3DZBA 1Y7HA 3TSWA 4BLVA 3LY9A 2OZEA 1LDMA 4NZMA 3HM9A 1I3MA 3SLKA 5KWSA 1NC1A 2UZAA 1J42A 1VRCA 1EINA 2WWIA 2ZBUA 3G1TA 3LUKA 4RSRA 5BVHB 2I4RA 4JB8A 5LQAA 3NBZC 4K1XA 3LT2A 5EQTA 2HEGA 4C4PA 4Y2QA 5DOZA 1ISIA 1PJ4A 3OMXA 4FFLA 4JLKA 4Y2GA 5I7AA 2P2SA 3K0AB 1F9EA 1CLEA 1CUVA 1OGIA 3ZV5A 2OHHA 4HEA6 2XUJA 3U4CA 3EZXA 1WAMA 4HSGA 1IY0A 4NK4A 2MSEB 2SCUA 1XNGA 3RYCB 4C2AA 3PCXA 3UG6A 4XUDA 5AWFC 1X39A 1QGDA 1XLWA 2PCLA 1DKPA 3EGCA 1ZK3A 5GAJA 4KN9S 2I9PA 4AZTA 1E3DA 2RC5A 3JQEA 4LZPA 4A92A 2MIIA 3HRHA 4JELA 1GUZA 1M7HA 4XX1A 5KS2A 2CL0X 3Q5DA 1RI5A 3CNBA 1EJ0A 4HSEA 4CDMA 3GVHA 2HHCA 1E5QA 2G1KA 3AR8A 3EISA 4LGVA 4NE9A 4A16A 3LK7A 2A0FA 3AHFA 1Z8HA 4JV5B 1AXEA 2CLHB 5I45A 3AP2A 4EJ2A 2Z8ZA 5G3YA 5AK0A 2M9MA 1N2IA 1U4SA 5ELMA 4ATNA 4D9FA 1AK2A 3QH4A 2FMXA 2JCBA 5H1YA 2WILA 3BMNA 3FZEA 3ETEA 3GJ6A 3KJQA 4RD1A 4ZI7A 2CNDA 1E1CB 3MRVA 3MFQA 3WGYA 2VJMA 2X0RA 4Q03A 4BTEA 2ZROA 5BRAA 4AJIA 2CF5A 4DNXA 2ZUBA 5K3AA 5DOVA 4LKRA 3WGKA 4I81A 3K1AA 3A9RA 4PGFA 1N2SA 1NWHA 1YS6A 2J4FA 4G24A 4M1KA 4UU1A 4CL0A 2PSEA 1X7ZB 1D9ZA 4DEXA 3TW0A 5JFGA 1JFRA 3UV3A 1LLDA 1ZL0A 4DQVA 1BMTA 1T6ZA 3OD1A 3OE7A 3LO5A 2OVBA 3SDSA 3R8FA 4D0NA 3NT2A 2WOOA 3KR0A 4TRRA 4X1YA 4Y9RA 3QG1A 2QRQA 4ZT5A 4BJ1A 1E2DA 4D9EA 1SOVA 5G40A 1QHXA 3G5AA 1TJ4A 4M1WA 4NNJA 1VLLA 3DAFA 4TOIA 5F9MA 4EKEA 1NG1A 1S9HA 3F5SA 4INOA 1EAYA 1WDKA 4DNOA 4C20A 1OH6A 4GKJB 2ZUWA 3A2MA 2VUHB 1JU9A 2AOVA 3ZI7A 4KLCA 3R7WB 3GLSA 4C87A 1XTBA 3HU1A 3FXAA 3R0ZA 4LSWA 1SXGA 4K6FA 4QWWA 5CB8A 4DT1A 5JT1A 1TCVA 1LCIA 3UEOA 3DR5A 3EYAA 3O8LA 4GLBA 3TFWA 4LTNA 1N5KA 1I6LA 1EQ2A 3ICPA 4Q4AB 2I03A 1EFTA 3VR1A 1T3GA 1ZMOA 2LRHA 2O7SA 4L07A 1DC4A 4ZT6A 3IE1A 4OLBA 1EIWA 5BSKA 1S1CA 3BORA 4XZ3A 5T7BA 5IJWA 1GUDA 3RH0A 1SHJA 2RHBA 2V7QA 4QXQA 4R9SA 2PYDA 3WV4A 1LPPA 4O5OA 2X1LA 4F4UA 1VXRA 5J23A 1L4MA 5L3QB 2VRCA 3NDPA 4UZEA 4OHYA 2X9NA 4PM4A 5HFJA 3DUFB 1BS1A 2O6HA 3RBXA 1Z6YA 1U0JA 4TWIA 3QYPA 4DBZA 3WNVA 2R00A 2G0AA 2UUPA 4XGIA 2VDQB 3PJDA 1Z4KA 1KJYA 3RUIA 2OM2A 3LFUA 3G0BA 1FP2A 4BQIA 1PG0A 1XTQA 2AKAB 4OXYA 4MUMA 2OZKA 2A2ZA 3L1VA 4RCVA 4AZVA 2B4RO 3ZHXA 1E1LA 2G1PA 2QGNA 