3SC4A

Crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
280
structure length
280
Chain Sequence
SLRGKTMFISGGSRGIGLAIAKRVAADGANVALVAKSAEPHPKLPGTIYTAAKEIEEAGGQALPIVGDIRDGDAVAAAVAKTVEQFGGIDICVNNASAINLGSIEEVPLKRFDLMNGIQVRGTYAVSQSCIPHMKGRDNPHILTLSPPIRLEPKWLRPTPYMMAKYGMTLCALGIAEELRDAGIASNTLWPRTTVATAAVQNLLGGDEAMARSRKPEVYADAAYVVLNKPSSYTGNTLLCEDVLLESGVTDLSVYDCVPGSELGVDLWVDSPNPPGYTGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Short chain dehydrogenase (A0QTM2 homolog) Mycobacterium thermoresistibile
rcsb
source organism Mycobacterium thermoresistibile
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase (A0QTM2 homolog)
total genus 93
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc4A00
2FZEA 3QA9A 1YOVB 4PVCA 1HTBA 3OJEA 1O89A 2PY6A 4GGOA 4Q39A 1O94A 4YJGB 3E18A 1DJQA 1L1FA 3WLFA 1NHGA 2BELA 1V3TA 2PD4A 3HADA 4YAGA 1HDYA 1HSOA 4NBVA 3NKLA 3U62A 2JFHA 3WGTA 4IDGA 1N92A 4BNKA 3ICPA 4IZIA 3P2OA 3NT5A 1LDGA 2HLPA 2E82A 5KKAA 2ZTLA 5JXWA 5FF9A 2W2KB 3PQFA 1IZ9A 1QRRA 2B0JA 2CMDA 2FOIA 2PH5A 3NTRA 4J9VA 4YQYA 1TI7A 4TQGA 4BMNA 3KBOA 1I2BA 5A04A 3HZZA 1P1HA 1YVEI 4I5GA 3ZV3A 1NVGA 1PGJA 4DIOA 4R1UA 2HSDA 3U4DA 2YUTA 1DBVO 4E3ZA 4GPD1 3JQAB 2Y1EA 2X9VA 4OYRA 1A72A 2UYYA 2NVUB 2JCYA 3HUDA 3JD1A 5AOVA 4E0BA 3WXBA 3DBVO 2VZ8A 5I7VA 3C7AA 2E4AA 1HDGO 2OGUA 5IZCA 1OC2A 4WCFC 3ZW9A 5TJHA 2BFAA 3ZV6A 3LC2O 2VTDA 4NU5A 4NZ9A 3WDSA 1EFKA 2CNBA 1LSJA 4ZQGA 4MPDA 1RM0A 4C7JA 5I8ZA 2HKIA 3M2TA 4FB5A 5JDIA 1QMGA 4JBGA 5KJ6A 4Y9DA 1IUKA 4G2NA 2HU2A 5HTOA 2B4RO 1LNQA 1Y8QA 1I36A 2V6BA 3O26A 4ZN6A 1AHHA 4FFOA 3SLGA 1ZZEA 1IOLA 3ZU3A 4FPXA 4B4VA 5JC1A 2VYNA 3DXFA 4ZGWA 1DJNA 4OXNA 2YW9A 4XB2A 4K1LA 1YB4A 4XGIA 3ADOA 3LDHA 4YAJA 2YHIA 4QSMA 1I3NA 1F8FA 4DUPA 2YFQA 3FWNA 3D4NA 3RUAA 4CMCA 1M75A 4EEZA 4J7CA 2ZQYA 2NVWA 4AICA 3E9QA 3BXXA 3L9XA 1Q0HA 4HV4A 3VH1A 3ZWMA 4XRGA 4LRSB 4OQYA 3NJ4A 4Y6SA 4LMRA 4D41A 3Q0EA 4PN3A 1WDKA 3PVZA 1WPQA 3UCFA 4M54A 3E48A 1ONNA 3BTSA 4FFMA 1I33A 5C3MA 3RKRA 4D43A 2OUIA 4X54A 2GERA 1MB4A 4HFNA 3MEQA 3LT1A 1HE5A 4ND4A 5EQDA 4ZRMA 2P68A 3ZCXA 4EDFA 2GO1A 4PLTA 1VL6A 2X4GA 1QR6A 3AM3A 4ROSA 3HE3A 2WM3A 5TT0A 4FFPA 4WJZA 2Q49A 4Q9NA 1PL8A 2BMAA 1R12A 2WWRA 5A9SA 3D7LA 4WUVA 3ENKA 4D42A 5KVCA 1SPXA 2YV3A 1P1KA 4CMIB 4BNFA 5I7SA 1NPTO 5CDTA 3U0BA 3JQEA 2Y93A 4EITA 3DOCA 3JQ7B 4RL6A 4RPJA 2E48A 2O7QA 2X5OA 1VM6A 4R5HA 3PIDA 3L6DA 3H2SA 4QEDA 3WGOA 3ZWWA 4GVLA 1LLCA 3ASVA 4BVAA 2FPPA 3GEDA 3GOHA 4JNKA 5JMWA 4GSKA 1DPGA 4YJFA 4J3FA 4MVJA 3AM4A 4YACA 3F9IA 3AFNA 3WWZA 3AU9A 3WYBA 2PKQP 4LK3A 3ETDA 3PHLA 3ZWBA 3FBTA 3W6UA 3WMWA 5THKA 3TQHA 4BL5A 4NFYA 1KERA 3VDRA 5JMPA 1NQTA 2HMUA 2VOJA 4L4RA 3DAGA 1LSSA 1NNUA 2G82A 1VJTA 4Q3AA 2E49A 2NSDA 2BI7A 3EZYA 1E3JA 2PGLA 4R4JA 2JAPA 3FPLA 1KEPA 3DBHA 4LRTB 4D0RA 4RVGA 3ETGA 4O0LA 3BAZA 2HJRA 1A9YA 2OMEA 3BMQA 2FP4A 2NVUA 3RAJA 2FHSA 3IP1A 3OA0A 3RFTA 3N74A 1XU9A 4JLWA 1E1MA 2HQ1A 4IDCA 2TMDA 5F5NA 4WOJA 2BFMA 3K6JA 1G0NA 5EINA 3UKOA 4YT8A 2P2SA 2PKRA 5HWSA 4IIVA 1GEGA 3NRCA 3RBXA 3ICCA 2J3IA 1NQ5A 1C14A 1G1AA 4B3IA 2O3JA 1I8TA 3NAQA 3ASUA 1U7TA 3DBLA 4BNNA 3ONEA 4BO7A 3RC2A 3V1UA 3KUXA 3R3JA 3S2FA 1HDZA 3BMNB 1C0IA 1GUZA 5TRTA 3W8EA 3C24A 1PZHA 4TWRA 1GV1A 4UVHA 4IDBA 1Z7EA 4E5MA 2RH4A 4XWYA 5JAIA 4B7UA 4PLGA 5L7YA 1PJ3A 5T57A 2D5AA 5THQA 4MVJP 3RKUA 1XQ1A 5JDCA 5DBIA 1OBFO 4B4OA 4IPTA 2EXXA 1ENYA 1OMOA 3UXYA 4TSKA 2J3KA 1VJ0A 3JQ9C 5JYEA 4BNWA 4YJHB 1NWCA 4QT0A 2QQ5A 3GN1A 3Q6IA 5CEJA 4TKMA 3VH3A 2Q2VA 2I99A 1VJ1A 1KY4A 1QV6A 2H9IA 4NMHA 3JCZA 1K6IA 3PDUA 3GK3A 1KEVA 3ZWYA 1NX6A 3G1UA 4M55A 3H3FA 1BG6A 2BFPA 2OZPA 1WDMA 1PGOA 2NNLD 4RQUA 1X15A 2W2LD 3QV1A 1XG5A 4K28A 5I9NA 4S1VA 2IRWA 3ANNA 4FW8A 2D8AA 2H6EA 3A1NA 3L9WA 1DAOA 4JP3A 4E5KA 4EJMA 1Y6JA 4J0EA 2ILTA 4CQLB 2XXJA 2Z95A 4PLZA 4MVJI 3AI2A 1E5QA 2D4AA 3EDMA 3NTOA 1CETA 3GDOA 4P4LA 4RLSA 5ENDA 5IXYA 1GV0A 3PJFA 2EW8A 4ALKA 1D4FA 2ZB3A 2ZYGA 3AUTA 1KVUA 2EGGA 1UXJA 1QYCA 2JHFA 4B7XA 3WSVA 1XSEA 2GN9A 1I0ZA 3S2EA 3HDYA 1B16A 1DFIA 1NBOA 4Q3BA 1JAYA 3ULKA 4E33A 3Q2IA 5TSDA 2NACA 1ZFNA 2X5JO 2B83A 3WQSB 2VWPA 3TZCA 4D46A 4E31A 4Y8VA 3PHJA 5JC8A 4PIVA 4QXMA 3PDJA 4BB6A 3KSZO 3PQDA 2Y68A 3M1AA 4WEQA 3Q11A 3VKUA 4BO2A 2QX7A 1S6YA 1LSUA 4N7RA 1MUUA 3GMDA 5COQA 1PX0A 3L6EA 1SZJG 1V6AA 4F6LA 2RHCA 3RWBA 5MGBA 1DDOA 2V6FA 3H6KA 5EIOA 4CM4A 4YXFA 1P45A 4R41A 1A27A 4Q3CA 5H83A 1YKFA 1P1JA 1XDWA 4MINA 5GZ1A 3FI9A 4M49A 3OA2A 3DBHB 2EKQA 3FN4A 3HFSA 3H9UA 5G4KB 2UDPA 1XWFA 4MVJH 5ES3A 4R54A 4CMEA 1PJSA 1FXSA 3SX2A 3UICA 5CPBA 1FDVA 1IPEA 3TOZA 2YQ4A 2RH8A 4DQXA 3AW9A 3ROMA 2G17A 4BV9A 3SXPA 5KOIA 1P33A 1RM3A 2X0RA 5C37A 5IF3A 4ZQBA 1I3LA 1LEHA 1MGOA 4BO6A 1KYQA 3GEGA 1EVJA 3KLPX 4PVDA 1XQ6A 3ADPA 2VZ9A 4I9UA 1ZEJA 4R51A 4R5MA 3VDQA 2EP5A 3M6IA 2Q4BA 4XRRA 4A7PA 1E92A 3OEYA 1JTVA 3QWFA 1ZNQO 2DUUA 3K8ZA 4GX1A 3OJ0A 4BQRA 1B15A 4NNJA 1D7OA 3GUCA 5DBGA 4CQMB 4YDRA 2HDHA 3MJTA 2FN7A 2B5VA 4YWJA 4HNGA 4BNLA 4E5NA 1BDBA 1JKIA 3S1LA 1GUFA 2G5CA 1EE2A 3ZH2A 1FK8A 1V3VA 4I5DA 5EERA 4CL8A 4CM1A 2XOXA 1YL5A 5BSGA 5FI5A 1U8XX 1IHYA 1ZSYA 1J5PA 3FRJA 3KXDA 3RC1A 3TZ6A 