3SC4A

Crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
280
structure length
280
Chain Sequence
SLRGKTMFISGGSRGIGLAIAKRVAADGANVALVAKSAEPHPKLPGTIYTAAKEIEEAGGQALPIVGDIRDGDAVAAAVAKTVEQFGGIDICVNNASAINLGSIEEVPLKRFDLMNGIQVRGTYAVSQSCIPHMKGRDNPHILTLSPPIRLEPKWLRPTPYMMAKYGMTLCALGIAEELRDAGIASNTLWPRTTVATAAVQNLLGGDEAMARSRKPEVYADAAYVVLNKPSSYTGNTLLCEDVLLESGVTDLSVYDCVPGSELGVDLWVDSPNPPGYTGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Short chain dehydrogenase (A0QTM2 homolog) Mycobacterium thermoresistibile
rcsb
source organism Mycobacterium thermoresistibile
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase (A0QTM2 homolog)
total genus 93
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc4A00
5JY6A 2AMFA 4Z6KA 4OQYA 1B26A 3DZJA 4MOWA 1PJ2A 2NUAA 4FC6A 4B3HA 5JNLA 3L6EA 3QHAA 3JQDA 4GI2A 5C7LO 2VTEA 2XF8A 3OQ1A 3U62A 4BNVA 2DFVA 1Q7GA 2X5OA 1UDCA 3R0IA 4PLTA 5GY7A 3QIVA 2D3TA 2OXIA 1ONOA 4CLEA 1Y9AA 2NVBA 2A94A 3WFIA 3ZV4A 5A3JA 5AOVA 4M89A 4R5MA 4DBZA 3JQBA 5JAQA 1HDYA 3L4BA 2ZK7A 1UH5A 3HB4X 3D5TA 2C5AA 4Y8VA 1GR0A 3DBHA 1N9GA 4YWJA 1R0SA 4XA8A 1HDXA 3BHMA 2YV2A 3JYNA 1S6YA 3JQ9C 4ZD6A 3DOOA 3IL2A 4NBUA 1T2CA 4W4TA 1T2FA 1W6UA 4XKJA 2PGLA 1YB1A 3WB9A 3QJ5A 2JCXA 3AJRA 2Y1FA 4IIVA 4EUFA 2R00A 2XXJA 5I8WA 2NTJA 1E7MA 2AEMA 1JQBA 3AY6A 3TZ6A 2Q45A 4ALIA 1YOVA 4QFDA 1I01A 2OBNA 1KETA 4CMIA 1E7WA 4JQCA 4JBHA 4W7IA 1N9GB 3MJSA 4B4OA 3ASVA 3DZHA 5KTKA 4C4OA 4CUJA 1B3RA 3B1FA 3AI1A 3I23A 3ZU4A 1NVTA 3GVXA 3QW2A 4URFA 4BB5A 1E7QA 1WNTA 3CZMA 2VRCD 3QWIA 1ZCJA 3SX2A 1PQUA 2E48A 2Q4BA 5KKAA 3VZPA 3I5MA 3K8ZA 5AXAA 1E1MA 3LDHA 2HMTA 4KQXA 4A0SA 4R3WA 5JMWA 5I8ZA 4ZICA 1YE3A 4CMBA 1B3BA 5G2OA 1NASA 4AG3A 5DOZA 3FPCA 2XXBA 1YVEI 2OL4A 3MJ4A 3ZHXA 3ETDA 5G0VA 4W99A 2RHCA 1MC4A 4PN3A 3GC6A 1VKOA 3HZZA 2VT3A 4J7XA 3NKLA 4D0RA 1IZ0A 3I83A 5EQFA 3JQFC 3UGKA 1BSVA 1U1IA 1P3DA 4CMAA 1B14A 2O3QA 4IXWA 1PS8A 1SB8A 2YQ5A 5ENDA 1R0LA 2OZPA 5KOIA 1JTVA 1FDWA 3I1JA 4FSHA 2NACA 1C1XB 4QO8A 3GMDA 4F46A 3FBGA 4QXMA 2FSVA 4UEOA 4DYDA 3QA9A 3RIHA 3S2EA 4OXNA 3UCXA 1UDBA 1BDBA 2ZYAA 3B1JA 4XYLA 3K73O 1JVBA 5ITVA 3QVOA 3K5PA 1O94A 1A4IA 4BO2A 3I4CA 1U9JA 1L7DA 2VWGA 4BO5A 3HUDA 1Z74A 5IDYA 1CERA 1OI7A 3PFWO 3VVCA 4BOYA 2FHSA 3ROMA 1KY4A 2I3GA 5FI5A 3GFGA 3JQ6A 1ZW1A 3NT2A 4NDNE 3ZWVA 4ROSA 2EJWA 4II3A 3JYLA 1GDHA 1KVRA 4DRYA 3JYPA 3LC2O 3WDSA 1ZSNA 2A92A 1MG0A 2DC1A 2DFDA 3EK2A 3BMNA 5DF1A 2EGGA 2V65A 3RUIA 1PJ3A 1VLLA 1DDOA 1HE4A 1HYEA 3ZHZA 3H6KA 1YXMA 3E48A 1PWZA 3KRTA 2TMGA 3CUKA 2W90A 5HA5A 2ZTLA 5T8KC 4S3MA 1PWXA 5EESA 1MC5A 3NAQA 2WJPA 2AQIA 1UUFA 3PJGA 1DRVA 1E1KA 3ITKA 1E3LA 4YJFB 1KVTA 2FPIA 1M75A 4J0EA 1YB4A 2VWHA 3JD1A 3QVXA 4TKMA 4FW8A 1E0DA 4DC0A 1PQPA 5HTOA 4U0JA 2H9IA 3P5SA 3QY9A 1C0KA 2BELA 3DAGA 1WMBA 4JJGA 3HDHA 1GQYA 1JKFA 4TMFA 3O8QA 4YJGB 4BO4A 3KYDB 4AJEA 3AU9A 3NDRA 3V1TC 3H5NA 3GZNB 4D3FA 5I7FA 4O63O 3KBOA 5A04A 1SEPA 1PEDA 3JYQA 3DMTA 4IJKA 3RI3A 1QXSA 3AM4A 3GAZA 1GAEO 3OHSX 4GX5A 1GTMA 2A35A 5F3RA 2WM3A 3C1TA 1H6BA 3JQEA 2BGLA 2JHFA 3W4KA 1DPGA 4O5OA 4RF2A 4K28A 4U6QA 1ZKMA 3PVZA 4W6ZA 1SCUA 4KMSA 5ILGA 1HE2A 4R1SA 1QYXA 4XX0A 2VUUA 1VSUA 1WWKA 4AJ2A 3QP9A 1F8FA 2VTDA 5FYDA 1FMCA 2ZYGA 4E3ZA 1G0NA 4GMFA 3ZH2A 3WGHA 4CM9D 1U8XX 4G2NA 1W8DA 1BXGA 3WX0A 2BKAA 1WZEA 2EKQA 3DHYA 1E5QA 3GLQA 4KWHA 5G0TA 4TVOA 5CFZA 5IXYA 1AGNA 4ZN6A 1PL7A 2P4QA 3GR6A 3LF2A 1JVSA 3JD4A 4RQTA 4Z9FA 5IZCA 3OJEA 4OKIA 2Y1DA 1LDEA 2G76A 3VH2A 4E2YA 5FF9A 2OO5A 4WK6A 1GPJA 5JDIA 3PHIA 2GNAA 2FY8A 4MPDA 3ZWBA 4BNIA 1KERA 4FJ1A 3V8BA 1GUFA 4BVAA 2GLXA 4BNYA 3Q9UA 4E5NA 4DQVA 2DBVO 4HKTA 2BGKA 2QYSA 3D0OA 3ONFA 3VZSA 3JV7A 2PZKA 3ZWXA 3FNEA 3COSA 4YJHB 4O0LA 2IEDA 1YBMA 3PHJA 4RF4A 5HBRA 4QT0A 3EHEA 2EERA 2BI8A 1U4SA 3F5QA 2AA3A 5T64A 1LQTA 4B8WA 4W9NC 5IDXA 3MJVA 4RLHA 2Q99A 5H81A 3WLEA 1V6AA 3ICCA 4MVJI 1R12A 3R1IA 2P91A 3EYWA 2Z95A 1P77A 3RCBA 3WNQA 3A28A 2FMUA 2PR2A 3HQ4O 4QX6A 4Q3CA 4WUVA 5A9SA 3RUAA 4U5QA 3AY3A 2XOXA 3L07A 1X13A 1BXZA 3K96A 1LSJA 2ZCUA 1H0KA 1V9LA 4CUZA 4J1SA 3VH1A 3GHHA 4RPJA 2BFMA 1WVGA 2GZ2A 4YAGA 4ZQHA 3GGOA 1NHGA 3S8MA 3UH1A 5JMPA 1E3SA 1LLQA 4A26A 5U9CA 1PR3A 3KVOA 2Y99A 4BKOA 4CV1A 1EEHA 3NDJA 3OIGA 5CPBA 1HL3A 3M2PA 3TNLA 4B79A 1Q2XA 2V6MA 3F9IA 2NTVA 4ZU3A 4HP8A 2ZCVA 2QZ9A 5I7EA 4CLRA 5ICMA 5L45A 3WGYA 1M66A 2W2KA 1W73A 1SB9A 4HFNA 4XRRA 1BVUA 4GX1A 3ZWNA 8LDHA 2HU2A 1VM6A 5T57A 2CVQA 2EP5A 3IUPA 4CMCA 2DTEA 1X7DA 4ND4A 5IZ4A 3G3EA 4BHTA 1MP0A 4L74A 4E2ZA 2VN8A 3U4DA 3E1KA 1UP7A 2EJVA 4WOKA 4PG8A 3V5NA 1DO8A 2QIOA 2CF6A 3PQFA 4YBZA 1OOEA 4FFMA 5L7WA 1TA4A 3WR5A 4CM8A 4GSKA 4K26A 4R16A 3PJDA 3JD2A 4GWGA 2J8ZA 2B83A 1FDSA 3TZKA 9LDTA 2P9EA 4RO0A 1DIGA 3KV3O 4OYRA 4RVUA 5G4KA 4BNGA 3GAFA 4FN4A 2DBQA 1HDOA 1ZK2A 2VWQA 2YZ7A 1NQ5A 1DC4A 1PJLA 1VSVA 3ANNA 3NUGA 2EG9A 3AFNA 3NTRA 2P2SA 2C07A 1SPXA 4HX5A 2CMDA 2QZZA 1Y6JA 2WEKA 4XD2A 5HM8A 3BA1A 3F1LA 2AQ8A 5KJ1A 1ARZA 4EEXA 4WASA 4B8ZA 4MP6A 5CDTA 6ADHA 1I0ZA 3WSWA 2VZ8A 2HDHA 1KY5A 2G1UA 4U0KA 3WWZA 1T2DA 4ND2A 3GN2A 2NVUB 4YPOA 2DBZA 2GCGA 2Y0DA 2RH8A 3DOCA 1XGKA 1LSSA 4YQZA 3VPGA 4PCVA 1ONNA 3FR7A 