3SC4A

Crystal structure of a short chain dehydrogenase (a0qtm2 homolog) mycobacterium thermoresistibile
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
280
structure length
280
Chain Sequence
SLRGKTMFISGGSRGIGLAIAKRVAADGANVALVAKSAEPHPKLPGTIYTAAKEIEEAGGQALPIVGDIRDGDAVAAAVAKTVEQFGGIDICVNNASAINLGSIEEVPLKRFDLMNGIQVRGTYAVSQSCIPHMKGRDNPHILTLSPPIRLEPKWLRPTPYMMAKYGMTLCALGIAEELRDAGIASNTLWPRTTVATAAVQNLLGGDEAMARSRKPEVYADAAYVVLNKPSSYTGNTLLCEDVLLESGVTDLSVYDCVPGSELGVDLWVDSPNPPGYTGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Short chain dehydrogenase (A0QTM2 homolog) Mycobacterium thermoresistibile
rcsb
source organism Mycobacterium thermoresistibile
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase (A0QTM2 homolog)
total genus 93
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3sc4A00
3Q6IA 3PZRA 3VAZA 3I4FA 4GI2A 4YPOA 1EE2A 3ASVA 4QO8A 1KVRA 1X7GA 1FDTA 4DA9A 1XCBA 3BMQB 1XR3A 4J43A 3H9JA 4F6CA 8LDHA 1U28A 3DHNA 1M6HA 3RBZA 3TPCA 4BGUA 4XR9A 4YJGA 1CIVA 1G6KA 2I3AA 1KVQA 3H9EO 1FDSA 5TSDA 4WEQA 4QO7A 4NFYA 5JW6A 2E4AA 5L9AA 1U3WA 2W2KA 1GAEO 2JFGA 2AQ8A 3DOJA 4W9NC 4CLRA 1XEAA 4UUMA 2CVZA 4QUKA 1NQTA 4ND4A 3DFZA 1NXQA 1U3UA 4HP8A 2H63A 1H94A 2PGDA 3ZW9A 4DPMA 3VZQA 2B5WA 5DNAA 4D45A 2QW8A 4E2ZA 2CUKA 1SEVA 1KEPA 1PJQA 4BNKA 4NK4A 4DPLA 1N1GA 3ADOA 4CR8A 3JQAB 1RM5A 2RHRA 5TC4A 1LU9A 1EVYA 5CDSA 4BV8A 1Q0LA 1ISFA 2X4GA 1ISIA 3IMFA 3PFFA 3W8EA 3KHUA 2ZJ0A 1EMDA 3DAFA 2P68A 4R16A 1F8FA 3OSUA 2HJRA 3OICA 1GPDG 4FIZA 5JCJD 4NMHA 3U4DA 3RQSA 1B3BA 4DGSA 4ND5A 4AJKA 3UW3A 3VH2A 2JCXA 1KEVA 1DB3A 2AA3A 3OQ1A 4PG4A 1E7SA 2X7HA 1LX6A 4YBZA 2RHCA 3ZV5A 2PK3A 5DBGA 1MG0A 1Z75A 2GASA 3IJRA 4M1QA 5IF3A 1YXMA 4MVJI 2OL4A 2VHWA 4ZA2A 4Q3NA 2Q2WA 2TMGA 1I10A 2LDXA 4ONEA 1UP7A 3GMDA 3D1LA 2W2LA 1EDOA 1NBOA 4MIOA 3G79A 4F45A 4Y6PA 1TLTA 2A4KA 3B1FA 1ISMA 3KM0A 1A7AA 2D0IA 1QKIA 5HA5A 1VJTA 1ZJYA 3HB5X 1WAMA 1HL3A 4EUHA 1C0PA 4YT2A 3GPIA 2FN7A 2Y0EA 3GG2A 4GBJA 3AM3A 4WECA 4BO4A 4QX6A 1MX3A 4IQGA 2GGSA 4NPCA 2BD0A 4EUEA 1L7DA 1NYTA 1E7YA 1HEUA 3DZIA 3TRIA 3FSRA 3OEYA 2HK8A 1WP4A 4NQZA 3CE6A 1PL8A 3B20A 5A1TA 5T8KC 1SNYA 1N7GA 3NT4A 2PWZA 2BELA 4R5MA 4OH1A 1ZXBA 3LT4A 3PIIA 4C7KA 1TT5A 4CUZA 1I36A 3AJRA 3RKRA 1RYEA 5JC1A 2G82A 3DDNA 3CKYA 4XDYA 1E3EA 4LRSB 1HZZA 3I9KA 1I3KA 2CDAA 3VZRA 3WDSA 1GQ2A 3PHGA 2Z5LA 3OETA 4IJUA 4JBIA 4P8RA 1NASA 3GT0A 4R51A 8ADHA 3O38A 4K1LA 4Z6KA 2FRDA 2O4UX 1CF2O 1GV0A 5G0VA 4TKLA 2Y1CA 3GNTA 1Z7BA 3PDUA 1P1RA 4RVHA 5DCUA 3BMQA 3ZU5A 5MGBA 1YH3A 3TJRA 2D5CA 4GMFA 5KIAA 4DIFA 1PGNA 2AQKA 3E03A 4XIYA 3FNHA 3IQDB 3ZWAA 3AOGA 4JJIA 4H3VA 3EVTA 4EEZA 5ENVA 3SXPA 1FJHA 