3SC4A

Crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
280
structure length
280
Chain Sequence
SLRGKTMFISGGSRGIGLAIAKRVAADGANVALVAKSAEPHPKLPGTIYTAAKEIEEAGGQALPIVGDIRDGDAVAAAVAKTVEQFGGIDICVNNASAINLGSIEEVPLKRFDLMNGIQVRGTYAVSQSCIPHMKGRDNPHILTLSPPIRLEPKWLRPTPYMMAKYGMTLCALGIAEELRDAGIASNTLWPRTTVATAAVQNLLGGDEAMARSRKPEVYADAAYVVLNKPSSYTGNTLLCEDVLLESGVTDLSVYDCVPGSELGVDLWVDSPNPPGYTGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain dehydrogenase (A0QTM2 homolog)
publication title Crystal structure of a Short chain dehydrogenase (A0QTM2 homolog) Mycobacterium thermoresistibile
rcsb
source organism Mycobacterium thermoresistibile
molecule tags Oxidoreductase
total genus 93
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc4A00
3RBVA 3U09A 4IGEA 2OBYA 3HADA 3WMWA 1BDMA 1PJ3A 2XXJA 2PD4A 3K31A 3GQVA 4IDFA 4RPHA 1DEHA 5EL0A 3GF4A 4RV9A 1DAPA 3OMLA 4GVXA 1GZ6A 3LQFA 5JMPA 1MP0A 2JL1A 4FGSA 4GSLA 4QO8A 3E9NA 4BQRA 3UFXA 1DHTA 5COAA 1I0ZA 4DC0A 3DZJA 4Y67A 1YH3A 4FJ0A 1LSJA 3NDRA 4CLXA 1P1FA 4WASA 3VH4A 1NVGA 5AXCA 4XQCA 3I3OA 3ZNPA 5IDWA 3I52A 1YONA 4IY1A 1XQ6A 4FFLA 2Q2WA 1ISIA 4Y8VA 1NHWA 5A04A 1P33A 3W6ZA 1K2WA 1WPQA 2O2YA 1OC4A 3ROQA 3F1KA 4FR5A 2ZB8A 3OIDA 3WLEA 5JC1A 2HMTA 4CMBA 1EUDA 2Y99A 2R6JA 3D7LA 1E5QA 1N5DA 4CLRB 1U2GA 1XG5A 3CZRA 3KZVA 4WLFA 4AJ2A 3DMYA 1GY8A 4HFMA 3AY7A 5BSGA 1WDMA 1NP3A 4CMJA 1ZSNA 1GZ4A 2FOIA 3BZUA 1R0SA 4JP2A 1Q7GA 1U8FO 4FN4A 3CTMA 1WP4A 4TWRA 1UP6A 4OYRA 5L45A 3JQCA 4MKXA 5KJ1A 4P4GA 4INAA 4FBGA 4JN6B 4PLZA 1R37A 5BNFA 5A3JA 3PYXA 4WUVA 3VZSA 3CE6A 3KLPX 1OMOA 2WTBA 1HE4A 2C82A 3I6QA 3PIIA 3T7CA 1PGJA 3KYDB 4Z3DA 2Y68A 4D44A 1LRKA 1PQPA 5CPBA 4MP3A 1V8BA 2EW8A 2ZYAA 4YB8A 4PLTA 5LC1A 1J6UA 1GCUA 4R51A 5JDIA 4WCFB 1I3MA 1X0VA 4LRTB 1U4OA 2VHWA 1UP4A 1UH5A 3ZV5A 1GEEA 1AE1A 3BTVA 5JNLA 1I8TA 5CP8A 3RC2A 1VSVA 4BB6A 3WBFA 1YGYA 4Y9DA 1HE3A 5F1KA 3MJEA 3JQ9A 1M2WA 2VYND 4XYGA 3ZWBA 3MJSA 5B4VA 3IUSA 4WK6A 1YO6A 3X2FA 1X15A 8ADHA 1TT5A 5BR7A 1GPDG 5FI3A 4QUKA 3ETGA 2FMUA 1YJ8A 4IJKA 4CPDA 1HSZA 3OQBA 4W4TA 1X1EA 4XB1A 3U4IA 1NNUA 3ZCXA 3GH3A 3FR8A 4NJMB 1T2FA 1KEVA 2FSSA 4KUGA 4WJZA 4DYVA 1ENZA 5DDIP 3WYBA 1WMAA 3V5NA 4BKOA 1N9GB 3T7EA 4TRMA 1KIFA 2ZATA 2XAAA 4XCVA 5HRUA 3F5SA 5C3MA 3WOHA 4CM9A 3E5RA 1EK5A 3EK2A 3UVEA 5EESA 1JA9A 1YB1A 3BMNB 4R5HA 1ZK0A 1VPDA 2ZQZA 3FF4A 4EITA 2IYOA 4CQMB 3GOHA 1BRMA 3PGXA 2V6MA 1ML3A 4I1IA 1WDLA 4IS2A 2A92A 5T64A 3ZWCA 1IOLA 1NQ5A 2IEDA 5IDYA 4CLRA 5C7LO 3JQBC 1VSUA 4J4HA 3BTUA 3DMTC 4LMRA 4PZEA 4HX5A 4NBTA 2HQ1A 4TVBA 3L77A 1YOVB 2QZ9A 1E7WA 3B70A 3RVDA 1O6ZA 4M89A 3AWDA 8LDHA 3EZLA 4GMFA 2B4TO 4YTEA 3DOOA 2NM0A 3V2HA 4DGSA 4RZHA 3K2EA 2GASA 2ZKLA 2EXXA 4YAIA 1QYXA 4IUYA 5KVVA 4FC7A 1E3IA 3G1UA 1PZGA 2BGMA 3U4HA 3G79A 3OIFA 1KEPA 2VZ0A 4UVHA 4CMGA 5KWEA 1AUPA 3H7AA 3ZW9A 2DFDA 2BH9A 4OAQA 3EDMA 2D5AA 4U0JA 4RLHA 2EWMA 1GU7A 2V7PA 1UP7A 2I9PA 4NHEA 3UCFA 4DVJA 5BNTA 3KYDA 4YRAA 1Z73A 2P9CA 3JYQA 5KVCA 1XHLA 5HBRA 1DFGA 2VN8A 3MWEB 1G1AA 3H5RA 4Q3DA 1E3SA 1A72A 5DP1A 5JW6A 1P1IA 5JLAA 5IFLA 4DWVA 1B8VA 4TROA 4RF3A 1J0XO 4WCFA 4BNZA 2A4KA 5AXBA 1ZUD1 5KJCA 1T24A 2NV6A 5IZ4A 4K28A 4U6SA 2DQ4A 1T2DA 5DBGA 4DUPA 5L40A 3PFFA 2AQ8A 3ZWXA 5THKA 1MG5A 4CMAA 3HUDA 3VPHA 1E6EA 2ZTVA 4GKBA 3JQGB 4E32A 1GYPA 1A71A 4FGWA 2O7SA 5JAMA 1FDTA 4UUNA 3S2EA 4MPDA 4ZJUA 1PGPA 5L51A 4K1LA 1M66A 4EYEA 3N74A 3KYCB 2C59A 1U8XX 2QRJA 3DZGA 4NJMA 4E2ZA 2NLOA 3FNFA 3NKLA 1RM3A 3RC1A 3QQPA 3U4DA 1BG6A 2DLDA 4DBVO 4J0FA 4BQPA 1N9GA 3D4PA 1HE5A 2VWHA 4UAGA 1PZHA 4IDDA 1I2BA 5L4LA 3WFIA 1H93A 1B3RA 2E4AA 2WD7B 3OEWA 3PHGA 5KIAA 2CVZA 2YHUA 3EY4A 4KMSA 1VKOA 2CNBA 3AM3A 3DO5A 1VC2A 4D3DA 3MOGA 4FFOA 2IODA 2BRUA 3AU8A 3FTNA 3CXRA 5DCWA 3INTA 2HUNA 4GL4A 4CQMA 1D1SA 2VYVD 1LEHA 2AEJA 3PWSA 4O63O 3QSGA 5BNIA 2EKLA 1QLJA 4YAGA 1EDZA 4YJFA 5EJ2A 3FWZA 1MXFA 1SZJG 3B1JA 4Q3EA 5EERA 2GR9A 1PJTA 2PD6A 4IMPA 2O2SA 4XWYA 5T6BA 5TGDA 1R6DA 1U1IA 4GGPA 1ISJA 2Q99A 3HE3A 4R1SA 1YOVA 3VOSA 4FS3A 4PCVA 4F46A 1HYEA 1C0IA 1ZCJA 1XU7A 3HHPA 2YQ5A 1LLQA 5L95A 4YRDA 1LLCA 1MA0A 4ZA2A 5CDUA 5KOIA 3GGOA 2VWPA 2UYYA 3ETDA 4KZPA 2GZ3A 3PGJA 2O3QA 1JW9B 1J49A 3I9OA 4GSKA 2CD9A 5JDIC 4CLOB 5MDHA 1SO8A 3PJEA 4R16A 4GPD1 4XGIA 2PH5A 1DRVA 3DBLB 5COQA 3KEOA 2YFQA 4CV1A 4GWKA 4JQCA 1U5CA 4NU5A 4Y6RA 3OA0A 4JP3A 2W98A 1I5RA 3PZBA 3MOIA 4ILKA 3V8BA 1P1JA 2O48X 1R0KA 5A9TA 3W4KA 1O0SA 5ITWA 3EW7A 3GZ4A 3PVZA 4II2A 1JU9A 4OQZA 2Y1CA 1P1RA 5A06A 1E3EA 3V1YA 3ITDA 3JQ7B 4JROA 3UCXA 3JQGA 4FIZA 2QHXA 2EEZA 1KVTA 2QYTA 5ENVA 4I5DA 1X7GA 4URFA 5JPIA 4YEDA 3ZU4A 4D43A 3MJCA 3WQRA 3F3SA 3ZNNA 5L4SA 4MJLA 5A1TA 3KYCA 3ZHXA 1RPNA 3GEDA 3KBOA 4GLLA 1N1GA 4KUHA 4RL6A 3ONEA 3OH8A 4NNJA 3H9QA 4R3NA 3TSCA 4XDZA 1BWSA 3NDJA 1EFLA 1QMGA 3DL2A 3KETA 4XRGA 5A03A 5JBIA 2OL4A 3D1LA 4Z0HO 3NJ8A 2GNAA 4FPXA 4ALNA 4BNFA 2W2LA 3H6KA 4OIMA 1GAEO 2H1SA 4J1QA 2GN9A 4BKUA 3ST7A 5B4TA 2V6BA 3L6OO 4BO5A 2EHDA 1HETA 2B35A 2HK7A 1PL7A 3L6DA 4ND2A 3ASVA 1NASA 1B26A 3UN1A 4IQGA 4E5KA 4BO6A 1X7DA 4NMHA 4QQRA 1C3VA 3SJ7A 1Y8QB 1LRJA 1LQTA 2FPPA 2GDZA 1ZZEA 4E5NA 1T2AA 2AE2A 1PJLA 1GQ2A 4RPJA 