1DHTA 1RM5A 4XJSA 3VKVA 1ZK1A 3VHRA 2J3HA 4Q3DA 5KVSA 4YAJA 1LDGA 3LLVA 5L3ZA 1G1AA 4XQGA 2X5JO 2CDBA 4WE3A 2J3JA 4WEQA 1T2AA 2OBYA 4M54A 1QSGA 1NBOA 5TJ9A 4B4WA 1OC2A 3JTMA 2O23A 1LDMA 2BFOA 1ZSYA 3NRCA 4YJDA 3VVBA 3BTVA 3CXRA 4FGWA 4FR5A 3S2FA 3DZBA 3H5RA 4DMLA 1RM4A 5IJZA 4K6CA 4DIFA 1FDVA 4D3DA 3PWZA 1N1GA 4XGNA 4E6PA 3DBRB 4ALMA 5JDIC 3RJ9A 4NJMB 3DZIA 4FFOA 1XR3A 3D4NA 4BNHA 4KZPA 3SLKA 1JAXA 4CR7A 2NU7A 1I24A 5L51A 4HFRA 1YDWA 4XQEA 2GASA 2P5YA 5DOVA 1IHXA 1NR1A 1X1EA 4EJ0A 5L9AA 4DTIA 2O48X 4I5GA 4WKGA 5JSFA 4GKBA 3O38A 1A4UA 1DHRA 4WLVA 5KVQA 2ZTMA 3S55A 1PGJA 3ETEA 3PJFA 1F0YA 3DONA 2PZLA 4IY1A 4OL9A 4DLLA 3PWSA 1SMKA 1W0CA 4AJOA 4KUGA 3FNGA 3MTGA 1B15A 4BGUA 3VKUA 4LMRA 1UXIA 1XWFA 2V6FA 2Q50A 5GZ1A 3I9OA 5LC1A 1NHWA 2ZTUA 1F17A 1DOHA 1LBEA 4R1NA 4BUCA 1PS0A 3KYCA 3VH3A 3TOZA 1PIWA 5AYVA 2Y1OA 4NI5A 4D0SA 3ZGYA 4PRLA 3C24A 1P74A 2GN8A 2WTBA 1E6EA 1TT5B 5F5NA 4J9UE 3CEAA 3SC6A 3L77A 1HZJA 5AVOA 5ICSA 2UVDA 1GCUA 3ASUA 2I65A 3BIOA 2NLOA 5J23A 4UEKA 3TJRA 4UREA 1IPFA 3H3JA 4CL8A 1I3KA 3V1UA 3EC7A 4YEDA 3FWNA 4PFJA 3RBVA 3ROKA 4CM5A 2I76A 2J5KA 2JAPA 5COBA 5JC1A 2IODA 5L4NA 1F8GA 2FP4A 3L4SO 2GDZA 4YT8A 3G49A 3QWFA 4YB8A 5IDQA 1EK5A 1XSEA 5IF3A 2YFHA 2VT2A 2HK7A 3WGOA 4DLBA 4OKNA 1ZFNA 5G4LA 3ZWWA 4OSPA 5A02A 5BQFA 2NVWA 3VH4A 4Y9DA 2H5LA 1DC3A 4BL5A 1K0UA 5EMHA 4QO7A 3W4JA 2VHYA 2OGUA 4JBGA 4N7RA 5IN5A 3GNSA 3WFJA 3P2OA 3FTPA 1ISMA 3ZU3A 4XJTA 3TSCA 1Q1NA 2EKLA 2PFGA 3WNVA 2ET6A 4KDEA 4O59O 3WWYA 1IZ9A 1H6AA 3EMKA 1KVSA 2EHDA 5TSDA 3T7EA 1KVUA 3G1TA 5G0UA 2JHGA 1E7YA 4Y6SA 1SBYA 2HK8A 4P22A 5GMOA 2VRCA 1HF3A 3BYZA 4WLOA 4MVJP 1K6XA 2Y0CA 4EDFA 3JQBC 2CVOA 1VJTA 1P33A 2ZB8A 1O0SA 2NU6A 3GG2A 2CY0A 1N7HA 1KEUA 4YJGA 1NNUA 4ESOA 1DIHA 1NXQA 4J7CA 4TRNA 5CEFA 1P9LA 4FJ2A 3Q0EA 2QG4A 2WWRA 3VPXA 1ZXBA 1P1JA 4NR0A 3ZNOA 3O26A 3D3WA 4TKLA 3PHGA 2X23A 4TQGA 1YRLA 1YH3A 2HK9A 4I8XA 4Y67A 4GGPA 2WDZA 4IGFA 4PZCA 3RU7A 1XU7A 4DLAA 4LW8A 4CM6A 4YAKA 5IFLA 1CWUA 4CM9A 4ALLA 2Z5LA 2B5WA 5ENVA 5H83A 1ULUA 1HZZA 3GVPA 1GZ6A 4WNIA 4LK3A 2Y93A 5I9MA 1B16A 5JCJD 5A1TA 5KJFA 5T6BA 2GSDA 3ANMA 4MP8A 5TNXA 1F14A 2BF7A 4CMGA 4WJZA 1Z73A 3PGJA 3D4PA 5JO9A 4BNLA 3NT4A 3UN1A 5EQDA 1DC5A 1I30A 3HHPA 4TZKA 4YJHA 2C29D 3TL2A 5IG2A 5DCYA 3D5QA 4UVIA 5CG1A 5F1OA 1GZ3A 1R4NB 1HTBA 3QV1A 3GEMA 3WGGA 3HSKA 5CPFA 3PK0A 5KVVA 1GFSA 5CAEA 1GQ2A 2PK3A 3EW7A 4YDRA 1M67A 4L0QA 1B2LA 4QEDA 1XG5A 4NK4A 3OETA 5HWSA 5CEJA 5F21A 1V0JA 1LRJA 2EP7A 4OM8A 1N1EA 2GN9A 3HDYA 4RVFA 3M1AA 4BO9A 1P1IA 3SC4A 1LC3A 3ZW9A 1LRLA 1RPNA 1JWAB 4WCFB 1DIRA 1ISFA 2NM0A 5G4KB 4BNKA 2X0JA 2ZB4A 4MIYA 4NBWA 4P4GA 3ADPA 2PV7A 4OOEA 4J43A 3CE6A 4IBOA 3GY0A 2OUIA 1IUKA 3C7DB 1MXFA 2VRBA 2GR9A 3W6ZA 1UZLA 5EL0A 3IP3A 2O3TA 4CUKA 5B4UA 1YQXA 1W4ZA 3UCEA 2HKIA 4M86A 4K9DA 4Y6PA 3ZHBA 2W8ZA 4JXKA 5JBIA 2D5CA 2RH4A 2X7HA 4IS3A 3DFUA 1DXYA 3PGXA 1YJ8A 4Q3BA 4CQMB 4EUHA 4MVJH 2Q2WA 4DYVA 1VL8A 2NWQA 1JA9A 3GNQA 1MFPA 3PWKA 4AL4A 3OQBA 3V2UA 1ZIDA 1NP3A 4MJLA 2Y05A 5COQA 2W2LA 2D5AA 3FSRA 4PVCA 2UAGA 4MIEA 8ADHA 3OMLA 1WDKA 3DHEA 4OO3A 5CP8A 3CMMA 4R9SA 5TQVA 2Z1NA 3OIFA 1SZJG 4PLYA 4ILKA 4RORA 4KUHA 3HFGA 1EDZA 4UUNA 1CEQA 2JKVA 3DBRA 4MVJF 1YBVA 4TSKA 1U5CA 4ALJA 4BKQA 4I08A 2HJSA 1GEEA 9LDBA 4R41A 4YQYA 1PJQA 2VHWA 4D41A 1TLTA 1DFIA 1PJSA 3ONDA 1VI2A 3DDNA 4O1MA 1WDMA 2NTNA 5IXSA 2B4RO 3LT1A 4CV3A 4YACA 3UAGA 1YQDA 1ADGA 1I32A 1BG6A 1PJBA 1TVEA 4J6FA 2HO5A 4OIMA 1BRMA 3AOEA 2DVMA 1EBUA 1XQ6A 2DUWA 1DFHA 3DZGA 1QR6A 3RBZA 6LDHA 3WLFA 1J0XO 4R54A 4I5DA 1SC6A 4ZQEA 4BKUA 3LT4A 1I3LA 3OSUA 3JQAD 1B8UA 2JFHA 1JU9A 3RUCA 4CR8A 5JAIA 3D3WB 3MWDB 3CZRA 3INRA 4PLZA 3UOGA 1MA0A 2Q1TA 4UVHA 2WYUA 1H2HA 3GUCA 5DP1A 2HUNA 1QYCA 3R3JA 3ZWYA 1OC4A 3OECA 3EZLA 4FOOA 5LDGA 4BNXA 4HFJA 2PH3A 1U3TA 3AOEC 2IZ1A 3A14A 4NK5A 5C37A 1F12A 1DRUA 4XDZA 5G0SA 4IQ8A 4CODB 2R00C 4MIOA 3PXXA 1O5IA 4RZHA 4GKVA 5BSGA 1HDZA 5CDSA 4W9NA 5A3VA 4YYZA 3NX4A 1A9YA 4Z0TA 3JQGB 3Q3CA 1OFGA 1EVYA 2Q2VA 3GGGA 2CSUA 3GG9A 4GWKA 4I9NA 2C7GA 4FDAA 1PZGA 4OSOA 3NT5A 3PDJA 1BGVA 5BSHA 2LDBA 3V2GA 3KHUA 1IB6A 1OAAA 2AQKA 4N54A 5K0ZA 2YDYA 4QSMA 3DHNA 1PS9A 1O95A 4ZJUA 5B12A 5ES3A 4CLRB 2YFQA 4BNMA 4MINA 4JK3A 4XGKA 1NFRA 3ZWOA 4HV4A 4XB1A 4W82A 1UAYA 1IY8A 4FPXA 3GF4A 3PDUA 3D7LA 1D1TA 5DZSA 2GGSA 3JQGA 2P9GA 3RWBA 3T4XA 2DTXA 4FFLA 3RD5A 2FN7A 1FK8A 2YHIB 4D3SA 2HRZA 3K2EA 2PA3A 3IJRA 3ENKA 5K6AA 3ROPA 4HBGA 1T2EA 4S1VA 1GPDG 1DLJA 3H65A 4Q3EA 1Q7CA 3DEYX 4UUPA 4WGGA 5ER6A 3STHA 1N5DA 1SAYA 4AJLA 4E2XA 5IDWA 2CVZA 4RF5A 1SO8A 3CH6A 2O2YA 3ZDFA 2ZIZA 1QYDA 3EVTA 1P1KA 1ZJZA 3U5TA 1CRWG 3C7CB 4NPCA 3KYCB 1NQOA 4PVDA 1UR5A 1JWBB 1HT0A 3GZNA 3ITDA 4J91A 4RVSA 3VOSA 4BB6A 2GF2A 4AJKA 4JIGA 4MKZA 4FIZA 2Q1SA 1UXHA 3TFQA 2JCVA 3AWDA 2C59A 3KOUA 3OA0A 4F45A 4N18A 3TDKA 5CDGA 3AOGA 2ZQZA 2PTGA 1N7GA 3LSYA 1YKFA 5TGDA 4BGIA 1AHIA 1CQIA 2YV3A 4U6SA 3IP1A 4BKRA 4I9HA 3RJ5A 3RUFA 4H16A 1IL0A 2LDXA 1CETA 3I52A 3EGOA 3AW9A 4GX2A 4YJFA 5TX7A 5GZ6A 2IDZA 1ZK3A 3LT0A 4R51A 2X9VA 2W98A 2H1SA 4J4TA 4J49A 1TXGA 1BTOA 3ZU2A 4OHUA 3CPSA 3ZV5A 3QWAA 4B4UA 3BMOB 3OBBA 4PG4A 4E5KA 2X86A 