1BTOA 2ZATA 5KJEA 3GH3A 4CM7A 4DBZA 4HWKA 3GNSA 4GLOA 4CL8A 1Q7GA 4K28A 2QRJA 3WQRA 2AMFA 3N58A 1D7OA 2J5RA 3FN4A 5I9LA 5FYDA 5CFZA 3EZYA 3UICA 2DTEA 3RFXA 2FY8A 3COSA 1A7KA 1B14A 2Q1UA 2CFCA 2C2XA 2Q1TA 3I6IA 2VYVA 3AY7A 1N9GB 1I2ZA 2HMTA 1X0XA 2HK9A 2WDZA 1YL5A 4YB8A 1ARZA 3SVTA 3V5NA 3L0DA 2W2LD 1BDBA 3OJLA 3VKUA 1KC3A 1NX6A 5LDGA 1R37A 2NU8A 2B0JA 4I5FA 1H9AA 3KYDA 1P1KA 4XQ9A 5TGDA 5ES3A 1S6YA 4D44A 3P2OA 1YO6A 3NKLA 3Q11A 1A72A 4YQZA 1Y7TA 2O2SA 5F21A 1J49A 3DBRA 1QP8A 3FD8A 4WNCA 4A73A 2EKQA 4NBUA 1V35A 5B4TA 3KOUA 4IUYA 4M8SA 4WASA 1QSGA 3C1TA 5F5NA 1N1EA 4JX8A 4J2OA 4P4NA 2J8ZA 4J1QA 1EFLA 3PWZA 3GGOA 4FFRA 5JCJA 1RJWA 2WD8A 3BAZA 3C1AA 3QRWA 3QWAA 2HUNA 1I24A 1QXSA 1AE1A 2CMDA 2Y05A 3IP3A 1PTJA 3DBLA 3MJTA 2EKPA 1IZ9A 2WD7A 4XGKA 4XGIA 4L75A 4IDFA 3KV3O 1K6XA 3JD2A 1SC6A 1YKFA 3GQVA 3LZ6A 4FSHA 4GQAA 4JXKA 3RC1A 4BNGA 1YDEA 3GVCA 4IBOA 5G4KB 1U7HA 5A9SA 3JQFC 4L8VA 4BNWA 4BO3A 1IOLA 1BRMA 2C59A 1IL0A 4ZD6A 3GZ4A 4BHTA 2IXAA 4MVJH 2BGLA 4EBFA 3NDRA 1HTBA 3TZ6A 4BGEA 2GN4A 1BVRA 3P7MA 1H2BA 1XU9A 3WTCA 4MVJM 1PIWA 5G2OA 3WS7A 4RPJA 3DZHA 4IINA 4AJ2A 4YYZA 1E3IA 4MVJA 3ON5A 3EW7A 3DBRB 4R5HA 5TJHA 5KTKA 1EEHA 2CD9A 4IGEA 5ILOA 4OHUA 1GCUA 3CINA 4H7PA 4CV1A 3G3EA 5TF4A 1IPEA 5H81A 1QYWA 2Y1GA 4CPDA 4JBHA 3PQDA 4RZIA 2Y1OA 3VVCA 2X5KO 5IFLA 2VRBA 5A4DA 2AG5A 3UAGA 2AEFA 3QWIA 3RKUA 1AHHA 2J5QA 1Y9EA 5C7IO 4R3NA 4NH4A 2WD7B 4ZICA 4E2YA 2H6EA 1QV7A 2P9EA 1KEUA 2NACA 3OHSX 2PZLA 3DBHB 1A9ZA 3K92A 1DRWA 1C1XB 1WDKA 1XIVA 2DBQA 1YB5A 1JWAB 3IL2A 1N8KA 3VZPA 2V65A 4BNUA 1BXZA 5AXAA 3HADA 4IIVA 2JD1A 4J3FA 1ID1A 1S7CA 4BNYA 4OOFA 2O7QA 3JQAA 3QVWA 3OECA 4CM3A 2PR2A 1LRLA 4MP3A 3V8BA 1PR9A 5COAA 4BB5A 1M66A 4BMSA 5TLSA 2YY7A 1GEGA 4TWRA 5TT0A 1GQQA 4UVIA 1DEHA 3ZN2A 3QSGA 3L6EA 4J1NA 4KQXA 5DT9A 3E82A 3UH1A 3BYZA 5J23A 1YQGA 2NTVA 5DULA 3JQ6A 3QVTA 4QXMA 4R9RA 4YJHB 3NRCA 4IY1A 1GZ6A 4JP2A 1PGQA 4LVCA 4CM9D 1E5QA 2ZTLA 3H3FA 3H5RA 4NFSA 1DFHA 4IMPA 4DPKA 5JYEA 4MINA 1NQAO 4J91A 3M2PA 5JDCC 4OGWA 3FTPA 1TXGA 1HLDA 2Q2QA 4BL5A 1SEPA 1FMCA 1GL3A 2YHUA 4A03A 5U9CA 1AGNA 2UAGA 1EE9A 3FBTA 1T2AA 4ILKA 4QTZA 2PD3A 1N5DA 4B8WA 1EDZA 4CLDA 3H65A 4FFNA 1JAYA 1UJMA 2YDXA 2VUUA 4HFMA 1OBFO 3ZWBA 1HWYA 4NJMA 5I9NA 1DO8A 4AJ4A 4AVYA 1U4SA 4QQRA 1BVUA 2VWHA 2HMSA 2WJPA 4Q3BA 1XHLA 1T1RA 1Z45A 4WE3A 4BMVA 4EITA 2PGJA 2LDBA 5G0TA 1VE9A 1LLUA 1NAIA 4IDAA 3WICA 4EGFA 1XQ6A 2Y93A 4WLOA 5K0ZA 1D8AA 1GFSA 5EQFA 4D46A 5CPFA 1H0KA 2DQ4A 3EDMA 1NQOA 2X0IA 2ZTUA 4XKJA 3JV7A 1I8TA 2W8ZA 2C82A 1O8CA 3ZWCA 1I3LA 3BXXA 4GX0A 2VHYA 2QYTA 1JVSA 1LEHA 1ZK2A 3IP1A 2PV7A 1KIFA 3SEFA 2O3RA 3WBBA 4R3WA 1ZO8A 5JMPA 3C7AA 1K2WA 3KXDA 