3C1AA 3OJLA 4NFHA 3C8MA 4S3MA 3VPGA 3WGYA 3DTYA 3I9KA 3QVTA 4MKZA 4R41A 4J0EA 1NWHA 1B7GO 3GAFA 3PHJA 1FXSA 2DFVA 4WLEA 3WGZA 1LSUA 4AJLA 3PK0A 1U3UA 2A35A 4CLOA 1V35A 5IDQA 2IXAA 2HK8A 4DL9A 2ZJ1A 1YBVA 4FB5A 1P44A 1CIVA 3QW2A 1I01A 5DBFA 4W7HA 4YAJA 2PKRA 5HA5A 3RC7A 3PDUA 4Z6KA 1XU9A 4HV4A 2GUGA 2DTDA 4XB2A 3NJ4A 1XQ1A 4ALIA 3E9QA 3LF1A 3DZFA 2EGGA 2CVQA 4DPMA 4NBWA 3INRA 1C14A 1SNYA 3GVCA 2AA3A 4LVUA 4R69A 2IZ0A 3PIDA 2UDPA 4WCDA 4XIYA 3VH3A 4KQXA 3U3XA 3GN2A 2OBNA 2E49A 3JQ7A 5DT9A 4UUOA 4I5GA 3RUAA 4RDHA 1JN0A 1NAIA 3BXXA 1VKNA 4B7CA 1YB4A 4GQAA 2Q45A 1UR5A 2VTDA 3EAGA 4B7UA 3ONDA 5DULA 2AEFA 4P38A 1NVTA 4CM3A 1YJQA 5CAEA 3BAZA 3ANNA 4F6LA 2B69A 1B16A 1UZNA 3H9GA 5GZ6A 3QA9A 2DC1A 4WNCA 3TL3A 3EC7A 4RVFA 1G0OA 2WMDA 4ZGWA 2C5EA 2VWQA 1WWKA 4TRRA 3IJPA 4B3IA 4OGWA 1NWCA 1GFSA 3HNPA 1C1DB 3GEGA 1BTOA 1D4FA 1GEGA 3JD3A 3O8QB 4UEOA 3WICA 5IG2A 1E7SA 1LBEA 4WLUA 4MIEA 1WLYA 5JS6A 3JQ6A 2I67A 2O3UA 2XPCA 1NTOA 2G82A 3I4FA 1H5QA 3FBTA 3UGKA 2DPGA 1UXJA 2X5JO 2YV1A 5TJ9A 3WB9A 1CERA 4CMIB 1O95A 1X1TA 5T5QA 2O3RA 3HN7A 1XDWA 4Q9NA 2ILTA 5GZ3A 4OH1A 4OXYA 2BI7A 5IN5A 3RC9A 3S2FA 3E03A 1H9BA 1NVMB 2PWZA 4RF4A 3LLSA 3DC2A 3WMXA 2PKQO 1QKIA 1DJNA 2CDCA 2J3HA 2EV9A 2YV3A 2Z95A 3AUTA 3JQAD 4B4UA 4OOEA 1IL0A 4MVJM 3CMMA 4KOAA 2DTEA 2DU8A 1DLJA 2GLXA 3C85A 2UUOA 4MO2A 3CMCO 2PGJA 2WWRA 3DZIA 3TRIA 3RUEA 3ZWPA 1KEUA 4BO9A 1HL3A 1FMCA 3WQSB 3VAZA 1DC3A 5K0ZA 5I7EA 4G5HA 3VDRA 1EE2A 3WGGA 4YXFA 1J4AA 1LDEA 3MWDB 2EERA 5F21A 1KEWA 1LSOA 2CF6A 3SC6A 4DBZA 1WAMA 4YJGA 1KY4A 3IP1A 1IZ0A 4BMSA 2J3IA 3HWRA 1PIWA 3I4CA 3IDSA 1HLPA 3ZN2A 1LDBA 4LN1A 5JCXA 3CSDA 2EP7A 3CIFA 1HWYA 3FPCA 5A02A 3E9MA 2Q2QA 1YVEI 4R68A 4N5NA 2P9GA 1Q0LA 3KSZO 2VRCA 4UVDA 1TXGA 4WEQA 1WVGA 1GZ3A 4YA6A 2BFMA 1LU9A 4PRKA 4BKPA 2AQIA 1Z45A 4L73A 1H2BA 1KVRA 3R0IA 4MVJP 1SEVA 4BNLA 3LC2O 3OJ0A 2G0TA 1Y81A 1WMBA 4XIJA 3GPIA 3DB2A 4QO7A 3WWZA 2VTEA 5EMHA 5JY6A 5CDYA 1TT7A 3CPSA 4MP8A 4E3ZA 1V6AA 5IAAA 3L4BC 1I32A 3OM9A 3SBOA 1RJWA 2PK3A 2FPGA 2EGHA 4RVHA 4XYLA 3ZH2A 3BMQB 4A2CA 1BGVA 3AI2A 3GVHA 3ZV3A 3E82A 3QLJA 4FC6A 1C1DA 2HKIA 1HDYA 3W8FA 3O38A 3H9UA 3PXXA 4RVUA 4D45A 3D4NA 1KOLA 4XDYA 4J6FA 4DPKA 5TT1A 1Y1PA 2HAEA 5JAIA 4YJHA 4A0SA 1SBYA 4U5QA 1HXHA 2VNSA 3T4EA 4CMIA 4IDCA 3GRKA 3K9QO 3UHAA 4MIYA 3ZNQA 1Q0HA 4L4SA 5L3ZA 3NTQA 3R3JA 1N8KA 3IQDB 4RO0A 4EEXA 4DC1A 5U4QA 1K5HA 2O3SA 2DTXA 4I5EA 2JD0A 3A4VA 1PX0A 2ZB7A 3RUFA 1H94A 4Z3KA 1KC3A 5L53A 1PS0A 3NYWA 5TT0A 3H2SA 2JFGA 1FDVA 1HDGO 4ND4A 3DFZA 4AJOA 4C7JA 4DPLA 1N7HA 1XEAA 2BELA 3Q9NA 3DHNA 3OHSX 1N92A 2DUUA 3LT2A 1ADGA 4WKGA 4ONEA 3WJ7A 1BHSA 1C1XB 1LDGA 3H3JA 1XYGA 1DB3A 3MZ0A 4NBUA 2DBQA 4CL8A 3EMKA 3TFOA 2GZ2A 5F1OA 1OAAA 4MVJI 5ER6A 4B3HA 1PGNA 4ZRNA 3ANLA 3A14A 2FRDA 4MINA 2FPIA 3HSKA 4GI2A 1E6WA 1E3JA 4E2XA 2BGKA 1ZSYA 3GAZA 2FR1A 4PLPA 1BVUA 4CM6A 3F4BA 5TLSA 2AW5A 4BGEA 4K26A 3ZU3A 4K6CA 4Z9FA 2HU2A 4BNUA 4UUMA 3QVWA 5TC4A 3SC4A 4BNMA 3PQFA 5I7VA 1U3WA 2DAPA 1Y8RB 2JFHA 2EP5A 2CFCA 2HMVA 3GN1A 3GUCA 1NFFA 1BW9B 1F8GA 1SAYA 2AXQA 4XYEA 5T8KC 5I7SA 3BYZA 4XR9A 1N2SA 2JD2A 2BGLA 3ADPA 1I24A 3K6JA 5EIOA 1DXYA 4CJXA 4EW6A 4CM4B 4BNXA 1GTMA 2V6FA 4OL9A 1AGNA 1B8UA 2RCYA 3F46A 4QT0A 3GDGA 1ENPA 2B5WA 4J49A 4W7IA 4BNVA 1PR9A 4YCAA 4D0SA 5C7OO 3ICPA 5H83A 4FJ2A 3BMQA 4ZU3A 3EVNA 1P0CA 4IZIA 1P9LA 2J5QA 4JCOA 4PIVA 2YUTA 2FR8A 4R01A 4U0KA 4EUFA 5JYEA 1CDOA 1JWBB 2CZCA 4F45A 2QX7A 1K6XA 2FHSA 3DFUA 3ZNOA 1ZK3A 1GV0A 2J5KA 1ZFNA 4L8VA 2EIHA 2ZTUA 2NADA 1J5PA 4RJTA 1KBZA 3UAGA 4WLNA 3ANMA 4IZHA 2NVUA 2FWMX 4LVCA 1ULSA 4LGVA 4R1TA 4ZN6A 5KVSA 3UW3A 5ILGA 1ENOA 3C7AA 1DRUA 4MVJA 7ADHA 1DC6A 4RQUA 3ZV6A 4MVJE 2HRBA 2GSDA 5TX7A 4RVSA 2ZCUA 1P1KA 2PZKA 2CVOA 3AK4A 3A1NA 4GGOA 1YQDA 1ENYA 4MVJG 4PG4A 2UAGA 3GNSA 2C2XA 2NTVA 3BMCA 4E21A 4AVYA 4IJUA 3ULKA 3VKVA 5G0TA 4CQLB 1D8AA 4H3VA 5A5FA 1G6KA 4ROSA 4BGUA 4B8ZA 5L7WA 1BXGB 3ADOA 3WXBA 4FFPA 4I08A 1NBOA 3RAJA 4RPKA 1A7AA 3BTOA 1C1XA 1OBFO 1DDOA 3W4JA 4YPOA 1K0UA 2VOEA 1V3VA 4BNTA 4BNJA 4J9VA 4U6QA 4BGIA 3WIEA 5B4UA 2TMGA 3LDHA 3NUGA 3IC5A 4KUEA 1MG0A 1L1FA 4M86A 3LK7A 4AJ1A 5TF4A 4A27A 3RI3A 1BSVA 4LISA 1UZMA 1DJQA 1IUKA 4CLHA 1M67A 1JAXA 3L9XA 1ZH8A 2Q1UA 3PWKA 3PZRA 4OJNA 4P4NA 1UUFA 4I5FA 2IEBA 2OHXA 4EJ0A 3QWIA 3F9IA 3U49A 4A7PA 4F3YA 2PNFA 3H4VA 3OJOA 4I8XA 1P74A 1ZJZA 4LCJA 2D8AA 2TMDA 4JGBA 1EQUA 4IMRA 5GZ1A 4CR7A 3SJUA 1F12A 5CEFA 4B3JA 1C0PA 3ENNA 1NPDA 2I6TA 1YXMA 3JD4A 3S55A 2BMAA 1ZIDA 4BKQA 3PHHA 1NQTA 1ISFA 2FSVA 4PN3A 1GADO 2ZIZA 1I3NA 4BMVA 4DREA 4G81A 1VJ0A 3INGA 1Q7CA 1EVZA 1A5ZA 4RVGA 4Q3AA 2NU8A 2H5LA 3K5PA 2DT5A 1XIVA 3B6ZA 5L4NA 2OOSA 2P68A 3QWAA 1D3AA 3ZDFA 1XWFA 4NK5A 5JC8A 1ZO8A 4ZQFA 3ZI0A 1MFZA 3DOCA 3WG9A 2X8LA 3F47A 1ADFA 4IS3A 3FHLA 3L9WA 5HS6A 4DA9A 3ZGYA 3RBZA 1GUFA 4DLBA 1UAYA 3NT5A 2RH8A 3M2TA 2OGUA 3F6YA 3F5QA 2I66A 1IPFA 5FWNA 1OOEA 1MUUA 1H0KA 3UKOA 1GYQA 3S8MA 3ZHYA 3IS3A 3DDNA 4OQYA 4DIFA 3B1KA 1KVQA 4HBGA 5B1YA 3PJFA 1GDHA 3ROPA 4TMFA 1NX6A 4BV9A 3ONFA 3WGOA 1B3BA 3WLFA 2HO5A 3BIOA 1Z75A 4Y98A 3AUSA 3W1VA 4KP7A 3ZZNA 1F14A 2RHCA 3SLKA 3FR7A 2I3GA 4QFDA 4G65A 1AXEA 