4OAQA 4KOAA 1MP0A 3SJ7A 5KJ1A 4MJLA 3LZ6A 2AQKA 3JD3A 2C2YA 5IJZA 4FN4A 4HY3A 1HYGA 2HRZA 4CUJA 5DULA 4ITUA 4ND5A 1WMAA 3E03A 1KEUA 3L4SO 4PZDA 2Q1UA 4XA8A 3G79A 5JNLA 2QZ9A 2PWZA 2ZJ1A 2X5KO 1B2LA 3TWOA 4AL4A 2VOEA 2ZATA 3A9WA 3DL2A 4BNIA 5T8KC 3U09A 2B37A 3GHHA 4HNHA 1YQXA 3RUFA 5CDGA 5IDQA 5KJFA 4J7UA 1EUCA 4I1IA 3GFGA 1KEWA 4R3WA 3ZGYA 4CJXA 1ADBA 2D59A 3D0OA 2GD1O 3WR5A 2D2IA 2GZ1A 3SC6A 3WNQA 3L6OO 5KNLA 4P22A 4W9NC 4F46A 1ULSA 3E5RA 1BSVA 1BVUA 4GMGA 4BV8A 2JD1A 5HM8A 4UREA 1T24A 1N8KA 2A92A 4P38A 4CMAA 1R15A 1R0LA 4YCAA 9LDBA 4LCJA 3PWKA 1P77A 3ZNNA 1EMDA 1PJCA 3IP3A 1BWSA 3DHNA 3N58A 2NQTA 4IJWA 3D3WA 4PLHA 3I9KA 3LC7O 3GZ4A 2ZJ0A 4FOSA 3DONA 4P4NA 4PLFA 5KJEA 1WVGA 1IZ0A 5DT9A 1HYHA 4J1SA 1BW9A 4Q3NA 4XCVA 2V65A 1FDSA 3I9OA 1FDUA 3GA0A 4IS3A 3NUGA 3TZQA 2X9NA 4FGSA 2AE2A 4DQVA 4D0SA 3OP4A 2PFGA 2R2GA 3QJ5A 4OM8A 5COBA 3PJGA 5AVOA 5JS6A 3P19A 5IDWA 1JA9A 1R6DA 2FR8A 4BHTA 3O8QA 3VH4A 4BKQA 3UGKA 1N9GB 2FZWA 2F00A 4GMFA 5JDIC 2FR1A 4XQ9A 4OIMA 1B3BA 1KVSA 2DKNA 2Q46A 3FF4A 3R6DA 4NJOA 1P0CA 3VVBA 1BXZA 2XPCA 2C59A 4YJDA 2GRAA 3WICA 4CQMD 2I66A 2H1SA 1EDOA 4RV9A 3V1TC 1UXHA 4GKVA 2O3RA 3GGGA 1XU7A 2VTEA 1E3SA 1A4UA 3VAZA 3TFOA 3AUAA 5GZ6A 4G5HA 5FEUA 4R1TA 4TROA 1A7AA 1WAMA 1PU2A 1X0VA 3MOIA 1PGQA 3K73O 3MOGA 1NHWA 2QW8A 4IIUA 3DMYA 3D5QA 1C1DA 4IZHA 1ZUD1 2PD3A 3WGYA 3DAPA 1Q0QA 2VYVA 2HJSA 3GGOA 3TZKA 3BHMA 3RUIA 4BGEA 3VZRA 2A35A 4R69A 3B20A 4JX8A 2ZIZA 4XYLA 4ALJA 4J7XA 3PZRA 4LN1A 4QO8A 3OIGA 1JWAB 1PZEA 3GLQA 3DFZA 5JAQA 1T2CA 1U4OA 3TRIA 4B3HA 1EFLA 2NVBA 1GQQA 2NADA 5CP8A 1DLIA 1VI2A 3ONFA 4WPGA 2AE1A 3FSRA 1B3RA 3C7DB 1DEHA 4ILKA 1GZ4A 1WZIA 4XKJA 2IXBA 4DGSA 4BO5A 1RYEA 4KMSA 1C1DB 4Y6PA 5AXAA 3WGQA 5L4LA 4J2OA 2E37A 3ST7A 1NASA 5DZSA 3H9QA 1S7CA 1LDBA 1SOWA 1Q7BA 1Z75A 1U7HA 1TB4A 2YDYA 3HDQA 4YQZA 2DC1A 4CM4B 1ISFA 1DFHA 1QLJA 3GF4A 1DIHA 1ZXLA 4BNJA 4OOEA 1EZ4A 3I52A 1CF2O 1QLHA 1UXIA 5H82A 9LDTA 2CF6A 2WSBA 3FTNA 4J43A 4IINA 1Y9AA 2A4KA 1VL0A 5BSFA 3OH8A 5BNIA 3GQVA 3G3EA 3ENNA 3IS3A 3IDSA 1HYEA 2DVMA 2YV1A 4UUMA 3KSDO 1EBUA 3DHYA 4WLVA 2PV7A 1ZSVA 2XF8A 3MWDB 5LCXA 3JQBC 4CLDA 4CM8B 3ZU5A 5G0SA 4Z9YA 5ITVA 2Q2WA 1RJWA 6ADHA 3JQ8B 3L4BC 4YRAA 4OQZA 4LGVA 5TX7A 3S2GA 4BO0A 2EIHA 4RGBA 1T1SA 4FD3A 3H5AA 7ADHA 1DHTA 4QECA 5L7WA 3E9NA 5TLSA 2ZTVA 1ENOA 1BXGB 3GZNA 3RD5A 1HZZA 3OIDA 1GZ6A 1L7EA 4FS3A 1BDMA 2Y0DA 5KWEA 3BMCB 5A03A 1C0PA 4K6FA 3KYDA 2O4UX 4P8RA 2AMFA 2Z5LA 2ZTUA 3W8FA 3F1KA 2D3TA 5DP1A 1DIRA 3Q1LA 4IGFA 5DCYA 3KEQA 5TQVA 1ZMOA 4A5OA 1FJHA 4WE3A 4DLAA 1UAYA 3ZHZA 1V8BA 3FCOA 4D3SA 1JU9A 4BNGA 1BTOA 4QFDA 4E5YA 2HRBA 1ZMTA 2GSDA 3RU7A 1E6EA 3UCXA 2VCYA 2OP1A 1ZW1A 2UVDA 3DZFA 3MZ0A 1HZJA 2WDZA 3IMFA 3VH2A 1ISIA 5HS4A 4E13A 1X7DA 4J49A 3BMCA 2VRCD 1RPNA 4ND2A 4Y67A 3L07A 3KLMX 5GMOA 4CODB 3HDHA 3NX4A 3KV3O 3MJEA 3KYBA 1TVEA 2VHVA 4ZU3A 4DA9A 4B7CA 2FWMX 1ZK2A 3ZU2A 2CVQA 1GPJA 4KUEA 2VN8A 1PJTA 4J2HA 1W73A 4MP3A 4U0JA 3PWZA 1X0XA 1Y5RA 2CVZA 2EF1A 3N7UA 4TRNA 1GDHA 1F12A 1HDOA 2I65A 2VT2A 3H8VA 4NIMA 4MKRA 1GU7A 1VE9A 2P9CA 1GCOA 2B36A 2VHZA 3KRTA 4P4GA 4IMPA 2O2SA 3H3JA 3RU9A 3DOOA 1JVBA 2Y1CA 1GADO 3UUWA 5A02A 3CTMA 2VWHA 5ER6A 3DQPA 2B35A 3RUEA 4OKNA 3W8DA 3VVCA 3ZDFA 4J6FA 3PIIA 1ENPA 3RBZA 1K0UA 2VNAA 4DLLA 5L95A 1I2ZA 5T67A 2Q45A 4JGBA 3VZQA 3Q3CA 5COAA 3L4BA 2V6GA 1JDJA 1SBYA 3KZVA 4CV2A 1GQ2A 2UAGA 3I9MA 3T7CA 4R68A 1H2BA 1N7HA 3C1TA 4ZQHA 2VRBA 4WLFA 3IC5A 4CR6A 1EVZA 2OBNA 4E2XA 4AJ4A 3JQCA 3PFFA 4FJ2A 2ZTMA 4CLXA 1RKXA 4W99A 3VOSA 1H93A 4L74A 3BTOA 3LLVA 1HDXA 3CEAA 2ZYAA 2X9GA 3JQ8A 3VPSA 3AU8A 4AJPA 1LTHR 3W6ZA 1E1KA 4YTEA 5G0UA 4IJVA 1VKNA 2P9GA 1YB1A 2PD6A 1GYRA 1I3MA 1NWHA 3K31A 4LMPA 5IDYA 2YYYA 4Z9XA 4DBVO 4PGFA 3OFSA 1I01A 3PWSA 5I9LA 3PHGA 4FCCA 3ZV4A 3HN7A 4WCFB 4DPMA 5JBIA 2LDXA 2VWGA 1Y8RA 3VPHA 5JCJD 4RORA 1V3UA 3JV7A 1AUPA 1YBAA 1Y8QB 1U3WA 2FY8A 3WGGA 4NFSA 3GR6A 1HLDA 1PS8A 3EYWA 4RPHA 4YYZA 1P1FA 4ONEA 3F46A 3GN2A 1E7WA 1HLPA 3DBRA 2WE7A 4BNYA 1NR1A 3VZSA 1TXGA 3OBBA 3B70A 1M2WA 4MDHA 3AY7A 3EVTA 3FNFA 4FQ8A 2HK8A 3H7AA 4TKLA 4U8GA 5MDHA 4Y98A 3JQFA 1ZK3A 3CZRA 4WGGA 2V7PA 2IZ1A 2J6IA 2VRCA 3GPDG 2X1HA 2GGSA 3LU1A 1PGNA 4CR8A 4MVJD 4C4OA 2X6TA 1B8UA 1A9ZA 2RHRA 1PIWA 1R4MB 2OL4A 4GLLA 3PJEA 2PZJA 1GFSA 4XYBA 1TT5A 4ID9A 4ZHSA 4JK3A 3JQ9A 4XQCA 4XYEA 3H2ZA 3IKVA 1Z45A 1W6UA 3DZIA 4JJFA 3JQFC 1Y81A 3WYEA 3GT0A 3EMKA 3NDRA 3U9LA 1U3UA 3G0OA 3ROPA 2BGMA 1NQOA 3V8BA 1E6UA 3GVHA 3RIHA 3QWAA 1HE4A 2YHUA 2DT5A 3WQQA 1ISGA 2Q1TA 2BGLA 5IXSA 4KP7A 1EUZA 4LVUA 4ZQEA 4A0SA 1YQDA 3D64A 3ZZNA 1E3IA 3HB4X 1UP6A 2HUNA 3OQ6A 4MKXA 4XQGA 2CFCA 5HS6A 4U6SA 1O6ZA 1X7HA 1PS9A 1LJ8A 5JLAA 4MVJE 1J0XO 3K96A 5BSEA 4BKPA 3GH3A 2CDBA 1R4MA 3U4CA 2XXBA 3G49A 4I5EA 4N18A 4ND1A 1TT5B 4MIEA 2J3JA 5F5LA 4EI2A 3LT4A 1UAGA 3AI1A 3PYMA 1NR7A 3UAGA 4W82A 3PYXA 3VPFA 4YAIA 2AEMA 1NVTA 2O3TA 3O9ZA 4UUOA 4WCDA 2WJPA 1Z6ZA 3ZWAA 1OOEA 4DYDA 1LLUA 1DC5A 2D5CA 4RF5A 2B4TO 3GPIA 3C85A 4IQGA 3OJOA 3U5TA 1JN0A 4CM6A 1KY5A 1GZ3A 4AG3A 4B4UA 2PNFA 4PG7A 3TJRA 4WNIA 1LLQA 3KYCA 4AJNA 3ZHBA 4AJHA 1N1EA 1J6UA 1E6WA 2EGHA 3BMOA 1T26A 2G76A 4GL4A 