3SBXA

Crystal structure of a putative uncharacterized protein from mycobacterium marinum bound to adenosine 5'-monophosphate amp
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
RWTVAVYCAAAPTHPELLELAGAVGAAIAARGWTLVWGGGHVSAMGAVSSAARAHGGWTVGVIPKMLVHRELADHDADELVVTETMWERKQVMEDRANAFITLPGGVGTLDELLDVWTEGYLGMHDKSIVVLDPWGHFDGLRAWLSELADTGYVSRTAMERLIVVDNLDDALQACAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium marinum m
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
total genus 68
structure length 177
sequence length 177
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.2.2.n1: Cytokinin riboside 5'-monophosphate phosphoribohydrolase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03641 Lysine_decarbox Possible lysine decarboxylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sbxA00
2PMBA 3O8LA 4I4IA 2NX2A 4JELA 4HX9A 4KXLA 2F62A 4KXMA 4P5DA 3U39A 3MAJA 1WEKA 1S3FA 3UQZA 1S2IA 4FYIA 3K2QA 4MEJA 2IZ5A 4RH3A 4NPAA 4FYHA 3EHDA 2Q4DA 1S2DA 1YDHA 3O8OB 2F2TA 2IZ6A 3OPYA 4JENA 1F8XA 1S2LA 1F8YA 2F64A 2KHZA 3QUAA 3HNOA 3PFKA 2IZ7A 3SBXA 4WL0A 3IMKA 4MCJA 1PFKA 2F48A 1MTOA 2Q4OA 4A3SA 2A0KA 5AJTA 4LJLA 4LJKA 2PFKA 4OHRA 4P5EA 3GH1A 2HIGA 4FYKA 2A33A 1WEHA 1T35A 1KZHA 3O8NA 3F5MA 2F67A 3BQ9A 4I36A 4PFKA 4JEMA 3OPYB 5ITSA 4LJRA 3O8OA 4U1RA 1ZXXA 4I7EA 1RCUA 2KLHA 4KXNA 1S2GA 6PFKA 5AJUA 4OHBA
chains in the Genus database with same CATH superfamily
3ANTA 1DXYA 2CZQA 5FWNA 4DC1A 2ORYA 4A0QA 2DR3A 2QPOA 3EGDA 1ZH4A 2CCJA 5F2OA 4BMVA 3HPQA 2W2MA 1QDLB 3MUNA 3SZRA 3WRYC 2JAXA 1ZK2A 5E2AA 1OWLA 3ZLTA 4F12A 5JY6A 1NBEA 4MQ4A 3HUEA 1XDGA 4J2TA 1V3UA 3ED1A 3UXEA 5L3ZA 3L79A 2CY0A 2FFJA 1A7AA 1PJQA 4H3SA 4BVKA 5JCJD 1Y3BE 2JA2A 3EX7C 3LQ2A 3DLTA 1JJIA 3FYUB 3V2GA 2WP0A 3IVMA 2QL9A 3AB8A 1B16A 1XK6A 3D7MA 4K9PA 4MPJA 4IFBA 4UUOA 1R4NA 3HUDA 5DYTA 1FFBA 3TQIA 1E7QA 2YMQA 2DRIA 1DBSA 3QIVA 5ENVA 1KSFX 2R9VA 2ZTVA 3DF9A 3HVUA 3KL4A 2Y76A 1I4OA 2ZIWB 3D6VA 4I1UA 1Y9JA 4N7BA 3F6BX 5FTMA 5AVXA 3CLTD 3OJWA 4IIHA 3WXBA 1OH6A 2HA4A 4NJEA 4QUIA 1XELA 3A27A 4BTVA 3ZCSA 1C7ZA 2RHGB 3T95A 3BUSA 4KE9A 1FUUA 1BZYA 2BAGA 4M9ZA 1O6CA 2ZJ3A 1QHNA 2WPDA 3FCUB 1XAGA 1F0KA 1Q6ZA 4GOLD 4QUJA 3Q11A 4B0OA 3SHTA 1MB0A 4YJGA 4AKIA 3F6SA 4F86A 1TJ4A 5AOVA 3GHHA 1M1NA 1XCOA 1S8NA 2IZ6A 5JYCA 4NZNA 2OHHA 2WF5A 1F2UB 5B6JA 1E3WA 5B55A 3RSQA 4FNAA 5JZSA 5JFTA 3PX3A 3UJHA 5HZHA 1SOWA 5EVJA 1M7HA 3QI2A 3IUSA 2HF8A 2QVCA 3O3CA 2XGJA 1LFAA 4DBLC 4EJSB 2PYDA 1C81A 1NI5A 5I01A 3AWIA 5HFNA 4G6ZA 4WOPA 3GP8A 1QAQA 1ZM9A 2HJGA 4ISCA 1DARA 3D4LA 3N6XA 4JQZA 2CLDX 4RYLA 3WZ2A 3H18A 1DZ3A 2ZANA 2DPYA 1JAZA 2QVGA 5L45A 1E7RA 3OA2A 3RRMA 1W7AA 3UXMA 2PFKA 4WDQA 1V7PC 4IZ6A 2QU7A 2P9EA 4D4JA 4FWTA 4DC0A 1SUEA 2IXGA 1XX6A 2ILVA 3KV3O 4OK5A 5K51A 1OYWA 3E8MA 3EEQA 4RACA 1T2VA 3MVEA 5KJ1A 3WFJA 4IIXA 3PIIA 3D3KA 4PS1A 4EI8A 4XR4A 3FSGA 3QPBA 1YL7A 1UBFA 2VZLA 2J3KA 4O4LF 2ZSDA 1JSRA 3PXBA 4MK4A 5DPMA 3ZZTA 4N5LA 4RVUA 3MT8A 3EFEA 3QVKA 5H7XA 3NAMA 1SKAA 4Q1AA 1KMQA 2GQ0A 2QTFA 1ZW1A 1VG1A 5E7JA 4TKUB 1PWZA 2XMQA 4B09A 8AT1A 1S9HA 1MG0A 2ZWAA 3RF6A 5K03A 1SQFA 3PQCA 1J8MF 3E7PA 2XQVA 4FHCA 4JNCA 1MKYA 5I9TA 4DREA 3FG9A 1WDTA 2WTEA 3WNBA 4UM9B 1YJ5A 3R5FA 3OCUA 1V1RA 2HPAA 4N0MA 4B74A 1B3BA 2MYPA 2REOA 5JASA 3OI7A 2DR0A 2PFGA 3ZEAA 1WMSA 1WETA 3IPXA 3K5PA 4CKYA 3EOAI 4MYSA 2OAEA 3WSWA 3DL2A 1KS9A 1E2UA 2OCAA 3ZZUA 3RSSA 2JGMA 2EJCA 3ZGOA 2D3WA 4H16A 1DIBA 3PX7A 4YAUA 1HV8A 3DZFA 3OZUA 1ENOA 4ARZB 1IM2A 3VR4D 3RKRA 3W2TA 2ORWA 1IU9A 1MAHA 5FWYA 2HRCA 3PPXA 4TUYB 3PVZA 3LPDA 5IPFA 2W6QA 4PYMA 4MKRA 3O4GA 2Z6VA 1I3CA 2H5JA 3PQFA 4WW0A 3LXRA 5LQRA 4GKAA 5KNDD 3BS4A 4QDTA 4DCVA 2QUBA 1Z0KA 2B1RA 4OO3A 2I76A 4RANA 3L46A 4CDNA 5BSKA 3LC0A 2AG0A 4AZ0B 2XCTB 3RR2A 2BKUA 4YMLA 1RVV1 5FOTA 3DFKA 2GH1A 4ERNA 4TYNA 3OFNA 4UUNA 4XTCS 3SWWA 5CBKA 2EU8A 3K6RA 3W06A 1SHKA 4FS3A 2C42A 4AJPA 1PUXA 3COWA 1JW9B 1M6HA 2V7QD 3CNEA 3S2YA 2ZRCA 3D8RA 2BHTA 4BGIA 2O5RA 1XTUA 3CEJA 5BVHA 4UZEA 2NU9B 1NSTA 3T9BA 4O8CA 3TBFA 4FVTA 1AXGA 4C4TA 2I2DA 5KWJA 4JLAA 5JD6A 2JGKA 1EXMA 1QBGA 2XMSA 1EBUA 3OLZA 2CLMB 2A9JA 3D3WA 4IAOA 1E18A 1QF6A 5U1PA 1KYIA 4LS3A 3D8SA 1DAIA 4HBGA 3TAUA 5BSMA 1VJ1A 5A5FA 5I6DA 1SU8A 2GF0A 1TMKA 3AR9A 5G2OA 4KQXA 2Q4BA 3IDQA 1I2ZA 4RORA 4RWEA 3UMSA 3SS8A 1CJVC 4NFLA 4DIKA 3D43A 5DE3A 2WHPA 4H7FA 4FX2A 4DMRA 2SCUB 5FADA 3ONFA 4HQFA 4JASB 1GRCA 1Q0LA 4MI3A 4DMUB 4E1VA 1NPDA 3R6TA 2QRGA 1RYBA 3O7WA 1R5NA 4QEDA 4TTPA 3JYQA 1RXWA 1IWPB 4WHMA 1JIJA 2JKVA 2FN7A 3L1HA 4LQ4A 4O6VA 1DG3A 1I7SB 3IKVA 2WA2A 3ZOZA 1TNDA 4OLJA 2JLCA 2GRJA 3GH1A 1U9ZA 5BUZA 5ITWA 4DABA 2WG2A 1LDYA 3GLGA 2G9RA 2GJ8A 3UB2A 4YDHB 3TW6A 2DBYA 2WAYA 2XQIA 2ECOA 2JAWA 5BO5A 1T29A 3GF4A 4C2BA 4YMUA 1IXYA 2ECPA 5LB2A 3FB4A 3EBLA 5ALQA 4LRQA 3T1TA 4KO2S 4ZZIA 2XITA 5C8DA 1QTQA 3JAMA 2IBSA 1J0XO 3U61B 3WWOA 5M34A 3E4DA 2DBRA 2ZI5A 3RS8A 2RC6A 4J43A 1ZC3A 2A1UA 3PNKA 3OQ6A 4EPRA 1W4ZA 3OO0A 1OUMA 3MB5A 4Q05A 3TZBA 1OGIA 1EIWA 3EUWA 3IBYA 1AMOA 4CEHB 3MWLA 1FJ2A 4YJDA 4Q03A 3RS5A 2F6RA 3OIDA 4AF8A 4Q37A 4WLNA 1CUYA 4CKWB 1ZUNB 3CVVA 2CLOB 1KETA 1K7SN 1Z28A 