4RF3A 4LSMA 3PLNA 1M6WA 1QV7A 5MGBA 4CLDA 3JQFA 5FEUA 1GZ4A 2WYVA 1QLJA 1VJ0A 3HN7A 3PJEA 3ZU5A 4E5PA 5I9LA 1NPTO 3WXBA 4ID9A 5JYDA 3ENNA 3AU8A 5C7IO 4IGEA 1N92A 3NJ4A 2ZJ0A 3RUHA 2OFPA 1EUDA 4MVJA 4YRBA 2O4CA 2G5CA 4DVJA 3DBLB 2NVUA 1DAOA 4CV2A 2FSSA 4CQMA 1PL8A 2AQHA 2IXBA 2WYWA 4O6VA 1YS4A 1XU9A 3WTBA 3ZNPA 5THKA 4NU6A 1NAIA 4DQUA 1XKQA 3ADOA 1OMOA 3KEQA 3PQEA 3EDMA 1DLIA 3F5SA 3DTTA 4AJ4A 3EUWA 5I7VA 1PU2A 3RKUA 1KS9A 4DL9A 5EINA 2O7SA 3UXYA 3M6IA 3KO8A 1Y8RB 1LXCA 1XYGA 4TROA 1HSZA 3O8QB 3FTNA 4LMPA 5FI3A 5B37A 2EXXA 3ZWAA 4XYMA 1D8AA 1V8BA 3ZWMA 2CDCA 4IDFA 4XYEA 2P5UA 4R5HA 4Q3AA 1C0LA 4ALKA 3KLPX 3DTYA 4MVJM 1MX3A 4NBRA 2X6TA 4IMPA 3ABIA 4WLUA 3BHJA 1CJCA 1LEHA 2J3KA 3Q2IA 2J5QA 3H9QA 3VPHA 4B7XA 2OMEA 1H5QA 3BTUA 3L0DA 2O3RA 1NPYA 3AI2A 5KIAA 3WS7A 3O9ZA 4FCCA 4WLFA 3IQDB 4LVUA 1BXGB 2B4QA 1TEHA 1GYQA 1OBFO 1NVMB 2VQ3A 2D59A 5JAZA 3LT2A 1D7OA 4J90A 2W2KB 1YL7A 5L7YA 1G0OA 1T24A 5L7TA 3UHAA 1JKJA 4MKXA 5JC8A 1E92A 4WNCA 4ZQGA 4D46A 2CFCA 3GUYA 1WDLA 3EY4A 3OJOA 1Q0HA 2EIHA 3OEYA 3GT0A 2X58A 1WPQA 4RVGA 5KJ6A 3JCZA 1SEVA 3L4BC 3WGQA 5JE8A 4WCFA 5JPIA 1LDNA 4KOAA 5EN4A 1DFGA 2HMVA 3FHLA 3WBBA 3DBVO 3F46A 1PZHA 1PZEA 3NYWA 3A4VA 3JQ9A 4BNWA 3G79A 1QKIA 4KUEA 2NU8A 1X7GA 2NSDA 1U8FO 2B37A 2UDPA 2YDXA 4PLVA 2D4AA 2GYYA 2AE2A 3HJAA 1U3VA 1JDJA 5JXWA 4ITUA 1UJMA 3GPDG 4L75A 4M49A 2QYTA 3E82A 4NU5A 4D45A 3C8MA 4LN1A 4QTZA 3ICPA 4BNFA 3G1UA 3LC7O 1Q7BA 3QVSA 2X22A 3WG9A 4BMVA 5B4TA 3TZQA 2I5PO 2P4HX 4IZHA 3RQSA 5TRTA 2Q49A 3I6QA 3Q6IA 1E3EA 3RROA 5JAMA 1V35A 3H8VA 3PPIA 3H2ZA 1ENYA 4LSWA 4WECA 5CEEA 1I5RA 2SCUA 2O2SA 1AUPA 1YWGO 4OMUA 1ZZEA 4FS3A 3QVTA 2QRKA 1XDWA 2PKQO 3I6IA 1LQUA 2WD7B 3WBFA 3W1VA 1KC3A 2O50A 3FNHA 4OGWA 3RSHA 2PWZA 3GH3A 4AICA 3GEDA 4PZEA 3B1KA 1HSOA 2TMDA 3PEFA 4XGIA 4GVLA 2AG8A 4ALNA 1JLLA 2X9NA 3JQ7A 3INGA 4R69A 3G17A 3PLRA 4N5NA 3RFTA 4BO1A 3H2SA 1X14A 2NV6A 5LCXA 2VCYA 3GN1A 4EITA 1AXEA 4CMIB 2EW2A 1H94A 4IDAA 3ZWCA 4ZQFA 1AXGA 1T4DA 1U2DA 4EYEA 1QMGA 4IQGA 3IIEA 1VKNA 3VPFA 1XHLA 1ID1A 1Z7BA 2P9CA 4J4BA 3LLSA 4IDEA 1ENOA 4IPTA 4XB2A 2C2XA 3DBHB 3U4IA 1ZH8A 2CNBA 4RZIA 4IUYA 4NNJA 3DR3A 3KZVA 5IZCC 2WSBA 4MVJD 3WICA 4DREA 4RLSA 1E6WA 4PG7A 5EERA 4WCFC 5DBIA 3TN7A 3ZI0A 1EMDA 3PP8A 4N5LA 1L1FA 4Z3KA 2WE8A 5KWEA 1ADBA 1E3IA 2G0TA 5C5IA 1A7KA 2I99A 1P1HA 1YBAA 3LU1A 4YRDA 3OJFA 1UXGA 1PTJA 3S2GA 3CSDA 4FBGA 5CHEA 1E6UA 3MJCA 4H7PA 4DPMA 3QVWA 1JN0A 1YQGA 4UAGA 1LDYA 2OP0A 3ONEA 5BNFA 2DT5A 4G81A 2Q1UA 2PKQP 2E37A 3E5MA 5A05A 4YT5A 3QWBA 2IZZA 4EJ6A 3RC9A 3NV9A 3U3XA 2A4KA 2PH5A 4JP3A 4XCVA 3GFBA 3DFZA 2W2LD 1AN9A 2B4TO 4L76A 3SLGA 4FFNA 2E82A 3U4HA 1EDOA 2B35A 2B5VA 3DBLA 3RAJA 1GCOA 4DGSA 3SJ7A 4XRGA 2IYPA 1EBFA 4IINA 4CM4A 4FC7A 4JN6B 3CINA 1NFFA 3WQQA 3ETGA 3OQ6A 3ZZNA 2EKPA 1FF9A 2VYVD 3OEWA 4E0BA 3PYMA 1PGQA 1Y5MA 3DZFA 3ZNQA 1HEUA 3N58A 2VUTA 1J6UA 3RKRA 3RC7A 3F6YA 4NBTA 2UYYA 1U7TA 2UUPA 1BW9A 1NVGA 2BLLA 1LTHR 4FGSA 2DTDA 1PJTA 3AM3A 3BZUA 3O4RA 4E33A 3RC2A 2FPGA 1RM0A 1EUCA 4P38A 2O3UA 2VOJA 5A4DA 2VHZA 3BMCA 2DPGA 5AQ1A 3FBTA 3I9KA 2J6IA 4LRSB 5BT9A 3ZCXA 1QG6A 3L9XA 1QORA 3OJ0A 3KLMX 1NM5A 2ZKLA 3KSDO 1A72A 2X0NA 4CMKA 4IQ0A 2RIRA 1RYDA 3KSZO 4E13A 3KETA 4KP7A 4DIOA 1IE3A 4IJVA 3QQPA 4J1QA 4IDBA 3GVCA 3A1NA 5TT0A 1C0PA 3GDGA 3Q1LA 1LJ8A 2HMSA 4Q3NA 2PLAA 4XIJA 4MO2A 2CDAA 3DWFA 4G5HA 2GZ1A 4BS9A 4YR9A 1ZUD1 3WYBA 3TQHA 3SXPA 4WEOA 1QYVA 3KM0A 2PZJA 2X0IA 4CLOB 2FOIA 3VTZA 4E2WA 3HWRA 4YT2A 1ADFA 3V2HA 1YONA 1LLDA 3A9WA 3TZHA 3WIDA 5BNTA 1KEPA 3VDRA 5K9ZA 1NFQA 3OP4A 1DRWA 5AXBA 4ZHSA 3GVHA 3DAFA 4CM3A 4BMSA 2JD2A 3I9NA 4J1NA 3NTQA 1KEWA 3UKOA 4TRMA 3RU9A 3DB2A 1ZK4A 1ULSA 1V3VA 1CIVA 2HLPA 2FWMX 3FWZA 3OM9A 5JDCC 4YVFA 2C5EA 1K6JA 3SJUA 4BIIA 2C20A 4RPKA 1ML3A 1LUAA 5L4LA 4BKPA 4E31A 3DL2A 4YAIA 4RDHA 1VC2A 1ZEMA 2X8LA 3PYXA 4YT4A 5DNAA 1PX0A 1UP6A 3BHIA 1DJNA 2JCYA 3W8FA 5B1YA 1RKXA 4XEHA 4YRAA 3WGIA 3RUDA 1Y7TA 3B70A 2V7PA 2WMDA 3LQFA 4IDDA 3JQAA 4A73A 4AVYA 5JFOA 1MB4A 4UVGA 1KEVA 3F3SA 3FD8A 1SOVA 1QV6A 5KVCA 4D44A 3U49A 5CG2A 1VPDA 4RVHA 3E8XA 3BXXA 2VHVA 4L73A 2PD4A 3PHHA 3PZBA 3U09A 1B8PA 1GUYA 2Y68A 2FRDA 1X0XA 3SEFA 3ZW8A 4YTEA 2JJYA 3H9GA 1EUZA 2UV8A 5KNLA 1Q0LA 2DBRA 1HRDA 4C7KA 1LU9A 3RUEA 4XIYA 3C1AA 4NJOA 4A2CA 1GYPA 4NG5A 5HS4A 4E4YA 2EV9A 2AXQA 3TPCA 1T4BA 2F1KA 2ZATA 3I3OA 3P2YA 2IZ0A 4C7JA 4BNZA 4CLOA 3K6JA 1LDBA 1NWHA 2FPPA 1I36A 3IAHA 3JQ8A 3PI7A 4M87A 5IN4A 2D2IA 1R16A 1ZMTA 1EK6A 1U2GA 1NQAO 1N2SA 1VJ1A 1NR7A 3ROQA 1MFZA 1B0AA 3G0OA 5JYEA 4Z9XA 1D1SA 4PRKA 4OQZA 1GD1O 1NX6A 3L6OO 1ONPA 3TFOA 3WJ7A 2O3JA 2PY6A 4L9RA 4A10A 5KKCA 4OOFA 3E5RA 5F5LA 3D3EA 3FRJA 4PLWA 3TRIA 1P0FA 3OICA 3RFVA 5T5QA 5ILOA 4HFMA 4TWRA 4FFRA 4WPGA 3KB6A 4P4NA 1I2ZA 4DIBA 3AUAA 3IDSA 4A7PA 1EVIA 3CMCO 3P19A 4J9VA 4CQLA 2CF5A 3PRJA 1MG5A 3TOXA 1YB5A 2WD8A 1GUZA 4M8SA 3UICA 3SBOA 1PGPA 1QRRA 2V6GA 1L7EA 3Q11A 2CD9A 4Z0HO 1O9BA 5AXDA 2I66A 5B4VA 1U7HA 1P31A 4PIVA 3KSUA 2GUGA 3WQRA 1YL6A 3OF2A 4MDHA 5ADHA 1DIBA 2VYND 5DBFA 1R4MB 3E9NA 2Q4EA 3I9MA 3GZ4A 4ZGWA 2PZMA 3WOHA 1P44A 4BNNA 4BNTA 4XWYA 1NQTA 2QX7A 3WGZA 4ZRMA 3FR8A 2RBEA 