2X86A 4HADA 4PFJA 4Q3EA 3HG7A 1ZVMA 3U4IA 3MCVA 5TJ9A 3UH1A 1KETA 1WLYA 4WNCA 4BUCA 1BW9B 4UVGA 3QWHA 3MJ4A 4BO8A 5L4SA 4Z0TA 3KHUA 1YWGO 1MA0A 5BNFA 5I7FA 1CQIA 1DFGA 2O3QA 4PLCA 4A10A 3NGXA 5L4NA 4CMKA 1PL6A 5DCUA 1MG5A 2Q99A 1NPYA 4MOWA 3RJ5A 1LDNA 4D7AA 3D4PA 2P4HX 1HF3A 1NAHA 1N7GA 4PG6A 4KZPA 2IE0A 1ADCA 3X2FA 3C8MA 1N1GA 5CDUA 2B5WA 3OQBA 4ZJUA 3WIDA 1YJQA 1DAPA 3IIEA 4RF2A 4DPLA 2O3UA 5I9MA 3RI3A 4UVEA 3LLSA 1UUFA 5DDIP 2BH9A 2BF7A 2Y1DA 4KTVE 2ZKLA 1JWBB 2H5LA 1U3VA 5LDHA 3GAFA 2WD8A 5IG2A 4JBIA 5DCWA 3TZHA 1DRVA 5C7OO 3H5NA 2GZ2A 1U4SA 2X0NA 4OMUA 3RUCA 3DDNA 4W7IA 3W4JA 4ZD6A 1E7MA 3DAFA 2EERA 4FC7A 5TNXA 4BO3A 2EKPA 4II3A 2X0JA 1U5CA 1W4ZA 4XEHA 4WLOA 5T5QA 3HSKA 3UN1A 1ID1A 1LBEA 1YONA 1R4NB 4LVCA 2YHIB 1PWXA 5F3RA 3DFUA 5EL0A 1DSSG 2JJYA 4GGPA 2Q1WA 3ON5A 3H9JA 3PFWO 5G0VA 3RC9A 3CH6A 1EBFA 1XKQA 2CD9A 4D44A 1EK5A 4H15A 4YJGA 5B4UA 3OECA 2PK3A 3I4CA 1H94A 4E2WA 1K2WA 1K3TA 1P0FA 5JCXA 1OI7A 5L53A 1J4AA 2IODA 1TA4A 1BMDA 3OEWA 1L7DA 2DUWA 2ZK7A 4FOOA 1GEEA 3R3SA 1YB5A 4IBOA 4N5NA 4HUJA 3ZV5A 5U9CA 1PL7A 1GYPA 1YH3A 2FMUA 4LISA 5T64A 2AEJA 3TL2A 3BMNA 4FSHA 2AEFA 4J1QA 1B8PA 1ZJZA 4FBGA 1Y1PA 5B12A 1VLLA 1GR0A 1MX3A 1R4NA 3WG9A 4JP2A 3NEPX 5IFLA 1B7GO 1JW9B 4XR4A 1Q1NA 1HE3A 2VHWA 2X7HA 3EY4A 1MV8A 2LDBA 3JQAA 1N5DA 5G4KA 4RVDA 3UW3A 3SBOA 3E8XA 1AHIA 3LQFA 3LVFO 3F6YA 1PGPA 3I4FA 2BLLA 2QRJA 4L0QA 1H2HA 2CVOA 1NPDA 3C1AA 2ET6A 3HHPA 1SC6A 1Y5MA 3T4XA 4DC0A 3LYLA 2ZQZA 3AOEC 1T2FA 2F1KA 1I24A 4BO4A 4CMJA 4WLNA 4J1TA 4WOKA 4KDFA 1QYDA 2Y05A 4QO7A 3WFJA 2NTVA 2Y67A 2E6UX 3KO8A 3PXXA 3O03A 3I1JA 2PLAA 3PGXA 1ISHA 1KC3A 2POQX 1PR3A 2PGJA 5G0TA 4LSWA 3PP8A 4MKZA 4QTZA 5GZ3A 2DFDA 1DC6A 3ONDA 2VZ0A 3EGOA 1MXHA 5U1PA 1H6BA 3KOUA 4CLRB 1GCUA 5I8WA 1F0YA 4R9RA 3NT2A 3OICA 1UDAA 1H9BA 1YXMA 4OGWA 1T2AA 1LC3A 2JCVA 4ZA2A 4AJKA 1YJ8A 1C0LA 2HMTA 3QIVA 2GASA 2BRUA 4QX6A 2WYWA 4BNTA 4AJ2A 2J5KA 2NU7A 2PGDA 3ZWPA 4I08A 3T7EA 2DBRA 5A9RA 1ONPA 4J1NA 5U4QA 1NM5A 2CY0A 1XR3A 3M2PA 1PZGA 5AYVA 3L0DA 2AA3A 1WZEA 1XYGA 5IZCC 3PJDA 3JD0A 4NBWA 4OOFA 1R37A 2Q2QA 1E3EA 4IQ0A 1BGVA 1B8VA 1D1SA 1YOVA 3JQDA 4RF3A 4RVFA 3RFXA 3NDIA 1LRKA 5LC1A 1NYTA 4EBFA 1JAXA 5CDYA 2NWQA 2GNAA 5FI3A 2W2LA 3P7MA 4KTTE 1B26A 2NQ8A 3AM5A 4ALMA 3I6IA 4GI2A 1YBVA 1P31A 2P5UA 1OZAA 1NFFA 3GDFA 2CZCA 4U0KA 4CMBA 4L73A 1ZK4A 5L40A 4B3JA 1LDEA 4RF4A 4WECA 1KBZA 4Y6RA 1HEUA 3VKVA 2IZZA 3CMCO 3VPGA 1I2CA 1KVTA 1C0KA 2Y1OA 4LCEA 5KVSA 4CLHA 2CSUA 1NVMB 2FPGA 3JQ7A 1LDMA 5CEFA 4M86A 1QXSA 1IB6A 3NT4A 3Q2KA 2IEDA 3QE3A 4YEDA 1MLDA 1NFQA 5F1OA 4CMEC 3W4KA 5C7LO 3DOJA 5ILOA 1AE1A 3BA1A 2YJZA 3PYLA 2GF2A 1IULA 2GDZA 3X2EA 4A26A 1FDWA 1SNYA 1CEQA 3AY6A 2EW2A 2J3HA 5KJCA 2Q1SA 3DZJA 4L4XA 2GN4A 4B8WA 4AJOA 1PTJA 1Z82A 6LDHA 3ANMA 2PZLA 3JYLA 5A5FA 2ZB7A 4B8ZA 4HFMA 4KWIA 3TF5A 2NV6A 2P5YA 1M76A 4PRKA 3NYWA 4WKGA 1SMKA 4PRLA 4XGNA 4MIOA 4DIBA 2DFVA 4JJIA 1KOLA 4DXHA 3GNQA 4IDFA 4UVIA 3TOXA 2W98A 3BHJA 2VUSA 2GN6A 1E3LA 1VL8A 2VUTA 1VC2A 2YY7A 1T4BA 4N54A 4BNZA 2BD0A 1C3VA 4OO3A 3IQDB 4XIJA 4E21A 4A03A 1C1XB 1WP4A 3GVPA 4R1SA 4WEOA 4XGKA 3UFXA 4M87A 2BI8A 3DMTC 3ROQA 4YPOA 4TZKA 3DBLB 3GMSA 4U6QA 1YQGA 5GY7A 2NU8A 2EV9A 4YRBA 1UP4A 4CMHA 4EGFA 3DB2A 5BSHA 4B79A 2C7VA 4FJ1A 4O59O 2JFGA 2IYPA 1GTMA 3DTYA 2IDZA 4RVHA 1UR5A 4ESOA 3PHIA 2PZMA 4L76A 2RBEA 2BGKA 4J0FA 3DMTA 5BR7A 3QVOA 3QWBA 3U49A 5B4VA 4YVFA 2I76A 3V1YA 4BKRA 4NJMA 4GWGA 4XJTA 4F45A 2I6TA 3ANLA 2HMVA 1Z73A 1T1RA 1EEHA 2FSSA 3A06A 1KS9A 5CFZA 3A14A 1IPFA 1UZMA 2NLOA 1D8AA 4BS9A 1J49A 4WASA 2W8ZA 4XDYA 2NTJA 5A9SB 4PG8A 5K6AA 3I6QA 1CYDA 1UJMA 4YT4A 3EVNA 2I9PA 1RM4A 4XR9A 5JDCC 4PLVA 3ZHXA 4NG5A 2Q3EA 4J4BA 1K89A 3BYZA 4D79A 2UUOA 4D3FA 1E7RA 4PZEA 2C5EA 4H3VA 1U8FO 1HXHA 1HDRA 2HK7A 4UULA 2AHRA 2C20A 3GEMA 2GUGA 1MC5A 2CDAA 3K92A 3TPCA 3DWFA 1CQJA 4UUNA 4YT5A 4MP6A 1I3KA 3Q9NA 4N5LA 3FHLA 1V0JA 3OQ1A 3JQ6A 4GWKA 3D3EA 4RO0A 4EYEA 2DM6A 1E1NA 2ZCVA 3ROKA 4DVJA 5HA5A 3TDKA 2PKQO 4CUZA 1EE9A 1I10A 2EJVA 1EVYA 1DC4A 4ND3A 4BO9A 2CDCA 5K6AC 3FNEA 3BMQB 4J16A 5DN9A 5ENVA 1XCBA 3FR8A 4TRRA 2UUPA 3AUSA 1HSZA 3IUPA 4GVXA 1YDEA 1LRJA 4WLUA 1SO8A 2EEZA 4RZIA 3I5MA 1ULUA 1WXDA 3FWZA 3GVCA 3FBGA 1F14A 3LT2A 1LI4A 4L4SA 1VSUA 4IDEA 2CF5A 2GN8A 3QW2A 3VHRA 3TFQA 1XEAA 1TLTA 2VHYA 3QWIA 4BKUA 1IE3A 4GKBA 4PLWA 5B1YA 1KIFA 4GSLA 2W2KA 1XELA 2J5RA 4RVUA 3WGZA 4CMGA 5G2OA 5FWNA 5DOZA 2WTBA 3MTJA 3ORFA 4BGIA 4OL9A 2X23A 5L3ZA 3W1VA 4CM7A 4OH1A 1U3TA 3WLEA 4QFCA 4NU6A 1VSVA 4EZBA 2WYUA 4FC6A 1PQPA 4CLRA 3B6ZA 1HL3A 3GDGA 3HFGA 4S3MA 5BQFA 4O63O 4FDAA 2GPTA 1SAYA 4E2YA 4CMIA 1SCUA 1E1LA 3ZN2A 4IUYA 1JKFA 3ITKA 1EQ2A 4YJHA 1P9LA 3COSA 3B1FA 2PTGA 3KTDA 3OMLA 3WSWA 4DL9A 2JHGA 1MFZA 1K6XA 1PS0A 4OSOA 3PHHA 4EJ0A 3CSDA 4BO1A 1ZH8A 5A06A 4FJ0A 1SEVA 4RQTA 4YJFB 5JAMA 2Y66A 2FRDA 5BT9A 2OXIA 2ZB4A 2EWMA 1OAAA 1GY8A 1LX6A 2O50A 5B37A 4W4TA 1H6DA 4HFJA 3VTFA 3WTBA 4CPDA 1U28A 3ETEA 2YV2A 3RSHA 1ZSNA 1N9GA 1TEHA 4CV0A 4ALLA 5CPFA 1R16A 5H81A 1VKOA 1F8GA 1XGKA 4Z9FA 5EMHA 2I3GA 4RPKA 5IZ4A 3IAHA 3WBBA 3ZW8A 1UDBA 2WYVA 3BTVA 3GG2A 8LDHA 2D0IA 4IMRA 3HN2A 1HWYA 4R3NA 4J91A 