3WJ7A 1PSDA 4H7IA 4KU4A 4RV9A 4BQPA 5LL6P 2HXSA 2J5RA 2MCFA 3COPA 2WUVA 4QVKA 1P9NA 4X3CA 5KAPA 1E1RD 2V9PA 1HL7A 2VA9A 3DDHA 3ILVA 1T4CA 4JUBA 1RQPA 4G0YA 3H5TA 3VR6H 1YQUA 4AFNA 1Y80A 2P5SA 4EF6A 5KSPA 1CJCA 3M6WA 4NLLA 2MHCA 5BN5A 1SCIA 1MC1A 3KZOA 4TTAA 5L7TA 5A71A 4DRXA 1GZDA 4GPAA 5G40A 1YS9A 4HTFA 4ZXFA 3NLLA 1PZXA 3K3PA 4ZAXA 3N87A 3FVRA 4A1OA 5IYZB 5KC9A 3TZLA 3EB9A 2FWMX 4IHJF 3BB3A 5HIAA 2VHZA 1V5FA 2O52A 1F12A 1T91A 4M0KA 3TQRA 3UKJA 4PG8A 1B7GO 1F20A 5EJEA 4KW7A 5JQGF 2HT1A 4ZOEA 1WCXA 1YVEI 2VTVA 3W8EA 4F2PA 1QP4A 5KO2A 1QP7A 4PM4A 3EQZA 3VSAA 3VR3D 2BFDA 1H69A 4IQ0A 4V0RA 5DDIP 5EKDA 2RKWA 2QD2A 2XHZA 5IUNC 1I8TA 1PHPA 3H97A 1IY9A 4BVFA 4YPVA 4PU0A 4EKDA 1D2RA 2J32A 4OGWA 5D00A 4RGVA 3N53A 4YV0A 1W88B 4HVAA 4A23A 3U5ZB 1JH9A 1WB4A 4BLOA 4QREA 3INTA 1DEKA 1E1DA 4KTVE 1U7UA 1PRYA 2AI2A 5F7JA 4DJEC 1XMXA 3OIUA 3MJVA 4BO1A 1SIOA 2ZUUA 2C1ZA 3I3OA 3CZ4A 3L6UA 5IARA 1PS9A 4BNZA 2Y05A 1JSLA 4YUYA 3NANA 3Q6IA 1WV0A 3ITEA 3ABRB 2GNAA 5FTKA 3LGSA 4OL9A 3CGGA 3DHVA 5EP3A 3UMMA 3CIOA 3W1EA 2J9FA 4HDRA 1ZIPA 4ENTA 2CE2X 2EP5A 1XVUA 2J5KA 2AKYA 5IFLA 3GRUA 2H1VA 2XMPA 4QYIA 1VLLA 4DR4B 1YS7A 3WIOA 4EYEA 4KACA 3UTCA 3HP4A 3ZOKA 3ETLA 5BW5A 4ITVA 1UOPA 2P9QA 5IJAA 4EIWA 1UPBA 2GVDC 1CC1S 1WOMA 4XUGB 2WWIA 1VSTA 1ZJ4A 5FOUA 5CBPA 3C6BA 3RQSA 1U0BB 1YU6A 1E0AA 1X0XA 2NQ2C 2RONA 2O8CA 4L4YA 4X5OA 3Q7SA 2VZ9A 2BFBB 4OP3A 1BC5A 4PCAA 1N5IA 3IDFA 1WS6A 1YUBA 2A14A 2GUGA 2J09A 2V5AA 3HCEA 4HDNB 4ZU3A 4YN3A 4JI1B 2X4LA 1G291 1EH5A 3TLGB 4GGMX 2LP4Y 1FNNA 2R8ZA 3G2LA 4LRTB 4OQ4A 2H1IA 2J0UB 1Z6XA 1UPUA 3FCCA 1FBNA 1KYQA 1MENA 3GJ6A 3IUPA 1BXKA 2QVBA 3K92A 1W48A 1DINA 2QI9F 3CKLA 4CNQA 2XJ9A 4WLFA 4ZO8A 2WR8A 2ZI4A 2JEYA 4LOHA 4V3CA 4BNDA 3ZVNA 1BMQA 3BDIA 5IWCA 1E4EB 1Z63A 1JEDA 1N5OX 1LSJA 1R8SA 3PU6A 1YR9A 3LF2A 1R00A 2R8YA 4KREA 1CUXA 1JAXA 1MT3A 2R8XA 3KR0A 3WGTA 2BKXA 2F8LA 4UBOA 4J91A 1F8GA 2ZXUA 2P7IA 1IXRC 4DV7B 2G83A 4AKGA 4BB6A 3EIXA 1GKUB 3T0FA 4LC1A 3U7RA 3OSZA 4YX9A 2PUDA 3HBLA 3OLQA 3ET5A 1E3TA 1ZWLA 4UULA 2Z2XA 4TL9A 3U3ZA 1AQYA 1X7HA 3B5IA 3HJTA 3LX8A 3DTNA 4MDYA 3A9TA 1TVEA 4RHYA 4XUDA 3ZE6A 4HBZA 1NUHA 4UUBA 4AURA 2PE5A 1KDTA 1WNTA 4PQYA 1QG2A 2FN3A 5DV9A 2O3QA 5KCZA 2GTIA 3KIPA 1TQ4A 3GG9A 2FMFA 3KTOA 5JSQA 4JY7A 3DMYA 4D6PA 2Q1YA 3NAGA 5JJBA 4Q82A 5D1HA 4BNGA 4C5AA 1TK9A 2XCLA 1I1OA 1M2VB 1Z8FA 1IEQA 4XSVA 1KOJA 2I55A 5H3HA 4F5DA 5F21A 3LT5A 2WUWE 4MLPA 1EBBA 3BL6A 4P54A 4O0LA 1WW2A 5JS2A 1DQRA 4YXWD 1TEVA 1N2JA 3ER6A 5T67A 3PTLA 3SR3A 4PS0A 3SHFA 4IDOA 4EVIA 5K0GA 2E3JA 2TMKA 3IP8A 3LKDA 2D5IA 4G09A 3QMVA 2FEAA 3QVGB 1QG0A 3INRA 3OJXA 2NUAA 1JQEA 3H5AA 2WYHA 4HVTA 5L9AA 4XX0B 1SCBA 1B0ZA 2JI8A 4ZV4A 2NPFA 3A7DA 4MH0R 1SHZA 3F78A 5A7GA 4DMHA 1Q7CA 1IVNA 3E5MA 4IIVA 4EHIA 1OLSB 5I7SA 3WTCA 2BRUC 3BKWA 3NNDA 4NOKA 1VPEA 4AW9A 4B85A 1XMQB 2ZOSA 4XIFA 2W6NA 1RIIA 4MAFA 4AYTA 4WXYB 4TTIA 1GD1O 2ZAGA 3L84A 4DLLA 1AGRA 2NN3C 3GUCA 1FFXA 3DMTC 3MRTA 1A71A 4OQDA 4E12A 2O1WA 2P27A 4GOMD 1EKXA 3N2IA 1LI7A 2HI0A 5DTMA 1ZISA 1S01A 3EXEB 2Q50A 1IVYA 2B8TA 1FIUA 2G25A 2FY8A 4RNDB 5A03A 1P4HA 1L4FA 1OX5A 4Y9SA 3TECE 4OIFA 2JJ1A 2OQIA 2PS1A 4ESVA 1CEQA 3RVKA 3GAFA 1RU3A 1GAWA 4L5AA 1EDEA 2OECA 3E3LA 2J4CA 4URYR 1FYVA 1N2ZA 2W0SA 2ZWIA 4FBMA 4F96A 4BY9E 2Y4NA 1XVIA 3WAKA 3H9EO 1AVTA 1E2LA 3P0RA 3OZCA 1VIMA 4Q19A 3UUFA 2B8JA 3F2IA 3PSHA 4YJFA 1LTQA 2I3AA 2I62A 1B0UA 1ISGA 2I4IA 2FPMA 4GUDA 4ZT3A 3F9IA 3UJ3X 5JO0A 3EVEA 2H0AA 1M5UA 4I4CA 1RT9A 2O0MA 5DM2A 2EQBA 1OR8A 4JL8A 3BHIA 3ZWYA 3PC6A 4E70A 8ATCA 2H4HA 3ESYA 4ROTA 4ED9A 2O0KA 4GX2A 3J80A 1NT2A 1Q2UA 2V0GA 4NR0A 3HABA 2VYVA 4GPZA 1O6FA 2VLBA 2C99A 5IM5A 2UUOA 4ENWA 5A6VA 4E5SA 1KAEA 1X7WB 3B13B 5CIYA 4LK3A 1I6KA 2FRXA 3BCHA 4DE5A 2WBLC 2JEOA 3ET4A 2VJYA 1S7GA 2R1UA 4LWQA 3KLMX 1L5GB 4EG7A 4TZ6A 1DKLA 4AJJA 5IXSA 1HG0A 1JKJA 1YAHA 3QYFA 4FD2A 4JMLA 4N0QA 2H8GA 2P0AA 2HWWA 3UNXA 5LZ5A 3U1TA 1KGDA 1R0RE 4YYEA 1YQEA 2NNLD 4QYIB 5FOVA 1ISJA 3A58B 2VAWA 1CEYA 3MBOA 3H8JA 4X8HA 2PXXA 3EXEA 2VF4X 3DV0B 1O94A 5K3BA 1T8PA 5LP6A 1MLDA 3T4XA 2YW2A 3N74A 2FWIA 4LXTA 5DK4A 1E0DA 2K87A 2QP3A 2E5FA 3M83A 3N2YA 4U7FA 5JDCC 1KE1A 1NLFA 2D0IA 2HNKA 1O58A 1E2HA 1PI3A 2H8KA 1QTNA 3WGZA 4C2TA 1S1MA 3GRFA 2BSXA 2CHQA 2CFOA 3CZPA 3SC6A 4WV3A 3S5UA 4PX9A 1UIRA 5BSRA 4DQDA 2YN4A 1SHUX 1VSBA 2P2LA 2PPVA 2II6A 3K2QA 5LLTA 3QSYA 1C3OA 3IX7A 1GG9A 1V1MB 3MERA 1SKBA 4YTEA 1GL7A 3VKHA 4B31A 1M2JA 4O2RA 4A8JB 1MJGA 3TRJA 3IUYA 3GPCA 3JVIA 1N7JA 2ZSFA 1YVRA 3N9IA 3NVAA 2B2CA 2BSAA 1M2EA 3RBZA 5B1YA 1YRHA 3OM1A 2I22A 1R0XA 3JQFC 4HAZA 1G0OA 2Q4RA 2H08A 1SZCA 5H1YA 4RESA 4DDHA 1SNYA 3A04A 3CG0A 4L74A 2X40A 3WRXC 4BZPA 4KO3S 4MQUA 1D5CA 4DA9A 4B6EA 1QKIA 3BB1A 4DMMA 2R6R1 1XQYA 2V98A 4LZPA 1KMCA 1CUGA 5DGCA 1JHZA 2O7QA 3F90A 3WGHA 4KWCA 4XDHA 5FL3A 2BGMA 3S68A 2D5BA 5IFKA 2VTEA 4QODA 3TIFA 3VV3A 5K2MA 3B9QA 3AR8A 4N0DA 3VH2A 3ZD9A 5LIRA 2NZJA 3ABZA 1FNCA 1GZSA 5SV2A 2YY6A 2OHJA 4JSRA 2AKEA 3A1WA 3FTEA 4D0GA 4NBSA 4KP7A 4KFSA 3VO9A 3T3DA 3UMBA 1TZ2A 1YR2A 2DWPA 1OLUB 2E6KA 2QLLA 5JMTA 1LBEA 5E0OA 1UBUS 4TS4A 1ZG3A 4H0FA 4MB0A 3DTVD 4PPQA 2GVZC 4BFWA 