5CDYA 5C7OO 4BNFA 3OA0A 3H5NA 4GX5A 3DB2A 3UCEA 2FOIA 4MVJF 3WTBA 4NJMB 1MB4A 1NFFA 4PLGA 4U5QA 1E1KA 3Q2IA 2V6BA 2YJZA 4OQYA 4YCAA 4CV2A 1UXKA 2BFPA 4ID9A 1E3WB 2PTGA 3Q9UA 3EUWA 2X5JO 4B79A 5IZCC 1R4NB 4D3SA 4N5NA 3DAGA 3DTTA 4WK6A 1H5QA 1ZBQA 3JSAA 4WLNA 4YAGA 3VDRA 3U62A 1OI7A 4ROSA 5AQ1A 3T7EA 2FZEA 1HRDA 2GN6A 4FJ2A 5GY7A 2OGUA 4DXHA 1DXYA 2VCYA 4BNVA 4WLVA 4XJSA 3ZWMA 4PLFA 5CDUA 3HN2A 4MKXA 2OZPA 4E5MA 1U8XX 3E9NA 2IZ1A 2NU7A 1IB6A 2ZIZA 3K6JA 3JQ8B 1UAGA 1YBMA 1P0CA 2GZ3A 2ZB7A 4FJ0A 5F1OA 3GGPA 5IDYA 2BF7A 5JAIA 3GEMA 2DKNA 5I7VA 4KMSA 4LMPA 4NBRA 4PZCA 1LXCA 3WFJA 1R0SA 2GLXA 3F1KA 3RFTA 1T24A 3F5QA 1I33A 1E3WA 3UOGA 4ALIA 2PKQP 4FFOA 3H9GA 1KY5A 4GL4A 4RVFA 1B8PA 1GPJA 4JK3A 4Y8VA 3ZWYA 2ZYDA 3A28A 3PZBA 3U4IA 5JDIC 1AN9A 2B35A 1MA0A 1TI7A 4LW8A 2PGLA 2AE2A 4RPKA 1D1SA 2DAPA 2WYUA 4E33A 5GZ1A 3FNEA 3R3JA 3VHRA 4EJ0A 1P44A 4JJGA 5HS6A 4UVHA 1KY4A 2D3TA 3D3WA 4M87A 1PS9A 4A26A 5JBIA 4UAGA 2EP5A 6ADHA 1WW8A 1V6AA 3H4VA 1JDJA 1ENYA 3AI3A 1DIRA 1GU7A 4NR0A 2GCGA 3KO8A 3VPFA 5BQFA 2AG8A 3H2SA 4ALLA 1Y5RA 4Y9DA 5T57A 3T7CA 1H93A 1V0JA 1HYEA 2X8LA 4XB2A 5EN4A 1ZNQO 4YTEA 4BO1A 2X0JA 3HFGA 1NHWA 4INAA 2VNAA 5IXYA 1HDRA 2DC1A 3IS3A 1W73A 3CEAA 3WBFA 3JD1A 2R00C 4GWGA 3W4IA 1ADCA 1E92A 5KVQA 7ADHA 1AUPA 3PYLA 1ZCJA 2X9VA 3NTRA 4LN1A 4FB5A 2UV8A 2Q99A 4RPHA 3ZHXA 3D5QA 2JL1A 4PGFA 3EAGA 1XWFA 2YUTA 2YHIA 3TZHA 1T2EA 1A4UA 2RH4A 4DYVA 1GZ3A 4E13A 1H6DA 4CL3A 3RUHA 1LC3A 2IXBA 3FR8A 5JPIA 4AJLA 3OFSA 3L6OO 3QW2A 4CODB 2WE8A 5G0SA 1K89A 4DLLA 1VI2A 3I52A 1EBFA 1DAOA 4X54A 3U3XA 3VPSA 3FWZA 4IPTA 4DLBA 1QYDA 1LLDA 1E6EA 3G1TA 1PS8A 1GUZA 4ZVVA 3RUDA 3N7UA 1A9YA 1C1DA 1PS0A 2HCTA 3I4CA 3CUKA 3KSDO 4KUEA 1GZ4A 2A35A 1Y81A 1P1FA 2Q45A 3KYDB 3RJ9A 2X1HA 3IKTA 4L9RA 3BIOA 1J4AA 1YB1A 1LDEA 2PH5A 2B4QA 4B3HA 3ZCXA 4D43A 1U9JA 3B6ZA 2Y1FA 1ENZA 3I9OA 3UCXA 4MVJP 4Y98A 3PI7A 1AXEA 1EVIA 1LI4A 4GWKA 1ISJA 1IUKA 4BKPA 1PGOA 1OZAA 2Q4BA 4WCFB 2WE7A 4BO0A 1PQPA 1BMDA 5CDGA 3BTVA 4XDZA 3VTZA 3WG9A 1NP3A 4R69A 1YVEI 2E82A 4XYGA 3TOZA 1MLDA 1OFGA 1HDCA 2B4RO 2FSVA 2OORA 4G81A 3S2EA 3U4HA 3PQEA 3EGOA 2GUGA 3IDSA 4BNLA 2O23A 4YJFA 1D4FA 4MKZA 3K2BA 3Q9NA 2I9PA 5MDHA 1B2LA 4ZRNA 4GPD1 5TRTA 2Y1DA 3LT2A 1XYGA 4FOSA 2AQIA 4ALNA 4O63O 4E30A 1LC0A 4KP7A 1EQUA 5L51A 3PJDA 4P4GA 1J5PA 1CYDA 2PKQO 1O0SA 1EVZA 3OIGA 2CF5A 4Z9XA 4BKRA 2QG4A 3VZSA 2IEDA 2VYNA 5BNTA 5JE8A 1MV8A 4IDEA 1G0OA 4XRRA 1FK8A 2X0NA 5L4NA 1MC4A 2VZ9A 4YXFA 1LDGA 5IDXA 5ILGA 1GQYA 5TNXA 4BNHA 3L4BA 2HK7A 4BB6A 5T8KA 2I76A 2BMAA 5A02A 4Q3CA 3MTGA 1UAYA 3GVPA 3TF5A 2VZ0A 2XAAA 3S2FA 1QLHA 2ZB4A 2DFVA 1HXHA 4CMIA 2PNFA 1W8DA 1ZH8A 1UDAA 4N7RA 4J1SA 