4CMHA 5JDCA 4FFNA 1QYVA 1ZMTA 4OSPA 3LC7O 2UV8A 3D64A 1BXGA 1PS9A 3D3WB 5IXSA 5ER9A 5TSDA 3TZKA 1ONPA 1I3KA 4X54A 4N5LA 1B8PA 1ZMOA 3AM4A 2NU9A 3GHYA 4FDAA 2ZK7A 4B4VA 1H6BA 1UDBA 4IXWA 2WM3A 3SEFA 2HJRA 1ZEMA 5JE8A 3VVCA 5IZCA 1TB4A 1NR7A 1E5LA 4EUHA 4ESOA 5IDXA 4GVLA 1M6HA 4FFRA 2DVMA 5B37A 3BMNA 1RYDA 1UZLA 2W8ZA 4HNGA 3HZZA 2Z5LA 1FDSA 1CQIA 2WE8A 4GWGA 5DN9A 4FOSA 4IBOA 4UULA 2AQKA 2O4UX 3NGLA 4BNHA 4BKRA 3G49A 5ICSA 2R00A 1Q7BA 3OA2A 3ROMA 1X14A 4WEOA 3QWHA 2EKQA 3GFBA 5KJ6A 4GX2A 3ZWMA 2O23A 2YDYA 4ALKA 5KJEA 2FZEA 3ZWOA 1PWXA 4R4JA 4FSHA 4UEKA 3VVBA 3JD0A 3HFSA 3HN2A 5JO0A 1CRWG 2Y1OA 3I23A 3DHEA 3GY0A 4FJ1A 4CR6A 4NBRA 2XF8A 1UXIA 4J1SA 1A27A 1I30A 4HP8A 1EUZA 1VJ1A 1YRLA 3RBXA 3ZU5A 3B1FA 5JFOA 4TZKA 3IMFA 3NT2A 1DFIA 3TZCA 4BVAA 1A9ZA 3PDJA 3H65A 1U4SA 4UVEA 4Z0PA 3ZW8A 2DBVO 5ITVA 4BNYA 3G1TA 3AU9A 3JQ9C 3OP4A 3KUXA 1NPTO 1W4ZA 1PJBA 1VL8A 3OEYA 4M1QA 2CDBA 3MTJA 1NFQA 1PJCA 4NG5A 3AFMA 3V2GA 1RM5A 3V1TC 2HRZA 3GDOA 2JHGA 1GV1A 2VYNA 4KWHA 1ZK1A 4HUJA 1MC5A 3OFSA 4RVDA 3HQ4O 2RH4A 3GUYA 2X5KO 4PLWA 3NTOA 4XQGA 1FK8A 4C7KA 1SEPA 5BSHA 1E3WB 1R66A 3PYMA 1R4MB 2Q1WA 5I8ZA 4L4RA 3IOYA 2CF5A 3DAGA 4Q3BA 4BB5A 1DAOA 1X7HA 3C1TA 3KVOA 2GPTA 4YT5A 1RM0A 5EQDA 4A73A 1YDWA 3GZNB 3D3WA 1XGKA 4DIOA 1ZXBA 1F0YA 2PH3A 3MJTA 3E6AA 3IIEA 3WX0A 1G0NA 2BFOA 1LUAA 1W8DA 4J3FA 2HK9A 2CDAA 3PTZA 1YE3A 4BO4A 2B4QA 1GPJA 4O59O 3AY6A 1V0JA 3EZYA 2J3KA 2WD7A 4CMEA 3I9JA 3GK3A 3M1LA 3UOGA 5CDSA 3HB4X 2ET6A 1FJHA 2OUIA 2YZ7A 4XKJA 3AI1A 3H5NA 5THQA 4RPLA 1KERA 2RHRA 3HG7A 3DAFA 2Z1NA 3OQ6A 4E4YA 1ZKMA 5L9AA 3GEMA 2FZWA 1QYDA 1EDOA 3CINA 3GA0A 3TPCA 3S1LA 2Y0DA 4UEJA 2D0IA 5I8WA 4OO3A 1QYCA 3S2IA 5KVQA 3TDKA 2OFPA 3H5AA 1O9BA 1E92A 3PJDA 3PI7A 4NBVA 1Q1NA 4EJ6A 1LQUA 4YRBA 1UXGA 3A9WA 2YHIB 5KCZA 4KDFA 2GERA 2CMDA 5ENDA 5TJHA 2JCXA 3ZV4A 3WSVA 4BGVA 1BDBA 2D59A 1EQ2A 2PLAA 3EYWA 4I9NA 5AXAA 3RROA 4BO0A 4YQYA 2D2IA 1L7EA 1IPEA 4PLFA 3EGOA 3DHYA 1OC2A 3OIGA 1T4BA 2GO1A 2X9GA 4ZQEA 5K9ZA 5EN4A 4WCFC 4AJKA 3CZMA 2Q3EA 4Q39A 5F5NA 1A7KA 1ARZA 3I5MA 4K6FA 3VZPA 1IHYA 4IXTA 2I65A 5HWSA 3DBLA 3JV7A 2D5CA 3K8ZA 1OI7A 3VPFA 4J90A 2JFFA 3JD1A 4F6CA 4BNNA 3VC7A 5ICMA 1HYGA 4JLWA 2X58A 1WW8A 2VWGA 3RSHA 4R54A 4E0BA 1MGOA 5JDCC 1GL3A 1B2LA 2NVBA 4ND3A 5I9LA 1LXCA 4YT4A 1ZVMA 1KETA 1LTHR 4J2OA 3SLGA 2O4CA 4TKLA 3HDYA 4DQVA 1ULUA 3IJRA 1VM6A 6LDHA 5JCJD 1TA4A 4TSKA 4DTIA 1ISHA 1ADCA 4R1UA 2O50A 3JQFA 1E3WA 4BIIA 1R4MA 2FP4A 1QV7A 4IDGA 1O8CA 1FF9A 3FRJA 3RKRA 3WNQA 1FDUA 4D79A 3GZNA 4DMLA 1IY8A 5F3RA 3IAHA 3OBBA 2DBZA 1GUZA 3ROKA 3P7MA 2UUPA 2EKPA 5J23A 2WSBA 4XGNA 1A4UA 5L7YA 2GN4A 4MVJH 3KYBA 1JKJA 4DMMA 4DLLA 1WXDA 1UAGA 4IDEA 4AFNA 2NU6A 4BNWA 2Y1GA 5FEUA 3RJ9A 3FCOA 1PWZA 2R00C 3LT0A 5LCXA 2VHVA 1PGQA 1SB9A 2O3JA 3DEYX 1HZZA 3HDHA 1R4NB 3WGIA 1ZNQO 2ZB4A 2BHLA 1SB8A 2E37A 2PD3A 4PG7A 4JK3A 2VHXA 2YJZA 3TF5A 4CR8A 1E1KA 2BLLA 3BA1A 4ZHSA 4HNHA 4KTVE 4JXKA 5KKCA 4DRYA 3PQDA 1PL8A 2JD1A 2Y67A 3QIVA 4MIOA 4R5MA 4PG8A 1Y8QA 3Q1LA 1UDAA 1ZXLA 5G2OA 3KHUA 4M49A 2YHIA 2X5OA 1LA2A 2FY8A 2ZTLA 4E13A 2PR2A 3NRCA 1YDEA 3MJVA 1SOWA 2P91A 4KQWA 4J7CA 4D0RA 4GLOA 2V65A 2XOXA 3TQHA 4E5YA 3P2YA 2DPHA 3PRJA 1NPYA 4YJDA 5TNXA 2CY0A 2PGLA 4JNKA 4RQTA 5TQVA 3KEQA 1E1MA 3K2BA 3D3EA 2ZTMA 1F8FA 3H8VA 1LDNA 2YW9A 1MFPA 4Y6PA 1B15A 3LF2A 2G76A 4DIBA 1EVYA 3JYLA 1GUYA 4XRRA 3M1AA 2HLPA 1DIBA 4PVCA 3NDIA 4Q3NA 3RUIA 1O94A 1A4IA 2NNLD 3LT4A 4UVIA 2IRWA 5DF1A 3P5SA 4HKTA 4PZCA 4R9SA 1ONOA 1GYRA 5EINA 4J1TA 2J5RA 3CEAA 3WDSA 5F5LA 4HFNA 3JQ8B 3QE3A 4CM5A 2VUTA 5F1PA 5MGBA 2OP1A 3IUPA 4BUCA 3EVTA 3UUWA 3U62A 1LNQA 2B4RO 1JTVA 3VZRA 3AM5A 3DTTA 3GLQA 3RUDA 1X0XA 4EBFA 4JIGA 1LC3A 3WQQA 1JLLA 2AG8A 4BOYA 3OSUA 1HT0A 4N7RA 2G5CA 2B83A 1N1EA 2Q1TA 3RFTA 4EUEA 4OOFA 2JCVA 4R3WA 4AJPA 4NH4A 4CM9D 1MLDA 2AQHA 3BMOB 1P77A 1HDCA 4Z9YA 5CDTA 1NR1A 2Q49A 1DHRA 2W4QA 4ZQGA 3W8DA 2H6EA 2PGDA 2O3TA 3PEFA 4FFMA 2BI8A 2WD8A 3JCZA 3O8QA 3KSUA 4PLGA 1R4NA 3V2UA 1PQWA 3MJ4A 2NTNA 2P5YA 4QX6A 5CG1A 2Y0CA 4WNIA 3QRWA 3IP3A 4ZVVA 3NEPX 5DNAA 1E7YA 4JJGA 4E31A 3TNLA 3JQDA 1EFKA 4IIUA 1Y5MA 3O4RA 4PZDA 4LSMA 3JQBA 2VT2A 3I9NA 1T1SA 3JQAB 3DMTA 5ADHA 4WOJA 3JYNA 1S7CA 3Q11A 3OETA 4J16A 3DBHB 2B5VA 4B79A 2GZ1A 3WWYA 1HF3A 4ID9A 4WLOA 1LDYA 5JAZA 5JMWA 3WGTA 3DOJA 3MEQA 3UICA 1I2ZA 1YQXA 1WDKA 3HDQA 3L07A 1DIGA 4CODB 1JKIA 1PJSA 4DLAA 4N5MA 1UDCA 4L76A 4PGFA 3RFVA 1U3VA 3TFQA 1LI4A 3E1KA 2VHYA 4RF2A 3FTPA 1I36A 3U9LA 9LDTA 3NGXA 1VJTA 3ZHZA 5I7FA 5G4LA 5T67A 1PTJA 1EUCA 1ZEJA 2Y93A 3GVPA 3KM0A 4XR4A 1BVRA 3SX2A 5LDGA 3HJAA 2JJYA 1C0LA 2F00A 3I9MA 4IQ0A 4H7PA 2GN8A 2QYSA 4RGBA 4W82A 4MP6A 2ZQYA 3KTDA 5DZSA 2NACA 1LJ8A 2WJPA 3DR3A 3F1LA 1NXQA 5A9SB 4QTZA 3TOZA 1TT5B 1N7GA 2HDHA 1YB5A 3JYPA 4L75A 2Y1EA 2HMSA 2GN6A 1TI7A 3Q6IA 5G4KB 3E48A 3JQ8A 3DQPA 3JSAA 4CM7A 4DXHA 4JBGA 5CDGA 1CQJA 3GRPA 1P31A 3OJEA 4QEDA 3LC1O 4JJIA 5HTOA 3EHEA 1E77A 1LSSA 2X9NA 1I3LA 4O5OA 4OKIA 5EPOA 3STHA 4A26A 3D0OA 2Y05A 1KS9A 4HWKA 3AJRA 4MDHA 4AJ4A 3WJAA 4LK3A 4H16A 4AJIA 3K92A 1MX3A 4IJVA 3LLVA 4CM8B 4RORA 3ZWYA 2PKQP 5G0WA 4A5OA 3W6UA 3TJRA 1OFGA 3BMOA 3FN4A 