4JJKA 3UHJA 1THZA 4DNFA 3IDAA 4QXAA 1M1NB 1VL5A 5T4BA 3WA7A 2WTUA 1EFAA 1GR1A 1IXSB 4CEHA 3K1AA 1SCKA 3BXEA 3O03A 4JB2A 2RJ3A 2XUKA 1Z16A 4M9QA 5DT9A 4YRMA 4DS3A 1Z7WA 3GEDA 2AX3A 3HVJA 1CUJA 5MGNA 4PCUA 3UGTA 1P2FA 2W2TA 2D54A 2JGFA 1N1EA 4GMDA 1D6NA 1XDZA 1FPMA 1G66A 1SUCA 3MBKA 1DBVO 5HHTA 4O3MA 3QXCA 4CF3A 1IDOA 2MJLA 4YCMA 4LF4B 7AT1A 2I9KA 3AM4A 5K2OA 2QMQA 1OBVA 3E3AA 5AJYA 3GUHA 1VYHA 2PUJA 1R9GA 4J0JA 2KBFA 2QIPA 3PYMA 2Y71A 3DXZA 3PNMA 5FV7A 2FDXA 4Z7QB 3A25A 4FB4A 3C4QA 4PLPA 1UJ4A 1YB1A 2YZ7A 1E2KA 1XRNA 3HA3A 4GPEA 4YAIA 3TQCA 2QZJA 4JKIA 1N0WA 1PG0A 1S8FA 1AZLA 2C9OA 3M1LA 5CEEA 1VL2A 2AUTA 5KNBD 2QMZA 2X0JA 2ZT6A 1Q77A 4EVQA 1XFDA 1TJNA 1P1IA 1ZCAA 2HDOA 4NCXA 4JQYA 1OV4A 3FPLA 4N9WA 3WO0A 2XNJA 3GD7A 1EUYA 3UEOA 4I4IA 3G5TA 5SY9A 1DJPA 4MEAA 1H05A 2VF5X 3CZQA 1CIPA 3DGFC 1I2BA 4DCOA 2IY8A 5LDGA 2DZDA 1KWKA 4LSMA 5D51S 3AL2A 2DAPA 2IXEA 3EASA 4BNYA 1CUAA 1W5AA 4XWOA 5HMLA 1BCSB 3IAXA 4ZT5A 4J0GA 2ZROA 1T9CA 1QHIA 4OH1A 4GI3A 2HRDA 4TSFD 2ZUFA 4D9CA 3ZGLA 3COYA 3DDNA 3OTHA 1KMIY 3MTGA 3MJHA 4P4NA 4RGYA 3KU1A 3VZRA 2QJTA 1M2WA 1Q0ZA 1K5PA 2FQ1A 2NYAA 2XRMA 4BJHB 4KK4A 1R5BA 3G9QA 3I9V6 1E3IA 3ICPA 2GJKA 1NQ5A 4Q4CA 3OWHA 4OMCA 3BK1A 3T3HA 3GAZA 1K4YA 4M0PA 5E3JA 2ZYSA 3FDZA 1MO4A 3K6KA 4N49A 4ADSG 5KSZA 3FMPB 3PQ5A 3CIFA 3S2SA 3QOFA 3TL2A 4HGOA 4JGIA 4C1NA 5I7UA 4GRDA 2ZTHA 3H99A 2QVYX 2HCJB 1H1LB 2C5GA 2CLKB 1W96A 2RGYA 2WLTA 4HOYA 1RE1A 4ZCPA 3ZWBA 2O8FB 4D9MA 2PWPA 4Q1VA 2AN3A 1EAMA 4WK4B 4NV0A 1JPNA 1QYVA 2KHZA 3OTQA 1YZFA 3E5RA 3UO8B 3S44A 4LHEA 4Q9IA 3I92A 4JA0A 3EUFA 4IJ5A 5BMOA 1WDMA 3CPJB 1Q44A 1WOYA 1JAHA 4OQLA 2XSZA 3BE8A 1W4RA 1F48A 3CKKA 1SCNE 3U2QA 2MT9A 4GMHA 1F14A 2NOAA 4XIJA 4U2BA 4D3XA 5HCNA 2A0XA 1EK6A 4AMVA 1ZMBA 2QX4A 3VZQA 3DC2A 1ZM4A 1C9YA 1CY0A 1CD5A 1KJYA 1X1AA 1YBAA 2Q6TA 1WE2A 1NVGA 4WEOA 3HR8A 4KVZA 4UHDA 5JZOA 3HBNA 3KYDB 2E4UA 3MMXA 4FYKA 4O4LA 2OFFA 2DQKA 2NTNA 4Q9NA 5JRDS 4GLJA 1CQXA 1WHTB 5D5PA 2QB5A 5JQGB 4FWBA 2JL1A 3TFWA 3UC9A 3O5AA 4NU6A 4I5FA 5JCJA 1A8QA 1P73A 2WOOA 3AQ4A 1D1TA 4MKFA 3N39C 3MWEB 2G4CA 1JR3E 1BYIA 2JFPA 4G3XA 2EFJA 4EGAA 5FO1A 5IF9A 2ZRQA 1F5NA 5IBQA 1G7SA 2ZRBA 4K88A 2QZ4A 3Q1LA 2D0DA 2P77A 4EITA 1UBNA 1YE3A 2ZR9A 3BIXA 1P3DA 4GNKA 4LA4A 1YRBA 2IYFA 3DBVO 4M55A 2AR7A 4MRSA 1M83A 2GZMA 3G2NA 3MM4A 2INGX 1CX9B 5JSHA 1H0HA 2VAXA 3RC2A 1SBHA 1C4OA 1AA9A 3AR3A 3RCBA 3FE2A 4BNXA 5HS4A 3MHPA 5EHQA 1L4KA 1A04A 4Y18A 3MCWA 3FRJA 4ZAFA 5DNUA 3I23A 4Q4AA 2AF3C 1SN7A 3CPHA 1L7EA 4RCZA 1JI0A 3Q6MA 3RSHA 3OOYA 4NBLA 4CU2A 2KMLA 5FP0A 2PMBA 3F4KA 1I7LA 4O1HA 4OD0A 1I3NA 1K06A 2C3MA 2GUWA 4OB7A 5G1NA 3WRVA 2AQ8A 3PLAE 4G41A 2VNHA 2AFVA 1GZ3A 2EGUA 1CRWG 3CINA 3HH8A 1Z25A 3CRRA 1BHSA 1AN0A 1FU4A 3HXMA 1TMYA 4DA0A 1KY4A 5CH8A 4M0DA 4MWSA 3ICQB 4JI2B 1W2HA 2J6IA 2J5QA 4XDZA 3P9SA 3I61A 3AM1A 2H1CA 3RODA 3WGIA 1C1DB 3GRZA 3K9QO 3WLSA 4J1NA 1WP9A 3TCXB 4H60A 4TMZA 2UXBB 3LOUA 3PGXA 3PPWA 2YRFA 5LQSA 4P0QB 1MGOA 2R6GA 1XTSA 4NJEB 1WY5A 2HCFA 1GVHA 4PLVA 4HAUA 5ECGC 3G7SA 4JBLA 2BM8A 5I9IA 5JZBA 1PW5A 2B30A 2P7HA 5DN9A 5IJWA 1QPGA 4TLDA 3CLTC 3G79A 1U6KA 3KCQA 4HNUA 2XA2A 4JT2A 2JZOA 3G2PA 4LBVA 4LBWA 1NDUA 2ODTX 1NR1A 4EUEA 1AO0A 1C50A 2OBXA 4QUDA 5MGBA 2FN4A 3L7KA 5CP8A 3LWZA 5EOVA 2OBYA 1D4FA 4H31A 1FDOA 4G8DA 2VBGA 3H1AA 5EHNA 4BKQA 1D0VA 1W85B 4H1VA 1MRZA 1G2PA 1KKLA 3L4SO 2B1JA 4GYJA 4D9GA 2ZB8A 5E1DA 1XU4A 4YP0A 5EKXA 3DL7A 4MINA 2CMHA 2BM1A 3IV9A 4FLEA 1O3YA 4LFAB 4GKJB 3T5CA 3PV0A 2JA1A 4JJ7A 4BQFA 2GSDA 1U9IA 3TEJA 3LQKA 5CG2A 3LBHA 2C4HA 3EG5A 1HX7A 2PMDA 1Z2OX 4PLCA 2W58A 4CGYA 4F2DA 3ZWNA 1MTOA 4EYQA 1JHRA 4Y2QA 4D44A 2J9FB 1BXRA 3V5NA 3CR8A 1VC2A 4NBKA 4GS5A 1AQNA 5B7GA 2GNOA 4LBZA 5JNRA 3I9OA 3L8HA 3IBCA 4PW0A 3T7IA 1VG0B 1ZXLA 3G1UA 4G9BA 2CVFA 3Q87B 3TZ6A 4G0WA 2LCQA 2ZU6A 4DWOA 2VYND 4KIJA 2O2HA 3EC1A 4KN6A 1BW9B 5KTPA 3HRHA 1OPXA 2WMNB 4ILKA 4HFRA 5FHQA 4K9LA 5C4GB 5HQ3B 1DEAA 4URVR 2BGNA 3JSAA 2GYWA 5LQNA 4L7VA 1FK8A 1BWSA 3UFBA 2OD7A 4RS3A 1RYYA 3PEVA 1KQFA 4KNWA 1OXUA 4GLBA 4K86A 4KXYA 4ML3A 1FRVA 1MN6A 1THMA 4W6ZA 2FSVA 3HB1A 2VWQA 5FBQB 4MW4A 3IHLA 1VMDA 5JBQA 4ZHQF 2DLDA 3OE7D 3CZ5A 4M0EA 4RETA 2YVAA 2ERCA 5ALNA 1LV8A 1TLFA 3JQEA 4MUNA 1RYDA 4O29A 4OFZA 2CFRA 4U9IS 4ZWNA 3DVSX 1GFWA 2BEKA 2FEMA 2R00A 4RY2A 1U7TA 1D5WA 3LSTA 2KM1A 4GI2A 5LSAA 2QPAA 1ZPDA 1SXJD 1DFGA 3AM5A 3MS4A 4K5QA 4NQRA 2VQFB 2ZIZA 3CPEA 3P9NA 3GBPA 3HJNA 3Q5GA 2PMWB 3E82A 4ZOAA 1MX3A 1QSGA 2XW6A 4E07A 5BRNA 3FNBA 2IE0A 4J3FA 1GYPA 3MJRA 1QFZA 1TQ8A 2HREA 2WJAA 5BVGA 3RYHA 5EQJB 1U0JA 4DLTA 2EZ8A 3H04A 1X14A 2WAOA 3NS7A 4M9XA 5IYZF 3ML1A 3OZAA 2J4FA 2XGOA 3EZ7A 3G9UA 1DXOA 4RA6A 4ZYVA 4RTLA 3H83A 4AY2A 1ITZA 4ZO9A 4ZQBA 4F4JA 1JQAA 4INZA 1U63A 2V7GA 2V3VA 3MCUA 3ZWKA 1N2GA 1K92A 2C2GA 1E99A 2V7WA 3A31A 3H2ZA 2X76A 3PGKA 4HEQA 3MOSA 3PZRA 2W98A 1S3IA 1PJBA 4K9RA 1BJKA 1Y5MA 2B2XA 4D25A 1V3QE 3MLBA 2FPXA 3R3UA 1FQOA 2HHCA 4QYWA 3KQYA 4XUEA 2WJYA 4J0IA 1I7PA 4RTMA 1K7XB 2A1IA 2WT8A 4D81A 1RLUA 4R0NA 1NBHA 2EEZA 4JVMA 3GCXA 1YRYE 2UZ1A 4FUQA 1QH0A 3KT8A 1FXWF 5EHZA 5HOEA 2HZ7A 4JJ8A 3N07A 3MGAA 4YREA 2C7OA 1KIAA 4TVOA 3WL3A 1RAFA 