4OXYA 4E32A 3H7AA 4UVEA 4DMMA 4EGFA 3GRKA 4NMHA 5KCZA 1UDAA 2VNAA 3OFSA 4J2OA 2AEJA 4OJNA 1EFLA 3ON5A 5F1PA 2ILTA 1B7GO 1CQJA 2IE0A 2C54A 3BTSA 4YCAA 4D7AA 3LYLA 1RWBA 4L4XA 1J49A 1FXSA 3GQVA 2VNSA 1V3UA 1BHSA 4CM8B 3RBXA 1WZIA 4IZIA 4NFSA 1KC1A 3JQ8B 2VYNA 4M1QA 2GD1O 2PGJA 1ZVMA 1H9BA 4AJ1A 3NGLA 1J5PA 2D1YA 4RPGA 3VPSA 1PGOA 1T26A 1U3UA 4E21A 5GZ3A 2R2GA 3AK4A 5A5FA 4IJWA 1KOLA 3LF1A 4AJPA 1ZNQO 2C2YA 3HG7A 3KUXA 3VZRA 1WXDA 3E9MA 1P1RA 1ZEJA 2POQX 5FWNA 4Q39A 1BXKA 1LRKA 2G82A 2YYYA 3C85A 3A06A 2OOSA 3GDFA 4CV0A 3D1LA 4GX0A 4MP3A 7MDHA 3PIIA 2OP1A 2YQ4A 2H6EA 3FCOA 2RHRA 4II2A 2YHUA 1GYRA 1I2BA 4OXKA 4F6LA 4NJMA 4PG6A 1E3WA 5U4QA 1ZK0A 4IDCA 4F6CA 3QE3A 2IEBA 4IDGA 4NZ9A 2QQ5A 1Z7EA 3NGXA 3CIFA 2GZ3A 1Z75A 1KIFA 1LA2A 1R4NA 5C3MA 4MKRA 2QW8A 3UW3A 1GU7A 2DU8A 1E1LA 2AE1A 2Q2QA 3CTMA 4UUMA 2P68A 4Z0PA 4LCEA 2DLDA 1HYHA 2PKRA 3RASA 1C14A 5IAAA 1A71A 4E30A 3HDJA 4GQAA 3MEQA 4ND5A 4U7WA 3B6ZA 3TF5A 4L4SA 1IULA 4WLNA 1C1DA 2XPCA 1DJQA 1GEGA 5HRUA 1R0KA 1FJHA 4BNUA 2JD1A 2C82A 4KTTE 2AW5A 3HNPA 3LZ6A 4QECA 2GRAA 3PQDA 1R37A 4CQMD 3HFSA 3C7AA 4IJUA 5EIOA 1WMAA 4YAEA 3AI3A 3MOGA 2VWPA 3I4FA 4B4VA 1GL3A 1EE2A 4DA9A 2I9PA 1K5HA 3UCFA 1C1DB 5U1PA 3WIEA 4LISA 3NJ8A 2E49A 3L9WA 1OZAA 3JYOA 2BGMA 3KYBA 4BQRA 2BFPA 3IUSA 2YJZA 2B0JA 1ENZA 1NTOA 1XLTA 3L6DA 5DCWA 2E6UX 4J2HA 1DEHA 1N8KA 3D4OA 3WQSB 5I9NA 4D43A 1R15A 2Y1EA 1I10A 1HDRA 3TZCA 3U0BA 5DP2A 3W8DA 4CMEA 5JW6A 1DBVO 5FFFA 1J4AA 1E3JA 2JFGA 3HB5X 2B36A 1LX6A 4W7HA 1KVQA 1NAHA 1BVRA 3GA0A 2BMAA 1PR9A 4UULA 3GK3A 3JSAA 3QLJA 4HWKA 3IMFA 1S7CA 1PJCA 4YXFA 4JJFA 1UZNA 1BWSA 1P1FA 3F4BA 1CYDA 4PG5A 4EW6A 3H9UA 4FJ0A 5TF4A 4ZRNA 3E6AA 4BMNA 4XZ3A 3PFFA 1VE9A 4CMEC 2VZ9A 1PJ4A 1Z82A 2ZJ1A 5COAA 1CDOA 3NDIA 1SNYA 5CDUA 1A5ZA 3JD0A 2EWMA 2PD3A 3UF0A 1XA0A 1UZMA 3JQAB 1YOVB 3K31A 4RPHA 4FD3A 3MWEB 4RL6A 3WJAA 3INTA 3K30A 3P7MA 3SVTA 4X54A 3ANLA 4KWIA 3GOHA 2ZQYA 3EVNA 3Q2KA 4CM7A 1T25A 4R1TA 3GRPA 3DOJA 1E77A 3E18A 1RM3A 1Y81A 1O89A 4EZBA 1EQ2A 5JO0A 5H82A 1R6DA 1TT5A 2Q1WA 3DMYA 1BMDA 4GH5A 3ZHYA 1HYGA 1Y8QA 2YY7A 3MZ0A 4M55A 1H93A 4LCJA 1H2BA 4EEZA 2VHXA 1NWCA 1CF2O 3UUWA 4DWVA 1DSSG 2HRBA 4RDIA 5C7OO 5L40A 2O4UX 4RQUA 1KYQA 4GBJA 4BNJA 3FF4A 1HETA 3RFXA 3I9JA 4RVDA 3MTJA 3PIDA 1FDUA 5DBGA 3JD3A 2G17A 3TL3A 4R4JA 3VC7A 4BV9A 3H4VA 1MUUA 1TT7A 4HNGA 2VYVA 3VTFA 3DO5A 1HDGO 4KDFA 5L95A 1DIAA 1ZSVA 4KQWA 2ZTVA 4PLGA 2RCYA 5ER9A 1WP4A 2IRWA 1WLYA 2GO1A 1ADCA 3DMTC 3ZN2A 1I8TA 1PSDA 5HS6A 1HLDA 3HN2A 4IXTA 1ISIA 4I5EA 3W8EA 2ZB3A 3E9QA 3WMXA 4AFNA 1GADO 1TI7A 2D0IA 1GV1A 1Q0QA 4FFPA 2VOEA 1E7SA 1P45A 1V3TA 3GGPA 1LNQA 4JX8A 4CLXA 1EQUA 2GN4A 4B3JA 2GN6A 2JD0A 2NU9A 3WTCA 4XDYA 3FPLA 1GQQA 3H9JA 2X4GA 4HUJA 2FR8A 3S1LA 2XAAA 4NQZA 4TRRA 4UVDA 4IMRA 1H6CA 2UUOA 3D64A 2QRLA 3BMOA 1XIVA 4FB5A 4R1UA 4QUKA 1ZJYA 4CJXA 4TRJA 2NQ8A 2HCTA 2NQTA 2DKNA 1HE3A 1R4MA 2DPHA 5DN9A 4CL3A 4ND1A 2IYOA 5DULA 3ZV3A 3UFXA 4AJJA 3IJPA 1I3MA 3RC1A 1E3WB 5TLSA 1UXJA 3W6UA 1HKUA 4NIMA 3AM5A 1T1RA 1B8VA 3UVEA 3PTZA 5EPOA 1U5AA 1MV8A 4IIUA 2HAEA 1RJWA 2BI7A 2R6JA 2JAHA 1I33A 5A9TA 2AEFA 4K6FA 2C7VA 5JY1A 1Y9EA 3WSVA 5TC4A 1X0VA 2JL1A 3MOIA 4I5FA 2ZYDA 1KBZA 3VDQA 3KYDA 5K6AC 3GDOA 3O03A 1K89A 4H15A 1M76A 4CMJA 3H5AA 4J16A 5THQA 4NFHA 4DQXA 1O8CA 2C0CA 3NEPX 3BTOA 2EGHA 4NBVA 2Q3EA 1XQ1A 4YA6A 1ISHA 2I67A 5DT9A 3WYEA 3IKVA 2I3AA 1LSUA 1PL6A 4GPD1 2B69A 2DQ4A 4H3VA 4RV9A 3CKYA 4L4RA 3C1OA 1Z45A 4K1LA 4KTVE 2GERA 2CZCA 4A5OA 1K6IA 3BAZA 4EJMA 3U9LA 1A9ZA 1U28A 4EUEA 1K3TA 3B20A 2HQ1A 3V1YA 2X5KO 1Y1PA 3OIDA 4OAQA 5DCUA 4BO7A 2YHIA 5A06A 1ZO8A 4HNHA 1LSOA 3C3XA 3K2BA 1IYZA 4PLFA 4GMGA 4PZDA 1M6HA 1LI4A 1Z6ZA 4ND3A 2GPTA 4G65A 1YDEA 2X1HA 2BHLA 4JGBA 1EFKA 4BGVA 5JDCA 2X0RA 1R66A 4FOSA 3H3FA 4I9UA 4BV8A 1K2WA 4B7UA 2D8AA 1EVJA 2F00A 3ORFA 3ST7A 1ISGA 4NFYA 2A9FA 3F4LA 3EZYA 3M1LA 1X7HA 4OH1A 4R9RA 2O7QA 4ZVVA 2EF1A 5TS3A 1IPEA 4MVJG 1JAYA 5TIIA 1IHYA 1QLHA 3ULKA 3GPIA 4TVBA 2PD6A 3RVDA 3BMQB 3T7CA 2HMWA 4GLOA 1U3WA 1EVZA 3LVFO 1I2CA 5TT1A 2CUKA 4J3FA 1NPDA 2DUUA 3AUUA 3TWOA 4Z3DA 1JKIA 3MJTA 1X15A 5A9SB 3ZWPA 1O6ZA 2W4QA 5A03A 1JW9B 3GVIA 1GV0A 1NYTA 4B7CA 2WE7A 4AJIA 2YUTA 1H9AA 1ENPA 1AE1A 1QP8A 3BMQA 4XR4A 4LRTB 3PHLA 2DAPA 3N74A 1D4FA 3R3SA 5AXCA 3ZNNA 4BO0A 3GEGA 2FR0A 1UAGA 2BH9A 1YGYA 4A27A 4EI2A 2EEZA 2HSDA 5MDHA 2EW8A 1YL5A 3GHYA 3AUSA 1HDCA 4J1TA 3GNTA 3IS3A 1MLDA 4UUOA 1HE5A 3I9LA 5F1KA 4XYGA 5T8KA 2QRJA 3E03A 4P8RA 1ZMOA 1UP4A 3MCVA 5JCXA 2NNLD 4DUPA 3KEOA 1RYEA 3VZQA 3EAGA 5T67A 3FN4A 3OA2A 1C0IA 3LK7A 2YV1A 4JNKA 5JCJA 4CM1A 5L53A 1D3AA 1Y8QB 4D79A 1E1NA 1EZ4A 3QSGA 3T4EA 2Y67A 3MJEA 3R6DA 2OORA 1ZXLA 3IC5A 4JROA 1LLCA 2Z1MA 3ZV6A 4PLHA 5JLAA 1MGOA 4Z9YA 4ZA2A 4TZTA 5JS6A 1M2WA 1PQWA 5KJCA 4AJNA 2BD0A 3WMWA 1ZBQA 4BQPA 4Y6RA 2J5RA 4CLHA 4Y98A 1IOLA 4LVCA 1DC6A 1EE9A 1XELA 2Q46A 4QFCA 1ORRA 3DXFA 3DQPA 4UEJA 4IS2A 2H63A 5BSEA 1X1TA 2FR1A 4GLLA 2YW9A 5EJ2A 1YO6A 2BFAA 3M2TA 4DPLA 1DAPA 3K92A 4Q9NA 5I7SA 4QQRA 2Y1GA 2IXAA 3JQCA 3FI9A 3DAPA 4B3IA 4U8GA 4P4LA 1QYWA 1E7RA 2JFFA 1E5LA 3WYCA 1FDTA 4ONEA 2I6TA 4XYBA 4HADA 4CM4B 4I1IA 4INAA 