3L0DA 2P5UA 3AW9A 3GT0A 3L4SO 2D3TA 3M6IA 4ZQHA 1XLTA 4BO8A 3BTSA 4CQMD 2X0IA 2YDXA 2EJWA 2P9EA 3DXFA 4L74A 3WYCA 1D1TA 1LRLA 1MV8A 1Z7BA 5AOVA 2JAHA 4Z0TA 4IQ8A 4NIMA 2C7VA 3PYLA 3C3XA 1T25A 1HDXA 3VDQA 3KB6A 3OF2A 1D7OA 1KVSA 3AUUA 5JSFA 4TZTA 4IIVA 2Y1DA 4P8RA 2NQ8A 1NQOA 4QFCA 3KRTA 4BNGA 1HTBA 4YR9A 1U28A 1Q0QA 2PZMA 3JQAA 1ISMA 4ZQBA 9LDBA 3TZQA 1XSEA 5U9CA 1LLUA 1Y9AA 3DAPA 1WNTA 3WFJA 4YT8A 3DBHA 3JTMA 4O0LA 4D7AA 1X13A 1UJMA 2P4HX 2OORA 2ZYDA 3BHIA 4AJJA 1T2EA 2VZ8A 4ALLA 3PP8A 3GG9A 2IZ1A 1JVSA 1NM5A 3H3FA 2I99A 1JKFA 4Q3CA 4PLYA 1VRWA 2B36A 3DONA 1QP8A 4L9RA 3WSWA 4IDBA 2QW8A 1KY5A 4AG3A 1EBFA 3A06A 3PWZA 2LDXA 4R1NA 1IB6A 2QIOA 4IGFA 4J7UA 2RIRA 2QRKA 3DWFA 3IKTA 4FOOA 3WTBA 5A9SA 5G0UA 1ZSVA 1ZBQA 1HZJA 4GMGA 4TVOA 1HKUA 1DRWA 2GRAA 5G4KA 3ZWVA 1PQUA 4FCCA 1Q2XA 4M87A 3VPXA 5DCYA 2PZLA 2PA3A 2HMWA 4BO3A 2C29D 2QG4A 3VPSA 2IE0A 4CUKA 3R3SA 1Y8RA 2PZJA 5I9NA 1JVBA 3ZWAA 1T4DA 4GH5A 1A9YA 1BW9A 1VLLA 4O6VA 2VCYA 1YL5A 1EVIA 4B7XA 3G3EA 3L6EA 4CM4A 3RKUA 1E6UA 4CM8A 3TZHA 1GQYA 2IZZA 4ZICA 1VE9A 2P2SA 1ZJYA 1B0AA 1QR6A 1Z7EA 4PLCA 5T57A 1H9AA 1PEDA 3EUWA 2VOJA 4YJFB 2ZB3A 5GMOA 3PJGA 3IL2A 3U4CA 1EZ4A 2Q4EA 2W2LD 1Y5RA 5H82A 4N54A 1LDMA 3DZHA 4WPGA 3H9EO 3O26A 4J4BA 4NU6A 1YQGA 1HDRA 3UXYA 2VZ9A 1Y6JA 1ORRA 1F17A 2B0JA 2GF2A 1BXZA 4UUPA 1BXKA 4OHUA 2X86A 4AJHA 1ADBA 4P22A 4D3FA 4WE3A 1DSSG 1IULA 2Q4BA 2X0NA 4HADA 2AE1A 1HYHA 1QXSA 3FD8A 5TS3A 1SPXA 2Y1FA 4CL3A 3BHMA 3E18A 3LU1A 2JHFA 4YVFA 2FN7A 3ZHBA 3UH1A 4XQEA 5AQ1A 5CEJA 3DBRB 4JX8A 3K96A 3HDJA 4EGFA 1PJQA 1QYWA 1HLDA 4KTTE 3RU9A 2D1YA 4NFSA 1PJ2A 4XJSA 3LZ6A 1W0CA 3AFNA 1Y9EA 3GMDA 1YBMA 1XR3A 3Q2IA 3X2EA 2I76A 4J7XA 4CQLA 2I5PO 3WIDA 4IM7A 3UF0A 1DOHA 4FQ8A 3FNEA 4E5MA 4BV8A 1E3LA 4R9RA 4BHTA 1V3UA 1WZIA 1JQBA 1DIRA 3QY9A 2C5AA 1MXHA 1PZFA 2C07A 4TKMA 4W6ZA 3VH1A 3TN7A 1P0FA 1KYQA 2EG9A 3ICCA 3MCVA 5FYDA 4DYDA 2NU7A 3DBVO 3QVXA 2VUSA 4PLHA 5FI5A 5KJFA 3JYOA 5JY1A 1JDJA 3I1JA 4UREA 4XD2A 2W90A 3O9ZA 4B4WA 4E6PA 4CLDA 4IPTA 1RWBA 1BMDA 3GFGA 2DBRA 1I2CA 1Z82A 2G17A 1GCOA 3QVOA 4OXNA 3WGHA 3GVIA 2F1KA 2PV7A 3TL2A 1B14A 3QWFA 1F06A 1I33A 1V3TA 1CYDA 2Q1SA 4M8SA 3NV9A 4Z9XA 4CUZA 2J3JA 3K73O 3WYEA 3LT1A 3NT4A 1QLHA 4I9HA 5JO9A 1ID1A 4CMCA 3GNQA 4RPGA 1SCUA 2IDZA 3FWNA 3RUHA 4KDEA 1FDWA 5BSFA 1QRRA 5KTKA 1U7TA 3CUKA 1M76A 3FNHA 3N58A 3RWBA 4HFJA 1PU2A 2YY7A 5A05A 4MOWA 5DBIA 4QECA 4W9NA 2X0RA 3Q9UA 1TVEA 2GD1O 3D5QA 3W4IA 1DIHA 4GKVA 4E33A 3WR5A 3LSYA 5H81A 4TQGA 4LSWA 5JAQA 1E7QA 3FPLA 2PY6A 2OXIA 4HFRA 1SC6A 5U1PA 6ADHA 3CH6A 1UXKA 4PLVA 3RASA 1ZW1A 1RM4A 3FNGA 3P19A 3AOEA 4XEHA 5B12A 3MTGA 3U5TA 3D5TA 3QV1A 4MVJF 4GX5A 5JXWA 2AEMA 3DBRA 5CEEA 4XJTA 3GMSA 1KC1A 2LDBA 4E12A 3RCBA 4D42A 3RIHA 2H63A 4WECA 1TEHA 1WZEA 2YYYA 3OQ1A 1EK6A 4LCEA 4RZIA 4XGKA 4QXMA 1T1RA 3Q0EA 5CPFA 1K6IA 1IZ9A 4AJNA 1HE2A 4U7WA 1QG6A 3WNVA 4BS9A 3AY3A 3GG2A 2NSDA 3AI3A 5K6AA 4IDAA 1U3TA 4GX1A 1U9JA 4J43A 3K30A 4L0QA 3VHRA 3UCEA 2CSUA 4GAEA 1DLIA 2B37A 1U2DA 1PJ4A 3KSDO 4NPCA 1QV6A 1XELA 1XA0A 1LLDA 1QORA 4HXYA 4UVGA 4CUJA 4EEZA 1K89A 4YAEA 4XZ3A 1EE9A 3G17A 4OKNA 2O7QA 1HSOA 4TRNA 5CHEA 5A3VA 3HB5X 2VRCD 2OP0A 3VZQA 1U7HA 3QWBA 1DO8A 5AXDA 2BFAA 1CEQA 2E48A 4AICA 2G1UA 1R12A 2FR0A 3QHAA 2W2KB 3ZWNA 5ILOA 3GNTA 1E0DA 3E5MA 3COSA 2R2GA 4RF5A 3TOXA 1Z6ZA 1GQQA 4RLSA 1S6YA 3NTRA 5COBA 2BKAA 4EZBA 5HM8A 1PSDA 4CMKA 4ZD6A 1E7RA 4ND1A 1CF2O 2NTJA 2VT3A 2ZYGA 2GGSA 1DPGA 2J6IA 1AN9A 3L4BA 2X6TA 3R6DA 3Q3CA 2BFPA 2X0JA 4NDNE 3Q2KA 1AHHA 4DQXA 2C2YA 1XCBA 3WTCA 2HSDA 3G0OA 1NFRA 3I9LA 1K3TA 3SXPA 4YDRA 2DKNA 2P4QA 2C54A 2VRBA 3PHLA 3ASUA 4NZ9A 3AUAA 4U8GA 2DM6A 5DOZA 2PTGA 2VHZA 3W8EA 1EVJA 1YL7A 2A94A 1JWAB 5G0VA 5BT9A 2QQ5A 3TZ6A 3I83A 3U0BA 4JJFA 3GDFA 3C24A 4ALMA 4PG5A 3ABIA 4WGGA 4CV0A 4FD3A 2NUAA 4NK4A 1MB4A 3PPIA 4OXKA 2IYPA 1H2HA 1JAYA 4MKRA 2X23A 2WYUA 3H9JA 3IKVA 3P2OA 1PR3A 2I3AA 4CV2A 1O5IA 4CV3A 4E30A 5JYDA 3ZWWA 2QZZA 4YJGB 2VQ3A 5EQFA 1CETA 3PQEA 3RU7A 3R1IA 1E7MA 5C5IA 3QJ5A 3FBGA 4PVDA 4B4OA 1P1HA 1V9LA 5IZCC 1OZAA 4YACA 1R15A 1YBAA 5BQFA 1DFHA 3KLMX 1VL6A 1YWGO 3ON5A 3VKUA 4E5PA 4J2HA 4YQZA 4ITUA 4K9DA 1DC5A 1C0KA 1ISGA 1HDZA 4BO1A 2EF1A 1K6JA 2WE7A 4PG6A 2C20A 1KVUA 1L7DA 2J8ZA 2X4GA 1NHGA 1AXGA 1XKQA 4XX0A 3DZKA 4KWIA 2JKVA 2OMEA 3TWOA 4A03A 1VI2A 3GGGA 2QRLA 1UXHA 2VYVA 5A5EA 5CFZA 4B8WA 4RCVA 1ONNA 4ZRMA 5DP2A 4CM1A 2OO5A 3LYLA 4JBHA 1IE3A 1HEUA 1TLTA 4OMUA 5G0SA 2H9IA 3NX4A 1SMKA 3GGPA 3VTFA 3RQSA 2W2KA 3VH2A 4BNIA 4W99A 3WGQA 3PLRA 2Y66A 1DC4A 4J1NA 5GY7A 2X22A 4DQUA 2HJSA 2YV2A 4W9NC 5AYVA 5T8KA 1SOVA 4N18A 4S1VA 3VTZA 1O89A 3DZBA 1EBUA 1M75A 2XXBA 3RUCA 1HRDA 5C37A 1QSGA 2HMUA 1H6AA 5KNLA 2C0CA 2DUWA 4YJHB 3S2GA 3V1UA 1NYTA 4E2YA 4YBZA 5IJZA 1ZK4A 2V6GA 3T4XA 3KO8A 3HFGA 1NAHA 3AOEC 3FI9A 2WDZA 5AVOA 1LC0A 4FW8A 4L4XA 4BO2A 3KOUA 3ORFA 3RFXA 1IYZA 4J91A 4YYZA 4YT2A 4CLEA 3PHIA 3QVSA 3OECA 2POQX 1EMDA 3C7DB 1EEHA 4MVJD 2EW2A 4AJEA 4BNKA 2UVDA 4WOKA 2Q46A 1DBVO 1Z74A 3M2PA 5TRTA 5K6AC 2Q50A 3I6IA 1E1LA 2WYVA 1PS8A 3OICA 1YKFA 2GYYA 4H15A 4M55A 2SCUA 2ZJ0A 4P4LA 1M6WA 4EDFA 3LVFO 3KXDA 4RDIA 2OZPA 4J9UE 5IN4A 