5BV8A 4CUJA 1ZRHA 3D3EA 4AJLA 4G1CA 4R71A 4K6HA 1CUVA 1BFKA 3ZBUA 2PA0A 3OAAA 4KI7A 4L8LA 1DKOA 3ZY6A 5FUMA 4TYWA 2NP7A 1O8BA 4HNAA 4ASUA 1QC5B 1W30A 4JEIA 3TTWA 5IAKA 4J6FA 1DBPA 4EJMA 4ZJUA 3U80A 4Y2JA 3BB4A 4C43A 1N2CA 3DQZA 3PFHA 1FNBA 5AK6A 2IUEA 2YKGA 1JNYA 3BK7A 4GC9A 4XZ3A 4CRWB 1D04A 3AL0C 3VPAA 5L6LB 2QN7A 2QJRA 4TS9A 1SUIA 5JWRA 5KTYA 3ZU4A 3W4KA 3ZU3A 3G0BA 2JI7A 2AOTB 4Q9KA 1P2DA 2BV3A 3EZNA 2CV1A 2WQ7A 1CHDA 3ESZA 2P6NA 2RH8A 3B85A 3JQGA 3P32A 4P36A 2PANA 4RA6B 1K8ZB 1I13A 1A1VA 2G8NA 3O2QB 1ZVKA 2QMOA 3OF5A 3VZCA 1MEEA 1NI4A 3VZDA 2WYOA 4OQYA 1T0HB 1YZTA 2BR4A 2VOJA 5E6UB 3T1YB 3F46A 2DWQA 1GV0A 4QAQA 3U4DA 2O50A 3OJLA 1D6MA 4LFBB 2B7LA 4AMBA 3VNVA 1AQJA 4B7AA 1XMPA 3NB0A 2G88A 1MRSA 2F1JA 2IYZA 1OX6A 2J3MA 3IPCA 4HYQA 3OWOA 4X84A 1GAXA 4YCNA 3S6JA 3ZHCA 1CW2B 1DBWA 1J2UA 1Y9EA 1MVLA 1M6NA 4IHQA 3WXMA 5T6BA 5IP5A 3QKUA 3FCSB 1CP2A 4RZXA 3BRWD 2NTJA 1RWMA 1JIUA 4TSKA 4J0FA 4UPVA 4GEKA 4LGVA 4PO3X 1QQTA 1JBQA 3D6MA 3H2GA 4XH9B 4EATA 1C3VA 3RANA 2XUIA 4ZMSA 2BGLA 3OC0A 3RIMA 3NMUF 3VVMA 1KDOA 5JNVA 3K05A 4I9GA 3MIZA 3VH4A 4CV3A 2GHQA 3WK6A 4HEHA 1EQUA 2JRCA 3JYNA 2BI8A 3DAOA 3I1IA 4TMKA 1M0TA 1NW9B 4B6PA 1Q19A 1Q7TA 5LZ8A 2ZVQX 3IC5A 4HTFB 4JYBA 1RQNA 1P45A 5LQKA 2G0NA 4KRGA 1VYVA 2HXGA 1DAHA 5SYMA 4UEJA 1U7XA 2PGDA 3FGOA 3PKJA 3FDIA 5KYYB 5MFPA 2W7TA 3KQHA 3EMKA 2J7PA 2V03A 1NF8A 5EWJB 3P2OA 3UJ9A 4QOEA 1SCQA 1QGAA 2I6QA 3EVTA 1W0KD 2FOIA 4R2KA 3FBGA 3G2JA 3UOAB 5DNYB 4EO4A 3UHAA 2R86A 3GZTB 2WRZA 1FSFA 2IYVA 3GLRA 1RI1A 1B0PA 3P9KA 3D5QA 3CNQS 4HWOA 4ZQEA 2CSUA 1J6UA 1W75A 1NUUA 1PLKA 3AHIA 3DLBA 4ZDWA 1QDEA 4N3GA 1KJQA 4CL3A 1P18A 4MMYB 3PUXA 4X85A 3AIOA 1LPNA 1RFGE 3GRAA 3AESB 1F8UA 4H7EA 4N5HX 4ND4A 4ECEA 4N5NA 2Q5JA 3IS3A 3JWGA 2V5UA 2OKGA 3BA6A 3HYCA 3T7DA 4UCFA 3ZTYA 5B4TA 4YRAA 3K4HA 3KBOA 4FIDA 1E9RA 1SBCA 4CR7A 5DO9A 1L5YA 4PINA 3ZTTA 4MS4A 1BVUA 3C8UA 1HGXA 4BE4A 4PICA 3E22B 2F1RA 4AWAA 3PYLA 2OO5C 4C05A 4E7OA 4O3FA 2WU0A 3H1TA 2W42A 1T9ZA 1NOIA 3OD1A 3LXMA 1E0JA 3V2UA 3RIHA 1SUAA 5DX0A 5CK4A 1U0GA 2CB9A 4LIPD 5GV8A 4JI3B 3B48A 4P7JA 4HMQA 2FF5A 4U5QA 5FUBA 4UATA 5JS1A 5CBPB 4N7MA 4HGRA 3WL6A 3WQSB 4CQNA 1BVRA 2BR5A 3S27A 2GXAA 4CM8A 3BQNB 4JSYA 3LU1A 1WPXA 2F9MA 2W2LD 3BYZA 3B7PA 3I5XA 1ZUWA 3P8ZA 1W59A 4LEIA 4PZEA 1QGOA 4LC9A 2UYGA 4LN1A 3HUFA 1WCIA 5L4LA 4R05A 1P4AA 3BQ9A 4BFYA 3H9JA 1E1QD 2B92A 5H16A 3KZVA 3K8OE 1A82A 1TM4E 2B6HA 2QLFA 3KTDA 2A94A 4LQDA 4F4FA 3KS9A 1IDN1 3CE9A 4HRVA 3CH5A 5FUVA 4F3RA 3JWPA 1WAMA 3A6EA 4HNAB 3RUAA 1OVMA 1X3LA 6LDHA 2VQEB 2I4OA 3DMHA 1J06A 3LWBA 4GGOA 5HFJA 1RBZA 4BVGA 2VZ0A 3PGLA 2WTBA 2CKMA 1DCMA 1EFUA 1RCUA 5M5BA 1ADJA 3BMNB 4BO2A 3A6PC 1P74A 2XWQA 1KVRA 1N57A 2FWAA 3IJPA 3QXJA 4CCYB 1MB4A 4PGFA 4D82A 4NXNB 1YCFA 4TKLA 1H2HA 1T15A 4BP1A 2G9UA 5ER9A 2I4TA 2GEKA 1XE3A 5AKJA 1PL8A 1DC4A 3TLKA 1I0IA 3G2KA 4GXRA 2FEWB 5JC8A 2FWNA 3V80A 3VKFA 1W36B 2OHFA 5KYTA 3Q8KA 1QB7A 1PL7A 4J7AA 4QA9A 3TR6A 5ADUS 3BTSA 4WADA 1KEVA 5E6RA 3DKIA 3BFVA 1NXPA 3W7BA 2HJRA 5BT9A 2PUHA 1XD2B 5EQTA 1NVTA 4BZQA 1QS0B 2H9AA 2CJWA 4O2BF 3HN2A 1OC2A 1VFPA 3RSCA 4AZTA 3BX1A 3V1YA 1T2CA 2JG3A 3O3NB 3FPBA 1XTJA 4FT4A 4MS3B 4MKZA 4R41A 3BILA 4S05A 4IEIA 3GP5A 4E22A 5DNVA 4KVFA 4RFSA 4RSGA 3GIDA 5JH7F 1JE0A 4WZZA 5H9WA 3IALA 3CVYA 4LDJA 4JLOA 2NUTA 1Y98A 2FSGA 4LQLA 3TWOA 3U5TA 1Z4QA 4BVHA 1VHTA 4FMBB 1Q1EA 3P4YA 4ZI7B 2Q9AA 3L6DA 3PG5A 5CFNA 5KNBA 2NP6A 1QGED 2XMZA 4IIGA 2W6CX 3VDRA 1KYTA 1H66A 2I2CA 3AKYA 5BN4B 4MGEA 4LKRA 3R74A 3VUEA 4YY3B 2JFWA 3EYAA 3H1FA 2GAJA 2IH5A 1XPUA 4YMWA 1ZUIA 3HSKA 2XUZA 4Y2TA 4MUJA 3QVGA 4A15A 1NOKA 4PVDA 2G76A 4M98A 4D3ZA 1DUSA 2BM0A 3HYSA 1XJCA 3GP3A 5B2ZA 3WB9A 4HAVA 4Y2RA 3LUBA 5KX5F 1RTKA 2O2IA 3SK0A 4TT3A 5EXPA 4F4UA 1LA2A 3A6GA 3LUHA 3P27A 3DJYA 4TRJA 4X20B 4BEBA 1T1GA 2WYUA 4QSHA 1UKAA 5K1ZA 4J16C 3A6HA 3NPMA 2FRVA 1E1CB 1H3EA 2P2NA 3N59A 3U62A 5IKOA 1JSXA 4H77A 4YJ3B 1GCIA 1XWWA 5CDGA 3AK4A 3ACBA 3SFVA 5TS2A 3URKA 2YDXA 3I3SR 4IFEA 2CNNA 3BGIA 3L7OA 1IM5A 1ENZA 4GOOD 5FBHA 3GV0A 5FBKA 5DM60 4YAGA 1O9GA 3FTCA 4WQMA 4BMXA 3PJFA 2W4IA 4U9HS 3WIBA 2J9YB 4ZPXA 3JD4A 2PGLA 4IEEA 3PD1A 5FI1B 1N1GA 2BCJQ 1TT5A 4LDZA 3AKZA 3CEPB 2QYOA 1STOA 5E3HA 4BMNA 3L0BA 1ZC4A 3KLNA 3ORRA 3KOZA 4FFNA 4UFPA 1AB6A 1EX6A 3DE4X 1L4YA 4NYMR 2XGSA 2J3QA 1MIOA 1A9QA 1LU9A 2JNWA 4RFVA 1FP2A 4XDGA 1Z88A 4YPFA 3E7DA 1RAGA 4GUAA 1IPEA 3PNYA 4MCAA 1ZXXA 2W00A 5JATA 4BYGA 4BWGA 3KZNA 1GA1A 4Y9RA 2C5AA 3DDOA 3MSCA 1WXHA 3C3KA 3OQBA 4YIHA 1YIOA 4ENSA 3LVFO 4WZ6A 4XWTA 3IQEA 5IVKA 3IHWA 1V96A 4W1PA 4TTVA 3BWYA 2X2OA 4GAEA 3ABOB 3TNDA 1U0LA 1XG5A 3BULA 2WYIA 5A9RA 2XNKA 4LJ6A 5CXXA 4B80A 1WDKA 2IIBA 3CX4A 5D3KA 4DXHA 4J76A 3SN6A 1GNTA 3ANYB 4KFTA 1AZSC 2D4AA 4FKBA 5F5XA 1K0FA 2HQSA 2YBEA 3HVHA 4LDQA 4D5EA 3JQFA 1WXQA 1ESEA 1YZUA 1P1HA 3KOWA 1UZAA 2HLNA 1R88A 3DOIA 4UASA 1WWKA 1X38A 2D2EA 4N7RA 4WNAA 5TLSA 1XU9A 1FXSA 1P0MA 1XF9A 4Z9BA 2PH3A 4KWHA 2R68A 1WO8A 5TVKA 2X9GA 1E9SA 4RM2A 1TDJA 2WIDA 5HUHA 5ADVA 4CKBB 2HH9A 3PQ2A 4FDVA 2GNPA 1QH1A 4AN4A 4POAA 1MB2A 1V1RB 2NV0A 3EH2A 3GFFA 3MCTA 2QMEA 4QO7A 3WNDA 1DXQA 3HWX1 4FEYA 5IJ0B 