1JKMA 5CA0F 2BHLA 3SM3A 2C3PA 2VHEA 1ZGZA 1LRLA 2ZT5A 3DAOA 1OPXA 5FBLB 3TR5A 2H9AA 1F12A 4QOSA 4F8EA 3UHPA 3LLUA 3OEYA 4CFYA 4PPYA 3ZHBA 1MFPA 2PFGA 4BBJA 2DH6A 2P4SA 2WJAA 3BXHA 3FCXA 4M54A 4Q9HA 4YAIA 5AVQA 1OYVA 3L05A 2V98A 3A27A 3WB0A 3KQMA 1IIBA 1CPYA 2P2NA 3UWSA 5L8VA 4DCOA 3NG1A 2PIDA 4CV3A 2X3YA 3P97A 1MXHA 1E3QA 1EFCA 2R1VB 5AVUA 1R8YA 1QGYA 5IVPA 3AM1A 1B26A 3HR4A 4XGKA 3D0QA 2QSYA 3LLSA 3AHCA 4LBWA 3R74A 4AF6A 1ZIDA 4EHJA 4F45A 3B38A 3T5GA 1H05A 3A0RB 4CLOB 5DYNA 2GXAA 3OLQA 4OPMA 1IATA 3U7QA 5EGSA 1A9OA 1YKSA 5SY6A 3OQ1A 1SCDA 3P9QA 4U2FA 5GGXA 5CA1F 1YZKA 3NT5A 1RXCA 2AR9A 4G65A 3O4RA 1JU4A 4AY2A 5HFAA 3WGOA 1G5RA 2FOXA 3OPYI 5C35A 4REQA 3AFMA 3E7FA 4BUCA 2DBQA 4Q1BA 4HNQA 1CEXA 4HS4A 4DZZA 4LC0A 1E4EB 4KHZA 4Q3BA 4AO7A 2XUAA 2CVZA 3DE0X 5ALNA 3GLHE 1WL8A 1DRVA 1P5JA 3C3BA 2BIFA 3JWGA 4FUTA 2RHTA 5J1TB 5HQ3B 4ZV7A 4Z7JA 3UHFA 3I9KA 1LY1A 1C3XA 3L84A 4LGMA 3H9BA 2JJ8A 1U5BB 1F5SA 2FVYA 4LHSA 1W1WA 2GPTA 3ELYA 2XZLA 4YAGA 1DAIA 2QTMA 3OLVA 3QMMA 1Q1GA 3JWJA 5JXWA 4LI3X 1YA6A 2IBSA 4XTRA 2D1QA 4ER0A 1Z0SA 3DL0A 3ZW8A 1Y63A 4IRXA 1UWLA 4ZVMA 1IHDA 1ZOLA 3CRMA 4A8TA 5FUMA 2YN0A 4QGBA 5KKAA 3M6AA 1Y5LA 4FMDB 2YMPA 4B74A 3HKCA 3OUUA 1I4TD 1JN0A 1TC1A 3THYA 4AY4A 2IPAB 1OFUX 2CZQA 3MJRA 3B51X 8MHTA 1WIWA 2XTMA 5HJ5A 3SLRA 1EGHA 3VHLB 1JDNA 1R9JA 3QEMB 1IY1A 2XHEA 4EA9A 4WE3A 5LOVA 3HKEA 2DLNA 1SU7A 4B4KA 3EDCA 1EGQA 2RD2A 1RHQA 3AUTA 1FZQA 3A06A 4R1PA 3USES 5JNUA 1B0PA 5IEBA 3OZWA 3I5MA 3E0XA 4H16A 4PONA 1EUDB 2JD1A 4O59O 2B0JA 1T4GA 3NBAA 1BNCA 1OF1A 2AQIA 4H7JA 3OCZA 4EITA 1Y9ZA 3E9QA 4B0OA 4XYBA 1CFJA 1K5PA 1UBFA 2H1VA 4CW7A 3BOSA 3VR0A 4DDHA 1PJ2A 2JIZA 5IF3A 3D4IA 2Q4OA 3FZGA 4ILKA 1YOBA 4BNMA 1CZOA 2OYCA 1WHSB 3QHQA 2C5LA 2K2WA 2NZYA 4BV9A 4BEJA 4HQNA 2OWDA 4EB6A 1HE8B 1YBFA 3IVGA 3WXMA 3TGLA 1CQXA 1NUUA 2ZBVA 4Q3EA 1AMOA 4LHZA 3B6ZA 4OB7A 2VQEB 3U7JA 3THSA 3KQUA 3BWXA 3HFJA 1QHFA 5LA6A 4BKRA 1AA6A 1JLLA 2IEDA 4JT8A 1DRWA 3C3MA 3PUYA 1XK7A 3TEJA 2ETVA 3ZWXA 4KBYA 3N2GA 3FMPB 4V02A 4BNJA 3HN6A 5K0EA 5DTRA 5EWMA 1D1TA 3WGTA 4LE0A 4UPEA 2RJ3A 1BEEA 5IH7A 3K1ZA 1RABA 4JROA 3G0OA 1Z45A 4P83A 1QZXA 