2HKIA 5ADHA 1I32A 1VKNA 3GOHA 3UF0A 2QQ5A 1PZEA 2C20A 3C85A 3C8MA 1LTHR 3RVDA 1SB9A 3ABIA 3PTZA 3WFIA 3H9UA 3INGA 5BSFA 1ENPA 2D1YA 4JIGA 4YVFA 4R1TA 2W90A 4PFJA 5B4VA 2D8AA 1B16A 4LK3A 1ZKMA 3H7AA 1PQUA 5JO9A 3EHEA 3TZQA 2AEJA 2SCUA 1R12A 2OHXA 1NPTO 1NQ5A 3SC4A 3EY4A 3ZU3A 1KVUA 3OJ0A 4D7AA 4CMHA 3AOEA 3IKVA 5KOIA 2F1KA 3NDIA 1NVMB 3WGQA 1SAYA 5HRUA 5T5QA 3MJCA 5G4LA 2B36A 1AHIA 1HE3A 4TVBA 2PD6A 3U9LA 4Q3AA 4ZQGA 3V2GA 1NAHA 1P33A 4BMNA 4CMGA 2E6UX 4FBGA 3HQ4O 1QRRA 4HADA 1WDLA 3GFBA 1DSSG 1HKUA 4UVDA 2BHLA 5TJ9A 5EQDA 1HT0A 1Y8QB 3IUPA 3RUAA 3ZV6A 3W6UA 4W99A 1BGVA 1PL7A 4CMAA 4ALKA 2YQ5A 4IJKA 4HKTA 5DN9A 1GR0A 2FZWA 3PYMA 4UULA 5L3ZA 1KEWA 1CJCA 4BQPA 3F9IA 1DC3A 3T4EA 2G0TA 3FR7A 3NAQA 3PHLA 4OSOA 2R00A 2YV1A 2V7PA 2QRLA 1CRWG 1V8BA 3TSCA 1U2GA 4OJNA 3EYWA 3BHIA 1FXSA 4ZQHA 1BWSA 2J3IA 1CQJA 1Y5MA 1U5CA 1B8VA 4BV9A 2X9GA 4IIUA 1KETA 3HUDA 4B4WA 3INRA 3TZCA 2EW2A 2Z1MA 2P9GA 4BUCA 2X22A 2CY0A 1T2DA 3JCZA 3V1YA 3JQBC 3TL3A 1ZK3A 5L4SA 4XJTA 5I9MA 3C1OA 4EYEA 3ZNPA 3EK2A 4KTTE 1JTVA 1E7MA 2GN9A 2AW5A 3WGOA 2JCVA 5FEUA 4GX1A 2EF1A 4MP8A 3WXBA 5JXWA 5G0WA 3LF2A 4BKOA 3H9QA 3Q0EA 2QZZA 1EUZA 3IAHA 5BSEA 1MFPA 1N7HA 1QV6A 1WZEA 3JYOA 4GSKA 3WYBA 1OC2A 3JQ7A 1R0KA 1F14A 1XGKA 2FMUA 1Q2XA 4PG6A 3PVZA 5KJ1A 5KWEA 1CERA 2DLDA 4Q39A 1C0LA 3W8FA 3JQ9C 3ZNQA 3NYWA 3UFXA 1RYDA 1YL6A 5A3JA 4E4YA 3JYNA 2HDHA 4E32A 1XDWA 5TIIA 1EK6A 4C4OA 1EQ2A 5A3VA 2B5VA 1DLJA 2JHGA 3UVEA 2EJWA 3B1JA 1M2WA 4N54A 4RL6A 3I9MA 3S2IA 3AU8A 5L53A 1NWCA 1H6CA 2OXIA 4N5MA 1I2CA 2C7GA 3PYXA 1ONOA 4Z3DA 3AFMA 4W82A 1LLQA 2IEBA 3BMNA 4R1SA 5CEEA 1H2HA 4U0KA 3LT1A 3ROQA 3RCBA 4N5LA 3IOYA 1MFZA 5FFFA 3L9XA 4U8GA 5FF9A 4AJJA 2C07A 4I5GA 5IDWA 1BW9A 1BXKA 2D5AA 2Y1EA 2UUOA 4TZKA 4BNXA 4MKRA 3TWOA 4E5KA 3KYCA 4PIVA 4D0RA 2XXJA 3F4BA 2GERA 3I1JA 2I3GA 3D4NA 1SMKA 5F1KA 4DVJA 3WMWA 5IG2A 3QJ5A 4UEKA 5LCXA 2BRUA 2OP0A 2VHZA 3STHA 3ANNA 2GN8A 4B7XA 3C3XA 1GUFA 1T1SA 2DBRA 1M76A 5TQVA 4I5EA 3KYBA 4DC1A 3RU7A 3GUCA 5F3RA 5I7FA 3WIEA 1ZXLA 1EVJA 3PLRA 5IXSA 3ZI0A 2NQTA 4FW8A 3TOXA 4UVEA 5AYVA 4Z0PA 2Z95A 1YOVA 2NQ8A 2O3TA 4FFPA 3LC2O 5A5FA 4J6FA 2FPPA 4BNIA 4JP3A 1U1IA 3HG7A 1UP6A 1LDYA 4WEOA 3WGYA 3DR3A 3OP4A 2BGKA 2I99A 4FFMA 1V3UA 3BTOA 4UEJA 3ZHZA 4DQVA 1KC1A 2O3UA 3I23A 3T4XA 3WNQA 3S2GA 1XLTA 5KKCA 2EGHA 3F4LA 4LCEA 3MWDB 1ZIDA 2WM3A 4YR9A 1LNQA 3FNFA 4ZHSA 1VSVA 1WZIA 3KLPX 3M1LA 4OQZA 2J3HA 3DO5A 4TQGA 2IZZA 1Y8RB 2GZ1A 3RUFA 2VZ8A 3GK3A 1YS4A 5BNFA 1KBZA 5COQA 1GADO 1V3VA 1PJSA 3GVHA 3AW9A 4J1TA 4PG7A 2GNAA 3JYQA 3D5TA 1DPGA 4YAEA 2NNLD 1YBVA 1IHXA 3L07A 4KDFA 3IJPA 1LSJA 4Q3EA 1CEQA 1NFQA 3CXRA 4IDDA 3K5PA 4YJDA 2RAFA 4B4VA 