4B4WA 3MWEB 5C5IA 1DOHA 2P91A 3U3XA 5JY1A 2AG8A 2DPGA 5TC4A 4NHEA 4RDIA 3VZPA 2EKLA 3UOGA 1EQUA 2R00C 3FR7A 2I67A 1A5ZA 3IOYA 1FF9A 4IJKA 3UF0A 4AJ1A 3QY9A 2WEKA 1NP3A 3UHAA 3ZHYA 4G65A 5IN4A 1R66A 2QHXA 3TNLA 3L77A 5JE8A 4K26A 4LSMA 4FR5A 4L9RA 1QYVA 2TMGA 3WYCA 4BIIA 4RLHA 3P5SA 2JCXA 1LUAA 1G6KA 3QLJA 4UUPA 1W8DA 1ISJA 3INRA 4XZ3A 5J23A 2OO5A 3DZBA 2QYSA 1QKIA 4JBHA 5BNTA 4IJUA 2DTXA 3WNVA 2X8LA 4MP8A 1CERA 4E2ZA 1ADFA 1MXFA 1UP7A 3I23A 1R0SA 2YZ7A 4JQCA 4I9NA 3DO5A 1T25A 4XJSA 4CV3A 4UEKA 1U9JA 3PK0A 3AFMA 2D1YA 1O8CA 3S55A 5CG2A 3O38A 1EDZA 1MG0A 3DZGA 1O9BA 1UDCA 2GLXA 3QVTA 2P4QA 4QQRA 2IEBA 3LC1O 2C2XA 1A4IA 4D45A 3GRPA 2EHDA 3S2IA 3P2YA 3QP9A 4NK4A 3WJAA 5ER9A 2WE8A 1ADGA 4BNXA 2DBQA 3M1LA 4HBGA 1HRDA 4XX0A 3C1OA 4IGEA 3D3WB 1AN9A 2XAAA 3JSAA 3PLRA 4KDEA 2WD7A 2OFPA 1HDCA 3V5NA 4CLEA 1LRLA 1W0CA 1B0AA 3EK2A 3JYOA 2BHLA 3NGLA 3GHYA 3SJUA 1IYZA 4PLYA 1XLTA 2DLDA 3A4VA 7MDHA 3BHIA 1YL6A 5IAAA 3QVXA 1MC4A 3JQAD 2O7SA 5HBRA 2VYND 5A05A 2C0CA 1P1RA 4A73A 1O5IA 5DNAA 4DYVA 1QSGA 5JY6A 4E12A 2Y0CA 4CM8A 4BNMA 3HNPA 2BKAA 2JFFA 3PEFA 4R1NA 5A5EA 4OSPA 1UXGA 3F47A 1X13A 5L51A 1N2SA 4JN6B 4F3YA 3WS7A 4NBUA 5CHEA 5EJ2A 1K6JA 2Z1MA 3KETA 2RAFA 3FTPA 1PWZA 4K6CA 1Z7BA 3E82A 3GZNB 4IM7A 4YAKA 3VC7A 2X0IA 5TS3A 5B4TA 1KC1A 3H9EO 1OC4A 3KYDB 4CUKA 4TVBA 1D1TA 1BVRA 3G17A 4L8VA 4YB8A 3ITDA 4N5MA 3RFVA 3C7CB 1GAEO 3DHEA 5F21A 3OF2A 4W6ZA 5L45A 1A71A 3JQGB 1ONOA 3CPSA 1EUDA 1SOVA 2Y1FA 2AG5A 3NV9A 1CRWG 4D3DA 3ZWXA 4GX0A 3HWRA 4JCOA 1XHLA 4EEXA 3ZWNA 2HO5A 2X58A 3Q9UA 1UZLA 3AI3A 1EK6A 5EPOA 2BFOA 1WDLA 2SCUA 2OHXA 4QUKA 5ITWA 4IXWA 1Y7TA 4HP8A 1Q7GA 1U2DA 2VQ3A 2C29D 3BIOA 2GR9A 1YS4A 2Q4EA 3EUWA 4IY1A 3OM9A 1DRUA 2JKVA 3D1LA 3PQEA 1LLDA 5JCJA 4YA6A 3GNTA 3PRJA 2V6MA 3PZBA 4CM3A 4I8XA 3GVXA 4A2CA 2G0TA 4I9HA 3I9LA 3I9NA 1SEPA 4DREA 1KVRA 5LDGA 3OSUA 3UVEA 2OP0A 1HETA 3CE6A 4CL3A 2AXQA 3JYNA 4BMVA 5CEEA 1LC0A 3JQGA 1WMBA 1JQBA 4CQMA 3K2BA 4M1QA 1H9AA 3K2EA 3IJPA 1UZNA 3DC2A 3FPCA 2AW5A 2C7GA 3RUDA 2R00A 5K9ZA 1GPDG 2EG9A 4Z3DA 1YO6A 2EP7A 3RC7A 3WGHA 3GFBA 4XDZA 3CMMA 4TZTA 1XIVA 4ZQFA 2NU6A 4UVDA 5CAEA 3KM0A 4RDHA 3AOGA 5AXCA 4OHUA 5G0WA 3ZNOA 4MVJF 1MFPA 2O23A 4GAEA 3D5TA 4E5PA 3GAZA 1I5RA 1PEDA 2DQ4A 3AUUA 3GUYA 2O2YA 4O6VA 2WD7B 2JAHA 3IJRA 4EUEA 2O3SA 4DWVA 1P44A 2GZ3A 2IXAA 3BTUA 1YBMA 1K5HA 1IHXA 4OXKA 4RVSA 5EN4A 2OBYA 4H16A 3I3OA 4Q3DA 2H63A 5JFOA 1ZEMA 2PA3A 4TMFA 4OJNA 4IXTA 1BHSA 3BZUA 1IL0A 3RQSA 1H6CA 5FYDA 3O4RA 3GNSA 2NUAA 4MVJM 4M89A 3DR3A 4JIGA 1JVSA 4CV1A 2UV8A 4AJJA 1DRWA 2NTNA 1M6HA 3GG9A 1ORRA 3WGIA 5TGDA 4GQAA 3QSGA 3AWDA 2PR2A 2JD2A 5DP2A 3SEFA 5JSFA 3CZMA 1SB9A 3QHAA 1M67A 3JQBA 2A94A 2R6JA 3GY0A 3HB5X 1NAIA 1ENZA 2HAEA 1QYWA 4XD2A 5A1TA 2RCYA 5KVQA 4YT2A 5JO0A 2B4QA 4BB5A 4CLOA 1PZFA 1DIGA 1GUYA 5AXDA 3MJSA 4OXYA 3CUKA 1ML3A 4BOYA 4H7PA 4E6PA 1ZK1A 3F1LA 2VNSA 4DBZA 5I7EA 4RJTA 1PJLA 1FDTA 4TVOA 5EESA 4MVJG 3FNGA 3NDJA 2DAPA 1HE2A 4EW6A 4II2A 1DXYA 5L7TA 1IY8A 1QV7A 2I3AA 1I30A 2Y0EA 4M8SA 3E9MA 4TRMA 2O4CA 1H0KA 3LK7A 1E7QA 2ZYDA 1GYQA 4NK5A 1E77A 1PJ4A 3KB6A 3KYCB 1H5QA 3LSYA 3RJ9A 3AK4A 3CXRA 4PG4A 2B69A 1T2EA 4FIZA 5DOVA 5TT1A 3F4BA 1HT0A 2GYYA 4O5OA 4RPLA 4YBZA 1E7YA 3ZU4A 3EW7A 5TF4A 1QP8A 1Y9EA 4HFRA 3HJAA 2C54A 4IS2A 2QRLA 2DPHA 5A9TA 5HRUA 1H6AA 1ARZA 1V35A 3SLKA 4ZICA 2QRKA 3U4HA 2YQ5A 5A3VA 3I9JA 1ZKMA 4IQ8A 4RCVA 5JYDA 3E6AA 1Q2XA 1R0KA 2W90A 4NDNE 2AQIA 1M6WA 4W7HA 1AGNA 3JYQA 4A27A 4AVYA 5C7IO 5K0ZA 3INGA 1WWKA 2I5PO 3WFIA 4KQXA 1CIVA 1X7GA 3C3XA 3H65A 5JPIA 3RBVA 4AFNA 2GCGA 2JD0A 3WTCA 5ADHA 1BXGA 4I5FA 3IKTA 3EZLA 1E3WA 1U1IA 1UXKA 2IZ0A 1ZIDA 2VWQA 5DF1A 2AQHA 2YDXA 3DEYX 3MJVA 2JL1A 4ZRNA 3STHA 4E30A 3T4EA 1PR9A 4C7KA 5DBFA 3HQ4O 4BGUA 3B1JA 4J90A 1EVIA 5JW6A 4ALNA 1XA0A 5CG1A 1VPDA 1PSDA 3OETA 3PGJA 4WLEA 4R9SA 4PZCA 1NXQA 4BMSA 4BKOA 3H4VA 2J5QA 2C82A 4ALIA 3GRKA 4JXKA 4F6CA 2DBVO 3LT0A 4GX2A 5TIIA 1U5AA 4AJLA 1SB8A 3QVSA 4FGWA 3ZNQA 4LW8A 3KSUA 1QORA 3K9QO 1E5LA 2OORA 3JTMA 3PLNA 4JROA 3DBRB 1WNTA 1X1EA 3EHEA 1P3DA 5KKCA 2EJWA 1Q0LA 3O8QB 4UAGA 2WMDA 4YR9A 4XYMA 4DTIA 1TT7A 3RCBA 4BQPA 2YFHA 2O48X 2HCTA 4IDDA 4GH5A 5KIAA 3BMOB 1BRMA 4FFLA 4AJIA 1NQAO 1X14A 5IN5A 4L75A 3RROA 1JLLA 1RYDA 4NR0A 4PLPA 4CLOB 4EUHA 2DTEA 3CIFA 3FNHA 3F5SA 4BNHA 1DB3A 4YAEA 4Z6KA 3ZWOA 4XQEA 3SVTA 1U2GA 4DMMA 4DQUA 4U5QA 3WJ7A 3A28A 3WQRA 1LQUA 3WIEA 2CUKA 1PQUA 1ZXBA 1Z74A 4EUFA 2C07A 2A9FA 1QYXA 3KVOA 3QQPA 1FMCA 3ZNPA 3INTA 4CQLA 3OIFA 4CM9D 1PJBA 3WOHA 1YL7A 3AJRA 4K9DA 1DHRA 4UEJA 1YRLA 3S8MA 2QZZA 3LF1A 1YDWA 1D3AA 1P74A 1X1TA 1T4DA 3F4LA 1DC3A 1P1IA 5T8KA 4DLBA 4CR7A 1PJQA 4E32A 5L9AA 4XB1A 4TRJA 4KUGA 1UH5A 1DIAA 4J9UE 2IYOA 4UEOA 5A3JA 5AQ1A 2HMWA 1CDOA 3H9GA 3MTGA 4NBRA 2ZB8A 4XYGA 1DLJA 4Z0PA 1LU9A 3OJLA 4W9NA 3K30A 4INAA 1PQWA 5KTKA 3D4OA 1NTOA 3JD2A 4AJEA 4RZHA 1NFRA 2Y1GA 3DTTA 3R0IA 3V2GA 3W4IA 3WBFA 3CINA 3WWYA 2FR0A 5T6BA 2X22A 4MO2A 1B14A 1GQYA 2VYVD 4O1MA 2RIRA 4NI5A 1E3WB 1PJ2A 2W4QA 4HXYA 4NPCA 1ZBQA 2P9EA 4HWKA 4BNVA 4WCFA 3TL3A 1YGYA 1V9LA 3GC6A 1Y8RB 4KQWA 1CWUA 4DC1A 1DO8A 3DZHA 1RM5A 1ISMA 3UCEA 4G81A 1I32A 