5BUSA 2HSDA 3ROZA 3SN6A 3U4AA 4C5CA 2ECFA 3G0GA 3MQ2A 4OJMX 2PUGA 2AKYA 4MEBA 4Q4LA 1Q50A 1ACLA 3QOXA 1MJFA 2XT6A 1JE0A 1ZYUA 1MNAA 4KI0A 2H5LA 2ZITA 1USKA 1MP0A 1YJ5A 4R7GA 1USGA 5K8CA 2BY4A 3ACCA 5IG2A 1W48A 3B6EA 4TL9A 2BI7A 4LWPA 3DBRA 2JIPA 1R4NA 1NVEA 2JVJA 5REQB 3DTYA 2IXDA 3WK7A 2XBMA 1AKRA 3KTFA 3HSYA 2H9IA 4WAUA 3DFFA 1NKSA 1L7XA 3PHHA 5AKYA 5HOQA 3N7TA 5HM6A 3A3KA 4R16A 2PBRA 5EKXA 6CHYA 4Q7MB 1QB7A 5D6NA 3W3AD 1YQUA 3MJDA 4TGLA 3ZD8A 4C1NA 2WE8A 5KYWA 2ZZMA 3HKBA 4D0GA 1A9ZA 1JG6A 2BHTA 3EF1A 1AS3A 3OHSX 4HAOA 1N2HA 5IJ9A 4GKAA 2F62A 4RSGA 1NAHA 4ZN6A 3SF8B 2PU7A 3AH8A 4HDRB 3N0WA 4BATA 3KNZA 3I9FA 3WK8A 1T9ZA 1U3CA 1CB0A 3I1IA 1AY0A 2ZUSA 3QTTA 2V55B 4TSRA 4CKBB 1HA3A 2H63A 1B0UA 4R3UC 1ISRA 2IEZA 1KAGA 4E5UA 3PQEA 5B1EA 1EFLA 2RGRA 3ZI0A 4PRLA 1P45A 2COKA 2QLJA 1DO0A 1KP3A 3O38A 4K6GA 1GAJA 5IARA 5JNVA 1KYXA 4OBBA 1CB7A 2LE0A 1ZNXA 2YR0A 1DKUA 4FNMA 1KDYA 4ERXA 4ENTA 2WSLA 4DCCA 4AP5A 1C4OA 3FRJA 1EK6A 1M0TA 3OP4A 4LHEA 1Q0QA 4IHQA 5KYYA 3JZFA 3L7IA 1YGPA 1PWEA 4HAXA 1DCFA 1N6RA 3N28A 4KLNA 1RADA 4DADA 1KO4A 4J0GA 2VUIB 3WKCA 5BSWA 3R7LA 4P0QB 1RI2A 4ND8B 1T0IA 1M1UA 3MFYA 4MULA 3UWMA 5AK6A 2JFFA 4KWEA 5KNCH 2QRUA 2Q7OE 3D31A 4QEDA 3W7VA 3Q41A 1RQ2A 1C3OA 1GV0A 2H8GA 2ZTLA 3DCJA 3EVAA 4Y1FA 3V6MA 2HO5A 4JHXA 4O4JA 2VDNB 2NVBA 3EEFA 4OA8A 1YC2A 4HDSA 4C76A 4DR3B 1A04A 3G88A 4YRRA 3HCWA 3GGDA 4UQOA 3HVHA 1YTUA 4V0ME 2VP5A 121PA 3I34X 4D4MA 1X1AA 2J87A 1V5GA 3CUUA 4JUDX 5CA0B 3TFOA 1O9GA 5C18A 3GLIE 5LIRA 1NSYA 1EGMB 1UAYA 3X44A 1KZ1A 3MGAA 3FROA 4ZAGA 4RPCA 3DBHA 3NHKA 2EAUA 3CLSD 3OZUA 4IDHA 1JFLA 2DTEA 1WY7A 1T9DA 3LT0A 4MKZA 3X1ZA 2JI9A 5KU7A 5K51A 2AN9A 2YHSA 3IQZA 1W1UA 4X1KA 3BREA 1M34E 2P3LA 1DO2A 4JGBA 4P86A 2RFLA 5AH0A 2GSWA 1JSLA 1QO9A 3GDOA 2VK8A 4YACA 2QTBA 1DT5A 2VAMA 4QC2A 3HJUA 3Q98A 4G0ZA 3MWFA 4UNQA 5BYAA 1FUYB 3JQQA 4M49A 3PUKA 4WUTA 3OFVA 5E3IA 3ZK8A 1WB9A 2FZCA 2Q6IA 3TDMA 5HUHA 1NOJA 1KIAA 3CLTC 2QPTA 2ZYGA 3QXXA 3V46A 3D1VA 4KE9A 1KFCB 1TZ2A 1XRLA 2ZJ5A 1XIVA 2Y2UA 4A5OA 1JIJA 2C20A 2HHJA 4NCAA 1EHIA 3PFKA 2ZI7A 1TUIA 4AN0A 1JBEA 4CDNA 4EYEA 3R76A 2K87A 2WTNA 3NEYA 