3PFWO 4TRNA 2J5KA 2VWGA 3JQAD 4CM1A 5FWNA 2XF8A 4HFRA 3WYEA 3DL2A 4FCCA 4AJNA 5HS4A 1PSDA 3PRJA 1HYGA 4HNGA 1NTOA 2ZYGA 5LC1A 2P91A 4Z9FA 5BR7A 2EWMA 2UUPA 3FRJA 5C37A 3U5TA 3HDYA 4IGFA 4OSPA 3KB6A 4HY3A 4BO2A 3I5MA 1E1NA 2QRKA 1V3TA 1YE3A 4CM6A 4NBVA 4G65A 5I8ZA 2HMUA 1HYHA 1PJ4A 1U3TA 2HLPA 5B4UA 1PEDA 4YEDA 1L1FA 3WNVA 4UVGA 3DWFA 3DMTC 1WXDA 2PFGA 2ZKLA 3WGHA 4RGBA 4EJ6A 4R54A 1TB4A 3P5SA 5L7TA 1K5HA 2X23A 2OBYA 4XQEA 3E18A 4TRRA 3NV9A 4L76A 2H1SA 4ND2A 3F6YA 4FOOA 2Q4EA 3CH6A 1KVTA 1SO8A 4A2CA 1P1HA 2EJVA 4HBGA 4NI5A 4W6ZA 3E9MA 1FDUA 3ORFA 5DCYA 3AUAA 3H5AA 1U3VA 3KYCB 3RJ5A 4CJXA 2FR0A 3GVIA 4PN3A 4A7PA 3WMXA 5EIOA 1GUYA 1GV1A 4IXWA 3RC2A 4CV3A 4YWJA 2DT5A 4OMUA 3WJAA 2P4HX 3GG9A 3WWZA 4ALMA 4PZDA 2G5CA 5A04A 3I9LA 5EINA 5HWSA 3CZMA 3S55A 1U8FO 4U7WA 1NWHA 2BFMA 4ZQFA 3BHMA 2EGGA 4BKQA 3AM5A 4E0BA 1GCOA 3DHYA 1P9LA 1P74A 3E1KA 4DREA 5DP1A 3TFQA 1UZLA 5JY1A 1LSUA 1B8UA 2B4TO 5ITVA 5JYDA 1EK5A 3JD3A 4EUFA 5I7SA 4FGWA 3MEQA 4D42A 4CM8A 4I08A 1QYCA 4B4OA 5KJ6A 3W4JA 1VRWA 3BMCA 3QVOA 4M49A 4DTIA 1O6ZA 4XYLA 2V6MA 2HRZA 3B1KA 3WJ7A 1BHSA 2PA3A 1A27A 3PHHA 3TL2A 2R6JA 4FJ1A 1WLYA 4CLOA 2O4CA 3MZ0A 4YQYA 3O8QA 1HLPA 1SPXA 2FWMX 5DBFA 4B8ZA 5JY6A 1FF9A 1P1JA 3O4RA 3RC9A 1OOEA 3AY6A 3CMMA 4BO6A 1X14A 4WOKA 2GPTA 3ZWPA 1Z6ZA 2VNSA 1HDZA 2VUTA 4HUJA 4EW6A 1I0ZA 2WYVA 3ULKA 1H6BA 3CIFA 3FCOA 3PEFA 4ZQBA 3VPGA 4GMGA 5AXBA 3PWKA 4IM7A 3QP9A 3ETEA 1LA2A 2Y0CA 4GH5A 1EBUA 1VL8A 5EJ2A 4Y6RA 1T2FA 1PJ3A 3MJVA 2W2KB 4RV9A 1YDWA 3GA0A 1R4MB 5A05A 1YJQA 4I8XA 2PKRA 1CDOA 3U4CA 3CPSA 2ET6A 3CZRA 4E12A 1U5AA 3WB9A 4JN6B 2D4AA 1ZUD1 1DRVA 4LISA 3G0OA 2VN8A 4XB1A 2CNBA 1E7RA 3M2TA 4HFJA 4XGNA 4BNTA 3WGTA 3VTFA 1I5RA 3DBLB 3ICCA 1PGPA 2X86A 4YDRA 1J6UA 1F17A 2NU6A 3QWFA 3DZBA 4L4RA 1IYZA 1G0NA 3FWNA 4UUNA 3WWYA 3JQCA 4L0QA 4IQ0A 1PGJA 2E37A 4WLEA 4CMKA 1FDWA 4YAJA 1YB4A 1DHRA 4NG5A 4J7CA 3SX2A 3W8DA 3DFUA 2VT3A 1ENOA 1IE3A 3BMNB 3Q3CA 4FS3A 4XEHA 2HJSA 3ZWOA 1C14A 3PPIA 4J4BA 4A10A 4YRAA 4NJOA 3DMTA 3RBXA 5H83A 1LRJA 1VL6A 1ONPA 2DU8A 1I3NA 4BKUA 3I9JA 3JD4A 4XD2A 1M6WA 3C7DB 4DMLA 4OXYA 1HE5A 1WVGA 4CLEA 5ITWA 4K6CA 3AUSA 1ZK4A 4P22A 3PQFA 2G17A 2NVWA 4JROA 1N2SA 1HDOA 3ITDA 4FFLA 4S1VA 1N9GA 3PWSA 1TA4A 3R0IA 1KOLA 1X1TA 4FPXA 4NBWA 1UXJA 1HE2A 2NUAA 1OAAA 1NR7A 2HRBA 5AXCA 3ZWVA 3AK4A 4K9DA 5EESA 4OO3A 2QZ9A 4PLTA 3JQ7B 2J3KA 4II3A 2OP1A 5IN4A 3PHIA 1P3DA 5JLAA 5TT1A 4XZ3A 1O94A 3NJ8A 1ORRA 4QEDA 4AL4A 1C0IA 2VHVA 5IZ4A 4BVAA 5JAZA 3K2EA 1DC6A 1DC5A 5L4LA 3PJFA 4MVJD 2HAEA 4LVUA 3BMCB 3TNLA 4TZTA 4QFCA 4B7UA 2CSUA 2DTDA 1QG6A 4D0SA 2YYYA 1JVBA 3BTSA 9LDTA 4KOAA 4RVSA 5JNLA 3OM9A 1JKIA 3RIHA 3AUUA 2PY6A 