2OOSA 3KEOA 4BNUA 1ZK0A 4GBJA 1LQTA 4KWHA 4CM9A 1ZJYA 1HKUA 4Z3KA 2QYTA 3EAGA 5JO9A 3V2HA 2ZCUA 5A4DA 1GL3A 3B1KA 4R16A 3IL2A 1YE3A 4YRDA 4DPKA 5AXBA 3OHSX 1KVQA 3WX0A 3FD8A 2Z1NA 2NU9A 1Q7CA 3PTZA 3GVIA 1G0OA 1AXEA 1VRWA 2DTDA 1T2DA 1F06A 4JJGA 2QIOA 2FSVA 3ZI0A 4HX5A 2Q50A 5FFFA 4CM5A 1GD1O 1O0SA 3I83A 4GX5A 1WW8A 2VUUA 3PI7A 1M66A 3JD4A 4HKTA 4NJMB 5ICMA 2FPIA 2DBZA 1CJCA 1A7KA 1DIBA 1JKJA 2AQ8A 2G1UA 4URFA 3TN7A 1O95A 3OJFA 4NBTA 1LDYA 4IDAA 3NJ8A 4MIYA 1BXKA 5F1PA 3AY3A 1F17A 1LA2A 4FFRA 3MJCA 3ZWCA 3F5QA 3TSCA 3AOEA 2C5AA 3CKYA 4NQZA 1RWBA 4E4YA 4NFHA 3E1KA 4Z0HO 3IUSA 4J4HA 4U7WA 4NH4A 3RASA 3E5MA 1LXCA 5KVVA 1ZO8A 4DRYA 3EC7A 4EJ6A 3H5RA 4J4TA 4KUHA 2Y99A 3VPXA 3WB9A 4WK6A 1E0DA 1QG6A 3R1IA 4XIYA 2QG4A 5ILGA 3V2UA 5G4LA 4BGVA 3JYPA 4R01A 2J8ZA 4RPGA 8ADHA 1AXGA 3K5PA 4GLOA 4PCVA 2VHXA 4PG5A 4DMLA 2VT3A 3F3SA 1OFGA 2HK9A 5KCZA 3NTQA 2PZKA 2NM0A 4OKIA 3GGPA 3QVWA 1ZCJA 3RUHA 2PH3A 5F1KA 5ICSA 1LSOA 3ABIA 3G1TA 4DIFA 4ZVVA 1E7SA 2HMSA 3LF2A 5EQFA 5IDXA 3DZKA 3WMXA 3HDJA 3PPIA 3QRWA 3ZWVA 4FFNA 5JAZA 1C1XA 2DU8A 3RVDA 3SC4A 3VTZA 5CDSA
chains in the Genus database with same CATH superfamily
2FZEA 2RHDA 4KR6A 4PWYA 4L2IA 2JA1A 2YWEA 1HTBA 4CBVA 1E2KA 3OJEA 3K32A 2BI4A 1T5OA 1A96A 2QXTA 3RDPA 5CFPA 3L0YA 4L5CA 2YVLA 3U7QA 5KX5B 3A2KA 2QRNA 3T06B 2VDVE 2SBTA 3JQQA 1A5SB 4BFTA 5KPDA 2EZ4A 5AH0A 2GEFA 5ANRB 1NHGA 3AHEA 4HUTA 3LP6A 4KQ6A 1RJDA 2PD4A 4PSVA 4MUXA 5BQ5A 3HADA 1HDYA 1FRFS 3GEHA 7REQA 3NKLA 1VLVA 5LJIA 1A9OA 1ODKA 2VSFA 1Y4SA 1DJMA 1QE0A 5JH7B 3PEYA 3AF4A 2CVFA 2JFHA 3MCUA 4IDGA 2XW6A 1N2OA 1PJ8A 1N6PA 1B6SA 1ZRMA 2RDMA 3ICPA 4DILA 2E82A 1NBMA 1W5AA 4G41A 3C2QA 3N2YA 1K8XB 5JXWA 4Y7DA 5FF9A 4XASA 3A58B 1WOMA 1L7PA 2B0JA 2CMDA 2EWWA 2FOIA 2HBQA 2ODBA 2HSZA 2PH5A 2YRWA 3D81A 3GW8A 1MAWA 1X7YB 1ZGBA 1UMCB 2YXBA 5J4LA 4MI6A 1YVEI 3VNUA 1E66A 2DHCA 3W5AA 2ZR9A 3CLKA 2K2WA 5AOBA 2RIPA 1TEVA 3T0GA 3IMGA 4R1UA 2HSDA 1EHYA 1DBVO 1G3RA 2A1UA 3A9SA 4GPD1 3FROA 4NL4H 4UE6A 2Y1EA 1WKVA 3TK1A 4DF3A 3JU3A 2C92A 5EZYA 2WJGA 1GWNA 1MNAA 1Q0PA 2N0SA 5ENZA 2VZ8A 4FE3A 3WXBA 4D81A 1YJXA 1DZIA 3C7AA 5IZCA 4HTFB 3ZW9A 3DZDA 3OAAD 1K4MA 2BFAA 1GPNA 3IEKA 2FE4A 4RNDB 5E9JA 1RI2A 2HWUA 1NN0A 4OD0A 4BVLA 2C99A 1NURA 1RKUA 1JHZA 5P21A 3BF8A 5JDIA 1QMGA 4PX9A 5KJ6A 4AUMA 2WOOA 3TB6A 5AIBA 2HX1A 5ALEA 5HTOA 3AL2A 2ZDGA 3IR7A 4ENWA 3RC3A 1Y8QA 1I36A 4PIPA 4Y1RA 2OM2A 3LCVB 3O26A 4BJ1A 1VA4A 1JHOA 2Q5CA 2GESA 5HIJA 3SLGA 4PR3A 1L5LA 3A4YA 1SC1A 4RSHA 3FB1A 4UJ3A 4CKZA 2CV0A 4US1R 3T3PB 3UT6A 3CRQA 1KSFX 2JI6A 4XGIA 4QREA 4YAJA 1SM4A 4EARA 1ID8A 4CEJA 2YHIA 4QSMA 3UUGA 4XVUA 2ZFUA 2YFQA 1XVVA 2I87A 2J0UA 3CPHA 3FWNA 3OC0A 1HUQA 1GGVA 2JAUA 3D4NA 4GD3Q 4GI1A 4WZBE 3DW3X 1AK2A 1M75A 1ZM3A 4MV0A 2A0WA 2I2AA 2DHDA 4UTRA 5H80A 2QIPA 4GOXA 3E9QA 3SSOA 2QTZA 3VZDA 3ZQ4A 2NPIA 3H2GA 4AICA 4BQQA 1N34B 1QFZA 1Q0HA 1R9JA 3L9XA 3PSAA 2O8EB 2B6NA 1TUBA 3OT5A 3WKDA 4OQYA 3NJ4A 1TU0A 4LMRA 3V1LA 4URXR 3AMVA 3GJ8A 3QOFA 5AI9A 1WPQA 1K9SA 4C78A 4YIKA 1LW7A 3UCFA 4A6DA 4DMKA 3EEBA 1QJ4A 4FFMA 4TYWA 4QG3A 1QOZA 3BN3A 3RKRA 5H16A 4D43A 5IH7A 2JLAA 2IFTA 4JLOA 2YMMA 4QTTB 4EHHA 1Q6YA 2DT8A 2FEAA 2J45A 3MEQA 3LT1A 3KHSA 3IBFA 2C2MA 3RUPA 2P7IA 4YBRA 2RCNA 4YUAA 2R6HA 4EDFA 3IIIA 4Y3UA 4ZMBA 2WU1A 3A8TA 4XSVA 5G3ZA 5E6SA 1W6RA 1NXWA 1L1QA 2G36A 4MR9B 5TT0A 1XVTA 3AW8A 4WJZA 2J85A 5FI0B 5A9SA 3HCBA 1I13A 5LYYA 4UAVA 4WUVA 3N2KA 4X60A 2C7PA 3T1HB 2UZIR 4MS1B 5KVCA 5LQUA 1SPBS 2CNLA 3Q7SA 5LXTA 1E2FA 4EJSB 4M9CA 4A5SA 1NPTO 2VJDA 3N1UA 1KI4A 4GZ5A 3P0FA 3JQEA 1RD4A 3DOCA 4RPJA 4GXTA 5FUVA 3R9IA 3GLKA 1XNRB 2X5OA 1FQJA 1R1DA 1DWUA 3PIDA 3R0VA 1NJFA 2ZWIA 4G5FA 1N0IA 1FTWA 4FVTA 2ANCA 1DINA 3S2SA 3ZWWA 2ZYSA 2GARA 1CE8B 1NT4A 3ASVA 4I1PA 3CUVA 3E9ZA 4BVAA 3GEDA 5A3QA 2ISCA 5JMWA 3O94A 2CEAA 1DJPA 1DPGA 4GSKA 4BMPB 1MGPA 3BCSA 3L41A 4MVJA 4HAIA 2PBRA 1WULS 3WWZA 4DSTA 3AU9A 1Y7LA 2PKQP 3NATA 4YUYA 2IW1A 2E4ZA 3TQHA 2QL5A 1YB2A 3C3DA 4UM8B 4BL5A 4EUSA 3LQQA 4QASA 1NQTA 1DWQA 1R74A 2GKGA 5JSYA 5JMOA 3DAGA 2Y92A 2C4VA 5B1IA 3JARA 2XNDD 2A4MA 2IA5A 2QX6A 4ARZB 2WIKA 5JROA 3FMPB 2CWWA 3K0SA 3EZYA 2XMZA 3L8EA 2A9VA 2JAPA 3WK9A 3FPLA 3FXAA 4PINA 4LRTB 5J1SB 4HDAA 1UJ4A 4DT1A 5AVWA 4O0LA 2OV2A 2HJRA 2FW8A 4QOJA 4U1RA 3H1TA 2FP4A 3RAJA 2FHSA 1XCMA 4JB8A 1X8LA 4WESB 1L4LA 1KO8A 2GPJA 2PX3A 4IGIA 4ZK6A 1Z2PX 3FGNA 4JLWA 1XC7A 2LE0A 4LYHA 1QX4A 5LB4A 2TMDA 2W7TA 2XIJA 3ZXYA 3OKAA 4CTJA 4RV4A 2EZ8A 3K6JA 4A0HA 2VSOA 3BK1A 1OYOA 4IIVA 1OF1A 3K70D 3A25A 1XALA 3TMKA 3DE1X 4RHCA 4ER3A 2J3IA 3VHXA 3S5JA 1G1AA 4P7KA 1K3UB 1R5BA 2BW0A 4WCVA 1U7TA 3DBLA 4BNNA 2Z5FA 4BO7A 1FYEA 3R09A 3M7IA 3R3JA 5SY9A 1NDQA 3IOEA 1T3SA 2Z4RA 3KKOA 4QUGA 1RJFA 3S2FA 2BEWB 4KYUA 2QVZX 4C3OB 1IVSA 3AG6A 3W8EA 2CNWD 3GLHA 1SD5A 3ETHA 3D8TA 1Z7EA 3KFXA 4IDBA 4QPCA 3ZHUA 2AFHB 3OFKA 1PJ3A 4QDZA 2D5AA 3I92A 5T57A 5THQA 1C9YA 1CR1A 3L18A 1FDRA 4TTJA 1K6EA 3IVGA 1OBFO 4EG1A 4OHCA 1CR6A 2XZDA 2PT5A 2CZQA 2IEGA 4I1OA 4Y9TA 3MUFA 1Z6AA 1VJ0A 2WP0A 5FOTA 3VC3A 2XRFA 4A16A 1UOOA 1IB0A 3G7NA 4B3IA 4HQRA 1Z0KA 1COWD 3CQ9A 5HGJA 4AKIA 3O3MB 2FUCA 4WXEA 1VJ1A 