4O4HA 2XQGA 3KK0A 4BO3A 3RIYA 3ZC3A 1NT4A 2B8EA 1XPJA 3LX5A 4W9RA 2WHEA 3EAFA 4XW2A 3UFXB 2EKDA 1KY2A 2PU5A 1FJXA 1YK1A 2WLSA 4D26A 3KHSA 5DX1A 4MEJA 5JAMA 5K8TA 1GZ7A 1X70A 5CPFA 1MVLA 1NDQA 1PL7A 1JEQA 2IIVA 3IUPA 3RU7A 4D6PA 4DIOA 2WQ6A 3HCRA 1U9JA 2GQ0A 3JQ7A 4WT7A 4RLHA 2QE7D 3ECAA 3QA3E 4TYQA 4DMKA 1QHHB 5AJXA 3R9IA 1BE0A 1DRKA 3M3PA 4BXOB 5EE0A 2O7QA 3RF6A 3ZCVA 4Q66C 2RCYA 1FXUA 2BM0A 1QU2A 3W6NA 4YUVA 3ZGZA 3QKIA 1S7GA 1ZMRA 2QT1A 1XEWX 4O8ZA 2F8SA 3FIUA 4LRXA 4QOHA 3HDGA 4URXR 2VF4X 1VMDA 4U0JA 1S01A 3DE7X 1PZNA 1YR6A 3E3NA 1RZUA 3DBVO 1TNDA 5DI9A 4BFSA 3ZGXA 4F6CA 3V2UA 1QUFA 3RAPR 4TUYA 5KJEA 2B7BA 3AZPA 1FFWA 3AF1A 3IMEA 4BNVA 3FLEA 4WECA 3MRXA 4YJGB 3O3OB 1K1EA 4KGVA 1OLOA 4I6GA 5TIIA 3HN7A 1M5RA 3W78A 1STOA 5LMZA 1FU4A 1HDGO 1HZZA 4DJJA 3DOOA 1TYZA 1P9RA 1BH2A 1TMYA 4WD3A 4C22A 3ZPXA 3K70D 5F76A 4HH3C 4JLWA 1Z63A 1QIIA 1JEDA 2HSWA 3H17A 4IIDA 4H4DA 4PX2A 3QVSA 1KRHA 2GOYA 1O3YA 4LOAA 3AY0A 3DONA 4OQZA 5CCDA 4DLVA 4ZRDA 3CLRC 2VIIA 4I9NA 1XA3A 2NU8A 4RO0A 2GJ8A 4RVNA 1KMHB 4Q4HA 5T6BA 4M6WA 4EPYA 2GN0A 2QYSA 1CHDA 1Q92A 4CQJA 4C21A 2QTFA 3VO1A 1ZVKA 1KI3A 2GKOA 1CD5A 2EFEB 2XYRA 2I4NA 3MYRA 3OEED 1XOIA 4J90A 1QWOA 2IGTA 1JT2A 2O6LA 2VNJA 1COWD 2NQ2C 1M8GA 2PD4A 2QGZA 3EA4A 1CDZA 3OJ0A 2M6LA 5CB4B 5M29A 2QQFA 1H2AS 4J94A 4OQLA 5ED0A 3W05A 2AUMA 1RXYA 3GH1A 1ABEA 2W7TA 3I6BA 3AILA 1NN0A 4YJDA 3E9MA 5ICFA 3VM6A 4F2WA 5EHNA 5NULA 2R00C 1RKVA 2A5JA 4JJAA 3U4DA 1UC8A 4LF4B 4MUIA 3T6KA 4URFA 4ZXFA 3ADPA 5HPYB 4TXNA 1XD2A 2Q3DA 3F6RA 3QA9A 3UH1A 1WS6A 2AWNA 2P4EA 2QTGA 3M9LA 3UG7A 1QTNA 3ICEA 3FN4A 4CQLA 1RP7A 4N9WA 1JEAA 4OUDB 1GPLA 1L1FA 2H3HA 3G3EA 2J3DA 3E4CA 4LFBB 1KFEB 1IZ0A 1IG3A 3RYTC 5LQSA 3OAAA 2EP7A 3SU8A 4RK7A 3VQTA 2VZEA 1L7BA 4XWOA 5GTDA 3MTBA 3OTGA 2FETA 2OZLA 1YRYE 4EG5A 1HNXB 1EXMA 1QH1B 4BASA 5B58C 4Y2TA 3UENA 3GJ4A 4KVFA 5CXQA 2A57A 2IYSA 4PNZA 2G09A 3TQCA 1CP3A 1WKVA 2HYDA 2BGMA 4MV5A 1OI2A 4OUKX 1ACMA 2RE8A 4G2TA 5LYYA 2NUTA 2ZI4A 1ZISA 4IL5A 5FXMA 2A0XA 2ZRNA 3TE6A 2IP2A 5KPDA 2J31A 2I3GA 1OOEA 2A9RA 1Q0RA 2OYRA 4CUKA 3SSOA 3GZ4A 2XE4A 2XYVA 3E1SA 4UM9D 4V2UA 4HD8A 3T34A 4CMBA 