3DZKA 2V6BA 3U4CA 4XQ9A 4MVJE 1PZFA 4JCOA 4JJIA 3VAZA 1AHHA 2HMUA 2HJRA 4R01A 1WAMA 1XEAA 5L4SA 2RAFA 4WOJA 3LC1O 5LDHA 3AY7A 5A9RA 4NH4A 4GL4A 4DPKA 1LC0A 5TJHA 1MXHA 1P0CA 1A27A 4JP2A 2AG5A 1XCBA 4L8VA 4A03A 4BGEA 3W4IA 5G0WA 3S2IA 3X2EA 2O3SA 4CPDA 3KXDA 1ISJA 3KTDA 2Y1CA 3QWHA 3F1KA 5A5EA 1VRWA 1G6KA 2ZB7A 1GY8A 2FZWA 1Y8RA 2AHRA 4GSLA 4CR6A 7ADHA 1SOWA 2DM6A 3K9QO 3PYLA 4RPLA 1WW8A 5BSFA 2QHXA 3IOYA 3OJLA 1UXKA 4BO8A 1Y5RA 2X9GA 3BMNB 3NTOA 4GVXA 4XR9A 3BMCB 4E5MA 4PGFA 3AUTA 3GMSA 4F3YA 1A7AA 3JQ7B 4RGBA 1BW9B 3WGTA 1LLUA 4XQCA 3AFMA 4GAEA 1HXHA 4DXHA 4RJTA 2Y66A 4R3NA 4IM7A 4DC1A 2WD7A 1HWYA 4NHEA 4CQLB 4HXYA 4J4HA 2BRUA 2NADA 2Y0EA 4LGVA 4EBFA 4J7UA 3N7UA 4PLCA 1HLPA 2VZ0A 5BR7A 1I3NA 4JLWA 4DBVO 4JBIA 2OHXA 1TB4A 2J3IA 3OH8A 3HE3A 4E5YA 4E12A 1DB3A 3QRWA 1C3VA 4BO6A 3DC2A 1C1XA 3H9EO 3HDQA 1VL0A 5DDIP 1U4OA 3F47A 1T1SA 4BO3A 3IKTA 5CDYA 1PGNA 4HY3A 4J0FA 5BNIA 2FZEA 4GGOA 1H6DA 4WLEA 3Q9NA 4AJHA 4R68A 4PLPA 5KJEA 4CMHA 4D42A 3HADA 2PNFA 4N5MA 1BDMA 1YJQA 4RCVA 4ZQBA 5ITWA 3PZRA 3X2FA 2VUSA 3FNFA 4WCDA 1F06A 2E4AA 4FQ8A 2PGDA 1VL6A
chains in the Genus database with same CATH superfamily
1K75A 4LYAA 4AMYA 3GJ6A 2GJ8A 2WZQA 3KQNA 3CUWA 4KXMA 5FA5A 3DZJA 4EO7A 1SBIA 4RKYA 4B3HA 5J4YA 1QYIA 5K1ZA 3KKLA 2VJAA 4KPUA 1KBOA 1VJDA 4GI2A 5C7LO 2W9XA 2QL9A 2VTEA 4BNVA 1M0WA 1Q7GA 3V2IA 1IHPA 1DWPA 1U2EA 3CLHA 3GX1A 3QIVA 3SBEA 3QVLA 1ZVQA 1GTZA 4ZO7A 1Y9AA 3WL3A 3ZV4A 5DN6A 4YFVA 1DKUA 5I9TA 3ZXUB 5SYMA 3S27A 4P34A 3UV3A 1RWPA 5HR5A 3EIHA 2XT0A 1CP3A 1UCFA 3AY0A 3JQBA 1G8HA 3L4BA 2WZBA 2ZK7A 4DWOA 2PUFA 1T9BA 3VKHA 2C5AA 5LBIA 1I51A 2H48A 4Y8VA 1GR0A 4US1R 2A5LA 2KI5A 1N9GA 1ONSA 2F43B 2HT1A 3FDIA 1Y3HA 4L78A 2EWVA 1N6OA 3U56A 4KSYA 4JVNA 2EDCA 4CT0A 5DRTA 1TVKA 3BWXA 4KE8A 4WXMA 2HRQA 4R3UC 2YC4C 2H52A 3CKKA 1UBLS 3DA8A 4MITA 3BS4A 2IPAB 3LKBA 3BN3A 3OE1A 4OQMA 4TWZA 4JP1A 1XTSA 2Y1FA 3VNUA 4EGAA 1E7MA 4P2GA 2HFJA 3P32A 4ALIA 4ZDJA 1YOVA 4PGAA 5DGCA 4B2LA 2C2MA 4BQSA 5CB0A 2X13A 2W71A 2NUPB 3SF8A 4CMIA 1GAXA 4D0NA 2ZPTX 4JBHA 4JQCA 4W7IA 1N9GB 2F43A 3MM4A 3UMFA 3GLRA 4ZYWA 4B4OA 1P0IA 1PHRA 3ASVA 1YT5A 2A0UA 2CFOA 2K5UA 4EPRA 2PXCA 1JAIA 1MORA 1QS0A 1SXJE 2OLJA 3B1FA 3BULA 2FX2A 3CE9A 1FQKA 4URFA 3VKFA 1WKCA 3ZD6A 4RYDA 3EDRA 1TJ4A 1SCKA 1D09A 1U5BA 2VRCD 3OOJA 1AM4D 1II9A 1L7OA 4TWAA 4I1YA 4RWZA 3SVZA 2Q8QA 4F2HA 2FJPA 1PFVA 1SIOA 2D13A 2BY4A 5CJ2A 2CDRA 4Z99A 4EHFA 4KQXA 4A0SA 4KRFA 3P9SA 4LV6A 4IF4A 4RIGA 4UBJA 1QGED 2CHEA 4W1QA 4ZICA 1U63A 1OFUA 4LOJA 4AG3A 3KZKA 2GBPA 3PDCA 1JMYA 4R8VA 5CFNA 3DTVD 4ASUA 2OL4A 1SC4A 3N2EA 3E70C 2B2CA 3R0XA 3QUAA 4W99A 4B76A 4PN3A 4A6XA 4KYVA 3GC6A 4PF1A 3IO5A 3CH5A 5KVSA 3DUFB 4HQRA 4D0RA 2XCIA 1TJNA 3BXZA 3SLRA 3D6NB 3UGKA 1R6TA 4OQEA 1BSVA 2W0SA 1ES9A 1C7ZA 1ND5A 1XP5A 2Z0MA 5EMJA 1NGSA 3UANA 1UEXC 2ZP1A 4K0KB 4BECA 3H2BA 4CT5A 4C29A 4HZGA 1Z2CA 4NICA 5FADA 5G3ZA 4A2PA 2D7CA 2O0JA 1DCFA 2ZUDA 4ACBA 4CIDA 2BTEA 1W48A 2YQ5A 4D5EA 4XB6B 5A7HA 2OZPA 4K9MA 1OYWA 4DNOA 5G1OA 3Q85A 1WQ4A 2EJCA 3V1KA 5FYQA 4DA0A 4WZBE 1KO5A 2LIVA 2QPAA 4QXMA 2FSVA 3OIUA 3ILSA 1EB9A 1ORTA 4PZ0A 1G5RA 3FZYA 1T8WA 3QA9A 4JVMA 2QLLA 4HXEB 4HGPA 5FLXA 3ZEIA 1TFRA 1XK7A 2CNDA 3EXFB 1II8A 1G63A 3BGIA 4Z8YA 1VE5A 3B1JA 3WOVA 5AI6A 5ECDA 3RTEA 4EQZA 3UUFA 2CNKA 1A4IA 3PQ7A 3FPFA 3VISA 4A0HA 1U9JA 2DOKA 1KYXA 3FSJX 5EWMA 2ZE5A 4LFBB 2ZT7A 5IDYA 4RPIA 5DW3A 3OU6A 3PFWO 4HLCA 3TOVA 2ZWVA 4BNDA 4BOYA 1GRVA 4Y1GA 1KY4A 2H65A 3P2IA 1LGYA 4PV7A 3JQ6A 3FUWA 3LDAA 1RI2A 1CULC 1FW6A 4IYJA 1UOQA 1OXBB 2DKOA 4CNQA 4II3A 3PLAE 1SHTX 2AK2A 2AKYA 4LXIA 5JQGA 1P7ZA 1KVRA 2X3FA 2VDKB 2GD6A 1A4XA 3C5WP 3WDSA 1ZSNA 1W93A 2DC1A 3EN0A 3PI6A 1HM5A 4C76A 2XD9A 4XVRA 1HYEA 3L7KA 4MW9A 2V97A 4TMYA 3ZHZA 4R7ZA 4FHFA 5IKXA 1KZYC 3E48A 4XSVA 4IZ6A 5L3QA 3IT1A 4M1MA 2XDWA 5AR1A 3QW4B 1PWXA 5EESA 1MC5A 3ZD9A 2AQIA 1CZUA 2XNSA 4X24A 5BN3A 3VR3D 2OQ2A 3FPKA 3PQCA 3HR8A 3WHPA 1WQ3A 4BE7B 4LDPA 2G70A 3ITKA 3BA6A 4O29A 4TXMA 2M6KA 3SQLA 4D9JA 3UYLA 1ZINA 2FPIA 2BKLA 1M75A 2EF0A 3GBSA 1E9AA 2C4MA 2CCGA 3K0AA 1YB4A 3GNLA 3JD1A 3QVXA 5FOTA 4P4TA 4DMCA 4U0JA 1ULBA 2H9IA 3P5SA 3DAGA 4OG2A 1WPGA 1L4KA 4B71A 1VZ2A 1NMQA 1ULAA 3HDHA 4GT1A 1TVMA 3ZVNA 3A1EA 1E2MA 4YJGB 3AEXA 4DCGA 4JI0B 2EBWA 4CTOA 4YRIA 1UEJA 2I1LA 3HCNA 1P2VA 2F8SA 1O95D 1VJRA 2O20A 4AXBA 2PGXA 2XNDD 2WSLA 3GZNB 2FV8A 2GCOA 5A04A 3F98A 3N0WA 1SEPA 3JQQA 4M9CA 4B9AA 1VA5A 1PR2A 3DMTA 1UZUA 3G8BA 4IJKA 4WY5A 5E3JA 5FX2A 5LJLA 3OHSX 5HUHA 3H5VA 1GZVA 1CUYA 5F3RA 4Y0VA 2QX4A 2WTAA 3C1TA 1H6BA 1JQLB 1E9VA 2X1MA 3GGSA 3HA5A 3U4AA 1M7GA 3W4KA 4W6ZA 3ZQJA 4K28A 1ZKMA 2CL0X 3PVZA 4DN6A 2IP2A 2HI0A 2APJA 3OLCX 1X94A 5AJTA 1UANA 4U7TB 1JKJB 5NLLA 5FYDA 1FFEA 2ZYGA 4E3ZA 1IK6A 4CM9D 4X44A 2QR5A 4HDMB 4AP5A 1YQUA 4G2NA 1G19A 1BXGA 3RG2A 3IAS1 4FFDA 4YCJA 1MNQA 1MX1A 3WI7A 4AU1A 4RNDB 1TUBB 1PP4A 3FTCA 5ICCA 4S35A 5ERGB 2GWRA 4AMGA 2JBAB 3K71B 3UXMA 4XWTA 3C3BA 3G7NA 3H97A 3BIJA 1JVSA 3FVVA 1XHFA 3OJEA 3HUEA 2Y1DA 2G76A 4LTDA 1FP4A 1OXVA 3R3ZA 4PEVA 4X61A 2V1UA 3DKKA 4WK6A 4CEJA 2OM6A 1YMVA 1DP4A 1DJOA 1LPBB 2VSFA 4GMXA 3OX3A 3PC2A 3CISA 