3F4LA 3PLNA 1H6CA 4XQ9A 2NVWA 4G2NA 4LRSB 5A4DA 4NJOA 5BSEA 1LX6A 2X7HA 4I9UA 4TRJA 4WLVA 1H6DA 1AHIA 3GHHA 4BL5A 3NAQA 2YFHA 4JBIA 4PRLA 1GR0A 4D3SA 2CUKA 4CMEC 2Q2VA 3C7CB 4LW8A 3ENKA 1CJCA 5TIIA 5FFFA 5ES3A 4A10A 2Y0EA 4BMNA 4OSOA 1CWUA 7MDHA 2E82A 3AOGA 4GX0A 1T26A 4XYBA 1RYEA 4Y6SA 3GPDG 2VUUA 4D46A 1W6UA 3QP9A 4O1MA 3O03A 3N7UA 3A28A 2BD0A 4YWJA 2E6UX 4C4OA 1DIAA 3CKYA 1Y7TA 4E2WA 4EJMA 1P3DA 2WEKA 2Z1MA 4D41A 4BO7A 1YS4A 5LDHA 4NR0A 3SVTA 1R0LA 5KKAA 4LMPA 4ALJA 1PZEA 3GR6A 3H2ZA 5I9MA 2YQ4A 4ND5A 1RKXA 3ETEA 4GBJA 1NQAO 1W73A 2JCYA 3ITKA 1YL6A 1HDOA 1P45A 4PFJA 4XYMA 5HS4A 3WS7A 2X1HA 3B20A 2AHRA 3GVXA 5FF9A 2WYWA 3PFWO 2NWQA 5DCUA 2NQTA 1PL6A 5IF3A 1ZK2A 4M54A 2BF7A 4NFYA 2GCGA 1VL0A 3RD5A 1I10A 4IINA 2C7GA 1R16A 4XA8A 2ZCVA 2NVUB 3KV3O 4J4TA 2RBEA 5DOVA 1MC4A 3WBBA 5L7TA 2PFGA 4HY3A 2AMFA 3D4OA 2A9FA 2AG5A 2VNAA 4NI5A 1E1NA 2X9VA 4IJWA 3E8XA 3FSRA 5IXYA 2IXBA 2HCTA 3RJ5A 3OJFA 1U5AA 3GC6A 4NQZA 5C7IO 3BHJA 3ZU2A 3C1OA 1PGOA 4II3A 1IHXA 4YAKA 3JQFC 2RAFA 4QSMA 1GD1O 3BMCB 5A9RA 4EI2A 2D4AA 3JD2A 2JAPA 2EJVA 5CG2A 5JCJA 3JQEA 1T2CA 4OM8A 4AL4A
chains in the Genus database with same CATH superfamily
2OFFA 3U09A 5ALIA 1LW7A 4IGEA 5JHHB 3NOOA 3WMWA 2PD4A 3K31A 1UKBA 3QXCA 4IDFA 5C32A 4DKJA 4ZI5A 3W04A 5JFTA 4J03A 4WNYA 2NX2A 1UC8A 1FZQA 2V96A 4GVXA 5CM8B 4NYIR 3LQFA 5EIBD 1MP0A 4BAZA 5B36A 1QDLB 5BWNA 3E9NA 4BQRA 4WCVA 1DHTA 4B75A 2F67A 1I0ZA 3ZTYA 2PJRA 4GNKA 2IWRA 1XC7A 3R76A 1L7AA 2VBIA 4FJ0A 3VR1A 4C6TB 3NDRA 3E0XA 1AKEA 2GCPA 1KK3A 1UC4B 4RVCA 1JZSA 3SR0A 1V16B 1Z16A 2CW5A 4XQCA 4ND8B 2DB3A 4LFAB 2FQXA 5AK4A 1EDEA 2XB8A 3I52A 3CW8X 3H18A 3VJMA 3WZMA 2O8BB 1OROA 4EL5A 1OBCA 2XOEA 5KINB 1DVRA 3IPYA 2I4TA 3PL5A 3H97A 3L7OA 1DO0A 1SK8A 2OKGA 3Q3VA 2VQFB 1IHUA 4FR5A 3NASA 4PAMA 3THYB 2A5LA 2R6JA 3D7LA 4JLNA 1N5DA 3U0VA 2R48A 1W1IA 1CFJA 1XI2A 1XG5A 1XXHE 5AJWA 3DMYA 3LWDA 1XL1A 3ROZA 2PUEA 2WV7A 4GPEA 1KQNA 1GPKA 1X42A 2JS7A 3AY7A 3IDAA 1WJGA 3IMEA 4KQ6A 4BQNA 4EZIA 1NG9A 1O97C 5DASA 2CSXA 2JRLA 4QOJA 4FN4A 3SICE 2JW5A 3I5YA 1AUVA 4FDMA 3CH5A 2G9VA 2OXFA 2AKEA 1FW8A 1GG5A 4I50A 4BTVA 3HU2A 1J24A 1NVAA 3B78A 3ILYA 3NBFA 4LDRA 4UCXA 4DYHA 4M38A 5KJ1A 1OXUA 2GCEA 1EYZA 1WB6A 2Z3WA 1MAUA 3SEQA 1H4SA 2IYLD 2W6NA 1MZVA 5HOEA 2G4VA 5D5QA 3CTPA 4G89A 1R37A 5HFJA 3TW8B 4URZR 4PU0A 1RQ7A 2VEDA 3UAVA 4C0SA 2GOYA 4DSTA 1ZM9A 1FBNA 1P72A 3TQQA 3A6FA 3UIEA 2B92A 3V33A 4HGYA 1AJEA 2D7JA 1XRPA 1WB5A 4HLDA 4LBZA 2FFJA 3T7CA 2IS6A 3HVUA 2P1RA 4O8CA 1ZCAA 3PC4A 2G83A 3UM9A 1E6MA 2V7BA 2BJVA 3KLBA 1D9XA 2OK7A 4L07A 1XNHA 2OB2A 3CZAA 1V8BA 4XUEA 5LOVF 4YK7A 4PLTA 5IC4A 1F6DA 5CB8A 3FGZA 1I3MA 1VGVA 4LNUA 3WGUA 2VHWA 5CGQB 3HJUA 3KELA 2RE8A 4ZVRA 1B76A 3WY9A 1UH5A 3ZV5A 1J8VA 1GEEA 4CCYA 3NJRA 2C5HA 3EZ7A 4A2PA 5JNLA 5LIPA 3JWHA 4H7EA 4PBTA 1U0EA 1N6RA 1NV9A 2GPJA 4BB6A 5KOJA 3PF9A 4MZXA 4QUIA 5SYAA 2O0HA 1HOXA 3ZE7A 5B2EA 2MSLA 3H8SA 4IEFB 4Y9DA 1XMOB 4NNOA 3Q8KA 3EDRA 1WBJB 3BXFA 3HU1A 3AVWA 8ADHA 1TT5A 1VLMA 5CJPA 5FI3A 3ND8A 5HZGA 4KLRA 4UBKA 4CPDA 1WRBA 3O4HA 1HYBA 1HQCA 5TMEA 3FOAA 3THWB 3I5AA 2E87A 3G9TA 3ZCXA 4JVSB 5BURA 3GH3A 1SY7A 4TZ6A 1M83A 3AIOA 1FSZA 3E4DA 2B99A 4GPZA 1KEVA 2XZPA 2QRZA 3QEAZ 5HSGA 2IPXA 2J30A 7AT1A 4RMHA 2YKGA 4TRMA 1EBBA 4B3CA 3EAFA 3ZD7A 4XCVA 3HVHA 5HIJA 3B51X 2ZLBA 4ND8A 2M6SA 4CM9A 2JGDB 3E5RA 1EK5A 3UVEA 4B09A 1YB1A 2FEKA 1W75A 2O7RA 3BMNB 3W2FA 3UJ7A 4M8LA 1SQGA 1VPDA 2DR3A 1I94B 4KX3A 2IYAA 4N47A 1VIAA 2YCBA 2GYWA 2JF0A 4YC7A 5BO5A 2PM8A 3TSWA 1ML3A 3ZD8A 4OLBA 1WV1A 4RIGA 1QHHB 3THYA 5A4JA 2FXIA 1H2YA 4K9MA 4LC9A 1V4NA 4BVKA 5E6SB 3CVUA 3T1VA 3ZYCA 3PQ5A 2YZGA 4HX5A 2XA1A 4NBTA 4RZSA 2PS9A 3NHRA 4UTXA 3L8DA 5KYTA 5LQKA 3RVDA 1H66A 1O6ZA 3VSEA 2BN4A 4P7BA 2B4TO 1HH4A 2VC2B 4MI1A 4A0GA 3H11B 3V2HA 3RSZA 1T5HX 3K2EA 2YJ4A 4ARSA 2B1RA 2EXXA 1AS0A 5DWQA 1WHSA 1NLMA 2H1HA 1UPAA 2AMLA 4OFBA 4D4MA 3AB8A 1PZGA 4FHEA 2WKWA 5FEMA 2VZ0A 2XVAA 1SCBA 1VXOA 3SYKA 5BQPA 3TW8A 5DFAA 3H7AA 4DM4A 4DF3A 2BH9A 3EIEA 3R7FA 4LJ9A 2I9PA 4C4YA 2D0DA 3ZD6A 2FRVA 5JNTA 1U2EA 2OLEA 1Z73A 3AHCA 3AHFA 3JYQA 4MARA 3WLRA 3MWEB 2W6QA 3WNCA 1XAIA 1X80B 1G1AA 6Q21A 5DP1A 4EA8A 4IGIA 5C8VA 3DD1A 3VC3A 5IFLA 4DWVA 4ZVQA 3R0ZA 1B8VA 1JQ5A 3RRMA 3UNXA 5A5VA 1J0XO 1ZIOA 5FYQA 4BNZA 3OM0A 1EWQA 3WNBA 3CN9A 5A4AA 1Q17A 2VK1A 1RLOA 2WUGA 2A88A 2V54A 2NV6A 3AC0A 4IIBA 4U6SA 2DQ4A 1T2DA 5DBGA 5DYWA 1VMEA 3MMZA 3KB1A 1F0KA 2AQ8A 2GVNA 1MG5A 1YE8A 3MMNA 3HUDA 3FMOB 4GKBA 3Q2OA 2HGZA 1NUAA 1GYPA 1L5FA 1EQAA 1CUFA 1T5DX 3WYNA 4IR7A 2QTMA 4BMZA 4IZOA 3C1UA 1FDTA 3FOFC 1WA5A 4WL0A 5FOWA 3RDPA 3M4NA 2YZ2A 3PR3A 4CKEB 4K1LA 5KOHB 4GM0A 4IRMA 3KFVA 1P6QA 4IIJB 3QUSA 4LZLA 3TKLA 1H3EA 2QRJA 2QTNA 3NWBA 4QPCA 4QWMA 2IY9A 4OATA 3ZK7A 1B4DA 3RC1A 3NOQA 4AY4A 4DBVO 2IHYA 2QM8A 2IVFA 1TLLA 2BI4A 2Q9AA 2VWHA 1EJ2A 3D4PA 3HB1A 2O0LA 3FA2A 4IDDA 5DTEA 4D6XA 1N5MA 1KYZA 1UWLA 1B6SA 1E0JA 2WD7B 3KAKA 3NV7A 4AIRA 2P6OA 4EH1A 3EY4A 5I3ZA 4JYCA 3QUTA 3SQOA 2JGDA 5HQJA 3NOVA 3FPFA 1ZLYA 1VBNA 4JZYA 4MW9A 4R2IA 2GVDC 5AD1A 2BRUA 3AR9A 2QRGA 3FTNA 3UJ6A 2QX9A 3PDWA 4B3SB 2XUKA 1Y42X 3KAPA 2BEVB 3OUTA 