4EHBA 1TU3A 3KM0A 2HCBA 4LV5B 2DETA 5GMOA 3VNRA 1UEXC 2W6QA 1FPMA 3NIBA 4TQGA 1LLCA 1USVA 4A7PA 4K7JA 4Y1RA 1T8YA 2QROA 1KJQA 2HU5A 3JD3A 3E5MA 2BGTA 4J0FA 4NMXB 1QG0A 4F6RB 4ZIRA 4YWHA 3I3SR 4XI9A 2PUFA 1NU8A 3NAGA 1C9YA 1JNYA 1VP9A 3AX6A 3IHTA 9GPBA 2NSJA 4FBGA 4RA9A 4BKPA 2XCIA 1NW4A 3AI3A 3MLAA 4QOFA 4EVRA 4RMGA 2J5KA 4A8JB 4M9ZA 5H4GA 2OB2A 2XCRB 1QGOA 1KNXA 4LFCB 2A14A 1NVXQ 5ESXA 2PUHA 4ISCA 3AXSA 2Z1DA 1U1GA 2UYCA 4NBKA 4C04A 4EGSA 5KYKA 5J9FA 1A8SA 2HWYA 4ZEVA 5LKAA 4P2BA 1NVWQ 4R01A 4R1SA 4HDKA 2PGOA 2O2CA 4OGKA 1HLPA 1TGVA 2QTTA 4HC4A 1P5HA 3G9TA 4FX2A 3WLFA 1ULTA 2ZULA 4UHFA 5B64A 3CQ9A 4U0KA 2PV0A 3F6PA 1GZDA 3G9QA 3IT3A 4O25A 2RCNA 4XUGB 3I8OA 4G4IA 1ORIA 2N0SA 2OHXA 4EENA 3AV3A 1AOXA 1JKJB 1QORA 3O9VA 3S2FA 2GDZA 3AGPA 2OSVA 2DM6A 3N70A 4S1OA 3MXTA 4KYUA 2H0RA 4K6MA 2QP3A 1OV4A 3UHJA 2I1QA 5HIAA 2GKGA 3FNEA 1Z4NA 4E5DA 4OHMA 4PE5B 1QZ3A 2VJPA 2C4UA 1G0OA 1P62B 3A1UA 1V4BA 2HIGA 2WQZA 3FFWA 3PT9A 3AEUA 4GE0A 3NEAA 4QFDA 3M5WA 2P1DA 4FM9A 3C3KA 3DYIA 4GECA 1ISGA 1KJJA 4INZA 1GNSA 1G3IA 3TLXA 4BV2A 4PPNA 3BWDD 3I4CA 3E22A 1XEWY 4YT5A 2PL1A 2BH2A 1EWRA 1G9XA 2W71A 4D3FA 1HY3A 1G18A 2ZBGA 3FDXA 4K9RA 4MUNA 3ZXSA 5CJPA 4R8RA 2ERXA 1T9CA 1VCHA 2NUAA 4ZVOA 4POOA 5K7SA 4MJ3A 4LJLA 3WFZA 1P4GA 3PDWA 5AICA 3GT3A 2Q3HA 1UPBA 2PX4A 1QRAA 2WU4A 5FR2A 2V74B 4OQNA 1YHZA 4X00A 3MWGA 1MRNA 2ZT6A 1EVEA 1P4JA 3CF4G 4L4UA 3L5KA 1DBWA 1DEKA 2VP0A 4XFKA 2DAPA 4GMKA 1Y34E 4KDFA 4W7SA 3ZWPA 3B78A 4J49A 2QE6A 4FJ1A 8AT1A 4MV8A 1VJ5A 5AKGA 2O2JA 5FCDA 4MITA 2DWQA 1M33A 1E1RA 2J33A 2K2QB 1V8OA 1OAKA 2HLDD 1Z07A 2PGDA 3QVKA 2H0QA 4OK5A 4WXRA 4XX0B 1ATZA 1IAVA 2LW7A 2CHVA 2OG2A 2QMEA 2GH1A 1I3NA 2YY5A 3FSJX 4ON9A 4UBJA 2Q5CA 3RSCA 1XEXB 1DQPA 2ET6A 4B43A 3EXAA 3HFRA 4OF4A 3BILA 4UM5A 5K4AA 1IWBB 1TPZA 4MQFB 1YA8A 2EARA 2HJGA 2P9JA 4PGAA 5IASA 1RXEA 1UBUS 3EGXB 1V7QA 1VLJA 1E79D 1FQKA 1KYQA 1MX3A 3KOMA 4NK5A 2ODPA 3H5LA 1AKWA 1IHUA 2YXPX 4BRSA 3L43A 4DDUA 2CFIA 1UXKA 4V0KA 2P62A 3MMXA 5BV2P 3E7WA 4BO7A 1LBHA 3UMMA 3A1TA 1KE2A 3NALA 3W1WA 1QK3A 4N0DA 1RTKA 4YR9A 4X9XA 8GPBA 2Q6TA 3DOHA 3MAAC 1DC7A 4E1AA 4TYWA 4YP9A 