3E8SA 4ZVNA 3QEAZ 1DBPA 1UC8A 1NNEA 3CNOA 2C8JA 2DBVO 3S6JA 1NXOA 1J7JA 1Q1GA 2P2NA 3GFPA 3KTAB 5CLGA 2ZWAA 1XF9A 5GONA 2QYSA 4D8VA 3D0OA 1BFUA 4GBMA 4IH9A 4QVIA 3JV7A 2C3OA 2QAGB 3FNEA 1GNPA 3M4ZA 3GZTB 1GNLA 1EFVA 3F6SA 2IEDA 5EY5B 3KB8A 1XQYA 1YBMA 2ZT6A 5HBRA 3V55A 1Z2EA 2OHJA 1T13A 4KQJA 2R6ZA 2IHTA 4Z2YA 2CKDA 2BI8A 2OV3A 2IYRA 2WILA 3O1HB 4I4NA 3GQBA 4W9NC 2PL9A 1V95A 3CZQA 3CWZA 3MJVA 3Q9LA 4LJYA 4U3JA 4D9EA 2IXFA 3I28A 3ICCA 4MVJI 5FRDA 5T4HA 4DR2B 2RGNC 4Q4AA 2KJQA 4K6KA 4UU0A 2L17A 5ADUS 5IU6A 3ZDZB 1WUHS 3WNQA 3A28A 1L5OA 2PR2A 3U37A 4FMCB 3HQ4O 2BR4A 4RNCA 4WUVA 1IWBB 3DLHA 1JSXA 3AY3A 3RH0A 1GUAA 2XOXA 5IAKA 1BXZA 2VH1A 1LSJA 1US8B 1V43A 1H0KA 1M1YA 2WUWE 4R0VA 4J1SA 5JH7A 3F5DA 3PUJA 5EFZA 2BFMA 5AQEA 1MO6A 2ORYA 5BW4A 4LI0A 2QLNA 1X3LA 1C9DB 1QGOA 3A4LA 3AXTA 3GGOA 1KP2A 1OKKD 2ZRFA 5IVDA 1FW8A 4WRRA 4N40A 3ZQUA 4MUJA 3IA7A 1N2IA 4P7JA 1Q7TA 2JLCA 1E3SA 1XZQA 1B73A 5THXA 5U9CA 1NG9A 2Y99A 1XTBA 1W36C 4CV1A 1PD1A 4YUZA 4JLNA 1VECA 1XZIA 1D4OA 2WKWA 3S5UA 3T7JA 1V4VA 3TRDA 3SVLA 3D1VA 5G02A 3CS3A 4B34A 1QDUA 4CE6A 2QL5A 3C5CA 3FJ1A 3IX7A 3M2PA 4B79A 1UFRA 4II7A 4OCZA 1SCNE 5FCDA 1ORIA 4QQKA 3SF0A 5BQ3A 3F9IA 1GRRA 3TLXA 5F2NA 2HSEA 4HP8A 2L42A 4P5EA 2OCPA 1W2HA 2XLBA 5FQOA 2AX4A 2FKNA 5JMOA 1M66A 2J9GA 4U8HA 2IELA 5L45A 5A0TA 3U4QA 4L9SA 1X9GA 4GX1A 4B3FX 1SU6A 2NSHA 3PBKA 1P60A 3GGCA 1LBTA 3ZWNA 2HU2A 2CVQA 1URPA 3TYXA 2P5SA 3A2MA 4JQYA 1Y6GA 2G09A 3IUPA 2BFBB 4AX8A 4CDMA 4ITRC 1H3EA 1OFIA 2QRUA 3O73A 4E2ZA 1YC5A 2VN8A 3RYCB 1AKTA 2O6LA 3UXEA 3MHTA 2A78A 2J67A 3K8YA 2PGAA 3U4DA 2H2DA 5JNVA 3T12A 5JD4A 1PG0A 4PG8A 3R3UA 4YAFA 2P2LA 4ZTBA 2FW8A 2QIOA 4AUKA 1CJMA 1OOEA 4F86A 2Q9AA 1GTL1 5DTRA 5BPFA 1WSWA 3BDAA 3LZDA 1MOQA 4GSKA 4C43A 4J16C 1Q15A 2VJMB 2ZYTX 3LIIA 5BW6B 4F3RA 4G84A 3G8AA 1I13A 1F8YA 9LDTA 3TZKA 2Z56A 3K0CA 4DEVA 2P9EA 1DIGA 4FNAA 5G4KA 3NXSA 4RVUA 1F3LA 3DHVA 5FNVF 3X0DA 1QRUA 4OHYA 1J21A 5EWJB 3ESZA 2P2SA 1GZDA 3JWIA 2C07A 3B85A 1TAGA 1YB2A 3B9RA 4UE2A 2CMDA 4Z7NB 4O4LB 1I6LA 2PGOA 3EGVA 1I2MA 3K32A 1H3NA 4WERA 4QGSA 2C9MA 2AQ8A 3F1LA 3SM9A 3Q7TA 4EEXA 4PSKA 4C4PA 2FAXA 1FSZA 3ZLJA 3O2QB 1P72A 2Q27A 1I0ZA 1FFXB 4H6XA 5AW9A 4DRXB 2VZ8A 3MT9A 2OXRA 4DE5A 4BFUA 5JD5A 1V8PA 4AC9A 3U19A 5HKKD 4DT1A 4YPOA 1KDPA 3OFNA 1R9NA 2X2PA 2Y0DA 4DIDA 1U2SA 1XGKA 2WIDA 2WUDA 1NY6A 3QFSA 2R6HA 1NLUA 1ONNA 1ZM7A 3I8OA 5G40A 2FFRA 2O7RA 4RAQA 2VBCA 4OHWA 3KT8A 3MN1A 3EQ6A 3QTTA 1ABEA 1CDEA 1N2XA 3JVVA 4IJQA 5AJWA 5HJ5A 3G02A 1C30B 5IHXA 4B09A 1G1AA 1L3CA 2GXAA 5CYPA 2X5JO 1KZGB 1RU3A 3DV0A 4Q15A 2J3JA 4F4CA 3N0XA 2P2CA 1DGQA 4WEQA 3QVMA 4M54A 2PXAA 3I04M 3T61A 4B75A 5TJ9A 1J0CA 3OF3A 4MZDA 3JTMA 2DMRA 4LIPD 4BMZA 3EAQA 2O23A 1LDMA 1R8JA 5IJ9B 4UHBA 3B8EA 3BTVA 4FGWA 4OKSA 5KNBH 3DZBA 2VXBA 3H5RA 1RM4A 4GOXA 2SBTA 4BKMA 4D3DA 3M6MD 1I1NA 1EM8A 4WOPA 3G9XA 4YCBA 2D0DA 4YLYA 2CK3D 3R7FA 2ZBDA 4Q34A 2P2GA 5E9QA 3RS5A 1JLLB 4L28A 3O2JA 3K9BA 5CT8A 3UH0A 1XR3A 3ZHUA 1I0LA 1ZD5A 3FZNA 4MPJA 3ANTA 3IP7A 2NU7A 2EKBA 3M6AA 4HFRA 2WF6A 1XHEA 4XSHA 1IHXA 5ALRA 4EJ0A 1ZKDA 4MQBA 3RRNA 3BWBA 5CFPA 3VDXA 2N9UA 4QUDA 2Z2JA 4ENTA 3D2LA 3O38A 1A4UA 3M3HA 4NBKA 4WLVA 3S55A 1CV2A 1YUBA 1PGJA 2GPYA 5JT1A 1KDOA 2FSGA 3L1VA 5JWOA 3PJFA 1ZD8A 3FOCA 2PZLA 3BIWA 4OL9A 5CT9A 5FWDA 3PWSA 4UFOA 1RVDA 1U3DA 4GXTA 1B15A 4BGUA 4B5KA 2QTVB 3G59A 4BV3A 2HRRA 2V6FA 3ZQ6A 4IIJF 2OCIA 5LC1A 4Z49A 2ZR0A 1CS0B 1LBEA 2CXXA 2ZTUA 4R1NA 3QY0A 5AVUA 1PS0A 1ZL0A 3KYCA 1XZPA 3IP8A 4EG0A 4RHTA 2YOHA 2R8PA 3DGFC 3TOZA 4FMDB 4L0CA 4AMVA 3SHFA 1RZRD 4UCFA 1AUQA 3USZA 2JEZA 1ILWA 1E6EA 1TMKA 2TMKA 2WTBA 3LLMA 3PE3A 5KYXB 1P29A 3A04A 4FHDA 2TSYB 4HB3A 1HQKA 5EUQB 3ASUA 2I65A 2GO7A 2I2FA 3KYJB 4M36A 4UEKA 3TJRA 2QRQA 1ODLA 4ZOQI 1BU8A 3ZY4A 2Z1DA 3FCYA 1JU4A 1PHPA 4LOLA 1V6SA 1QFMA 2C04A 1QB7A 1RJ9A 1VA4A 4R9UC 3MB5A 1MIOA 3BBLA 3EC7A 2WY2D 1Y7HA 3RBVA 1UBCA 1Q50A 2I76A 2JAPA 3VJLA 3AR8A 4J7AA 1F8GA 3X3HA 3TQTA 3GAAA 1XMVA 2Y1XA 1IMJA 3GAMA 3QWFA 2HNBA 4FZVA 3O4VA 3WIVA 1Z0SA 3WB0A 2D5IA 1RHJA 1WCYA 5JH7F 4LJ6A 5IF3A 3WGOA 4QUJA 5DSZA 4DLBA 2PAAA 1P7YA 4OSPA 3PQ2A 4V02A 1E1QD 2XUIA 2O0LA 3VH4A 4KV9A 1DUSA 4BP9A 5ALJA 3RF6A 1GHTA 1DC3A 1ZOSA 4BL5A 2YRFA 4QO7A 5EIBC 3UV6A 1MO2A 1GT91 1RLIA 3K0FB 4MRMA 2VP6A 3WFJA 1INLA 1HH4A 4EKGA 4IQ4A 2IPLA 5AJXA 2PBRA 5D3KA 2PX2A 4IIHA 1AVTA 2BV3A 1YZKA 2IXEA 3E7WA 4QD3A 1PVOA 1F51E 2C7QA 3TSCA 3GFSA 2FB9A 3MWFA 5JD3A 1D2GA 3V8QA 2GEUA 3OUTA 1PR5A 1H6AA 1LWNA 2DGDA 4PTLA 4LC9A 1FMLA 1KHHA 2X77A 5BVHA 3M6UA 4Z54A 1Z6AA 4K87A 3T7EA 2OY0A 3U80A 1FLDA 3II6X 3Q2OA 4JI6B 1OREA 3K4QA 3NEYA 1NLFA 4AKHA 3CB4A 3ENQA 4MVJP 1K6XA 2Y0CA 4BVJA 4IJMA 4D2IA 2ZDHA 2VQSA 1OROA 2CK3A 2AOUA 3OJWA 5HJ7A 1GPWB 3HYCA 3NHZA 1ZRSA 1L7RA 4JB8A 4O1HA 1UJ6A 4Q1CA 3KTOA 1RHRA 5CEFA 1P9LA 1Q91A 3Q0EA 4MV4A 2WWRA 3OWOA 3EZXA 3TBFA 3PNMA 3JW8A 2ESRA 5IMSA 3D1JA 3B6JA 4IHJB 3FDFA 1P1JA 4HB4A 1PDWA 1GPNA 4P08A 3R09A 1D04A 4CBVA 1YVRA 3D3WA 1BS9A 3PHGA 4I7EA 4M9XA 3N2KA 4YLEA 3T41A 5LYJF 1YRLA 3H8JA 2PRJA 4Y67A 2C0PA 4GGPA 4UASA 2GAOA 4FVTA 4YAKA 2J3EA 3E3MA 4KQKA 3O2NA 1VG1A 1ODTC 5C52B 