3KETA 4DBVO 2DPGA 1DLIA 1EFKA 3QLJA 2Y99A 3DMYA 3HSKA 3JQ8A 4HXYA 1Y8RA 1WWKA 3LK7A 3M1AA 4JLWA 4BO7A 3K8ZA 4WJZA 3GFGA 4Z3KA 2X0RA 3M6IA 1LQTA 3NJ4A 1BXGA 1Z7EA 3ZV4A 2OBNA 4FN4A 4YT8A 4D3FA 5L7WA 2GDZA 1RM3A 1YGYA 5KCZA 2GYYA 4LMRA 5CEJA 3PIDA 1LQUA 4E31A 1RWBA 3ZV3A 1MGOA 1R4MA 1F12A 4MVJE 3LC7O 1Y9AA 3CTMA 4BNJA 1F06A 5K9ZA 1M67A 3QE3A 4NFHA 3UHAA 3D4OA 4IDGA 3TQHA 4RCVA 2PZMA 5A9RA 2VRCD 2C2YA 1E1LA 5JAQA 1HETA 1SOWA 2PLAA 5CEFA 1H9BA 4J7XA 1DRUA 1HSOA 2BGMA 4J90A 2ZCUA 4MO2A 3RBVA 1WPQA 2Q1WA 4J0FA 1ZEMA 4RDIA 3RC7A 3F1LA 3PP8A 3I6QA 4D79A 4O6VA 4RZHA 1PWZA 4MVJG 2GD1O 4CLHA 2C5EA 4Z0TA 3HE3A 3RSHA 3PDJA 4FGSA 4IDCA 4PRKA 2X58A 4XX0A 4CQLB 1XSEA 2RIRA 4E21A 4HNHA 1JU9A 4J4TA 1HE4A 2O3JA 3GPDG 2BKAA 3OQ6A 4MOWA 4RVDA 4CR7A 3NTOA 5CG2A 4LGVA 3ST7A 5FI3A 3K96A 1E7QA 4XYMA 4C7JA 1TT5B 3LSYA 1P1IA 2P9CA 2A94A 4NU6A 3R3SA 1DDOA 3GRPA 3AWDA 1L7EA 2J3JA 2IDZA 2OO5A 1XU7A 4F46A 4M54A 1DIGA 4RQUA 1LSOA 1MXFA 4AG3A 1NNUA 5JO0A 3MCVA 4R41A 2VWQA 4B4UA 2QIOA 3LLVA 5H82A 4NHEA 3JYLA 1R4NA 4W9NA 4YJHA 5IN5A 3BHJA 1RM0A 1ML3A 5G4KA 5A9SB 3AOEC 1LUAA 2IE0A 3HN7A 1B15A 4TRJA 5GZ3A 2ZJ1A 4F6LA 1HZJA 4L73A 4R9SA 3H8VA 1PZHA 1T25A 2DBZA 4R4JA 3N74A 1LDNA 1CETA 1PJLA 4J9UE 3LC1O 4G5HA 5EPOA 3RUEA 3DZKA 1HSZA 2FSSA 4YT5A 3X2EA 1JWBB 4CLOB 4NNJA 4YT4A 4ZN6A 3KLMX 1YL7A 1E3JA 4R01A 2ZCVA 1GEEA 4ITUA 5DCWA 2EP7A 5GZ6A 1E0DA 2OFPA 4CMEA 3ENKA 3V2UA 3JQFA 5AXDA 3K31A 4CMJA 5HM8A 1HF3A 1ZK0A 1ZSNA 1IHYA 4IJVA 1DC4A 4XR4A 4YRBA 1C3VA 1R16A 2A92A 4A27A 1DJQA 4B3JA 4BS9A 4D3DA 1JW9B 2WYWA 4XRGA 4PVDA 1O9BA 4LCJA 3KSZO 2QX7A 3DZGA 5ER9A 3GUYA 4PLWA 3Q2KA 1X0VA 3ZNOA 1VC2A 1LLCA 3L4BC 4YACA 5KKAA 9LDBA 2NLOA 3G49A 1DHTA 1XELA 4WGGA 3KBOA 5B37A 3G1UA 3D4PA 2TMDA 2V6FA 3A1NA 3TZKA 3WGIA 4R1UA 4WLFA 5L40A 3HWRA 3KZVA 3PHJA 3JTMA 2Q49A 3D3WB 3WSWA 4ESOA 4NDNE 4OL9A 4MIYA 3WGZA 1NHGA 2E48A 3GHHA 2UYYA 3S8MA 4CQMA 3F47A 3E6AA 2BFAA 1BSVA 4AJEA 2D59A 2P5UA 3QWBA 1ULUA 1HDGO 3ONEA 4I9UA 5JAMA 4BNMA 1QR6A 4AJHA 2I65A 2ZQYA 3QHAA 4YJGB 3VVBA 2DVMA 3L9WA 4YAIA 1E6UA 2CF6A 5JMWA 4DYDA 3NX4A 3GN2A 4RF4A 4CM8B 4I5DA 4CLRB 3O03A 4GGPA 2C54A 2XOXA 5LDHA 4CM9A 3DZFA 5B1YA 4KUHA 4JQCA 3OBBA 4KTVE 3SJUA 3DAPA 5IAAA 4QECA 2FR8A 3W4KA 5B12A 2DPHA 4OAQA 2VT2A 5I8WA 4OXNA 5F1PA 3JYPA 3D7LA 3RASA 3GMSA 2NWQA 1X15A 4OM8A 4HV4A 1DIAA 4EI2A 4M86A 4EEXA 4J4HA 2VTDA 2JD0A 2VYND 1R15A 4PLZA 3ENNA 4XQGA 4EZBA 5THQA 1NVTA 3WYCA 4RVUA 2GSDA 4BOYA 4PRLA 4O1MA 1VJ0A 3HZZA 4O5OA 1YWGO 2EW8A 2IODA 3DZJA 3PGXA 1XQ1A 1R6DA 2O3QA 4NBTA 2HMVA 3LYLA 4NIMA 1ADBA 3QWHA 4NU5A 3RD5A 1C1XA 4HFNA 4OKIA 2HMWA 2HQ1A 3RUIA 1ONNA 1Y8QA 4OXKA 4CLXA 4Y67A 4P4LA 1K6IA 