5T41A 5F23A 2Q27A 3CYFA 4BP8A 1OZGA 1CDOA 3EAGA 3S81A 3IHWA 3O8QB 5BOSA 3HR8A 2PMCA 4PS1A 4RTKA 1YHYA 2OHGA 3LBNA 4KIWA 3SYRA 4RY0A 5J4VA 3G8AA 1Y42X 2V3WA 3QY9A 3HVRA 1JHDA 4HRVA 3B53X 3RU2A 2DHQA 1NX6A 3ZCUA 3AF0A 2QQ5A 2R2GA 3A4IA 4YMLA 3IBCA 4RJ2A 1M2FA 4M0UA 2ANCA 4GKKB 1KYWA 3MS4A 1S5PA 1SVUA 3BIOA 3WK9A 5LP6F 4FR5A 1TFRA 2BHNA 1LVHA 1VG1A 2EKPA 5B7NA 1J9ZA 1RQGA 1U98A 3R20A 5G2OA 1DP4A 2TRSB 1REQA 3VU9B 3MJHA 4NZ9A 4MB2A 2GBGA 2MSLA 2JAPA 3ESRA 2C54A 4WNIA 3SD7A 1FJGB 3O8RA 5LBUA 5THKA 4PFSA 2H00A 3IIIA 4CIDA 1N75A 4LPSA 5IT5A 4OD0A 3E9EA 1JA9A 1TOAA 1OHHA 2D13A 2BEUA 2PYZA 3INRA 4G0QA 4RENA 2ZRKA 3W2HA 1N3YA 2XRFA 2HCRA 5CT9A 1EXNA 3HI4A 3KSUA 4XRGA 1UFQA 5IC4A 4ID3A 3CMMA 4CL8A 1F0PA 3VZCA 3KJZA 3LWBA 4LJSA 4UTRA 2QP9X 3FJOA 1PSDA 4I4CA 4UNSA 3DT8A 3OPVA 3Q8MA 4YV0A 4BO4A 4ACAA 2JGJA 2WPDA 1ZUNA 3DE6X 3GT7A 1GYRA 2YHIA 3RSOA 4O4IA 4DKXA 1JQDA 2FPIB 3AO0B 1N5MA 2FCAA 4TTJA 2WY2D 4JBIA 1L9KA 3LW8A 1NLUA 4MR8A 2X6QA 4NCNA 5FADA 5SZJA 1TD9A 3GVIA 5MF6A 1G1AA 3WHLA 3B3JA 4FEGA 2C04A 1K2VN 3HXTA 4QKQA 4RULA 1PVOA 4EY6A 4Z54A 2QSJA 3IDFA 1ORDA 3UWKA 2JIBA 1PCXA 1RAGA 1VL5A 4XPIA 3SI7A 5JWRA 1ABBA 1P29A 1N25A 2FX3A 4FDVA 5FL7D 3JRXA 5TMBA 3QJ5A 3TDNA 1VHLA 4OFWA 3FF1A 2ES4A 3EMKA 2BVNA 1J24A 1XAGA 2C8VA 1NBHA 1KJ8A 1M8KA 2WYUA 2ZQZA 3FKSD 3NOQA 2J9ZB 4HPWA 4JSTA 4MW2A 4CIXA 5JYEA 3R5TA 4CM3A 5D7BA 1L3CA 4I5DA 1YB7A 1VPDA 3ASZA 4Q9KA 2HK8A 3C16C 1AD2A 1U3VA 4ODIA 5DTEA 1AZLA 4KFUA 3G5TA 4JBWA 5F2KA 3SZUA 4FR0A 3C41J 1CF4A 5LFAA 2A9VA 1U02A 5EMKA 1ML4A 3DT9A 1P81A 2DHEA 3EJWA 1OZAA 2Q0HA 2J9FA 3SX0A 4GXNA 5CX4A 2OBYA 3VHXA 1BFKA 1NOKA 3FGZA 3O4VA 3OOJA 2EZ4A 4D9JA 3CZ4A 3O2NA 1PJBA 2GD2A 1XKQA 1C7JA 1G5FA 3PQ6A 4AIIA 1MTOA 3H3XA 1I80A 4D46A 2FLVA 4BO1A 2PO7A 4AJ9A 3M83A 1YR1A 5EZ5A 4KQEA 2JHCA 1ZCJA 4PN7A 1Z0DA 2O8BB 4LYDA 1NDUA 2AOUA 3NRBA 2O8EB 1FIUA 4PQYA 2PKXA 2F8MA 4WCVA 4XGQA 4ZAWA 4YRQA 1Z75A 3RUDA 4LK3A 4KUEA 1OGYA 4X6LA 2ZPUA 4F4HA 3WGNA 5EI5A 5CLLA 1DSSG 2X0JA 3TW8B 1A97A 5AW0A 4ESVA 2GZAA 3Q1LA 1HQKA 4LVNA 3TSAA 4M1QA 1NZDA 2E9SA 3UMSA 1X14A 4G37A 4MWTA 1RAAA 2H59A 2P9HA 2XUQA 4HVTA 1P74A 2B3DA 