2XOKD 1YA8A 5ENVA 4M9QA 4U39A 2BGUA 1GZ6A 2FWAA 2RMKA 1CZRA 3R3WA 5E6UB 3RJMA 1FQOA 4BVBA 1RXVA 2JGAA 2VPIA 5JJLA 4ZANA 3WDKA 4IF6A 4F84A 3EXEB 3F71A 4Q5IA 2HA7A 3QXHA 1Y8AA 2K2WA 3ROTA 3VKWA 2OHIA 1EX7A 4R1LA 1BJRE 1XLWA 4DWWA 3HHPA 5F7JA 4TV9F 3TL2A 2C88A 2C29D 2BSQA 1XT6A 3OQIB 1GZ3A 1RXSA 3C8UA 4M0PA 1WTCA 1HTBA 3QV1A 4FYKA 3GEMA 4C4SA 4CCYB 5ALSA 1ZR2A 2D0PB 3DE7X 3EFBA 3PK0A 4TM7A 1L3BA 4U4AA 3W9YA 4B47A 5FWXB 1V37A 2H7YA 3AF2A 3J81k 2AUNA 5C7YA 1GQ2A 1U1DA 2B8WA 1M67A 4L0QA 3T3IA 1TJ5A 4AZWA 5HWSA 1NA5A 3KEMA 3UENA 3AWIA 2R1TB 3F5MA 4M0MA 2NU8B 2XUJA 2J09A 3WGUA 4UHHA 4BWYA 1FP4B 1P5HA 1OY1A 4TWBA 4QAQA 3M1AA 3O74A 1P1IA 2GEKA 4BO9A 4GOLD 4EJSA 2XVAA 3HNOA 2F59A 4WCFB 1FNBA 3TXYA 4RTQA 5G4KB 3DGEC 1Z9BA 2NZ8A 4A15A 4WN3A 1KK3A 2YZGA 4NATA 2PA0A 1PBNA 3UPTA 2QW0X 4FGZA 4NBWA 2ST1A 4OU4A 4P4GA 1M6VB 5IW8A 3RRMA 3ZXIA 1ZI9A 2H1CA 4IJ5A 1TX4B 1ZM2A 4DLSA 4OD0A 3KQLA 3FE2A 3FH0A 3SKVA 3UT5B 1DO2A 1JECA 1M2VB 1WNFA 1MXFA 1Q11A 4L95C 4YQFA 2PUWA 2YHBA 1TQ8A 2ZIUB 1DARA 3W6ZA 3ZZTA 5CBPB 5M04A 4ZJPA 4RTJA 3OO0A 3USES 1HI9A 3IP3A 1O1YA 3QF7A 1MU0A 4QTXA 4PWYA 1XTPA 4Y6PA 1YE8A 3ZHBA 5JBIA 4G4SO 2P6RA 2RH4A 2D1FA 3DFUA 3IBTA 1GNSA 5E8JA 1AQLA 1Q44A 3IUJA 4UUBA 4DCNA 2Q2WA 4HGQA 1VL8A 3PWKA 4RKRA 2IWRA 1QFSA 4AL4A 5T3YA 3OTHA 1A5BB 2EKZA 4BP1A 3HEMA 3OQBA 2A3RA 3RU2A 1ZQ9A 2I4MA 2JIQA 3K0BA 5JPCA 3L7AA 3VYRB 1NJ5A 2YNMD 2W2LA 3J7AC 4C30A 4ZMBA 2IZ5A 1NJ1A 1NRIA 1R1DA 1RAHA 4KLCA 1GPKA 3KT6A 4MIEA 4BP8A 3OMLA 8ADHA 4OO3A 1JFSA 1RWXA 4PSVA 1YGPA 3CMMA 3ROFA 1QRAA 3GFQA 5F2EA 2IPMA 3FX2A 3LOPA 1VE6A 3OIFA 1NLYA 4L07A 2AV6A 3PT5A 4N65A 3EJWA 5TV2A 4ILKA 1RPJA 4TXHA 3HFGA 4G9GA 4DLPA 5BN5A 3A32A 1U65A 4UUNA 1CEQA 1TLFA 2CJFA 4JLOA 1UL1X 3JQRA 3JAMA 1FDRA 2Z8YM 1UC5B 4AF8A 3ZYZA 4BKQA 2OQRA 5ALHA 4I08A 1TQ2A 4KDCA 2FXIA 1MPXA 1NVVQ 2ZJ6A 4QDZA 3AVXA 1PJQA 1QVRA 4ZT5A 3A3PA 1CQIB 1WHTB 1DFIA 1G4AE 1P2UA 3Q15C 3R77A 5F77A 3ONDA 4ASUD 2XA9A 4EHIA 4O1MA 1WDMA 2NTNA 3HXLA 4CCYA 1FVFA 4QXQA 2AB0A 1NC3A 4YRZA 1QAOA 3LT1A 4WV3A 4CV3A 3UAGA 1PW7A 2JS7A 5H16A 4DDKA 1YQDA 5JBQA 3NB0A 4BUJA 4MRRA 5KQRA 1UKAA 3SOPA 4OIMA 1FJXA 5F98A 3GFTA 4R71A 2GPWA 3GGDA 1VPEA 1WXQA 2WINI 1CR4A 4LJKA 5H9VA 3T1YB 1XRJA 4MO9A 3BT7A 4X85A 1T6ZA 1WCWA 2BFCB 2D4HA 1D9XA 1S3SA 2AJ8A 4KHZA 4LYYA 4DQLA 3EEFA 1SC6A 2EU8A 1KZ4A 3LT4A 4URUR 1NC1A 2FPXA 4MQLA 4NAUA 1II8B 1J2TA 3OSUA 2ZYIA 3JQAD 1JU9A 1AA9A 3DMGA 3UTCA 2XZPA 4RKQA 2FZKA 1ITZA 1JDBB 1MQ9A 1QR2A 1GJRA 3NM4A 4OGKA 1DPFA 1QYCA 3Q72A 4ZMRA 4YJ2A 1RXUA 2F3RA 5IBQA 5FA6A 5J58A 4HC4A 3BHNA 1GPAA 3RLIA 1CHDA 2IVZA 1Y1SA 2IZ1A 3E4CA 1QE0A 3IALA 3R5XA 4FK8A 2RI0A 3L40A 1HQYE 2ZAGA 4NK5A 5DWVA 3GLFA 3R8XA 3KQHA 3Q7SA 4LE1A 5K51A 4GUAA 3N53A 4MIOA 1O5IA 1A8UA 2WWHA 3CA8A 3ONWA 2ZXUA 2YZNA 1WABA 5ARBA 1JIKA 4MPPA 5AH0A 5A3VA 5DGDA 4CEJB 5C8XA 4Z0TA 2PDAA 3CB2A 4U9HS 4GL2A 1OFGA 1OX5A 2Q2VA 1VFPA 2C7GA 2FEOA 2ADFA 4DMFA 3MC1A 1XZJA 2ZVDA 3HJRA 4J0GA 1R5NA 2PLNA 3F96A 1JYSA 1T3GA 1OAAA 4Y2HA 4KYTA 5B6JA 2YDYA 1XTUA 3SX0A 3HN6A 1YZQA 3UT5A 3DHNA 1PS9A 4WXPA 3QJYA 1MDFA 5D2CA 2RCNA 2XB4A 2XNHA 5L6LB 2ZBVA 3IV7A 3KDPA 2C1EA 5B12A 1YHZA 5HG0A 4CLRB 5HRCA 3LUCA 1NBMA 3I04A 5DGXA 4XGKA 1OWMA 4ND7A 2CSXA 2HPHA 3V34A 4HV4A 1KWGA 2HH9A 2VAVA 1VBMA 4W82A 3TEJA 1ZU4A 1IY8A 4EPXA 1WZ2A 1T3LA 3GF4A 3MJFA 5A4AA 3CO0S 1CEEA 4CN9A 1D1TA 1YQTA 2AN4A 4OLJA 3ZDRA 3JQGA 4KQEA 2P6OA 5LQUA 1P2TA 2P9GA 2IL1A 2XWSA 3L1KA 3SSMA 1E94E 2DTXA 4BGDA 1YRYE 2BGJA 2HWYA 2W6PA 4WKBA 3ZJVA 3DF7A 3RD5A 3KAJA 2IOFA 4O2AA 4RK7A 1GDDA 5GV7A 4D3SA 4Q1VA 3B6IA 3E3OA 2BEVA 3MWJA 4MV5A 1B93A 3QHQA 1IH8A 3K2EA 1C8LA 1TQ4A 3TW8B 3ZKAA 4DCMA 4KRXA 4EB3A 3ROPA 2N1BA 1T2EA 2WAOA 4QFMA 5EUBA 4Q3EA 1Q7CA 2ZI4A 2EFCB 1RRKA 2MSCB 1EBBA 1TM5E 3STHA 1XAJA 4OK6A 4X84A 2HL6A 4K9LA 1N5DA 4KQ2A 4WIAA 3Q7PA 5AK0A 2R7NA 1JHOA 2CVZA 5IDWA 4F04A 3RV4A 5SZJA 1G20B 3LGXA 1CHNA 2ZJ8A 1H65A 1G8AA 4J94A 1SKAA 4ZC8A 3EA4A 1ULHA 4WMLA 3D43A 4MGKR 3NQ41 2ZIZA 3ZDFA 3WHKA 3UIEA 4X1KB 4F72A 4JV5B 3EVTA 1VBNA 1XWWA 1ZY2A 3WWCA 5U4XA 3FKJA 2X2EA 4QYXA 2Q5IA 1L9KA 1NQOA 2PS1A 5AHOA 2V96A 3ROGA 3CKMA 3E9RA 2R8EA 4CQJA 2GZHA 1E2HA 4GBED 2J85A 4N3BA 4J91A 1W25A 3R3HA 1SG9A 4X7PA 3BWDD 2C4KA 3B1VA 3W90A 2M1ZA 1NNI1 1JR3D 4PIPA 5F4BA 1VDMA 4RY2A 5D1HA 3DXYA 1ADJA 2AOWA 2CZGA 3DKIA 2C59A 4AWBA 5B6PA 2Y92A 3GEHA 5D6OA 4OP1A 5E2IA 5EHQA 3FWKA 3TDKA 2ZQZA 3LSYA 2FRDC 2IPOA 1RACA 1L5YA 3DLAA 1NKVA 4RL4A 4BGIA 1CQIA 1WHTA 2YV3A 4GYWA 4U6SA 2JIZD 4BKRA 4BASA 1GITA 1IL0A 1TMOA 2D2VA 2UYQA 2PUVA 3I52A 3MINA 4GP7A 4H16A 4YJFA 3E3NA 3NBFA 2QTWB 4NCXA 1Z5PA 1VLQA 3OKCA 4MI6A 3JPWA 1ZVJA 2VPQA 2CKMA 1D4AA 1JDSA 4Y6LA 2W98A 2H1SA 1YQ9A 2RGDA 1T29A 1TXGA 1CW2B 3IEUA 1WUYA 2FN9A 3ZU2A 1OU0A 4OHUA 1ZL2A 1A8HA 4LGCA 4F1KA 1KO8A 1N0WA 2GRUA 4PSDA 5JYCA 4F96A 4N7BA 3O3MB 2JAUA 3B60A 3W0LB 1CS4C 2ZSHA 5GPBA 4ATNA 3QBDA 3L8CA 5F9HA 3UMGA 4PG4A 4E5KA 2FPSA 4LSMA 4X63A 4CLDA 1AU9A 1EP2B 5FEUA 5DYGA 1ACLA 1VHWA 1U2GC 3G2KA 3EGCA 3PJEA 2ZBFA 1JT2A 5AESA 5DTMA 3ELUA 1VCHA 1H9CA 2EG5A 1Y7IA 3ENNA 4UEWA 3AYXB 4KGDA 1MAWA 3RUHA 3F9CA 1NN0A 1VCIA 1BFDA 1TPZA 