1SXPA 3EBOA 2HA6A 3R0JA 2A0FA 1YZVA 5IT9A 5CLIA 3C14C 5BNZA 4PGHA 4RW0A 4JJ4A 4X24A 1XCBA 2VBFA 1EA7A 3JQAA 2IH2A 3NJRA 1OWOA 4JJIA 1MBZA 4JYMA 5ERXA 2APJA 4GXQA 1HT1E 3F6YA 4U6QA 5ARCA 3RB8A 3U3MA 3ENZA 2J7PD 4B6FA 4H9GA 4G4GA 4ZMBA 4RTPA 2A6PA 2V7BA 1E5XA 4TVBA 1TI7A 5HK8A 4FT2A 2IHNA 1FL9A 1QHXA 1YQQA 1HYBA 1YMVA 5KWEA 2OD9A 2FRDC 4BO9A 1KC3A 3QLUA 1RC0A 3UG6A 5EFOA 1WVIA 3TW8B 4IF6A 5B2EA 1X8XA 1PFYA 2YNMA 3ORSA 2CXPA 4Q34A 4RDHA 4F11A 3AEUB 2HRBA 1ZHOA 4D9JA 5HRCA 2D7CA 2Z3ZA 2EZTA 2VQSA 2HF9A 1XZIA 5EP2A 3O8QB 3CUSA 2FPLA 3HKCA 4PSAA 4QU5A 5J4VA 2X7JA 3MWJA 4HH4A 4UBKA 5EE5B 1G21B 1XDUA 3LM8A 1WUIS 4NVRA 2BGIA 4W99A 2IP2A 1EWYA 2PT7A 3NYQA 2WHRA 3BGSA 2YXLA 4JUDX 3PPVA 3DW1X 3OZFA 5LPNA 4WZBE 3T3IA 4I0WB 3RS3A 5AW9A 3L5KA 2FSIA 1A8IA 4WZAA 4ND6A 1KSGA 4ZI7A 2OLEA 4Z4CA 3CNNA 1DIOB 1XXHB 3CMCO 3DE7X 1XZJA 5IRCD 1U8ZA 2H5EA 3W5UA 2FWJA 2QAIA 3V34A 4PYIA 5C8YB 1PTJA 1DV1A 1WMEA 2BHNA 2DCMA 3DCJA 2Y67A 3JWHA 4TX1A 5HJ2A 2A7QA 4DC9A 4F3YA 1JDTA 1SXJC 4RCVA 4IVRA 2MSLA 3II6X 4QQ8A 1NVEA 1T9KA 3KFXA 4LNUA 2EYQA 4INPA 2PU7A 3MWKA 2VP5A 1GL6A 2QE7D 1J2TA 3DGEC 1P1CA 1UOEA 1ZN2A 1E1RA 2VH2A 1DO8A 1MO2A 2A5JA 3ZXXA 1SBYA 2TS1A 1FYWA 1UR5A 1H1LA 2YINC 1U7DA 1B8OA 3GWGA 5HM8A 2IIPA 2BBTA 1LFDB 4B3CA 1DRWA 2QTCA 4GPD1 4KGDA 3S7TA 1CVLA 5AJUA 4O4IF 4WNYA 2NNWB 3BRWA 4KV9A 1JR6A 3IKTA 4OTZA 5DCUA 2FJPA 1TA4A 4W8HA 4N76A 3C87A 4FQ5A 2GEBA 3A3PA 3QUSA 2MIIA 2DPXA 2PZKA 2Q5FA 4B3MB 1Q50A 1TO1E 3P9YA 4KXWA 4L2IA 5E3IA 1CE8B 4RSMA 1R6BX 2XE6A 3B6JA 3WIDA 3KSDO 1ZK3A 3JD1A 3UAOA 2JLRA 4GXTA 4CFYA 1DS6A 3WHPA 1LD3A 1N0HA 4LXUA 3RG2A 2I8CA 1U2SA 2DUWA 2WHPB 1TVCA 5E4YA 4NU5A 1DELA 1OC4A 1OFIA 1I3MA 1PK8A 4FILA 4YEDA 3LFUA 5CLHA 5KZMB 1PX2A 4X8OA 2PS9A 1DAMA 1JT2A 1QO9A 2NU7B 4RYDA 4YMIA 3DE5X 3M4NA 5JJCA 1RW4A 1BX0A 4HDRB 1V4NA 1EA5A 3G82C 3WGMA 3CG4A 4ETWA 5K05A 2E21A 2FUNB 2VSOA 3GO4A 3C4VA 2XTMA 3WFZA 4EA8A 3HWWA 2PYIA 4LJSA 3COSA 4C4SA 1HLDA 1B00A 1SR8A 2H3HA 2Z3VA 3EVAA 3PVCA 3QWHA 4U63A 2Q7DA 5JFGA 3RYCA 1G1MA 2XZTA 4B7XA 5KNCA 2OHXA 4JNKA 2IZZA 3B3AA 1L8LA 3I01M 3KKZA 4WOCA 5I45A 5DF1A 2C95A 3FOBA 1NW5A 4E6PA 5JI3E 5F1OA 2WB2A 3KETA 4CMKA 2WD7A 4QXOA 4TRNA 1F6DA 2HBRA 4JYPA 2GN1A 4MS1B 2J08A 3OJEA 4JI8B 1WABA 2JC3A 4GLOA 1CP3A 2WZQA 1X1DA 5EZSA 2FSPA 1WG8A 4NYMQ 3RGWS 4M1KA 1OXKB 3ECSA 1NJ8A 3GRVA 4D4GA 2WUGA 5KQRA 4YWJA 5CCBA 4AWBA 1ADCA 2OEPA 2CF6A 1C0IA 3ESQA 1U2EA 3OQIA 4H0CA 5KJ6A 3RVMA 4EFNA 4QLBA 2XNDD 4RKRA 1H8HD 3ZDFA 4RIHA 5THXA 4DR6B 1T24A 1P77A 2N42A 3AESA 3UWMA 3OP1A 3QUBA 3SJCA 1KMMA 1GRVA 2W2OA 4FYYA 4R0VA 3CLRC 4JGBA 5EG5A 1YZGA 3T6KA 4B83A 1DFIA 5CW1A 1KO1A 1UEIA 3SSMA 4FMPA 3BEOA 3L8DA 1YULA 2A3RA 2RG7A 3UMJA 4D79A 1PCXA 1SC3A 4UEOA 3WGUA 1MDFA 3QA3E 4BXOB 2ACWA 4R5HA 1XRMA 1U9CA 4QGFA 3I5YA 1BN6A 3FPCA 2DX7A 5EESA 3QELB 4G84A 2OXCA 2QG4A 2V54A 4YCLA 1KARA 1WBJB 1JG1A 3JQRA 4I99A 2QS9A 2VYQA 3OPYB 4WJKB 1ORWA 1TK3A 2N1MA 4UM9D 3I2JA 3PQ6A 3WIEA 5LQUA 1FVHA 5KOIA 2Y99A 3OZIA 1T3ZA 1KP2A 3L0YA 1ORIA 4JZKA 4CMEA 1Q0TA 1V9CA 1IUOA 4EAQA 4BPBA 4I8DA 5IXYA 2QTZA 3AILA 4EHDA 1KY2A 2IX3A 2AKAB 3WOHA 1L7DA 4ER3A 1XD2A 1CDEA 1SCAA 1RPAA 4CT0A 2ID9A 1XZKA 3NH6A 4UM8B 4PC2A 1F0YA 3IFSA 5HCUA 2C31A 3KLOA 3D1JA 2HHLA 3I9KA 4QBFA 1QZZA 4O25A 4WCDA 4AJIA 4MVXA 4EY4A 2QRMA 5EWMA 1XD9A 3X43A 2NVBA 1BX3A 3ONEA 2FPPB 3EXFB 3LAWA 2GPNA 4JWTA 4LGCA 2XUAA 4KQ9A 4BNDB 5D5QA 4Q5IA 2V7XA 2VO1A 4WESB 4KQEA 4U7DA 4LMRA 4CCYA 3OZDA 4I1IA 1WVMA 3LYHA 4LZOA 4NV1A 3RO7A 3UAGA 4IS3A 2P9FA 3KT6A 3NXKA 1A9PA 4J49A 5DEOA 4FDUA 4BTLA 1GPDG 5B1IA 5ALXA 5EMLA 4D9HA 1A9YA 5FPQA 4CFSA 2NTVA 4TUYF 1UZUA 4JH0A 2VI5A 4OB6A 4QJIA 4HNVA 1ZM3A 1II0A 1PG5A 4HMPA 3N0RA 2SCUA 5TEWA 4D6XA 2I6SA 3ICEA 4BMDA 4GFDA 1NX6A 2R11A 3O4FA 1Z3CA 2QTVA 3PC8C 3WYAA 2V6IA 3ZLBA 3E6AA 2AEFA 5DP1A 3NONA 2XTNA 4TLMB 2O8BA 1NN0A 3A4YA 1CQWA 1HKHA 4G8BA 1UC5B 2ZB2A 4QPPA 1V48A 4FNMA 4I5GA 4A92A 4DV1B 4ZOBA 1PQPA 3VGPA 4A16A 1AZWA 1JLHA 1PWEA 4CM1A 5A3QA 1SXJB 1MW9X 3DPUA 3HJRA 1UMBB 3DLAA 5JVDB 5TDHA 2B5WA 4DT1A 2CDBA 3LLMA 3OJFA 3JD3A 3L7YA 3MS2A 4EHLA 3K0HA 3F96A 3CPSA 3IODA 2JFGA 2C9BA 2CJFA 3WWEA 4NONA 1KH2A 4F9EA 2DCUA 3Q9SA 4TLCA 5D01A 4L95C 4BNKA 2YJ6A 4ZO4A 4ZAYA 4HNGA 1YBFA 4HZUA 5K4AA 4AMYA 1QQAA 2HDNB 3HP7A 2VDPB 4TV9B 1FRFS 2HYIC 2DU8A 1O6GA 2N46A 2C57A 3HCDA 3T7JA 1OZAA 1G8GA 1IBSA 5BWBA 2WWTA 4WJLA 4BN5A 2CNLA 3ASYA 3FR8A 3TRFA 1M8GA 3PB3A 3UJ6A 4A3SA 1VIYA 3IIJA 3QV1A 1X39A 3RFUA 4WBNB 2FSVC 4GX0A 4PHCA 5TQ0A 1SBNE 4PG7A 4HDMA 3TZEA 4AKTA 4HUQB 1H5NA 3D9QX 1DX6A 1FYEA 3ZDDA 3O1IC 4N65A 3TTXA 3SIXA 2Z2KA 1T35A 1NU8A 3P19A 3VX4A 4BLVA 3TGLA 4HGNA 2BGTA 4Q1EA 3ECCA 2WFZA 1ODLA 1AF4A 2UV8A 3F5MA 3K32A 3QLTA 4L6CA 4YS6A 1QVWA 3GVCA 3PUIA 1N3YA 1EK0A 4MI1A 3P0EA 3RJZA 4GH5A 4HAWA 1CXZA 1DLJA 4R7GA 2HRZA 1BD3A 1UBMS 1KDZA 1JX6A 2EIHA 1XYGA 1X7YB 3NAZA 1K68A 3GLHB 2L69A 5H81A 1ACMA 1CQZA 2E4WA 3VOSA 1ZGJA 2FSUA 3HV0A 4X90A 1V3TA 4EG0A 3BFJA 2JVJA 4UHBA 6ABPA 4MHTA 1GJRA 1S8AA 1DKRA 1ZD8A 2VXOA 4B48A 6PFKA 2FN8A 5B53A 2Q5EA 3PNPA 4MVJG 5ICFA 1HK7A 1AM4D 1R18A 1BU5A 3G0OA 3JQ7B 2D1YA 5TARA 2ODAA 5CA0A 1T5DX 3REQB 3IESA 