5CFOA 2AEJA 1X7XB 3IAFA 4HNRA 2EKLA 3GCZA 2VHUA 2OB1A 1K97A 2JVJA 5HK9A 1QHHA 4UBJA 3QF7A 1V8DA 3B1JA 3HBFA 3Q7PA 4EQ6B 1UJ6A 2GR9A 1VE6A 3DJYA 4JC5A 3LVRE 4Q82A 2PD6A 3N6XA 3OTQA 4IMPA 1E2DA 1G42A 5E6SA 5IW8A 4UCQA 3KDPA 1R6DA 4GGPA 5G53C 1BD4A 3T7IA 3I6MA 4DCPA 4YCSA 1HYEA 2ATCA 3OG9A 3OFND 3HBAA 2ZRQA 4Z99A 4UCFA 4E1BA 1LLQA 2OORC 1LLCA 1YZGA 5ALOA 4I9FA 1Y89A 2CFIA 1P5HA 2UYYA 4KZPA 2RHOA 4G0NA 3F96A 4W5QA 1O97D 5IAJA 4MCHA 5D86A 3AT1A 3LHFA 1X19A 1P2BA 3EG5A 1I1HA 1VDMA 3RYFA 4J0DA 2YMQA 2Q5QA 1PD0A 5BRNA 1IATA 3PF8A 4HG2A 3UWDA 1CT9A 3SMVA 5B6IA 2BZ1A 2VDQB 1L4LA 4HWSA 5COQA 3KEOA 4KKVA 4TPKA 2C1ZA 1LVUA 4KIFA 5SZJA 3SP1A 2C99A 2QJFA 1GGMA 1QIHA 221PA 3M34A 1V8ZA 4MR7A 4FK8A 4XW2A 3CSUA 1X80A 1RHMA 4JDUA 5B7NA 4ZIRB 2F55A 4BZPA 1I5RA 4ABTA 2O1WA 2HQSA 3GLHE 5AHKA 3RIEA 3W1EA 1YASA 5AW6A 3W4KA 1JQJC 1VSBA 4BLWA 1YFJA 2BHTA 1O0SA 1E9EA 3EPPA 4UHKA 2DJIA 2OV1A 4E14A 1F20A 5A3RA 1Z6AA 1JU9A 4C4PA 2REXB 3KQVA 2Y1CA 4NAHA 2WR8A 1EH5A 3THOA 5A2QA 2F1OA 2Y92A 3CUVA 4GOXA 5CIQA 3ITDA 3QUQA 2QL6A 3TZBA 4U2CA 2QHXA 4ZVOA 2VAMA 2CNKA 3TD2A 2QD3A 2X7XA 1X7GA 1HPLA 5AVWA 4YEDA 2DMRA 1AQLA 1SOMA 2BVNA 5IWCA 4G86A 1XPUA 4FEAA 2JAOA 2V6JA 5L4SA 3KJQA 5KOHA 2CNLA 3K0EA 4BX0A 1RZRA 4F3NA 4IIJA 5CAEB 1RRGA 3RYIB 1DCFA 1OIVA 1PV1A 2O6HA 4H3HB 1RYZA 4XOUA 3N39C 2ZSHA 5DISB 2QRNA 2ZPUA 4I5IA 3QLEA 1GCAA 4CKXA 3ONEA 3LCUA 4CKYA 4KRFA 4Q3KA 3OH8A 1XDBA 1NBMA 4H3SA 4XDZA 4A0RA 2SKEA 3K94A 2NU6B 4JITA 1O6FA 5FPQA 2B78A 3L8EA 1FFSA 3ONWA 3X3HA 4XRGA 5JBIA 2OL4A 1Q11A 5AI5A 3WKAA 5D51S 5F1YA 4CRWB 2ZJOA 1CY8A 2BEVA 1X7XA 1JDPA 1W36B 1SH7A 1C4WA 4J1QA 4KGDA 2VFAA 4NENB 4UU1A 4L85A 4MUKA 3KQPA 3ST7A 4L22A 1ZOPA 4G0QA 4ZALA 3L6OO 5B1IA 2EHDA 2M2IA 4F11A 1HETA 2B35A 2HK7A 3A26A 4AP5A 4AMBA 4C0QC 1NASA 5DTRA 4DKXA 3UN1A 3U37A 3K3PA 3G9XA 1V2HE 1X7DA 1L4EA 4PR0A 3SE0A 1LRJA 1LQTA 1QO0A 3LO5A 4FMDB 2AH5A 4A5SA 1SBCA 2R86A 2AE2A 5HKAA 1PJLA 2DPMA 3SHTA 1T9CA 2AKYA 2FJUA 1ZGGA 1HKHA 3H5IA 2ZULA 3OJCA 2AJDA 4JBWA 4EG0A 3AERB 1N5OX 3VPGA 5FKJA 4DANA 5HKLA 1N36B 1R5NA 2QPAA 3JALB 1V5FA 1K8YB 2J1LA 1NWHA 2QUAA 2WFLA 4KQCA 4WLEA 3TLXA 1FTWA 1D2GA 1Q5PA 1Q19A 3LA6A 4ZK2A 4RKFA 1ZD8A 3IVRA 5E4FA 1KP2A 1PFKA 4DW8A 3FPSA 3LW7A 1I4TD 1SCAA 4C14A 3E81A 2I7TA 3U7FB 2FVXA 1A9XB 4EI9A 4MUEA 4OQEA 5EXXA 3BFVA 3DSRA 2EJUA 2OPBA 5ED0A 4DB4A 1GGHA 2YL2A 4FB5A 1P44A 2PMBA 3OD5A 4L2IB 3OCCA 4L8WB 5DBFA 1A9TA 2AYYA 1E2GA 4LTMA 3EIQA 5HA5A 5BPFA 1A4XA 2I8AA 2N9UA 4HQ0A 1G2PA 3KB2A 4C6RA 5CCEA 2GUGA 2QT9A 2DTDA 2H17A 3NJ4A 4ZWNA 4BMXA 3CNQS 3E9QA 2C92A 3A2MA 3KJNA 4Y2XA 4INJA 3R0QA 4AXXA 3I0NA 1E3DA 1KJ8A 2F3PA 4KYUA 4NBWA 1SNYA 4B83A 2AA3A 2F1RA 1USUA 2A86A 3B3FA 4IILA 3M49A 5JJLA 5EWMB 1E3TA 4LZNA 3UJDA 4B5LA 3U3XA 3GN2A 3E9DA 2E2WA 1KDZA 5FBVB 3EWNA 4RDHA 4F2WA 4B7CA 4N76A 2P6UA 1YB4A 4KZKA 1EXMA 4FMBB 4GQAA 1UR5A 2XQVA 3GJ5A 5BQOA 3EAGA 5FXMA 3SM9A 2NO0A 1NVTA 1U2PA 2CLMB 4KNYA 1YJQA 4AMZA 2ORYA 1SG0A 2AG0A 1X2BA 2BRUC 4H17A 1WW2A 3BAZA 3LHIA 3RYIA 5CAEA 4F6LA 2B69A 3D02A 1UZNA 3SFTA 4WNCA 1G0OA 2AOUB 4B2PA 3UUEA 3VTKA 2C5EA 2VWQA 3CYFA 3NVAA 4JXJA 2WUVA 1WUHS 2ODPA 4F4IA 2PYZA 3NP9A 3JVVA 5H1YA 4YV1A 1FX1A 1WD7A 2RBKA 2WZDA 2JFPA 3HNPA 1C1DB 2J41A 1BTOA 2XA2A 3GEGA 3O8QB 4FNAA 4I19A 3VR5A 1BE6A 1LBEA 3L6BA 3PDIA 4MIEA 4NATA 5JS6A 5DBHX 3JQ6A 3GT7A 4MYCA 2B2CA 2O3UA 1CUZA 2PKEA 5KU1A 1PDWA 3FBTA 2H2DA 4Y2YA 4P0TA 3VKHA 4NENA 2ODNA 1GNQA 4BV3A 5A6VA 5LVAA 2YV1A 5HIIA 4IL5A 1BOOA 3HN7A 4Q9NA 1XDWA 4BGDA 3EF0A 3BE6A 3LGXA 4FUTA 4OH1A 4OXYA 5CLLA 2BGWA 1QUFA 2AR7A 2HM7A 4IO0A 4X60A 3TPZA 3V80A 3ZY4A 1EXVA 1SWVA 3FTCA 3HP7A 2IU3A 1MB3A 4RF4A 5ERXA 4KPUA 2NT4A 4BFZA 1VB5A 1JYEA 1PNOA 4URUR 2ZBFA 4UDXX 4K3VA 2GXUA 4DJJA 1QKIA 2VDJA 2YV3A 4JGGA 1T36B 4BNDA 2DETA 4BY9E 2CHEA 2RB4A 3BL8A 2HIMA 3CMMA 4IZ6A 4JJZA 1XAHA 2XE7A 3AERA 5IVIA 3LUPA 1NU6A 4QOEA 1KEUA 1ULTA 1NRWA 1R1DA 3JALA 4BO9A 1FMCA 4C04A 1B74A 1VHQA 1DC3A 5D5HA 4ZI3A 4QM6A 1ONBA 3TB6A 1Z5OA 5I7EA 3VDRA 2QS9A 1CW2B 1XD9A 4V03A 2EL7A 3ZHRA 1EJ0A 3RNLA 3MWDB 2IX3A 1EUCB 1U1FA 1CR1A 3RSGA 4XFJA 2B1IA 1A96A 1ZH2A 1A9XA 2CF6A 4RTRA 1WAMA 4RJJA 1IMJA 4EHJA 3OOEA 3DLHA 1JPUA 5GADl 4L2IA 4KHPB 2VUIB 2MSEB 4Y7DA 4J07A 1LDBA 3OEHA 4KCGA 4U9IS 3IUNA 3SQLA 2PRZA 1B0ZA 2ZIXA 5LB2A 4IVRA 3TFWA 1VCNA 5JCXA 2AJTA 1N6LA 1JKXA 2EP7A 1P2UA 3CIFA 3KUDA 5EYPB 3DA8A 5A02A 2QN2A 3CUWA 4B31A 3OLZA 2IOQA 2QZ4A 4IFEA 2YYAA 5K8IA 3F73A 1WOYA 2XNDD 4PSAA 3AR7A 2O52A 3TMAA 2COKA 2E0IA 3SHOA 5AUPB 2P9GA 3UJ8A 1G4AE 2PGXA 1Q0LA 5EWMA 3RYCB 5JSUA 2VRCA 2W4MA 3DG9A 1WVGA 3F6BX 5D1NA 1CE8B 2P27A 3E35A 4BKPA 2WJGA 4PRKA 3KYIB 5LKAA 2NTEA 1Z45A 1H2BA 5H4GA 2YN4A 4MVJP 3RVRA 2WRZA 4EPXA 1Y4AE 3AQIA 3PFBA 1CV2A 1U94A 5JJ5A 1U7DA 1E59A 2I71A 4QO7A 4XIJA 3WWZA 5EMHA 4DSOA 1UPUA 4AY5A 1WY7A 3KQNA 4A16A 3CPSA 2ONZA 1XZAA 3G85A 4ARIA 1I32A 2XWSA 3H75A 4BN0A 1F8UA 5M04A 1L4UA 4GHWA 4PC2A 3T1QA 5FRDA 2EGHA 1L1RA 2RHDA 2AOUA 3AFHA 2OM6A 1V4BA 1XKXA 4NOLA 4RD1A 4V02A 3DAYA 2QQFA 3NEYA 3W79A 2Z6QA 4MW4A 1R0YA 2BCJQ 1U1GA 3EEIA 2FN4A 2DR0A 4CNBA 2CHQA 4TS3A 4S1NA 1C1DA 2ZUVA 5FT9A 2W6IA 3TIXB 2VPZA 