3KTDA 3R6DA 4QFDA 1ZSYA 1Y6JA 1GTMA 5F5LA 3FBGA 4XIJA 1Q0QA 3DONA 1E3SA 2DUUA 2NTJA 4LSWA 3ANMA 5JFOA 1VM6A 2JFFA 2YQ4A 5U1PA 3V2HA 3NT2A 3WX0A 3S1LA 1HDXA 4DIBA 3LU1A 1B26A 3AM4A 4JCOA 4YA6A 4P38A 3PLNA 2EEZA 1RPNA 4WOJA 2OMEA 3IIEA 4OIMA 3K73O 4L4XA 5EMHA 3E9QA 3FHLA 3ROMA 3LF1A 1XG5A 3ONFA 1A71A 1Q7BA 1O5IA 2Q46A 4E5YA 2HO5A 4KZPA 1E77A 1X13A 4GLLA 3AU9A 3GZNA 4B7CA 1FDVA 1B0AA 1ZFNA 4RQTA 3ZGYA 1BDMA 1EUCA 2AHRA 3V1UA 1YJ8A 2GR9A 3VH1A 1DOHA 1IY8A 7MDHA 2ZB8A 4TROA 1Z82A 4CMCA 3BA1A 6LDHA 1LSSA 4OYRA 1T2CA 4I9NA 4AJIA 1WMBA 3H6KA 4KWIA 4YRDA 2AQHA 4CUJA 5JSFA 2AEMA 4WKGA 5KJFA 2EERA 4QT0A 2NSDA 3GC6A 4MJLA 2VHXA 4AJOA 1VLLA 3SLKA 4PLVA 3HNPA 2DTXA 4CQMD 3C24A 5FI5A 4XQCA 4OOEA 3VPXA 4PZEA 1LDMA 5EERA 2P2SA 1SZJG 1CWUA 1O89A 1VSUA 2DFDA 1ZW1A 1PJBA 2IRWA 2GRAA 4Z9YA 5KVCA 3D64A 4IS3A 1E6WA 2Q50A 2WTBA 2EG9A 4FD3A 2NADA 1TVEA 3AI2A 4RJTA 4RDHA 4RF5A 4II2A 5CG1A 4OKNA 3QVXA 1MXHA 1T26A 4U0JA 4WCDA 3UCFA 3PGJA 4BO5A 1KERA 1ZZEA 3DHEA 4N18A 4AJ1A 3P2YA 3EZLA 2A9FA 5GMOA 2I67A 3ICPA 4RVGA 4GX2A 5A9TA 5BT9A 5CP8A 2GZ2A 3DBHA 1I01A 1WDMA 3E5RA 2AE1A 5JDIA 3A4VA 2H9IA 2VQ3A 4HX5A 3SJ7A 3JQDA 1E7WA 4IJWA 1NVGA 1ULSA 4UREA 2CDBA 1VPDA 4BIIA 2ZYAA 1XKQA 5KVVA 5ER6A 4EJMA 3F3SA 3DTYA 3QV1A 2ZQZA 3GRKA 2DUWA 3E8XA 2YZ7A 1LBEA 2NVUB 3X2FA 2EV9A 4LRTB 1GY8A 3ZWXA 3AFNA 3QVSA 5G0UA 4GAEA 4KWHA 2YDYA 2X5OA 5DOZA 2I66A 5JCXA 3DQPA 1YOVB 2XPCA 3W6ZA 4J7UA 3GF4A 4FC6A 1TEHA 3OH8A 3DBVO 1E1MA 4Q3DA 4RF3A 3WQSB 3GEDA 4IMRA 5AOVA 4E2WA 1P77A 3NDJA 2Q2VA 1MG5A 2ZK7A 3FNGA 2B69A 4E5NA 1ISHA 3BMOB 4GVXA 1C1DB 4BGVA 1YBAA 2JHFA 3VDQA 2Y66A 3GY0A 3MOGA 4ZJUA 3EC7A 3KSUA 3OF2A 5U4QA 1EZ4A 3OIFA 4EDFA 3GHYA 4RLSA 4UUPA 1ZMTA 1A4IA 1DJNA 3VOSA 4E6PA 2FPGA 3HB4X 1YONA 2C7VA 3KUXA 1NR1A 1QYVA 4FR5A 3ROKA 2QHXA 2WWRA 1JAXA 5I7EA 3RFVA 1GDHA 2BI7A 5AVOA 3A9WA 4CQMB 2FHSA 5ICMA 4WCFA 3ZH2A 3MJEA 3GZNB 2X6TA 3K30A 4MP6A 1ADFA 1ISGA 2NV6A 5A5EA 4AFNA 5TX7A 1Z73A 2W98A 1NFRA 2O2YA 3WR5A 3UXYA 2BLLA 4JBGA 3AI1A 1U7TA 4JJFA 3PK0A 2VOJA 5K6AA 1PZFA 2B83A 1H6AA 2C0CA 1D1TA 1GYPA 1K3TA 3DOOA 2PZKA 1X1EA 5DBIA 2P5YA 4KDEA 2JJYA 2CZCA 5A06A 1JQBA 3INTA 2O50A 3LDHA 2EHDA 2O48X 2BFOA 3FPCA 4PG5A 3TFOA 3ZWNA 2HU2A 3OJFA 3ZU4A 4BQRA 3RAJA 4J16A 1VL0A 4PLCA 4RORA 2E49A 5IJZA 4DC0A 1O95A 1PWXA 4DIOA 1UP4A 3UKOA 2JAHA 2RH8A 4L74A 3VC7A 2NVBA 2AXQA 4GKVA 1KS9A 1UXIA 4KQWA 4CM4B 5BNIA 2ZTMA 3VH4A 1QYXA 3ROPA 4GGOA 2JCYA 1Q7CA 1NPDA 3GN1A 1I2BA 2I5PO 4UUOA 5KNLA 1ZJZA 4E5PA 3ZHBA 3ZU2A 1VKOA 3HHPA 3RWBA 4PG8A 3SLGA 1HDYA 5IZCA 5EL0A 3LQFA 3WLEA 2W4QA 3PJGA 2HSDA 5ENDA 1W0CA 1G1AA 1LDBA 3UN1A 3HJAA 2VOEA 3IUSA 4MDHA 4E2XA 1M75A 2P4QA 3ITKA 3OJEA 