2HM7A 1JFFA 2O4CA 2QUAA 3K0FA 1ZGAA 3OPVA 1EJBA 1M1YE 4I55B 4LHVA 5FTNA 2YWHA 4CV2A 4WXEA 1ZD9A 2IXBA 4V0QA 4XJVA 3IQHX 4C7OA 4Z4CA 1XU9A 3ZNPA 4QHSA 2FVYA 1QKJA 2JGEA 4NU6A 4H1HA 3EPJA 2KLBA 2O2DA 4NCKA 5AVVA 3IHWA 2B5OA 3PNKA 1OMOA 4HLNA 3OQPA 4DJEC 2MMGA 4FYMA 1U0LA 3OFVA 1OLSA 1FXWF 2HIGA 2J33A 2RBGA 3NR2A 5EINA 4F3TA 2PZ8A 3KO8A 3A8TA 3B5JA 1KI6A 5IBPA 5FI3A 1XYGA 3ZWAA 4LMPA 1RJ9B 4KCGA 3X1YA 5ED0A 1D8AA 4YXWD 2CDCA 2ZSAA 3MFYA 2HQBA 3L6RA 3H2KA 3KQVA 4KWEA 5AT1A 3T5AA 2JFQA 1VB5A 1RI1A 1PFGA 1S8OA 3OZDA 1DRJA 3ZCSA 5LD2B 1XAIA 3V4PB 3JARB 5FAKA 1X2EA 1MX3A 3F2VA 3WC4A 1J9GA 1GNTA 4NBRA 2A0WA 1Z36A 1VRVA 2PL1A 3CGGA 3MXTA 4RTOA 2J3KA 4DLXA 2OORC 1SKYE 2OR3A 4G5OA 5BN1A 1G3UA 4RZ2A 2JLYA 5JPDA 1UQRA 2OMEA 2CLLB 2GPBA 1H5QA 2V7QD 3LX8A 4LNAA 4TKUB 3U17A 4WXYB 3VR4D 3K70B 1SK9A 4IZOA 5CM8B 3INNA 1TRHA 4WLFA 2PSSA 2IC5A 4BJ6A 1WE2A 3F4KA 2C2ZA 4LVUA 2BHRA 5BY2A 2YINC 1IDN1 3L8MA 4KX3A 1BXRA 5JAZA 2PNJA 3UHFA 4J90A 3SE7A 1FMJA 5L7TA 5CCXA 1XD2B 3UHAA 3OUZA 3WB1A 1IMOA 4DR1B 3ZS9A 5LZ9A 2HGSA 2CFCA 4R83A 1WDLA 2EIHA 3BE6A 4EPWA 4YMVA 1XMXA 1IU9A 3DH0A 3WA6A 1EHIA 1WPQA 1GPLA 1YI1A 1Z16A 2MYTA 3AIOA 3LBFA 2P4SA 4P7FA 4X7MA 1W8IA 2ZXFA 4L9AA 2PCLA 1LDNA 5JE8A 2YASA 4KOAA 1VHDA 4UCQA 3T94A 3WLIA 2GF0A 3CLUD 1KJIA 1DJPA 3E9EA 1M8PA 4V0NA 1PZEA 3NYWA 3A4VA 3JQ9A 1WV1A 3MNFA 3T35A 2Q2OA 4KUEA 2DZDA 5TY0A 3QIAA 2NSDA 1U8FO 1RR6A 2YDXA 5E9AA 5DASA 3QYPA 4WNYA 4WZAE 1N6RA 3C3CA 3LQQA 2WHEA 3HJAA 4QGGA 1U3VA 5KTMA 2YBDA 5F52A 4WUTA 4UD6A 1PFUA 1K7FB 3FMGA 2V9ZA 3PB3A 3PXBA 2IUUA 4CF3A 4AYWA 3QM1A 4FONA 1U0JA 3RHSA 4B0PA 5EIWA 2EJBA 1MZVA 4IHJA 2F3SA 3DWEX 3FMPB 3BH7A 1USWA 4G36A 3UUEA 1V9CA 1GGMA 1K8YB 1T34A 4TXJA 3T8YA 5FI0B 3G1UA 4TPKA 1Q7BA 2G9VA 2X22A 3QVSA 4POAA 4BMVA 2LXNA 1I14A 1BGXT 3AR7A 4JZYA 3OZAA 4OB8A 3KKQA 2I5PO 4Q7QA 4J76A 3RQSA 1ICIA 2VZLA 1NX9A 4LOHA 2BF4A 4P3OA 1GWNA 5ITZA 3Q6IA 4ZZ1A 1E3EA 1ZRHA 4QARA 3FOEC 1EX6A 2HLDA 3PPIA 2Z30A 4H7EA 4JYPA 3NV7A 2IV7A 3UWMA 2QT1A 5B2EA 5CNJA 4C4AA 2SCUA 4QOFA 3BREA 1AUPA 3CT4A 1NKTA 1QPZA 5EQJB 5A7GA 2HW8A 3F67A 2IIVA 3L6CA 2H3EA 3D0KA 4O4LA 2WSMA 1U9CA 2GNPA 2PKQO 2O9JA 5GVRA 4HVLA 3QX8A 1LQUA 2WD7B 2ZJAA 3DVSX 3L7DA 4OGWA 4KWCA 2PWZA 2VCEA 3W9BA 3GEDA 2ZAYA 3B1KA 1AKWA 2RC6A 3SDSA 1OXXK 5BWMA 1GARA 3E1GA 3LAWA 2WLSA 3WZ2A 1TYDE 1M1NA 2ZIWB 4UDOA 3G17A 3I34X 2V98A 2OVBA 1HQCA 1V8DA 1ZGGA 1X14A 3TDMA 3T4UA 2IZOA 1KBQA 3H2IA 1WBDA 2C5SA 3AERA 2QM7A 3GYBA 3A9TA 1DAKA 1AXEA 1S2LA 3IQWA 2P3QA 3JZMA 4WZBA 1L5HA 3VNVA 4GD3Q 2EW2A 4QG7A 4LBYA 5EHGA 3R7WB 4IDAA 1U04A 2B2XA 5H8WA 1AXGA 1T4DA 3G89A 3L7MA 2HADA 4C4TA 4OLBA 4AQDA 4YP0A 3VU1A 1XVUA 2PLFA 2DWQA 4OP2A 4EJ2A 3V4RA 3WKAA 3VYUB 4HL6A 5LJIA 4IVQA 1SBQA 1Z7BA 1COZA 4LCBA 4PX9A 4M21A 1XLTC 3T5TA 3EZ9A 4J4BA 3PRYA 2PMDA 3EIUA 2FPOA 3GJQA 3JTEA 2ZE8A 4IDEA 1PK7A 4OUDA 2XMBA 5E3HA 4F6RA 3U4QB 4ZAYA 3WNZA 3R75A 2BGTA 2C2XA 2PLWA 3U4IA 5TARA 4YRSA 5LIRA 3CTPA 4IOJA 1I5OA 4HPWA 2RGGA 1U1FA 1UMDA 2ZROA 2Q3DA 4NNJA 3KZVA 3QXSA 1J7KA 5H80A 5IZCC 5IKEA 4DREA 4K3UA 3KFXA 4I1OA 1L4NA 1EESA 2DUMA 3H2YA 5EERA 2I33A 1HURA 4C05A 2GKOA 3TNDA 3ZI0A 5A5EA 8AT1A 5IULC 1M1UA 2CXNA 3LRTA 4Z3KA 1RYYA 4RKEA 5KWEA 3KSMA 2FPUA 2XYGA 3W6PA 5C5IA 1A7KA 5AKGA 1MBZA 1CJUC 4LPKA 1C9YA 2AJLI 4ZJYA 1Q1EA 3LU1A 3MSCA 1UXGA 1S8AA 2O2HA 1QPBA 4P35A 4S1WA 3CEJA 3RRXA 3A1UA 3S2GA 5FJJA 3ZTTA 1HLGA 1XNHA 1GVHA 3FCSB 1R64A 2XJ9A 2FQXA 3KP1A 4PGGA 2HCRA 1HUQA 4GBGA 1SKQA 2Q3FA 4H7PA 4M0CA 4BN4A 3ZC3A 3ONEA 2CJWA 2YYAA 4MMZB 2KHZA 2D06A 3LM8A 3R0QA 2PKQP 5F3DA 3A10A 5EXTA 3VGJA 1YKSA 4BCDA 1KJZA 4A8HA 1Y3IA 4QLBA 2VYFA 3FGZA 1SU7A 4YT5A 5ALOA 1FQWA 1ZVKA 2IZZA 3FFWA 5GWXA 2AGVA 2FW6A 3RC9A 3U3XA 5IT9A 4RJJA 1K8XB 4F91B 3GFBA 1FYDA 5CDFE 3HCAA 2FR8C 2HIHA 1AN9A 2B4TO 3IVMA 4TUYF 4DVGA 2WAXA 3Q5GA 4FFNA 4S04A 3B3QA 1ORDA 1EDOA 2B35A 2B5VA 4QRHA 2PEZA 4RZUA 4XM2A 2IYPA 3WO1A 4MRSA 1JG4A 3W9UA 2B1IA 3QE9Y 4FEEA 1CUIA 5TVGA 2VYCA 5LB2A 1I0IA 1VIAA 2HLDD 3CINA 2W37A 4WNAA 1NFFA 4O4HB 1MJGA 1V71A 3QKSA 2ZRHA 1V1MA 5C1DA 4RK6A 2PPLA 4E0BA 5ALGA 2YZ2A 1B0PA 2HHHB 4MSUA 3K9NA 1Y5MA 3EWIA 2C77A 2QYOA 4K88A 5AK3A 4DSNA 4Y3UA 2BZ0A 2VUTA 1K9SA 2JGKA 3VHXA 2PZAA 4D9KA 2P9FA 2V7EA 2RGWA 3TI7A 2H1VA 3N2ZB 1U7TA 1ZH0A 2H5EA 2UUPA 2BLLA 1QUEA 3N05A 3ANYB 3STYA 5KNDA 1PJTA 3BZUA 3RC2A 3BK2A 3KJHA 4I9GA 2Z5FA 4N49A 3DV2A 4H77A 2J30A 2VOJA 5FO1A 5AQ1A 5A4KA 2WT9A 4FFVA 2QQGA 3I9KA 1W29A 2YIDA 5G1NA 3SK0A 4C4XA 2I9KA 3PENA 4HX2A 2QYHA 1ZRMA 1QG6A 3CQ9A 4H18A 3TSWA 3G6WA 3KLMX 4CMKA 3KSDO 2X0NA 2G72A 1RYDA 1ZWKA 3N2LA 4NJEA 4RTMA 1PV2A 4Y2PA 3X1ZA 2HEGA 4KR2A 1KQGA 5MFPA 3RRBA 4OHZA 5HF9A 1DIOB 2JFWA 3EB9A 3FWPA 621PA 4OF4A 3D59A 4S12A 3GVCA 2TECE 4O0MA 5TT0A 4HYTA 5J2UF 1F6WA 4Q3NA 1T5HX 1WL8A 3K5HA 4XIJA 4O4JB 4URWR 2J3LA 2GZ1A 3AUXA 4L2IB 3ZGNA 4Q6WA 5JWHA 1JQKA 4XLLA 1ZUD1 2AIRA 3FGOA 4N6NA 3WYBA 3WIUA 4WEOA 1S3FA 4KNYA 3KQTA 3BGOS 5H02A 1W5FA 1FUEA 3I0ZA 4MQUA 3KHSA 4FKZA 4DEXA 3RYCA 3IOEA 4PY2A 1LB1B 1QVVA 2OFWA 2QUZA 4F1WA 1VCMA 3HWRA 3MCZA 2F8LA 4YT2A 5JOQA 3V2HA 3CVYA 1HZZC 5HP4A 2FSUA 1F9AA 1NE2A 4L0MA 4A8PA 4DZTA