2D5AA 5EAIA 2I91A 4KO2S 3AUJB 2HC9A 1PNVA 1E96A 2JFWA 4HX5A 4MCJA 4BO0A 3EEQA 5AUNB 2QL6A 2OXCA 2I6QA 5CUQA 1NLFA 5I7EA 3MUFA 2X2EA 2BWJA 2IWRA 3TVYA 1ZW1A 2VHXA 3MCUA 1EA7A 2QVCA 4LGCA 3K9QO 1W44A 3NV9A 3HEAA 1TDJA 3KE9A 4QUEA 3MHTA 4F2HA 5E95A 8ATCA 2J0UB 1F38A 5DM4A 5K0FA 4PLTA 5TR9A 1R0SA 2IGBA 2YIJA 3ANNA 3RK0A 4B79A 5IFLA 3HXKA 5J5CA 3DTVB 3T9FA 3ZD6A 2BEWB 3LBHA 4DAOA 1F4VA 5ALZA 3AF5A 4EHKA 4D44A 1XPRA 4H17A 4DARA 1UC9A 1E6LA 1XELA 1IJFA 2EHDA 1QQ7A 2PEZA 3TINA 1SHKA 4EYSA 1CR0A 5JJKA 3KE8A 1Q7CA 4KN8A 1MFZA 1CJTC 5E6SB 5HZMA 1IOZA 4C03A 3ZBUA 1M0EA 3MJFA 3I2GA 4NCHA 2A9KA 2NU6A 1ADFA 3U39A 2PSDA 1NURA 3ZS9A 3GCWA 5JARA 4G0XA 1OZHA 1YCDA 3CCFA 1L0BA 4Z4IA 2FRXA 4GG1A 3AFHA 2XYGA 3TRJA 3SQOA 5ANRB 4JQSA 1HYBA 4JT4A 3HY4A 5H9VA 4D4KA 1E0KA 4WBSA 4YCBA 3RBAA 5DM60 1SQGA 3VUFA 3LCMA 4AJNA 2ISSD 4JQZA 2OXIA 4B31A 4W5TA 3GA0A 1PJQA 2GF2A 3ZQJA 4LISA 4AN4A 3H5VA 2XZPA 3H9GA 1KYYA 1U0FA 1WSDA 5THXA 2PWYA 2B61A 2CBGA 4ARBA 4CM4B 3H83A 3QLEA 1TCAA 2J8ZA 3RC2A 3Q4GA 4HZIA 3NVKI 3B5JA 2CDRA 2OCAA 1Y1PA 5DXAA 3ZVRA 3V1LA 2Q3EA 3BD8A 1EHYA 4XIJA 3SM9A 4A5SA 4ZT3A 5J2TF 4V1CI 1SK8A 4QUAA 2L0XA 3SIPA 3HWWA 1SGWA 2FPSA 3WNBA 3N2YA 4XQEA 3JZDA 2VDJA 4XPZA 5LL6P 4J9UE 4WY5A 4MZXA 2QSUA 4C0JA 4EPRA 1JG4A 2GWRA 3HHPA 1LVUA 3W3AH 8OHMA 1I30A 3OT5A 2O3RA 2VHTA 3DOCA 4FEAA 1VMAA 4UOQA 1BE8A 3CT6A 2WWYA 4PANA 3BSWA 4QHSA 3VC1A 1V1MB 3H84A 5IS2A 1RBZA 2BC9A 3HCAA 4C0AC 5KSOA 2Y1XA 3ABZA 2FSFA 1V47A 4LOJA 5C8YA 2BFPA 1XWFA 1AHHA 4FS8A 2H52A 3HTXA 1UK7A 4DB2A 1XKLA 3NNDA 1DXQA 5JSZB 3CMCO 1GVNB 1U7DA 3K9NA 1GM5A 3WB9A 3GNQA 3KDAA 2GXUA 2JGFA 3ZU5A 3S7ZA 2HSEA 3HV0A 3E5NA 4G4SO 1R5OA 4DZRA 1OXSC 1KI7A 5JD3A 4AKIA 1HQDA 1ZHOA 2XV1A 5CVCA 2Q5LA 5AM1A 3R9XA 1JWAB 1XYYA 3QI2A 4IIUA 3ILXA 4PFJA 3O4GA 1WVMA 3EMVA 4HFMA 4FKMA 2F2TA 5FNVB 3CCCA 1KI1A 4MUXA 1MN6A 3NAMA 3M2TA 3OC0A 1NF8A 1D2GA 1XWWA 2G9VA 2XBUA 3EQ6A 4OM7A 1O08A 4LYGA 3LQRA 3DM9B 4U6QA 3RANA 5KHAA 1XQYA 1G66A 1TF5A 2BL4A 4OHZA 3RC8A 3ESXA 1OXBB 3MHPA 2BHSA 4JR2A 1GEEA 4LYEA 4NKRA 1LS6A 2GEUA 5CGQB 3VAAA 1UT6A 4R2JA 1K7EB 1Y7PA 4N5LA 1P6UA 3SJAA 1L5MA 5FV4A 1XRSB 