4G24A 4K9QA 2FN8A 4RSGA 4XOIA 4Y0VA 4QSHA 4A91A 4NMHA 1NA5A 2J4CA 3PDUA 5FJJA 3IQZA 5IM4A 1UFRA 4XXHA 1D04A 1NX6A 1RJ9B 1X74A 1ZUIA 2BHSA 2HWXA 2J30A 2OKCA 4R8MA 2P9JA 2BFPA 1CFJA 2P77A 1U9CA 3RYHB 3TIGA 3TI9A 1L3IA 1J0CA 4M6WA 4IG9A 5KNBA 4RJ2A 2OILA 2E4VA 3QLUA 5IAOA 2HBZA 2X3FA 1X15A 2W2LD 2WKPA 3PQ5A 4K28A 3TQFA 4S1VA 3FPEA 5I9NA 4KIGA 3ANNA 5TEVA 5IBQA 5KQMA 2H6EA 1L5YA 5EGSA 1JIJA 1Q50A 4X1KB 2LW7A 4EJMA 4ZXFA 2PNJA 4IDNA 2ILTA 4J0EA 3MUOA 4MVJI 4K2AA 1YQ9A 5CA0A 4UUQA 2ZI3A 3JAWB 5KVAA 4P4LA 4RHTA 5IXYA 3CHYA 3G2IA 2IHTA 2Q27A 2Z6UA 2YJNA 2OFFA 1Z6TA 2B92A 2ZYGA 1KVUA 3I28A 4HMPA 1UIMA 3ZZUA 3ZBPA 3NZEA 1E6CA 3V8NA 1OBOA 1UC9A 1BH6A 4ISCA 4V03A 3WSVA 4EA6A 2D4HA 3K0AB 4UMVA 3T5GA 1I0ZA 3SC2A 1CV2A 5ITZA 1B16A 1NBOA 3ULKA 1JAYA 2CXSA 2WF8A 4P9NA 3U7JA 3Q2IA 3B2QA 5TSDA 5LQJA 2FFJA 2D1SA 1J5EB 2EGUA 3EZGA 2B83A 3T5AA 2VWPA 4Q7KA 3AVWA 1ONSA 1SKAA 3OWHA 2VAWA 4ZTBA 4PIVA 4DIUA 1YBHA 3CF6R 4FMBB 4QXMA 3X44A 3KJXA 1N3IA 1X42A 2PGXA 1ZNYA 4WEQA 4DM7A 4EMUA 5C31A 4BO2A 2QX7A 1IFXA 1UEIA 1Z5UA 3TMAA 4N7RA 3GMDA 5COQA 4DCGA 4PFQA 1KHTA 2EFYA 3V7WA 4F6LA 3JW8A 2V6FA 3FTFA 1PG0A 1XRJA 4ZVMA 4YCCA 3VKVA 1P45A 3BICA 1GPUA 2HIGA 3B1VA 5DFAA 5H83A 4WN9A 5ECYA 1T9KA 5CA1A 1P1JA 1EINA 3FYTA 1FTGA 3DBHB 3TXXA 1F9EA 1A8HA 2H52A 2V5AA 1CS0B 4EIWA 3ZJTA 2I6SA 4X91A 4YQEA 2EARA 2E21A 4WAUA 3IKMB 4E03A 4GYWA 1QHSA 4R54A 5AHRA 1QRDA 3CH5A 4I81A 1I4WA 1KYVA 1WR8A 2NAPA 1FXSA 1G6Q1 2G3YA 2ACVA 2GCEA 1E2IA 2PH7A 4S0ZA 5BO5A 2TSYB 2W2MA 5BV2P 3MBOA 5LQDA 1KPIA 1VMKA 5C3UA 5KKNB 3OY7A 4MZXA 3AW9A 2G17A 4BV9A 4GMHA 3COVA 2RJNA 1KMCA 2WPDD 3HKBB 4DV3B 2IXGA 2VAVA 5F2KA 3R0QA 5T3UA 2JIPA 5B6IA 1RKBA 4MJ7A 5BN4A 1MVLA 4LDPA 2XUAA 4LQDA 4C43A 5D00A 4LF8B 3I0MA 3LBYA 2D13A 4Z7JA 3MD0A 3H97A 1XQ6A 3ADPA 1GG2A 5HUQA 3KPWA 5IVIA 4ZFNA 5KC8A 3JZAA 2EP5A 4YMIA 1PDWA 4PR0A 4BVFA 5JH7F 2ODTX 2Q4BA 5BSWA 3G9ZA 3CH7A 2XBLA 3GP3A 3RM3A 3OEYA 2YXPX 3L1VA 1TJ3A 4LNUA 1QK5A 1C7QA 4GX1A 2X40A 5E6RB 3GMIA 4BQRA 4NNJA 3UFBA 4DV4B 4QM7A 1Z63A 3UMFA 3W77A 2VATA 3GUCA 1RWNA 3STWA 5KJFA 3LXMA 1I7SB 2N1BA 3GI1A 3FCXA 2FN7A 1VGRA 3GB9A 2CBGA 2ZRMA 3UIEA 4E5NA 2BGRA 3H0CA 1BDBA 3QMVA 3S81A 1JKIA 1JBQA 5DEIA 5AVQA 4W5OA 1GUFA 4X44A 3B9PA 1E9RA 1JJVA 1FK8A 1V3VA 2IUEA 3P26A 3JPYA 4CL8A 3ANTA 2P75A 8MHTA 4Y2QA 3LLUA 1YL5A 5BSGA 3PNSA 4AURA 2AKEA 1TYCA 3FRJA 3HU5A 4MWCA 4UHHA 5DJ5A 4OAQA 1QP7A 3P2KA 4Y2UA 1XXHA 1SVSA 3UWPA 3LZ6A 2J0VA 3Q3JB 4IR7A 3ZE0B 3CUSA 5ADVA 5K5EA 2AZMA 4HN4B 4RHYA 5K3BA 1JAZA 1OHHD 1MX1A 2NUBA 2OB2A 4HEQA 2KS6A 2HRZA 4Q02A 3JR7A 4LUCA 5E7IA 4ND5A 3UAWA 2QLMA 2C1ZA 3QPCA 2Z56A 3L4SO 5JCOC 3AYXB 4OGKA 1O7JA 3P20A 4XA8A 3G79A 5JNLA 5LP6A 2QZ9A 4JR1A 1L7VC 1Q11A 3SOZA 2VOEA 4AL4A 4UHDA 4RCYA 4Y2SA 4ZZ3A 4YMHA 3T61A 2JB9A 2XB9A 3HLTA 3NC1C 2NZWA 1EUCA 4J7UA 3FM9A 1KEWA 2I4MA 3GFGA 1VJ5A 3H19A 5SYNA 4BC0A 4BTLA 4CJXA 4EKGA 1TZ2A 1N32B 5JNVA 2D59A 2ZG6A 3L05A 4GNKA 4RD3A 2D2IA 2NGRA 3SC6A 1FYWA 3R4CA 4GQIA 3LA8A 4W9NC 1WMEA 2F9FA 3E5RA 5CYPA 3STYA 3BGIA 4BV8A 2OE2A 5BMVF 5HM8A 4ZIRB 1I7DA 4MIKA 3KTOA 3HI4A 4JMPA 3IVMA 1EWKA 1SUIA 3F7OA 3MGCA 4B6EA 2A92A 4PYNA 1R27A 3W5UA 3ZPXA 1MRNA 4HB2A 1Z88A 2XI4A 4CMAA 3W5IA 5GOZA 1NC3A 4ZU1X 4D8VA 1CC1S 4DFDA 1NM5C 1KJQA 3EIUA 3H1EA 1N5RA 4I50B 1U90A 3IP3A 3N58A 3NB0A 2D5IA 3L7LA 4C4XA 3U39A 3T4UA 2WWIA 4PLHA 4C3ZA 1TM3E 2H4XA 4DLRA 1QVAA 4HQKA 4CEHA 3ZCSA 1GLGA 4FOSA 4P4NA 4PLFA 3MCTA 4DNQA 1CG6A 1KI8A 4DA4A 3LWDA 5KJEA 1G19A 1R4ZA 1IZ0A 5DT9A 5AK3A 5REQA 2JZCA 3HO1A 2ZRCA 2ZIXB 3G02A 3H13A 3KOMA 4OFXA 5C8VA 3I9OA 1KJ8A 3GA0A 4IS3A 5HFJA 5HF9A 4MR8A 1IZ7A 1OJ7A 3FDJA 2IEYA 1XQXA 2XF2A 4FGSA 4ROTA 4D0SA 2DY1A 1AB6A 2ODNA 1ZRHA 4M9SA 3OZUA 2SKCA 3P19A 5FDFA 1JA9A 5JHHB 4QFBA 3EPLA 2PHZA 4A2WA 5B7PA 1Z13A 3IAM6 4BHTA 2D7JA 1LPSA 1ZGZA 3AIOA 4BKQA 3UGKA 2H4FA 3N76A 3Q7RA 2FZWA 4JB2A 1EP2B 2X0KA 5GONF 3B2NA 2IH5A 1E2DA 1JFFA 2ECQA 5FNVF 5TMEA 4DUGA 2Q46A 3U3OA 2Y9PB 4IHJF 3FI0A 5ARCA 2WPNA 1N6HA 4ZCPA 1YR1A 2XPCA 1EFPA 2G83A 4CQMD 3QNWA 2C9YA 2L69A 4FYMA 1OGJA 4OQPA 2H1SA 1EDOA 4FW9A 4HD8A 3V1TC 3DT9A 2HA3A 1I4OA 3J7AC 2VTEA 5GZ6A 4AG5A 1KDRA 3GLTA 4TROA 4JXZA 2ZWPA 3VNQA 4W5JA 1PU2A 1U81A 1LCIA 3D02A 1PHPA 5EA2A 4EFKA 3R9XA 2RHMA 3K73O 4TT3A 3KV1A 3SZUA 5M2QA 1SCNE 3EEQA 1V1MA 2VYQA 4POOA 2A58A 5GINE 1RI4A 3TZKA 5JWOA 4KXXA 1U8YA 1RAEA 2QJTA 1DWPA 2WHPA 1YZVA 2A35A 4MQEA 4MQLA 5DTRA 4JX8A 4RKFA 1RKVA 1WMSA 3IV7A 4J7XA 3MS4A 5DM60 4BVBA 2YVUA 1RACA 1JWAB 2FHPA 2FEKA 2Z8YM 3ZEAA 1G7TA 1F20A 1P4AA 2NVBA 1GZHB 4V02A 3ONFA 2I71A 2L0XA 3WG9A 5CB4B 4HMQA 1RZRD 2AE1A 1JNYA 4HZUA 2ZRKA 5D5QA 3F74A 2JJ1A 5LYJF 4ILKA 2QLFA 3PA6A 1BS1A 5J63A 4C89A 1QS0B 1QHGA 4KO4S 1HNNA 1Y8AA 4XKJA 3SVZA 2IXBA 2RGYA 2XD4A 3CVOA 4BO5A 1RYEA 4DGSA 5KOJA 5LD2C 3OF3A 3UOWA 3WGQA 2R7NA 2QVGA 1SGWA 1UT6A 1LK5A 2BEUA 4OKSA 4EYQA 2XDYA 3DL4A 3H9QA 5DZSA 3KXKA 1W35A 2AMVA 4F2DA 4R83A 1S7CA 5JFTA 2JIMA 1SOWA 5KYUB 2WVGA 1J97A 1IEWA 1OPXA 1Q7BA 1M8GA 2MR5A 3EVGA 1U7HA 3NCTA 3QKUA 2CFSA 3UMSA 5FUQA 1TB4A 2XNJA 3C97A 2DC1A 4CM4B 3I04M 1DFHA 2DRIA 4EI7A 1ZN9A 2YC2C 1C3LA 1SULA 2A0XA 2QI9C 