1MB9A 3SJZA 3QKRA 4F71A 5KKCA 1BMTA 3ZGNA 5BQOA 2GERA 2XMRA 4QTZA 1LH0A 3UB3A 1DG9A 1K3TA 1SIBE 1VMAA 2W0MA 2HZBA 3AI1A 4EUKA 2C9DA 2PLRA 2GR9A 3IP9A 4JBXA 4ZZ3A 3INNA 5H68A 4DHEA 2Q8NA 1C3LA 2WE8A 3REQA 4DZTA 1DJMA 3VC2A 1T9GR 4ND7A 4RVDA 5K7SA 1ZVVA 4MWOA 3ZI4A 2VDVE 4J7XA 1G20E 1QIGA 2FSFA 3ZV6A 2F43B 5AK0A 1NDQA 1JGTA 3S1AA 1MOZA 4LDAA 5IH7A 2PL5A 3SQWA 1NJSA 2QXUA 4Y6QA 3QXXA 3LOQA 3CMMA 1UOQA 4AIRA 3HK2A 3E3MA 4ESOA 1X7YA 5LDHA 2HCRA 2MSWA 3G0HA 2O7NA 1ZR4A 5HJ7A 2QN1A 1GTSA 1U3TA 4NZOA 2GCOB 4QG3A 2PSFA 5DSXA 3DPIA 4MCIA 4R8MA 1B3RA 3UV7A 5I7RA 2HSEA 2HMTA 3IAUA 4TLLB 3WVNA 2BHLA 1IHXA 1M1XB 2YUTA 1K7EB 2OOKA 3LLCA 4MUHA 4RKWA 3WLLA 4YBRA 3G88A 1NIPA 1BIFA 4ZU1X 3RAEC 1ORDA 2YQ4A 4CL2A 5LBIA 1PZMA 3R5HA 1D6JA 3P9QA 3A3YA 2EP8A 1L5NA 1ARZA 1MTZA 4DSNA 4Q7QA 2NG1A 2Z2ZA 3L1VA 2O2SA 4RE6A 5HKKA 3H75A 2QRQA 3F3SA 1T3TA 2EQ5A 3VOBA 2PS3A 4Z7JA 4EYGA 3WAJA 1RLMA 1AHIA 1QC5A 2FP4A 4BMSA 4CDGA 1FEZA 3HDVA 1AGYA 4C14A 5T7BA 3RH0A 3K94A 2OHIA 2JAUA 4JOQA 1LBSA 5DM1A 4CMJA 3JVVA 3LUCA 1Y9DA 3D8HA 4GGPA 1XJWA 3S1SA 3PEYA 3ZTWA 2YV1A 5CIQA 2B20A 3PEFA 3IEUA 4QM7A 4MRRA 1EM8A 2GXUA 1ZOOA 3NHUA 3CWQA 3ZV4A 1PT8A 2G06A 3QYAA 2GN0A 1ZGGA 1M7GA 1Z7EA 4BLWA 4XAQA 4PZ0A 4R7TA 3NTXA 2O8CB 2Q6VA 1LLDA 2BGKA 4BL5A 3PJGA 1BDHA 1G7RA 5DNAA 3RS9A 4ZIRB 1ZJ5A 4RJJA 2WU1A 3WLMA 1K1EA 4ZJPA 4ZZ2A 3LP5A 1WCIB 2ZJ5A 4KQMA 3QA9A 3TM4A 5JVDA 1H1TA 3P2MA 5CVVA 2YWFA 4Y1GA 5EKTA 1K2VN 1Y1LA 1ZRSA 4R3NA 5BWCA 2C7QA 3L7DA 3Q4GA 3GLFE 3V7NA 1F0NA 1TT5B 5EWLB 2X1HA 4KFCA 3KKKA 5AHOA 3C3JA 3SIWA 2R8EA 1AUPA 3TPCA 2E89A 1BOFA 4IJUA 1PKEA 2DKFA 4KFRA 4EELA 2ZE5A 1X0VA 3IQDB 1W47A 2YICA 1MQ8B 4NMLA 1C1XA 2R25B 2XOXA 1GZ6A 1DGQA 3IDSA 2F90A 4TQAA 5IEJA 1Q7BA 1YXMA 2DOKA 2W83A 3O8LA 4X62B 1WXWA 2AWNA 4FOSA 2HBZA 4KSYA 2A58A 3KQPA 2UUPA 4R84A 1FYDA 4EB3A 5HRAA 2MTBA 4GU5A 4R1SA 4Q1DA 1E94E 2HIAA 2NU6B 2QN8A 1GG8A 1ZCBA 3AF3A 1PYGA 3M82A 4MUFA 1NMQA 5FPKA 2XHEA 1DTWA 3IMEA 2GN8A 2HW8A 1EINA 2ZBDA 2PKWA 4BO0A 1WBBA 1FS5A 3VVCA 1T5LA 3PTZA 3O0TA 4XPIB 3RTBA 4DTCA 4AKHA 3EIQA 3W5IA 3ZGXA 4B45A 2DEUA 2C5SA 2NU6A 2G9VA 4C7VA 4UCWA 3RJ9A 3B1ZA 4MR7A 4O08A 3MWDB 1NP6A 3QU5A 4YIKA 3RVOA 4Q3OA 4AO8A 3BOSA 1WM1A 4X65B 1TUBB 1PGOA 1ZCZA 3N1UA 4GKVA 4L9WA 4MWEA 2XUJA 3KWFA 4XLLA 4HB2A 4ZOCA 3TQTA 3C16C 2J6HA 1Q1QA 1G5PA 3K70D 4YRFA 4PN3A 5F7ZA 4B6OA 1BD4A 1JT9A 1L4UA 2JI9A 3P0JA 3KXLA 4LZLA 1PLJA 2RGBA 1KQPA 4D4MA 3G0GA 2DWOA 2VL7A 1DDIA 1HE1C 2V8BA 3BVPA 5B7QA 2AF4C 3N8DA 1TZMA 5FPTA 4KPFC 3CO0S 4ZDJA 2FZVA 1IY2A 3REFA 1B8PA 3MFQA 4IYRA 3VQTA 1PQ4A 3BHMA 2MMCA 3C3CA 4IIJB 1K6EA 4WXHA 5DTRA 1NYRA 5CB4B 3F8WA 2PU5A 3A6JA 2GEJA 4HGYA 4B3HA 5BQ5A 1DT3A 3NNSA 1F8YA 2I4NA 2W6ZA 3DZKA 1NXQA 3OEED 2PUAA 4J07A 1CNFA 3LHKA 1A9SA 1LI5A 2FVYA 2HD4A 1YH3A 2BKLA 1S4MA 2RFLA 4KH0A 1H2AS 5AKIA 2WWYA 2E5LB 1NG9A 1M3SA 4EB6A 2RHOA 4MRVA 2G72A 1O4VA 1Z4PX 1N9KA 4TOIA 4JI6B 5HZGA 1E2JA 2XYRA 1Q11A 2QM7A 4WY2A 4XPIA 4CUZA 4FGJA 2J5BA 3UG7A 4DLRA 5B3JC 4DV6B 1IN6A 3B6EA 3KEFA 4B4UA 3IOEA 1DPGA 4HAXA 2L18A 4ANFA 2HJWA 1LQUA 3CF6R 3JQ9A 5ED0A 5C5IA 3WGOA 2QA5A 4RQTA 3W2EA 4EF5A 3AVYA 1NUAA 3BCSA 1Z0SA 1R12A 1U5BA 3EEBA 4KRXA 2VDWA 4MUXA 4UQOA 5LKRA 1K4KA 1NXSA 1XTBA 1VXOA 2QL6A 2WSMA 3ZWWA 2FDCA 2AG5A 3DM9B 5FBZA 2WD7B 3F8SA 2VNIA 4P80A 1V1JA 3GR6A 4JP8A 2VDUE 3UBMA 2R6HA 5C46F 4I46A 2GDJA 4UTZA 1XQ9A 4K1XA 2WFAA 4M54A 2A9FA 3T3EA 3TLJA 2CNDA 1TU4A 1QFJA 5CJ2A 2X8LA 1T8RA 4JEMA 5LZ7A 1FB5A 5FBVB 2Y27A 5HPYB 1FTGA 1VRVA 1XB2A 2XVYA 3D8UA 2ZZMA 2EG5A 3E4CA 5HM6A 3K70C 3IILA 4I4LA 4RFLA 1X94A 3K2IA 4TPKA 3F9RA 4FP9A 2Q8QA 3T7AA 1G9XA 1U31A 3KPVA 2CUNA 4IWYA 1ND6A 2ID4A 4UC0A 3EDYA 4KQ1A 3HJGA 3I42A 1QG4A 1XI2A 3HBAA 4F3CA 2OC4A 1E4VA 4DCCA 4DQLA 4HL6A 2FHPA 2HK8A 4HQNA 4R1NA 3HM2A 3FAZA 1YASA 3LO5A 2HNBA 4RHCA 3KE9A 4YHHB 5JEEA 3ZQ4A 3NTOA 4BE9A 1KHTA 4Y1RB 5H4GA 3EZ9A 3LZDA 3PXEA 3DFMA 2WU3A 1IQPA 1UJCA 3AUFA 3L7NA 2Z6UA 1CUIA 5GINE 5LD2C 3PT9A 3EA0A 1IJFA 3KFLA 5CLLA 5ICCA 3PR1A 4UCXA 1NR5A 1KP9A 4JP3A 1EM8B 4PFSA 2GVNA 4IO0A 1L7RA 1QANA 1KDVA 3GLKA 1BXGA 4TV8B 3H7AA 3WISA 1G5RA 3QVVA 1JVNA 1OLOA 1R27A 2VP3A 4OQPA 2Z56A 3UGKA 3T3OA 6REQB 5CB6A 1PVOA 3HZZA 5GTDA 3MRVA 3NRCA 4QQFA 2GZ3A 4PFJA 2V45A 4PX2A 4C7BA 1A2QA 5LIPA 1J97A 2GEUA 4FMCB 1P31A 1Q1NA 2DC1A 4YWHA 1AGNA 5CX1B 1RJGA 2BMJA 2YMPA 2ZKLA 4HPXB 4EHFA 3TL6A 1OI3A 2BMWA 2KE5A 3BXZA 3N8KA 2F8TA 3QBVA 3NP9A 2O3RA 1YFKA 4C21A 3VYUB 4YYZA 4YFYA 5ICGA 1FX1A 3E9DA 3RIEA 4P4UA 1O54A 2WM9B 1HM5A 3AHDA 5F78A 2FA9A 4JUCA 3A70A 4U3JB 5C53B 3ZXSA 3CVXA 4C0AC 1G55A 1HORA 2RH9B 2O8DA 3IT1A 1GWNA 3EPRA 3UF0A 3DHNA 2Z0MA 4UXHA 2XQKA 4M9CA 3RT7A 2ADOA 721PA 3GLFA 1ML4A 2LIVA 3DEYX 1GGMA 3HNOA 4EQ6B 2PZAA 2Q1UA 3PVSA 1I80A 1MABA 4HHEA 4KE7A 4M7WA 4I3HA 4ATNA 4Y0AA 2BUCA 1CRZA 1D4OA 1N9GB 1V5IA 2JCGA 3AF1A 3MJDA 1GFZA 4IIDA 1G0NA 1DOHA 4TRRA 5EP1A 2E4XA 2G80A 3R4CA 4EKIA 5HKAA 4NBRA 4QTUB 4DV4B 5ECYA 3QFRA 3ELYA 2O8FA 4XVQA 5BNTA 4W5RA 2RGCA 3SQXA 2QAGA 1EYZA 1W5SA 3G68A 1KMNA 1QDUA 2NW6A 3K9NA 5LMNB 1P61B 2RBGA 4QQNA 4XEUA 4BO7A 1YS1X 1PJAA 3BGWA 1N6OA 3QF7A 4MW5A 2GA8A 4R2LA 3IP3A 2ID8A 3CYFA 