2JIZA 4LDNA 1E63A 2PPLA 3D6NB 4QOFA 8OHMA 2H2IA 3IAM1 1KOLA 3L3BA 3PU6A 4DA0A 3TAUA 3WWEA 1KMHA 3COWA 1T91A 1K6EA 2FW8A 1NI3A 4L02A 1HXHA 3T15A 3FOEC 1OCEA 2XTMA 3K9QO 3U7RA 3F9CA 4MIYA 3C39A 3HA3A 5CFRA 2ID4A 1Q0HA 2ZVPX 5CHYA 3EGDA 4UBNA 5D3MB 3A6LA 3U48A 4H7JA 3DHVA 1RP1A 3IQDB 1W581 3UB3A 3ID6C 1J21A 3MTIA 2O3SA 1O6BA 2JD0A 2OZKA 3WQBA 1NRJB 1FVOA 1T36A 2CUTA 1XZDA 2JEZA 3ORRA 5KTRA 3FTFA 4IIDA 2B1QA 4Z3KA 4GG1A 1CP2A 1ZU4A 3AGQA 3UJAA 1PS0A 3DC7A 2C2BA 3EMDA 3PDHA 3DKPA 3IOCA 4RVNA 4AJOA 1BWRA 4UCWA 3DFZA 2WNHA 4MV0A 1M72A 2L2QA 1T1JA 4Q1EA 2O5EA 3TXAA 3F8SA 1A2OA 2P6NA 3MWDA 1YI8A 3QEBZ 1ADGA 3DVSX 2HZ7A 3IURA 3JQQA 4G0MA 4IVPA 3CY6A 2FEMA 2WT4A 3E3AA 2FQQA 1KOJA 2JEOA 3I76A 1U5BB 2I62A 4NBUA 3RH0A 2ZKIA 3HGMA 5F7XA 1E79A 3PTLA 3EMKA 3GLKA 3K05A 4QFMA 5F1OA 4ZJZA 3O2SB 3N2ZB 4MR9B 5HCUA 3T7SA 3ZXYA 4ZRNA 3VYWA 1XTJA 3H05A 4NABA 3UMGA 3NTXA 3UWPA 4DM7A 3ANLA 2XUQA 5KWVA 2FPIA 9ABPA 1MRSA 2JH3A 4FT4A 4D80A 5DMXA 4ZDWA 2LIVA 3PQ2A 1E3JA 3X2SA 4WH0A 2BGKA 5E4JA 4GXNA 3OWOA 3S1SA 2V7VA 2JJ2A 3RABA 4CU2A 1JWLA 1M1YE 5CJ2A 1RMQA 5TLSA 2X2FA 2D8MA 4BGEA 3RYCA 1D2MA 4JLJA 4L5IA 1MB2A 5CH8A 5TC4A 4BNMA 5EJAA 1U3WA 1CE8A 4OHMA 1KY3A 5GAJA 1GN9A 4JYPA 5CM9C 2MYUA 3TTXA 1EX1A 3GN1A 3GUCA 5CLJA 2GMWA 2JASA 4NMXB 2R6DA 2XYHA 1SAYA 1F8GA 4XR9A 1N2SA 4M21A 2BGLA 3ADPA 2ID7A 2YWJA 4K05A 5EIOA 2JGJA 3K70C 1GTMA 2V6FA 3PX2A 4OL9A 1Q92A 3OIUA 3DEHA 5EIHA 5IM4A 2Q6TA 1V5IA 4BNVA 1YJCA 4W7IA 3Q1KA 1G5RA 5C7OO 2C7QA 1WU7A 4EKNB 2ID9A 2QLTA 4R6WA 5H83A 2NO4A 3DJFA 3ETCA 4J0GA 2JVKA 3TW6A 1VL5A 4JYZA 1P0CA 2RAUA 2WZCA 4EUFA 3DGFC 3RRNA 4OGGA 5KWJA 4B32A 3CSSA 1WB9A 1CDOA 1TL7C 1F7UA 4BBJA 4EBBA 1QHNA 2IP2A 4PQEA 3KR0A 4ZKEA 4KREA 2XMRA 1OLSB 1WV0A 3I61A 4YCDA 1J5PA 1CZNA 1CY0A 1L5QA 1YU6A 4IIEA 3M4YA 5DEOA 3VNSA 3AO0B 5FPPA 3EARA 4EARA 2NVUA 4A8PA 4IKPA 2GYVA 4DJ5X 2PG3A 2L19A 3G7NA 1KEEB 2ZREA 2ZRMA 2FUKA 1G66A 5D3MA 3NHAA 3C7AA 3E58A 3PENA 3KZ1E 4DFDA 1L5MA 1Z7GA 1C7JA 2AJLI 4LOJA 3RJMA 2OG2A 4V2IA 2H1LA 1DC6A 1OPXA 3LIIA 3H9CA 3UZUA 4MVJE 1CUVA 1USWA 4HTFA 2FRXA 2HRBA 1VCOA 1QH0A 4PQFA 4ACAA 1P1KA 3G23A 4RK7A 2IPAB 1EK0A 3Q40A 4MVJG 1GPAA 1KRHA 2LKCA 1RWNA 4P98A 3CWCA 4BLVA 5HIAA 2VXCA 2C2XA 4WRRA 1WEHA 3G8AA 2K6GA 2WWGA 3FMGA 3SCZA 4EZBA 3ULKA 1JUDA 2ZDGA 1MOPA 2WINI 1PEYA 4H3VA 3W90A 2DEUA 1G3QA 4HEA6 1E98A 4B8ZA 1Q6ZA 4LY0A 5JNVA 4F60A 3ND5A 3MUFA 4I08A 5AIAA 3Q88A 1TRKA 4JEHA 4RPKA 2G36A 1SU6A 4DDMA 4TLLB 3JARB 4MYUA 2H2AA 1DTWA 2L69A 1FLAA 4TV8B 3U7EB 2VOEA 3PNQA 1V3VA 3INYA 1TMGE 4DNXA 1Y8CA 1SELA 1XMXA 4FKMA 4MR9A 4MWSA 2PSSA 1UT8A 4J9VA 4Q7LA 1NBWB 3NETA 3WIEA 2CXOA 4ZVUA 4EL0A 4QDOA 3ESXA 2FK8A 3NUGA 2VRWA 4DNQA 2NU7B 1A7JA 1GTVA 1MG0A 2JJ1A 5B3JA 4ETMA 2HHHB 2NP6A 4CF3A 3RI3A 1O2DA 2W9XA 4HWPA 2XW6A 2XLBA 1Y82A 5CVUA 2L42A 1CUJA 1JAXA 2HWYA 4PWZA 3SF0A 4OJNA 1Z0DA 4HNVA 4GNRA 4Q4JA 3R8CA 2IEBA 2FWJA 1MAAA 3UBMA 1SA0B 4EJ0A 4MPRA 4MRAA 4TT8A 1M6EX 3F9IA 4FZVA 3SK0A 2ZBPA 1G3RA 1LVGA 4I8XA 5BYJA 2D8AA 2CVHA 3FVVA 3EFHA 4JGBA 3SOZA 4LGCA 4LUCA 1N8SA 1EQUA 1S2LA 1XZKA 4IMRA 5GZ1A 3Q12A 4B3JA 2VO1A 2WLTA 3U80A 3IKJA 4KLAA 4W5TA 3W06A 3OZIA 2BMAA 3PHHA 1KQFA 1Z34A 4GBED 1URPA 2ZIZA 5KX5A 1I3NA 4DREA 3QX7A 4G81A 1F2DA 1Q95A 5C5EA 4E03A 4H35A 2QM3A 4P35A 1GGKA 1B8OA 5K6TA 1EVZA 1ZNWA 1SJ9A 3QI7A 4G26A 5CB0A 3GEIA 4RVGA 2YV4A 2NU8A 2H5LA 2J7KA 2ZR8A 4M99A 2DT5A 3B6ZA 1J0DA 5L4NA 4QRDA 1DAEA 4W8OA 1LV7A 2VK4A 3R4CA 4RMIA 5H3LA 3V6LA 3VZBA 1GAXA 1NQXA 4R83A 4B2IA 1QRTA 4ZYWA 4BX3A 3ODGA 3DOCA 2I55A 3P45A 4MWBA 2R44A 1MNQA 2XODA 5FLXA 1ADFA 1ZCZA 4IS3A 1RHJA 3L9WA 3JS5A 4DA9A 4S04A 3H86A 2J9XB 1RAIA 3NHSA 1QO0D 2WYOA 5ITZA 3NT5A 1KEEA 2QP3A 5FWNA 3GJ0A 3A6JA 3QEJA 3QG5A 1MUUA 4OEHA 1H0KA 4FYMA 3H2JA 3R7NA 4G3XA 2FHPA 3QPUA 1QR2A 2QB5A 4X44A 1P17A 1ULHA 2CHVA 1SVUA 1GGFA 3GB9A 4DIFA 2JGFA 4EM6A 3FWYA 3K53A 3PJFA 1GDHA 4YQEA 3ROPA 1J06A 4KO4S 4BV9A 3ONFA 3WGOA 4CE6A 4QBTA 5HM6A 3PBKA 3WLFA 4EK9A 2HO5A 3G8BA 1KZGB 1XN1A 3BIOA 1C2YA 3G5UA 4ROTA 5BMVB 5I5GA 3ZZNA 1F14A 4TXMA 2ACWA 3SLKA 5K0GA 2R66A 1Q74A 4NS4A 2EU8A 3A32A 2WBLC 2XYPA 3PC3A 1NY5A 3QEMB 1VLQA 5EGNA 4CMHA 1W34A 3T3OA 1FPMA 3LC7O 1QGDA 4FX2A 1BU5A 5D00A 2UYQA 4YMSA 4OL0A 2IY8A 1YUBA 4H4DA 5EUQB 1QOZA 5I51A 3JARA 3KE9A 3B89A 2BEKA 4FDAA 4TV8A 2GCNA 3MMSA 1UDBA 4FWBA 4NCNA 1Q2UA 3WIBA 1JIJA 1RCFA 3SEFA 5IZCA 4IG4A 3VVCA 3K0KA 4N3AA 1J09A 1LGYA 2WTMA 1H23A 1V8FA 1WZCA 5B37A 1RYDA 1O54A 1UZLA 1DEXA 4NCAA 2WIJA 3EVEA 1B1AA 2Z5LA 4GC5A 2WE8A 5DN9A 1WG8A 2E4YA 4I3FA 2CB0A 3ENVA 4RAQA 2A9RA 2ZI6A 3EVZA 4XGQA 1UT6A 1XTZA 4UBMA 3U2QA 1NN1A 1XF9A 3NGLA 2C7PA 2XCSB 2QL7A 2ZT7A 2M98A 1PN3A 2XUOA 4AUMA 2BR3A 2R00A 4AS1A 4PINA 4WD3A 4K0KB 4PFKA 1PT5A 3GFBA 3QMPA 2UUAB 4POAA 2O8VA 2ZE5A 2W6PA 4MHOA 2RK6A 2O23A 2JIQA 4FQ7A 5TMPA 4U8HA 2FZEA 3ZWOA 4TYPA 3CF4G 2HK6A 1NLUA 4PV7A 3SR3A 5L6LB 1CRWG 4DLSA 4M7WA 3VR5D 4FJ1A 4I50F 3WAJA 3K70D 3N2YA 3UHPA 2OG1A 4H6VA 1UXIA 4J1SA 1A27A 3JPYA 2GHIA 4JELA 1JBEA 1KI6B 4D8UA 3RV4A 4LSZA 3PNPA 2CV1A 1KJWA 3BD6A 2IUTA 1I9CA 3B1FA 4LECA 3TLGA 2OXTA 1E2HA 5JFOA 1Z6YA 2NZUG 1KAEA 3EWIA 5BOSA 5K4GA 