1CT9A 1DIHA 4NPAA 1EXDA 5IBPA 2YMLA 3O8RA 2RGNC 1QG0A 1JAIA 5CD9A 3DMRA 1SVMA 4LI0A 3K0FA 1CF2O 1QLHA 3F71A 4MVYA 5CLGA 1RP1A 3DLAA 4RE6A 1NG9A 1U8CB 2OV3A 2P30A 1CRQA 2OLKA 4UMFA 5F77A 4XRGA 5JAPA 3FTNA 3FIUA 4M98A 1YSCA 3L3BA 2CXNA 4FYVA 1A5AB 3BL8A 3RU2A 5BSFA 3GQVA 3LL4A 3UMMA 4GLBA 2HU5A 3IDSA 4ZT7A 4WZZA 1HYEA 2DVMA 5BWLA 2I4RA 1EBUA 3COYA 4M60A 2WWYA 3MWDB 3OZFA 4NS1A 3FOEC 4EB3A 4Z9YA 4DM3A 2Q2WA 1ACLA 4P86A 3X1KA 2JLUA 3EC2A 3EVCA 3SZGA 3JQ8B 4UZEA 4YRAA 4OQZA 4LGVA 1Z6YA 2PUHA 2V9ZA 2EIHA 4MX8A 1T1SA 2XNCA 2QMHA 3ELWA 4FD3A 4RGBA 4AW9A 1W85B 3L4JA 1AV7A 3U3RA 3GXBA 4AUNA 1ZMBA 3TE7A 4EMSA 1IWOA 1OBHA 5HHTA 4UDYX 3WK5A 4CKBA 1GITA 3KOZA 1RLUA 1L7EA 1QIFA 4FS3A 1BDMA 1J9EA 1RBQA 3BMCB 4P6VF 1SBTA 3AXTA 3JS5A 2VQDA 2VLBA 4RKEA 2ZTUA 2JFNA 3F1KA 2D3TA 4FN5A 1FRNA 1ZHOA 1YFJA 3OKPA 1QOPB 2G7MC 3C5CA 3Q1LA 5DCYA 5TQVA 4HAZA 4NZNA 1E6KA 1UAYA 1JEYA 5DCLA 3HBNA 4RHFA 2ZXEA 2BDTA 2CXHA 3F96A 4RK5A 1FUKA 2HMYB 5I4IA 2AVNA 1FTYA 3SX0A 4PTYA 3WYNA 1K27A 1ZD2P 2OAP1 4ID3A 3K0CC 3FX2A 3L40A 5EEHA 3M5CA 5FNVB 1BTOA 3DWIA 4Q0MA 1AC5A 1RJEA 4ZOLA 2Q6OA 4KQIA 1THGA 1C9KA 1CLUA 2WNIA 3EDYA 1UBRS 2HRBA 3A3YA 3OLQA 3OPYA 4LWPA 4TV9A 5EMJA 1FUIA 3UCXA 3FDZA 2F1RA 1IBMB 2UVDA 3MZ0A 4UM7A 4JL6A 1BFUA 1VCHA 4WK2B 2GEUA 2H07A 4LHYA 2WDZA 3M3DA 5ECWA 3T0IA 5HDBB 2QTLA 3KZKA 4NZYA 2WG2A 1Q6ZA 1XPJA 2IXEA 1X7DA 5EMKA 5B36A 4MB0A 2ZVJA 1E1DA 1RPNA 2VEOA 4ND2A 1T2NA 4Q24A 1RXCA 4HS9A 4ZPXA 3EXIA 5DNYB 1ETUA 4BX0A 4B3TB 4KQFA 2B7BA 3MJEA 2GHRA 2Q62A 3KFLA 4E46A 1S5PA 1S96A 2HLDD 1SCAA 2HV9A 1YUMA 2CHQA 2FWMX 1QKJA 1ZK2A 2XVXA 5EHGA 2KLBA 2L18A 3QXXA 4FWBA 2VN8A 3P94A 3P32A 2G0AA 1MENA 1V71A 2HJWA 1OWOA 2FSHA 2REQA 1ZQ9A 3KYJB 4J2HA 4QQ8A 2I34A 4IHAA 4U0JA 1FPMA 4MP3A 5JD6A 2EC5A 2F43B 1X0XA 4CT0A 4CIYA 3N7UA 2EF1A 4IV5A 1GDHA 1F12A 2I65A 3OKCA 3T7JA 3UATA 3HDTA 5LOVF 1BJRE 1FXUA 2JI8A 4NIMA 1GU7A 2AFIB 2FVXA 2Z9CA 2WV7A 3W6PA 1D2RA 3RU9A 3H3JA 4DG8A 5JADA 4GZ3A 1C8BA 1RS0A 1CR4A 2Q3MA 5EZYF 5HQJA 3E1GA 3IIMA 4EVQA 3UUWA 5DSZA 1QC5A 1U9IC 4Z8XA 4WHMA 5B6PA 1QZZA 2ZU6A 1RJGA 4X85A 3RUEA 3W8DA 1KMMA 4BWYA 4M88A 2Z58A 2J3QA 2VJCA 3PIIA 1ENPA 2WWXA 2ZBRA 2VNAA 3ELBA 3ETNA 1I2ZA 1A9SA 2Q45A 4S1TA 3VZQA 3T38A 4B6RA 3EPHA 1G18A 3TLCA 3M1YA 3EGXA 4LDQA 1T0JB 5IDVA 4FMCF 3NI2A 2DMRA 3H16A 1L5ZA 2QE6A 1EP9A 3SEZA 3UMVA 3ASZA 3DOHA 1ODCA 4DVGA 3DDWA 4WLFA 2B9VA 3IC5A 3LDUA 4R2JA 1SC9A 4AJ4A 3JQCA 4FJ2A 1QYIA 2ZTMA 4P31A 1Z4QA 1R3DA 2BHRA 4JLSA 3A9VA 1T8PA 2WVJA 2K5UA 4L74A 1B93A 2VTVA 3LLVA 2AHOA 3QEOA 4RA9A 3CRNA 3AU8A 3CRZA 1QRTA 1LTHR 1Q0SA 3Q7QA 4P4TA 3OU6A 1E1KA 2W2QA 3NWOA 4YTEA 4FBLA 2I2CA 5JXIA 2PD6A 4XOUA 4N48A 1O2DA 2G70A 3AJ8A 3CX4A 2D74A 1U9IA 4B17A 4Z9XA 4DIDA 3NXKA 1XDGA 4K05A 3OFSA 3E8MA 5I9LA 1W25A 4AN0A 5TQ0A 3THWB 1KZ6A 2IPAB 4FCCA 3M33A 3TCNA 4WCFB 4KGDA 5JBIA 3CZQA 2BVNA 4ZHQB 2DZDA 2DCUA 1W52X 5JCJD 5LBIA 4A36A 1AUPA 4INZA 2WSSD 1U3WA 1JLKA 2AXPA 3WGGA 1QCYA 2AFRA 3R0JA 1RQPA 4WZBA 3I5UA 1HLDA 1V41E 4B80A 1B8OA 4PPYA 4ONEA 3GN2A 4AZ3B 5D85A 4ZI7B 1QK3A 2PDAA 2QV7A 3PFBA 1YD7A 4BNYA 4DHWA 2O6LA 1IM5A 2GJSA 3KVVA 4L0MA 3B70A 4M1YA 4MICA 3ZK9A 3EVTA 2WINI 4IJMA 4Z2YA 3ZCUA 2XYQA 4KJXA 3ILYA 1SWVA 3QPAA 1GSHA 4TKLA 4M2LA 1FQOA 5AQEA 2D62A 2PJUA 3SC3A 2ERCA 5JNUA 3B5IA 2IV2X 2PR7A 4B0PA 4MULA 4E22A 2GGSA 3LU1A 5IMSA 1DUIA 3R23A 2QM3A 2DWQA 5CT8A 1PGNA 2R1ZA 2WABA 4GOOD 4CR8A 5H8WA 5IPFA 4G09A 4HNRA 3X1XA 5JTUA 4H7EA 1L0BA 2YZ2A 4GBED 1Z0DA 4C4OA 1F2UA 2X6TA 2RHRA 4Z4QA 3ECCA 4GLLA 4HVLA 4XYBA 1ZOIA 2W70A 1OX5A 4E15A 5ALVA 3THYA 1EA7A 4P3NA 4GHWA 2WG1A 1D2AA 1VPLA 1W6UA 1XDBA 3HGMA 3V4ZA 4HNQA 2MT9A 1E1CB 3Q40A 5DHAA 3GLGB 3IPCA 4JLVA 1QHHB 1U3UA 2BBOA 3RABA 1OT3A 3EFOB 3HBLA 2BGMA 3T12A 4EK9A 3L8GA 5FT9A 3L7CA 1QQBA 5K4HA 2DT5A 2GXSA 1J7JA 4NHOA 1LX7A 3B9QA 5KQPA 2FPKA 2Q1TA 3WLMA 1U2TA 4FGKA 1EXNA 5IXSA 3R7WA 3LQRA 4DE5A 3EGDA 2DWPA 3NORA 3ZDBA 4I36A 2E6KA 2XEDA 1I1NA 1XRSB 4LVUA 2OTCA 4YR9A 1E4EB 4WWHA 2VQFB 3ZZNA 3OUZA 1E3IA 1KJ9A 1NOJA 2H8GA 1UP6A 4NDAA 4TL9A 3TLYA 4KODA 5KYYA 1N2EA 2LD4A 2VJKA 4ZREA 1D2CA 1PS9A 1LJ8A 1U1FA 1KFKB 3NP7A 3R3ZA 4ML3A 2FN3A 3T7KA 5EJ6A 1A9XA 3R24A 1A1SA 3Q3HA 3U4CA 1R4MA 3T94A 3KB8A 2NG1A 3G49A 3QX9A 1TT5B 3GBSA 5KOHA 1ZUNB 1FQWA 2DPYA 1IZ8A 3QKRA 4J3NA 1IJFA 3NPMA 3FYHA 1N2CE 2FOLA 2ODAA 2ZUTA 1C4WA 3SDSA 4EI2A 4YMUA 5BXYA 3AL0C 3PEVA 3V9AA 4AECA 5BV1A 1S2IA 4G0ZA 3FFBA 3UAGA 4W82A 1EDDA 3LPLA 4MQBA 3SQOA 3NBUA 4JYPA 4HDKB 3L7AA 1E79A 4TYPA 2AEMA 4ZVKA 3VPFA 4B84A 4YAIA 1X3LA 1AURA 1Z6ZA 3C14C 4O3FA 3WLIA 4RHUA 1V45E 1M8PA 1OOEA 5DHRA 3WAGA 4PAWA 4D9CA 5JWRA 1DC5A 2D5CA 1YZ3A 4ADSG 2CJWA 4RH0A 3DL0A 5IARA 2P4EA 2B4TO 3GPIA 3C85A 3AZPA 4B5KA 2OD7A 2A9QA 3I32A 1JN0A 4AG3A 1BROA 1GDDA 4GXQA 3L04A 3MOSA 4PG7A 2QVCA 1Z0JA 3AERA 3WAKA 3MA0A 4TTSA 2WTEA 5F3DA 4AJNA 4B9AA 2HYIC 2FSVC 1N1EA 2OZLB 3E22A 5KYVA 1XN4A 4DA6A 2G76A 3DWEX 4KSYA 4GL4A 4ZOBA 3BE5A 4EY5A 3IILA 3BFKA 1VZ3A 2C42A 3D7RA 4CE6A 2YWDA 3U7IA 4GE0A 5TJ9A 1N5OX 3B52X 4X1YB 1KETA 1T9AA 2WICA 3M0EA 5BQ3A 1W88A 3GCZA 1X3SA 4BUCA 1BW9B 2LIVA 4UVGA 2QL7A 3ZGZA 5L4SA 4CKCA 4KLNA 2JFVA 