2QTBA 1B1AA 3AY7A 2REXB 3MT7A 4TXJA 2G70A 2XB4A 5DI9A 5JANA 1W34A 4RPGA 1OX4B 3C41J 4YDRA 1T0UA 1SUBA 3V2HA 1UAYA 2FPRA 2VEDA 3B9RA 3DSRA 3EQ8A 4AJOA 3F97A 1EZZA 1Y5LA 1KQOA 5AMXA 4DLYA 4YCSA 2PKYX 3NBUA 2H63A 2VHJA 3UT6A 3VX3A 3C3EA 3IA7A 2EFHB 2QD5A 3LDGA 2G6BA 4PX5A 3QHPA 4CHTA 5LU8A 1H6DA 4YJHA 1DAFA 2G40A 4P34A 3VDMA 5HVNA 2KQUA 4WN9B 1T8UA 1UKEA 1U5CA 2ZXEA 3I83A 4N40A 5TPZA 1XMIA 5FLEX 2YC2C 2RGNC 1J25A 1XA3A 2YQZA 3CV3A 1QZ3A 1FX0B 1N3IA 2FPGB 1ZOLA 1E2GA 2AG1A 2XYQA 1DUVG 4HH0A 4QGGA 5GGXA 3U3XA 4CKXA 3EF1A 1B6GA 2YIJA 1BFDA 4ZANA 1YHNA 5A62A 1UDBA 3NASA 4YQYA 5BN1A 2GCGA 4LSGA 2HMYB 3K5HA 3C6ZA 5DWDA 2W2VA 3RVPA 2E49A 2AFIA 5KOHB 4UE6A 4CEIA 2WSIA 1JKJB 4UEWA 5AHRA 2WTAA 5B1DA 3GUZA 3SFZA 1J23A 1QCYA 3LW8A 3PXUA 4CLXA 3G0CA 2XODA 3IB6A 3GJZA 4B9AA 1P80A 4MYTA 5C2JB 4F04A 1B6TA 4RIIA 4LHYA 5FYQA 4H7DA 2XOKA 1WZUA 2V9ZA 3O4RA 3QX3A 4ZEOA 5A4JA 2A8YA 3BMCB 2J31A 2XMBA 3QVJA 1EP3B 3CXUA 2VCHA 2ZFUA 3DTTA 4YAFA 2IW3A 4ENVA 1U0FA 5AXDA 1UFKA 3ZCQA 5LQJA 4R31A 3AUAA 3OE7A 1RLIA 4OKIA 1JQ3A 5BSFA 3ESRA 3THWA 3ORHA 2BEWA 2PZEA 3UWOA 2PH1A 2HC9A 2PPLA 3CNBA 3R7WA 5LZ4A 3ASZA 3AUUA 3UN1A 3U7GA 5FWYB 2GAFA 2BD0A 5DYYA 3UK7A 5IN4A 3C85A 1ZYUA 1TO2E 2QGZA 3GHYA 5FPSA 5BMVB 3SZ3A 3VH3A 1ZCFA 5BQ3A 3FOFC 4PYLA 3GPBA 4K28A 2A0YA 4N12A 1M6WA 2JJ8A 5HF8A 4X66B 4W5TA 3VPFA 3FDJA 2FFRA 4AY3A 4YK7A 4CQJA 5AW3A 2O4CA 3GELA 3P97A 1IJBA 1A97A 3A4IA 3PA6A 4XX1A 1CYDA 3EISA 2IV7A 2ZJYA 4HFMA 5BUQA 4KR2A 1TOAA 2AYXA 2J1LA 5FFFA 2FMUA 4IXWA 4OUKX 4JEHA 5LB4A 1WU8A 3H9GA 3IUJA 4HWRA 4DR1B 3DE6X 4GO1A 3MINA 4DRZA 2BKEA 4FZVA 2ZT7A 4FB5A 1RHKA 3ZQUA 4US1R 2AFHE 2BHSA 2C9MA 2VP0A 3IPYA 4P3PA 3AETB 1CZKA 2F3RA 1H0RA 4AP5A 1RDFA 1T34A 4I4TB 2JLZA 1MORA 2QP4A 2AVNA 4D4IA 3WLNA 5F23A 2Q4OA 1VECA 4HNQA 3RRJA 3AXSA 1ZH2A 2QTMA 4QPNA 1UFVA 2OZKA 3C4JA 3GK3A 1ADGA 1T5TA 2HLDA 1YRAA 3UW1A 1K5HA 5JYDA 3AZPA 1KI9A 2C92A 3D6NB 3O3MB 5I8ZA 5KB3A 2E4ZA 1DKMA 4WBSA 3STXA 4TQ9A 1ICIA 3MTIA 3I2GA 2B98A 2VJCA 3LBNA 2BKVA 1E3SA 1CY6A 3DBHA 5H4HA 3QEJA 2VJAA 1W581 2DVMA 1DAKA 1N0IA 3BTUA 3IJ5A 3NIWA 4S1VA 3ER9A 2JAPA 4UUPA 3IPAA 3U13A 1D2EA 4AJHA 4CPDA 3VSEA 2V59A 1LDNA 4HG2A 3VPHA 4LUCA 3HKBA 2PO7A 3L0CA 2AOUB 1VDMA 1Y63A 3PFIA 4QU9A 1M1YB 4RQBA 2Q27A 2AW3A 2RI0A 1SU4A 4CKZA 1VMEA 1XR3A 1V11A 2VUSA 4URFA 3LUJA 4IIYA 5ANRB 3HUUA 1BW9A 1UT6A 2DH6A 2ZZKA 2Q6LA 2LCIA 3KYJB 5AVQA 4YXFA 2OL4A 1V8BA 2X8BA 3QH4A 1CJSA 1C8VB 2OCIA 1ST3A 2PKXA 4I1VA 13PKA 3IQZA 4M1ZA 4EY6A 1BWRA 1YR6A 3ND5A 4DV0B 2X7HA 3W5AA 1RC1A 4N3BA 4I6JA 5JJKA 1CNEA 1YVDA 4X7MA 4PN7A 1H5UA 1VG9B 1GN8A 4V2UA 4XGKA 4DAEA 1L0BA 1NQXA 4Q4DA 3OCYA 3OAAD 4O33A 3B1FA 3G8CA 2X0IA 5E9JA 4CQMD 4DQVA 1RYEA 5EE3A 3L06A 4G0VA 1XNRB 3GN1A 2RBKA 3U7JA 3C5CA 4DA8A 1TCUA 3VHXA 4X1YA 3W6ZA 4IG9A 1AOXA 2RI1A 3GIWA 4PLWA 1WPQA 1J56A 1TTHA 2P8JA 4GVPA 3USES 1DEOA 2X19A 1ISRA 4MV1A 1B42A 1OTXA 4WGFA 2POQX 3U0BA 1ULAA 1NZJA 4B4KA 1NL3A 5J5CA 3I9LA 4LJ8A 5TQ0B 1EFKA 1Z75A 2PH5A 3BWCA 2BGRA 4BV8A 3MD9A 2I1LA 2JATA 2VHXA 2WSLA 4QBHA 2IXBA 1CIVA 2VK1A 3B89A 5E8RA 5EPUA 2RHWA 4UZFA 3VNAA 1HLFA 2W5UA 1R15A 3E5NA 4YP9A 2FWBA 1QIKA 4S12A 1WXIA 4HLNA 1MPXA 3C45A 4N18A 3G5UA 2VDMB 3TKYA 4FYHA 5B30A 4D1YA 1T8TA 5FNVA 3OPQA 4N1AA 3STTA 1A69A 3PC3A 4AS2A 4EUHA 5M04A 2CZGA 4RENA 2VYFA 1QK4A 1SKUA 1ZHHA 3QWIA 5DIFA 2WIJA 3O21A 2YXPX 4W1SA 2JFUA 2NXNA 3EFHA 4JI5B 2FG7C 2DLNA 4ETIA 2HBQA 4TTJA 4CKCB 2BFMA 1PZNA 3J7TA 1Z15A 4QL3A 2A5FA 2ZJ2A 3C8HA 3GT0A 1OH7A 1NV9A 3O8OB 1X1BA 5IT0A 1ZNQO 3W8NA 1GARA 3R0QA 1PL6A 5KC8A 3C1TA 2IDJA 1VKOA 5L3SA 3JZMA 1BRMA 1SKYB 3LC7O 5P8WA 4D4LA 5IJZA 7ABPA 3FRIA 1M10A 4DSOA 2UZ4A 2YUIA 1ZD2P 1IBCA 1MA3A 4EM6A 1W0JA 1WU7A 4D7AA 1D07A 4EJ6A 5EI5A 1QG6A 1HDIA 3SJUA 2A2ZA 5TS3A 5D6OA 1SUWA 3R3XA 3LYAA 3I5UA 3TKLA 3KB8A 2ZUBA 4JLSA 1U7HA 1Y1QA 4IGAA 4Q3KA 4JA2A 1DMRA 3OUTA 1AURA 2HF2A 4OBBA 1H4TA 4PC6A 4QX6A 5IBPA 4Y1EA 3VKVA 4NI5A 3ILHA 3QEAZ 4V0ME 4QXRA 1WL8A 4D9KA 1W88A 3ETGA 5A7FA 1LS1A 4WERA 2IF2A 2GBPA 3HMKA 5G0TA 2JFBA 3H1BA 4QT0A 3W8FA 2BMDA 4J2OA 4AQ7A 4KR3A 1TLTA 2D2VA 2HIGA 3FJ1A 3NYWA 2AOUA 3PHHA 1G8FA 1MV5A 2H00A 1EFDN 2IPOA 3RRNA 3UUWA 3N0WA 5LOVB 1DWUA 5DMHA 1VG8A 1XCMA 3ETEA 4MR8B 1C30A 2DSTA 3RWMB 2IT1A 1FOEB 4MTCA 1CVIA 1WLSA 4LX8A 3DAPA 1PZFA 4N47A 4YMTA 3DM5A 1BH2A 3HB9A 3A37A 3BK2A 3L0ZA 4FXPA 2PKRA 1G6OA 3F8TA 3B5EA 1BE8A 2NO6A 3W2HA 3QOWA 1B76A 4Q7LA 2B8NA 3SQMA 1TD1A 1OW3B 4NATA 4J90A 1R8QA 4PF1A 2XB9A 3U9SA 2AZDA 4BAGA 4LOJA 5GQSA 4HDQB 3B52X 3FX2A 4LFCB 2FWRA 2YVUA 2JCYA 4NBNA 5C1OA 1U0RA 2GFIA 1CZUA 4E1BA 5NLLA 3L7BA 2R2AA 3H6GA 4IO1A 2XDWA 3WZLA 1AKWA 1R9NA 2NVUB 1ZMXA 1FTYA 3GLHA 3Q98A 2IOQA 2Z9CA 3A32A 4IDDA 1QOQB 4O2BA 4ZP1A 5SY4A 1PW7A 5F1PA 4RFSB 2IYUA 3N75A 1JKIA 1QHHB 5LA6A 5KYUA 4CR6A 5ILOA 1K8QA 4XJXA 3BXGA 2A4KA 4I3FA 1W6RA 3N8IA 1FRNA 4MVJA 4BNUA 1UAAA 3A4MA 5A5VA 1Y81A 3RTCA 2XVAA 3BJZA 1JP7A 3PPYA 4JC8A 4IIFA 1B2RA 4EW3A 2AT1A 1I3LA 2P9ZA 4W8GA 3ZWVA 3FGPA 2IUYA 2X2EA 2ZS7A 1JYSA 1ZWKA 3OTGA 2C2HA 4GBMA 3REOA 1RIFA 1U90A 1N0UA 3K0CC 5F4BA 1TQ6A 4EY7A 1RKUA 3S8YA 2XKBA 5TMBA 1MHTA 2W8BA 1ABBA 3AFGA 2P75A 2HSDA 