3B48A 4U7PB 4CMIA 3UAVA 4NZZA 3WJ2A 1RZRD 1BJRE 4EMSA 2C77A 3C8MA 3UQZA 1LPBB 1UDAA 3HGMA 3ZXUB 3MMZA 2C9OA 1WU8A 2EYUA 2ASVA 2WJYA 4OI2A 4M86A 1UJ2A 3GLHB 3I61A 4XDZA 2JL1A 2ZANA 4QBGB 3E15A 3ICQB 3A4LA 1Y4DE 1B16A 4DCTA 2QYOA 1YI8A 4P4TA 1PDOA 2HDNB 1NT2A 4ZQFA 5H81A 5FUYA 2OHVA 3RGWS 3NYWA 4I4TA 5LN1A 2RMKA 5A6VA 2QN9A 1Y3IA 3ANMA 4JWTA 5U4QA 4FQ5A 4L3OA 3STTA 1QIFA 3U0VA 2VF8A 4EDHA 3ELUA 1T8PA 3B85A 3D6JA 3KVOA 2CJYA 2FUG6 2WUWE 2IUUA 2ZUUA 3BK2A 1XCOA 1GGHA 2XOKA 3CEPB 3CVYA 1A1VA 3KKZA 4RM3A 3DQZA 3ITKA 5CDFA 4V0SA 3WL3A 2QY9A 4O6VA 3BZBA 4LDAA 1UZNA 1CIJA 3AG6A 2Q1SA 4AWBA 5JBIA 3IEIA 2VYNA 2YVKA 2ZGVA 4EB0A 1H1TA 2FWIA 1UJBA 1IM5A 3EB9A 3PRHA 4IF4A 1P0IA 1V48A 5K0JA 2NP7A 1LLFA 1NMYA 1B7GO 1CUBA 2Q8PA 5PGMA 4F4IA 1EXVA 2VQDA 2CD9A 3IOYA 2PXAA 1TM1E 1ZGCA 1BS9A 1R0RE 3B1WA 3E0QA 3QVVA 2M1ZA 4MS4B 4MUYA 3LXUX 3EUEA 1CRLA 3QPVA 1D4OA 3KT0A 4PAMA 3EBOA 1VECA 2BSQA 2WHQA 2VBCA 3BC1A 1P4RA 3OIYA 3PC2A 4GHWA 4RGVA 4XB2A 5JRDS 2GILA 3Q2OA 3S6JA 3NHMA 3L5OA 3OEEA 2PRJA 4QUIA 2YJZA 3GCDA 2VWHA 3RSQA 1N33B 1YS7A 1Y89A 2P75A 2YWFA 3SS9X 1M2VA 3DM5A 4DR4B 3SICE 1EFAA 1GPYA 4Y2SA 2IOYA 4E4TA 1NSFA 3OECA 4AT1A 4KG7A 3EXFB 3DEYX 2YZNA 1AK9A 4RIGA 2Y76A 1SCBA 4BJHB 2ADMA 1LTKA 1PEAA 2BZSA 2GT1A 2OZVA 3GC6A 4U6NA 3V4VB 3LC2O 1DWUA 2AMVA 1SA0B 2XB6A 1ODLA 1UODA 2ZFUA 2X9LA 3KYBA 4GL4A 4TQAA 1LX7A 4FSHA 5JH7F 2BTQA 3K6JA 4IRUB 3AFOA 3FWKA 2D06A 5I7HA 4QIHA 3FZYA 1DINA 1HEYA 3CZAA 3ZYZA 4JOSA 3GLGE 3TRFA 4YC7A 3ZDCA 5DFAA 1N1EA 3TOCA 3PNQA 1NJ2A 5AI9A 1XZAA 1FLAA 1YDHA 1PP4A 1GTVA 3EIOA 3I6IA 4TMFA 3KO8A 3WYDA 1FBTA 1XU7A 2A30A 4L72A 2GJ9A 3X1WA 1IQ0A 4KWIA 3BXGA 3JALA 4AMUA 2B37A 3A6KA 2BZ0A 4BAGA 5ITZB 3SZLA 1YAJA 2G6TA 1Y48E 4LXQA 3DEAA 1O6ZA 1G59A 4GX0A 5EJ2A 2X8JB 1C30A 2C2GA 4RZUA 1L4BA 4F5WA 3INGA 2O8CB 1WEKA 2I6FA 4I1YA 1J22A 1O94A 3OPNA 2PD3A 2WG2A 4AKTA 3QZUA 5HCIA 5BPFA 3IDZA 1GOTA 1ZSVA 5BORA 2O8DB 3RD5A 5LZ5A 4PF1A 4WASA 4J7UA 1TA9A 4RKEA 5EGNA 1NPTO 2OY0A 1PGQA 3CF2A 4FGJA 4RL6A 3WGIA 2W2MA 4ZYYA 1E59A 4LZAA 3BJIC 4RA6B 4UPDA 3H7IA 3IPAA 5FAXA 3RTCA 3UO8B 3VBEA 1KI6B 3DMTA 4I6JA 4N5IX 1U7OA 1YZGA 3KLP