2X4DA 1DFGA 4NZOA 5KYKA 4JT8A 2W4MA 5TMPA 2GCOA 5IUJC 3KZNA 3GLVA 2B8JA 1ANKA 1UJ2A 2BUBA 3RJ5A 2P4HX 3WWOA 1XHFA 1ATZA 5LMUB 3DDUA 4BFWA 4PG6A 4KZPA 1GFIA 3NHWA 1ADCA 1F5NA 3WJ1A 4A82A 4RZXA 3AR9A 3ZY5A 4COOA 1M2OA 2FPUA 3WIDA 4Y9UA 2ZT5A 4RF2A 1TRHA 3EZ2A 5TQ2A 4KH0A 3W9UA 5I9MA 1HY3A 1NJ5A 4Y6QA 5DDIP 3OLZA 4GZLA 3W1EA 1JFVA 1Z5ZA 3AVTA 5D1NA 2WP8J 4DN6A 1DAGA 2PX0A 3C3KA 1CUCA 4I6GA 1NXXA 4LF7B 3QKSA 2YJTD 1HO3A 1H22A 1EFRD 4HPXB 1FNDA 5C7OO 5EP2A 1R50A 2P27A 3KU1A 5ECDA 4W7IA 1L8OA 1XRRA 2AG1A 2V7QD 3W4JA 3LMKA 4ZCSA 2IU6A 4XWOA 5IVKA 1Z6GA 3DAFA 1W0KA 2PL5A 3I30X 3CX6A 2OCBA 4I66A 4D2IA 2EJCA 4XD7A 5F23A 4II3A 1TYZA 3ELUA 1U5CA 1IDN1 1RPTA 2KPOA 3R5TA 1W4ZA 1OXTA 4G97A 4D99A 4AMBA 2I3ZA 2PIDA 2CFIA 1F2TA 1WV1A 2JK1A 4Z86A 1Z39A 3UN1A 1LBEA 1R4NB 2NO4A 4LVCA 1PWXA 1BHJA 1ZN8A 3B9RA 2WNSA 4F84A 1Y7PA 2BEVA 4Q3LA 2ZE6A 1RYMA 1Y4UA 2BJVA 3AEYA 4AZ0A 1RXVA 1SUEA 1RLJA 3U31A 4P92A 2Q1WA 4REMA 3H9JA 2W37A 4ZYWA 1U2PA 4FU0A 4OIFA 3N3BC 4H59A 4KR9A 3O9VA 2HSGA 1M1YB 2FZVA 4ZOCA 4MUKA 1KIAA 4D44A 2FQ1A 1EK5A 1MPTA 1T8SA 5B4UA 3OECA 3I4CA 3ENVA 3W9SA 2PMBA 3EDCA 3RT7A 4E2WA 1K3TA 4X71A 3ZDCA 1UPFA 1CJKC 5L53A 3Q9SA 1TA4A 2F7SA 2NO9A 4CIAA 1KPGA 3COPA 2DUWA 5JXHA 5LLTA 4FOOA 1A9QA 2FMFA 2WJ6A 1GEEA 3E3AA 1DV1A 3EWIA 4ZP1A 1J2TA 4N5NA 1XTVA 4X24A 3ZV5A 2AN5A 4RLFA 5U9CA 2GAAA 1RWPA 1GYPA 2XUGA 3DKRA 1M1XB 4LOIA 4MUYA 4WY2A 4XWGA 2QX4A 3U37A 4CU5A 4KXUA 3OZVA 4MRPA 1EA5A 4BPBA 5CCXA 1DTEA 3BA6A 2AT1A 1P7YA 2HQBA 3GIDA 1Y1PA 4FBGA 4F4JA 2WKRA 1GUDA 3ROEA 3EARA 3HBJA 1X86B 4M37A 3KQUA 1AKNA 3O5AA 3LSTA 1EFVB 1JJFA 4JBXA 1Q21A 3RSFA 4I8DA 5IFLA 2WF7A 6Q21A 4MHTA 4E08A 3V1MA 4A6EA 2VHWA 2X7HA 4NOMA 1GPWB 1MV8A 2LDBA 1N5DA 3W06A 4GI5A 1FQKA 3ED5A 3PUZA 4XW2A 5DK4A 2FW9A 2PVCA 2QG9A 1EAMA 3NONA 3LCMA 1ZA1A 2QTMA 2R62A 2IOYA 2WUVA 3JALA 1NPDA 4S1PA 1QQTA 4TXMA 4MCIA 4HNSA 4JR0A 2HEGA 3GD5A 2JLSA 3ACBA 3KLOA 2HDWA 3LYLA 3NU1A 3QTTA 1E61A 1YQUA 2I03A 3PXCX 4ND6A 5D7BA 3SZLA 2RD2A 1ZG3A 1VBKA 2F1KA 4IIFA 3N0WA 4ZAWA 2IV7A 2GWHA 4UU8A 2TECE 2I4NA 2GHTA 3HB1A 5F9HA 4Y9SA 3NBMA 4WOKA 1TU4A 3ILXA 4QO7A 1R9GA 1G5TA 2QMOA 1RI3A 3OHMA 4PONA 4YROA 3A4NA 3MYYA 2E6UX 3KO8A 5KMGA 1XA3A 3Q0TA 1V5FA 2QM0A 3FJYA 1USIA 2JVKA 3PP8A 4RMIA 2DFDA 2A2ZA 1DC6A 1RLMA 2H1WA 3EGOA 4JB3A 5LPNA 3NC0C 1E60A 3AQIA 1Q1EA 1YR7A 2Z3ZA 1TNDA 5U1PA 3ZLTA 2R6FA 3HUFA 1LBHA 5JI3E 3RAEC 5AW6A 1XPUA 3P9ZA 4LJSA 4GYKA 2AMJA 1MDFA 1RZUA 3I53A 5FV4A 1K4YA 2O8FA 4BVJA 3AF0A 3QYAA 2FSIA 4BEWA 3KB1A 3BILA 2JIZD 3T3OA 3T7TA 1SU4A 4FNOA 2JCVA 3HJTA 3CN7A 4BBAA 4KZKA 1Z4JA 3QIVA 1JZTA 2BRUA 2D0PB 1NJGA 1GFWA 4KVGA 4OJQA 4DQDA 1PEYA 4OQEA 3T7EA 2BTEA 3CGGA 1ONPA 1NM5A 3NNNA 2VO1A 4QQNA 1UMDB 2NZ8A 4X7PA 5AM5A 3A9CA 2AA3A 3CVVA 1FX0A 1QZ3A 4F4CA 2PRKA 1M5UA 4KMRA 2Q3LA 1R37A 2A5LA 4KPUA 1E3EA 4GC9A 4FUTA 2ZZMA 2NSLA 4BP8A 3CLTD 3FH0A 1DJOA 2DQYA 4N6OA 1LRKA 4B76A 1LWOA 3LUCA 2GEKA 2R7LA 5F33A 1INLA 1NYTA 4GPIB 3UGQA 4YASA 2NWQA 3QYPA 4EHAA 1V95A 1U04A 1N77A 2W2LA 1JG7A 2CFOA 3A9RA 4EGJA 4KTTE 1PAUA 3I6IA 4MR9A 2ZDHA 4FX2A 3UTCA 1P31A 4F5WA 4J0KA 5FTMA 1G9SA 1OZAA 5ALOA 5C1OA 4U0KA 4CMBA 4L73A 1L4MA 2FETA 2IE8A 1FBTA 3LUBA 4WECA 2Q5OA 2L42A 2FRXA 4OUDB 3WBJA 1YTUA 1EWRA 4Y6RA 3NH9A 2FZLA 2IZZA 3CMCO 1I2CA 1V8ZA 1EDEA 2B99A 2AZDA 2IZ5A 5DHTA 2JBHA 4HGOA 1NVMB 2ZWMA 4RM3A 1LDMA 5JLJA 2DBYA 3Q2KA 5LZ7A 3QE3A 2BISA 1MLDA 2GZSA 4CMEC 4KQJA 5C7LO 2VJOA 5FBVB 4YRCA 1X8KA 3BWVA 3COWA 3E7WA 3MJHA 4D97A 5AM3A 3OT1B 3FWYA 1Z08A 4CKWB 1GA1A 1ZD9A 3X2EA 4A26A 1EIWA 1W46A 2TRSB 5KJCA 5ALPA 2EW2A 5LZ8A 2Q1SA 2XGMA 4L4XA 1H3EA 3AI7A 4N1AA 4B8WA 2CXUA 5EJIA 2PZEA 5CGZA 1G5QA 2XKJE 5JOQA 1KSHA 3L1IA 4DM4A 1Z5WA 5JIBA 2FCAA 2H2HA 2J4DA 1GG8A 2PA0A 1P7PA 2C7OA 4M0CA 2ZB7A 4B8ZA 3FAKA 2B25A 4HFMA 4KWIA 4HLDA 1NRJB 3ZJVA 3T5BA 1QVWA 3NYWA 4C6TA 4DQLA 3WK6A 4K6OA 4PRLA 4FONA 5I4BA 3FUWA 5EIBC 3VSCA 2DFVA 1KOLA 2PWPA 4NCNA 4P35A 4DR1B 4DXHA 1PNTA 3GNQA 2GLTA 4DT1B 4YA6A 4GICA 4BWGA 2W98A 1XKTA 3BHJA 2QD2A 4YO8A 3WDKA 5JJCA 2UYCA 1E3LA 3FNBA 4WESA 3IXLA 2SICE 4D57A 5LA6A 1GRVA 1G4UR 2H0RA 3BPSA 4BNZA 4JT9A 5DNUA 5EAIA 2A5YB 4YFYA 2P8JA 4OO3A 1FFXB 3IQDB 3NOQA 4H7JA 1L5QA 4HAUA 4Y7CA 3SQLA 4AK9A 3RR2A 2WTXA 2QTTA 3TW4A 2XCSB 1JT9A 1UQUA 1ZI6A 3M6XA 1IY0A 4LXHA 1Z2EA 1CEEA 3ROQA 4AT1A 2FPLA 4YPOA 3U6KA 4LDAA 3DBLB 3HHEA 3GMSA 1SQ6A 4M9UA 2YVQA 1YIOA 5CDFE 4DCMA 5B7NA 1XTJA 2BEWA 1D03A 1XJWA 1GKKA 1LV7A 4CMHA 1LFAA 3K6RA 1WHSB 2AB0A 2GCIA 2QMEA 1E63A 3QE2A 1PNVA 5BSHA 4O59O 1KZ4A 4G9EA 1WB6A 1N8NA 1GTMA 1PJZA 2IDZA 1NBWB 1UR5A 2QN7A 2HNBA 4COKA 3VFDA 4ESOA 3LJKA 2PZMA 2ZRHA 3ENQA 2XA9A 4QG7A 2IZOA 4F97A 1YOBA 3HKCA 2D0DA 4TV9F 3V1YA 4XJTA 4ARIA 3TEMA 3ANLA 4AB1A 4K81B 3A06A 5F64A 3KT6A 3QFFA 3QFSA 2H7YA 1J2RA 3LBAA 3T5CA 3DOIA 4WA7A 3KKNA 4QHYA 1Q1BA 1NVEA 2YWGA 5AKXA 3RTGA 2H1IA 4A1FA 4IHKA 3HXOA 1V8DA 5CFLA 5FBRB 4XDYA 2OBLA 1VJRA 4JHLA 2QAGA 1GZ5A 1G7SA 4JIMA 3L01A 3CPEA 5KYXA 1YZGA 2OFOA 2HY7A 3H5IA 3VNAA 4XR9A 5JDCC 4HK4A 4PLVA 2Z09A 3KKPA 2BOVA 5JVDF 2B9EA 1TD1A 2RGNA 3DW1X 4POAA 4J4BA 1K89A 3BYZA 5DGHA 1BQ3A 5LQKA 4LX8A 1DU4A 1TJ4A 1E7RA