1KRXA 2FI1A 3EBPA 5HR5A 4E4RA 1DQZA 3SJBA 3WA6A 3W3AA 3EMBA 4PZZA 2ZYUX 1TQHA 3HYNA 2G77B 4IKEA 4IXMA 2DG2A 3ZW8A 5JAOA 1IMOA 5LWQA 2DBVO 1C7ZA 3FVRA 4OLJA 4BNYA 4R9UC 3G1TA 1K7SN 1W5FA 3F9RA 3KUXA 1NPTO 1W4ZA 3DM9B 2C4TA 3KCQA 4P6VF 3TLAA 3OEYA 2WTNA 3PA8A 4X3CA 4NG5A 1J2TA 1LPOA 1PJCA 2AFIB 1FU8A 3DQQA 1RM5A 4RHFA 2HRZA 2ILVA 3SZLA 1RWPA 4ARCA 2B1JA 2P67A 4YROA 1MJGA 4N41A 3OZWA 3L0OA 4KWHA 3LTNC 4RSGA 2A1TR 4HUJA 2X0EA 4Z53A 1U65A 4J0FA 1WTAA 3IP5A 4ZK6A 2JG3A 2PXHA 1JPNA 3EGXB 2Z56A 4RVDA 4UHEA 2RHWA 2X5KO 3NORA 3WDMA 3IEIA 2ODQA 1OA1A 1WXHA 3MPOA 1L7RA 1TC2A 1JILA 5BMVA 3PYMA 4MQ5A 1T9ZA 5E4YA 1TIKA 1Q7RA 3N5KA 5AM0A 5EJGA 5I8ZA 3DAGA 3UOAB 5K8JB 4K7JA 3PV0A 4MJ3A 3ZDAA 1DAOA 4IJ6A 5KPJA 3SKVA 4YT5A 2WWVD 2QJTA 1JR3E 1DCKA 1CQPA 1XGKA 3Q4GA 2NNWB 4MUJA 4D81A 1ZMXA 3KEMA 5B3JC 1ORHA 3WAKA 3JX9A 2QTFA 4FVTA 4LZWA 2BFCA 4D6YA 4F4UA 4MR8B 1V39A 3T06B 1A9RA 4O33A 3PTZA 4BO4A 3HUEA 4AJ9A 4FNMA 1MJ5A 2Q29A 1DJMA 3AY6A 5DV9A 1WL8A 2XNJA 1FDIA 1BOFA 4GLFA 4NZOA 2JFZA 2PNJA 3WZ2A 4BLSA 1PZNA 3I9JA 4J0IA 4RCZA 1VCIA 2QN6A 3QVJA 3ILHA 1RPJA 3RS5A 1THTA 1LNSA 4I4LA 4QU0A 5AKKA 4XKJA 4NV3A 1OWMA 5THQA 3PE6A 3KWJA 4HBZA 3T38A 3WWOA 1OI2A 5LP6C 4MKFA 1ZKMA 1MO2A 2YOHA 3Q15C 3GEMA 4TKVB 4XLLA 4A6XA 2FZWA 4JQSA 3WYAA 4UTOA 1NQWA 4L5CA 1OSNA 2XWQA 4O8ZA 4UEJA 4FINA 5IJ0A 2LNDA 4L9AA 2X0FA 3S2IA 5KVQA 3DEJA 3H5AA 1BN6A 5BV0A 1TKBA 3KHTA 3PJDA 1ZN9A 1M73E 3PI7A 2NAPA 1Q1NA 4WFQA 4YI3A 1FRNA 2WVAA 2P4UA 1V45E 3DLPX 3HFJA 3ZZUA 3TM4A 1UXGA 2IPOA 3W2IA 4IHJF 2ASEA 3BK1A 2P0EA 3QE9Y 4MAAA 1L0BA 3ZV4A 1M8KA 4MV8A 4D4GA 2J3QA 4BGVA 1JIQA 4OYLA 2GPNA 2W6ID 3DEZA 3EYWA 3WXMA 2JIZD 5DHUA 4P82A 4BE9A 1KO7A 1UBSB 1CRPA 1Z0UA 4IRUB 4PLFA 2O20A 3OIGA 1Y3BE 5I4CA 3S7ZA 3MNFA 4PZYA 3SN6A 1C1YA 2OV2A 1MVLA 3F6CA 2CLHB 2G1JA 4JDPA 1QRAA 3BD7A 2ZIEA 5EN4A 5CIYA 4AJKA 3CZMA 3PQCA 5DHAA 1JEJA 1VBKA 4Q39A 4RD3A 1ARZA 3I5MA 3VZPA 1P2GA 2NO5A 2I65A 3KT3A 4ECAA 5FWXB 1XROA 3JV7A 1DWOA 2D5CA 3TE7A 3WP1B 1O96B 1KGSA 1OI7A 2HGSA 2JFFA 4IV0A 2QX6A 1JSXA 1EG7A 1QB7A 2I2WA 1EJBA 3OZGA 4Y9RA 3WL4A 2NUPB 1NXVA 4L8GA 5A4KA 4A36A 1PT9A 4RTKA 3JZFA 2GXQA 4AX8A 3U7GA 4LYGA 3ZV7A 5AKHA 2AFIA 1WW8A 1RMTA 2WKSA 1AA9A 4Y1RB 3SFVA 4QEKA 5EXDA 4BLRA 2VHQA 5I9LA 1LXCA 2P1ZA 4Q9AA 1KETA 4OK3A 4X7BA 4UXHA 2O4CA 1S01A 4RM3A 4R8SA 1TAQA 4ZOAA 5FO0A 3IJRA 1VM6A 3E4CA 6LDHA 5JCJD 4YHHB 1U3DA 2GKSA 2ZAYA 3NWEA 1ZI9A 2J3EA 2OD2A 1UJNA 2PBZA 2UVPB 4A0QA 2Z6AA 4R1UA 1SQ6A 4JLMA 4O2LA 2PN1A 3MUEA 4GE3A 4XTCS 3TYXA 3UJPA 2IH2A 1O8CA 3LFHA 4OQFA 2WTUA 4TQUS 3FRJA 3TX6A 3FDZA 3PE3A 3VSDA 1E79D 2OFOA 4NARA 3LDUA 4DMLA 2FEOA 1ICIA 5JYCA 1GUZA 5CNKA 1BKYA 1YZLA 2EKPA 2GRUA 3CLRC 2WSBA 3SIWA 3MLEA 1A4UA 1GWNA 4RIHA 5L7YA 1GTSA 3KYBA 1X7WB 4RNCA 2ANCA 5HIMA 4KR2A 1E2PA 2WQZA 4BNWA 1UAGA 2V0GA 1CXZA 3LNTA 5EUMA 3RJ9A 4RDCA 3KTAB 2R00C 4Q7EA 2KWIA 2CDNA 3MWFA 2I1VB 1PGQA 1SB9A 1ZN7A 2I03A 2VHVA 3NC4A 3ZE1B 5EJ8A 4BFCA 3C3KA 3WGIA 5E7JA 3HTXA 1ZNQO 1A8PA 2E37A 1EFHA 3LUAA 1F4LA 4JSTA 1XBTA 4TKVA 2Q4RA 2VHXA 2WP8J 4YUAA 2BWJA 3TF5A 1COZA 1YFKA 2HOQA 4PBRA 3ROEA 4LI3X 5I7UA 4Q1FA 2R1UA 1FP4B 3OSZA 4ZHSA 1KXZA 4HNHA 4KTVE 1NXSA 1MB0A 2QL5A 1E9SA 4KIUA 1VE1A 4O4JF 1L8XA 1IZZA 1PL8A 1TTQB 2JD1A 4PG8A 1BWPA 1QO7A 1Z2OX 1UDAA 1J9ZA 3FBWA 3BXOA 2IQ5A 5CGZA 4ZVTA 3PGVA 1LA2A 1EGAA 2ZTLA 4KQHA 4C0JA 4EIWA 4HDQB 5IPFA 1U8ZA 1AKYA 2PR2A 1L7PA 2BBWA 1ORDA 3FMVA 2CYAA 1E2UA 2PL1A 2P91A 3BBLA 4M0KA 4KQWA 4N03A 2ZJ3A 1F2TB 1U1EA 3OOHA 2Q3MA 2V65A 4HDKA 2XOXA 2JZCA 5J59A 1P39A 5FBZA 5TNXA 4E5YA 2JK1A 3N8NA 1ZHFA 4DZRA 3CGGA 1B73A 1DQSA 3IIIA 4EOGA 5C80A 6NULA 5LQAA 2I87A 3OPNA 3O93A 4CT0A 4R9VA 3D3EA 2LVBA 2I2CA 5B5SA 3HJFA 1H2ZA 1JAHA 1TNDA 4NPAA 4ZXPA 1JQ3A 1HRKA 1ESCA 4G1EB 5FWXA 3RHFA 3LF2A 1RR6A 1TF2A 2YC2C 2D1TA 3LRTA 3M1AA 1M5UA 5A3QA 4PVCA 3IVGA 2JHCA 2MDTA 2Q3BA 2NUPA 1J9GA 1ST2A 1KYTA 3AZPA 3LT4A 2RCNA 4JI4B 1GFIA 4PZCA 5EINA 4OSEA 3K2IA 1QK4A 3FHCB 4Q9HA 3RW9A 1IN6A 1VLJA 4FLMA 4ZGBA 2YXNA 2C2WA 1P0MA 3QE3A 1SOUA 2XZOA 2GNOA 3GAMA 1JG6A 2FPSA 5MGBA 3IUPA 1P1CA 4HH4A 4BUCA 2ZU6A 2C61A 4H2DA 3K1ZA 4AK9A 2UVPA 4MEAA 4KE7A 4GDMA 3U62A 4DQDA 3CKLA 5FI1B 3O9MA 1ODKA 3HLTA 2FDCA 5E7QA 3G7SA 4EBFA 3WGLA 3C6ZA 5HBGA 1N5JA 3LP5A 4OGLA 1DJPA 2XECA 4LOLA 3UOWA 3WQQA 4IIJF 3PUIA 3UATA 2QTCA 4R3WA 4AJPA 1WPGA 2HSJA 4NH4A 5KYXB 3K6KA 1L5OA 1N6KA 2JJ1D 4ZANA 4D96A 1NR1A 1NXPA 4JSRA 2G72A 3ZBTA 2QBYB 4ZQGA 3KTAA 5JWRA 2NSHA 5HK8A 1KFCB 2YWBA 3JCZA 4XUCA 2AUTA 3A04A 3IAS1 3V2UA 2I29A 3C4VA 3G0BA 3HEMA 3MJ4A 4TXLA 4M0CA 4YO7A 2SKDA 5BN3B 1Z0SA 2QMHA 5DSZA 5MN6A 3IP3A 4YXWD 2VTBB 4OI0A 1D0VA 1PT8A 4B40A 5DNAA 2BSXA 2YVKA 3REFA 4HB3A 4NWIA 1EFKA 2FZ5A 4IIUA 2H9AA 4RS3A 5I4KA 2LW7A 1Y5MA 3O4RA 1FP4A 4LJYA 2I7XA 3JQBA 4QPDA 4U4AA 3BGSA 1SUIA 1NE7A 1U7WA 3RARA 5IEBA 4JLBA 4KMRA 3TPFA 2MR5A 3T1HB 3BL5A 5JSKA 3C6BA 2VXYA 3DBHB 1INLA 3WWYA 2PUGA 4B3TB 1YR3A 4WLOA 3HXMA 5FTWA 3B5EA 2QRHA 4HZIA 1YQXA 2ZJ2A 3U9TA 3HDQA 2X42A 4NMMA 1V4VA 5KNDD 1JKIA 1AF4A 3M70A 2OCGA 3NAGA 4N5MA 1R64A 4CEHB 2P6MA 1F2TA 3KP1A 4D43A 4MDFA 2A0YA 2LZ0A 2CFSA 2VHYA 3AR4A 1I36A 2BAGA 4RF2A 5DN6A