4NV3A 3UFXB 1ELOA 3NHKA 3GDGA 4ZCSA 3ZDZB 4XPZA 2C9CA 1XHEA 2I6FA 2JZNA 4EZBA 1KYXA 1EFRA 4UHJA 3T06B 3VNQA 3E35A 3KUUA 3N2KB 3PJDA 4J7CA 4DR5B 2ZCJA 1CSEE 4ALIA 1P4GA 1PNVA 1ZVMA 2FPWA 1KK1A 4LHXA 5LYYA 3MT9A 3PXGA 4YMHA 4J75A 5DNCA 1A2KC 2G5PA 3ZX5A 1VJTA 1K89A 4B8WA 1WMBA 2I9PA 2A5GA 4YLYA 3F5QA 3RT1A 3R7FA 4MVCA 1SA0A 4GP9A 1YNOA 4X6LA 1TF5A 3V6LA 4D3SA 2JIOA 5FDFA 1T1JA 1E3DA 2ISQA 4NDZA 3EEFA 4NAHA 4MRPA 3LT0A 4WE3A 4LHSA 1UMBA 2WJIA 4F7WA 1TUIA 4P2BA 1JIXA 3V55A 3I9V1 2VS1A 5CURA 3QG1A 1E5LA 1XROA 1CUEA 2COUA 1N2CE 1RYNA 4XASA 5LNK1 2Q0XA 1YR1A 1BYUA 3DBRB 2H85A 3M8KA 1ESMA 3GZNB 4JYZA 2WSYB 2DFKB 3LY9A 3RUDA 1Q20A 2WKRA 3DKPA 1O0BA 1JHOA 3R23A 5LBUA 1HBJA 1ZLXA 2BEVB 2VK8A 1X7ZB 3QPVA 4GEGA 4ZI5A 1N36B 2ZRFA 2XVMA 3JQ8B 4YRPA 2OPHA 3T1QA 1FTNA 3H13A 5AKHA 5AICA 1QAOA 1CY8A 1YAJA 1YGYA 1I3OA 1TYBE 4EKGA 5F76A 3DONA 5LYJA 5C34B 4AG3A 3D7LA 2H0RA 1YKSA 3CO5A 2PLAA 3H86A 2DTEA 1TTQB 4PCLA 1OKKA 5J63A 1L7XA 2ODEA 3CSDA 3O90A 3CW2A 1HURA 3FTNA 1QGUA 5AVOA 5G4LA 3ZV5A 4JC5A 4DJFC 2D74A 3ZH9B 3OOHA 3FVVA 2JFQA 1GGNA 4G0QA 4MZXA 2RGXA 1EESA 2ZCVA 5EYPB 4UOZA 4KQWA 5TR9A 1H3NA 2BZ1A 2J6BA 3KQVA 5GP1A 1QKJA 1W8IA 1G7TA 1ICEA 4MKGA 4L15A 4X1YB 3MUFA 3CQ9A 2B34A 4G63A 3GLUA 1GTRA 4A2PA 2IPXA 4OHWA 4XGRA 3TEMA 3JWIA 3U56A 3F6PA 5KSOA 3HNRA 4JT8A 4XR9A 1QVVA 3OZWA 4Q47A 1ZD4A 1THGA 2EW1A 1M74A 4RZ3A 5IDYA 2RGGA 4G2NA 1OFHA 2I4LA 5JECA 4CN9A 3WDSA 3FZYA 4DM3A 2PX4A 2CXXA 2WTXA 4BIMA 2CDRA 3PUWA 4RK6A 1P2GA 3OHPA 4KXMA 3K8QA 3QZUA 4AZWA 3PPIA 1MGPA 2CLHB 2DFPA 1CT9A 4C6HA 3TNFA 1P75A 3GGGA 3QELA 3RHFA 4Q4HA 1IZ9A 3NFYA 4JIGA 1RXEA 1ZIDA 5JHGB 4WA8A 5FKJA 2PZMA 3DMNA 3NPAA 1EEHA 4OQMA 2JGIA 1SZDA 3HY3A 4M4SA 4CR8A 4YB8A 4X92A 3TGPA 2GD2A 2OV2A 3K53A 2PSJA 3ZD7A 2AK2A 1M34A 2EDAA 1CETA 2FV8A 2R6AA 4V0MA 5SZJA 3RLIA 2ZBVA 1NWHA 3HKCB 1JAIA 5I8WA 5J3JA 4L8WB 4EH1A 5AKGA 5F5LA 1MQ9A 3Q15C 4P33A 2UXDB 5E0KB 3VYWA 4U2EA 5HNKA 1RD4A 3VI4B 2G04A 3L0SA 5J40A 3KPJA 3LVQE 4ZV9A 5C1DA 1DOAA 3AIMA 1G4AE 3DPSA 3LECA 4UM7A 4MR9B 2W2KA 5ICSA 1WIWA 1WSBA 1A4XA 4HQ0A 1V1MA 2QE7A 4M1QA 2NSYA 4OSEA 2A9OA 4YP5A 2YYSA 3FFBA 3RYIA 4FCTA 4RKEA 4DUGD 1FW6A 3BTOA 3KT0A 1JSCA 1JEYA 2V74B 1GGEA 3CRQA 4ZQGA 3WJAA 4Z49A 4AG6A 3HKEA 3IBSA 4BGEA 2WM3A 5JAPA 3M6UA 1TM3E 2J0SA 3SBXA 1TT7A 2EW8A 2H2AA 5TPWA 4EGFA 1TB4A 2V1UA 3R0IA 3W2FA 1Q84A 1H4SA 1KMHA 1EDBA 4HYYA 3W3AA 2PQ0A 2JARA 3BFPA 2WNIA 3FDXA 3UAXA 4ND1A 1QNFA 4PNPA 4B6GA 1VIVA 3TUJC 5EZYF 4EDHA 2QJWA 5JROA 4CF6A 4EX7A 2ZYDA 3MXTA 2XRYA 3P26A 3I0MA 2OT3B 4BEJA 3FPAA 4TS1A 5K0NA 1KZGB 1Q95A 1ZZGA 2AUMA 2MMGA 4NHEA 4Q7KA 1WX1A 2YCLA 3GCWA 4E32A 2B5VA 4CFZA 4I08A 5ALIA 4FGSA 2A3NA 2OY0A 2DR2A 1K5GA 1H6BA 3FUXA 1KF0A 1VKRA 4RQAA 6YASA 2A88A 3DZGA 3GC6A 3HU3A 3O6VA 5CVJA 4EHHA 5AUNB 4KV7A 1QQ7A 4EHKA 2O20A 3MW8A 3SMVA 4AY4A 5EXXA 2F3QA 4H6VA 1ENYA 1C2YA 1IHUA 2PAAA 3G1WA 3OT1B 4YLGA 4ZU6X 4CHGA 3E9YA 2CMGA 1W73A 5E38A 2JASA 3VDNB 3DDZX 3MGGA 4URWR 2XYPA 4E5VA 3LZ6A 3RASA 1EIZA 3C3PA 3K96A 3OKPA 4JKOA 4FQ7A 2E2WA 4IUDS 4TT8A 3DXYA 2V7PA 2JIQA 2PBLA 3FNEA 4Q7JB 3O9VA 5DHPA 2IS6A 2VP2A 4RMHA 3LHDA 4QE3A 1C9DB 4R68A 5BWLA 3NV7A 4R6XA 1CY2A 4RPIA 4TYYA 4OHBA 3CLSD 3DYVA 3HPRA 3W9YA 5LLDA 2C4NA 2X41A 3AZOA 4UVIA 1J0DA 2X23A 1XBTA 3SVZA 4US0R 4YROA 4O4JB 3OMXA 3TTUA 1Q2XA 1D7AA 1QH8B 2A1TR 3H5OA 1OT5A 4MRMA 2JZCA 4UHEA 2WWVD 3WKEA 3WK5A 4UOEA 2F62A 2VUHB 4XFJA 3SVTA 5TX7A 4DLUA 4TMFA 1Y3HA 5HE8A 3TR0A 4ARBA 4C0QC 3OQJA 3PEWA 3LD9A 1EUCB 2IEBA 3BTVA 5FWXA 1P1RA 4Q4LA 2FFHA 2HK7A 2QTVB 2B4TO 1HQDA 4KVAA 5A1TA 3O8DA 1NKTA 1OF1A 3VO8A 4KQJA 2IHZA 3P2EA 5LMUB 2YV3A 4QNNA 4X6UA 1EGMB 3Q7TA 3BWXA 4ERXA 4DJJA 1EVZA 2WMDA 3GA5A 4O5AA 4RDIA 3AEYA 4UEQA 5HZMA 4WINA 2Z83A 5BSVA 3ENWA 3QVOA 3EE6A 2WM8A 3ELBA 1KI6B 4EVRA 3M4XA 3N8GA 3VU3A 1AXRA 4HJXA 5JNUA 2G71A 5C7OO 2JIMA 4WGGA 2LKDA 1BROA 4GZ3A 4Q9LA 4KAJA 2XNSA 4DF3A 5DX1A 3ZJUA 1Y6FA 1P0FA 1FUEA 4ZAZA 1JVSA 3G1TA 3KQKA 1JS1X 5F5NA 1NF3A 2VT2A 3HU5A 5P21A 1E5TA 3UHFA 3KWMA 5C4MA 3LJKA 2QGFA 1TJYA 1MO3A 5AKZA 7MDHA 3IVXA 4NS1A 1E2BA 1MIHA 3JQ7A 1BMFA 4O4JF 1ILEA 4AJ4A 3D3JA 3DEKA 1DADA 2GGSA 4LMAA 2D1TA 1IY0A 5HGJA 5IM4F 2QJOA 4RNCA 2CFCA 4XFDA 4RKFA 3T4EA 1HLGA 5IW8A 4CWAA 2DKOA 1PHRA 2R6JA 3WMGA 5L3VA 2CK3D 3A0UA 3WMEA 2ZWMA 2GCPA 4G5FA 4TMYA 1NNUA 5FFNA 1H9CA 1KJ9A 1Q5PA 2FETA 4LDRA 2IEGA 3WHLA 5COBA 5AUPB 1NVDA 3U7QB 1L4GA 3SQDA 4B1FA 1HNXB 1YV9A 4DJDC 2VF7A 2ZBRA 3H17A 5DN6A 2BHRA 1LI4A 3MGBA 4AF7A 1KRWA 3BD9A 4YCCA 4TV9F 1MF7A 1ODKA 4L0MA 5K09A 5KPDA 1U5AA 1CIJA 1IB6A 4X63A 1NY6A 3UM9A 2ZUEA 4P38A 4MVJP 3LUPA 4F2HA 5JAUA 1K98A 5E7QA 3A3OA 3CRZA 3I2HA 3WYBA 3MWDA 1KO5A 1YZLA 2QIOA 2UU9B 2PGJA 3NC4A 2EKBA 3VKGA 1Y4SA 2OFOA 2WTMA 2HO4A 3K8YA 4Q4JB 5F52A 3WYNA 1GL3A 4E5UA 2WQ6A 3H42B 5CB8A 1E4EA 3HB0A 4PAMA 4LW8A 5BV2P 1CUSA 1DXHA 3GJ5A 4IIJF 3KJNA 3HVIA 3CX7A 1X1EA 3KAPA 2XBMA 3H6HA 3C3BA 2IDZA 4HWPA 5EJGA 2CNKA 2GBFA 4JI7B 3IQHX 3A6LA 4HGZA 4UMDA 1KVUA 2VSYA 3OTOB 2NZUG 3B38A 3PRYA 2FLVA 2Z1DA 4II2A 2QZZA 5KCMA 4DQUA 1U2TA 2Q49A 1CUHA 1SC6A 3DOUA 5GJVC 3VM6A 4DLNA 1GPJA 2A30A 3CS3A 3GY0A 2P35A 3IAM6 3ZUGA 1H2XA 1A7KA