4FC7A 2Y0DA 2PH3A 1BG6A 1RM4A 1WNTA 3C7CB 4FDAA 4J9VA 4O59O 1DAPA 4TSKA 4CUKA 5L95A 1PJ2A 2Y68A 3RU9A 1QLJA 3H2ZA 3O26A 5DOVA 2CVOA 4IS2A 1JN0A 1DIBA 5A03A 3MJ4A 2BI8A 1K6JA 2IYOA 3ONDA 4GVLA 1MUUA 5T64A 4DMMA 2Q3EA 2VTEA 3HDHA 3K9QO 2FPIA 3D3EA 3JQGB 4H16A 3U09A 1R0LA 3WGGA 2VYVD 4O0LA 4GSLA 4CM4A 4XWYA 3NTQA 4CMEC 2NM0A 4PVCA 1Q1NA 3FI9A 3KEQA 1R66A 1UDBA 2NU9A 4E3ZA 5C3MA 1I30A 1VJ1A 3OMLA 3TDKA 3WOHA 2EIHA 1CQIA 3EVNA 1SB8A 3ZDFA 3A14A 2VWPA 5KVSA 4YJFB 1UZNA 3O8QB 4J49A 1F8GA 3ZNNA 3VKVA 3NT5A 1QMGA 1U2DA 2ZTVA 4R68A 4CR6A 3LVFO 4IZIA 1GD1O 3DC2A 1UXHA 2IYPA 1P0FA 4ZRMA 3A06A 1IPFA 1ZMOA 4Z0HO 1T4BA 3GDFA 1QORA 3WIDA 3VPHA 1PU2A 3AY3A 1U4OA 1OC4A 3MTJA 4MIEA 2Q1SA 4ZU3A 2PZJA 1E3LA 4JGBA 4ALJA 4DLAA 4W7IA 4XA8A 2JKVA 3NGXA 2D2IA 1WMAA 2WEKA 1W4ZA 1W6UA 1ZEJA 3ETGA 1X7DA 4NZ9A 4WPGA 3JQGA 2I6TA 1LJ8A 4RO0A 4WCFC 2CVQA 4K6FA 5C5IA 4NK5A 4CM5A 4J2HA 3CMCO 3GR6A 2Y67A 1NPYA 1PR3A 3ADPA 5JS6A 5L45A 2IZ0A 3GVXA 2PD4A 4DQUA 3GAZA 4U6QA 3ASUA 1AXGA 4BNZA 3U0BA 1JKJA 1T4DA 5THKA 3V1TC 4YAKA 5BSGA 4FQ8A 5T6BA 3I3OA 4H15A 4A0SA 5JC8A 2CDCA 3RROA 2YHIB 3FPLA 4URFA 1UXGA 2EXXA 3ZW8A 3GDOA 2ILTA 3QQPA 1DIHA 4L4SA 3RUCA 3NEPX 3KVOA 5TS3A 3D0OA 2XXBA 1BXGB 1A5ZA 1K0UA 3KEOA 4ND1A 3ZHYA 3E48A 1J0XO 4BNNA 3OIDA 5K6AC 2H5LA 2G76A 2GF2A 3DEYX 4BGIA 1X7HA 3WQQA 4GKBA 1LRKA 2JFHA 3O9ZA 2BH9A 4UEOA 1KVSA 2J6IA 3F5SA 2DM6A 1D3AA 2YFQA 1NM5A 2X9NA 1P45A 4TRMA 4PCVA 1JKFA 2Z1NA 3GLQA 3U49A 1ZVMA 3L4SO 4AJPA 3ETDA 3UUWA 4WLUA 1RKXA 4ZGWA 1YQDA 4CMBA 3QA9A 4WNIA 4Y6SA 5COBA 3Q1LA 3P19A 4CV0A 2VRCA 3TN7A 2ZB3A 4IDBA 2JAPA 2OUIA 1SCUA 2V6GA 5ICSA 4I1IA 2R2GA 3QIVA 3KRTA 3WLFA 2C29D 3HDQA 4ND3A 2NVUA 3SBOA 4W7HA 2JD2A 3VH3A 1MC5A 1KYQA 3OQBA 3AUTA 1PZGA 5C7LO 3MWEB 1F0YA 3NGLA 3GEGA 4IQ8A 3PXXA 5IDQA 4PLYA 3L6DA 1JA9A 1P31A 1PJTA 1YRLA 2WSBA 3ZZNA 3BZUA 3PJEA 3DXFA 4TKMA 1Q0HA 1IZ0A 2FR1A 3GNQA 3RI3A 1Y1PA 2C5AA 2G1UA 3GGGA 3MJSA 4AICA 3DOCA 1YQXA 1UH5A 5CAEA 3EMKA 5DDIP 1PL6A 3GAFA 3IC5A 3BTUA 3ANLA 4JNKA 2VUSA 4RF2A 3SC6A 3H3JA 4A5OA 4U6SA 4R1NA 4DL9A 1DBVO 1B7GO 1PX0A 1N92A 1UUFA 5HTOA 3B70A 3CSDA 4TVOA 3FF4A 3FTNA 4Q9NA 1OMOA 1UDCA 1JLLA 1UZMA 2YV2A 1DFIA 4M89A 4IXTA 4J0EA 1PJCA 3LLSA 3ZWWA 1DFGA 4S3MA 4PLHA 4PLPA 4BO9A 1I3MA 5L7YA 2FP4A 5HBRA 1GYRA 3R1IA 2NTNA 1Z74A 4F3YA 1MP0A 2GO1A 4QSMA 3WSVA 2QYSA 3JQBA 3I83A 2F00A 2POQX 4WUVA 1PQWA 4LSMA 4CMIB 1SBYA 4XCVA 3UGKA 1XA0A 4I9HA 1B3RA 2WMDA 5T67A 2O7SA 2OOSA 2B37A 2RBEA 1GYQA 3OJOA 5DP2A 2RCYA 3QY9A 3HFSA 3I9NA 4B3IA 3NUGA 2YFHA 4XYBA 5CDTA 4DWVA 1IULA 4KUGA 4MPDA 1UR5A 3G17A 1ADGA 5DF1A 2YV3A 4IZHA 3OA2A 4M55A 3L77A 2O3SA 5DZSA 3JQ9A 3JQEA 4RLHA 2UDPA 1C0KA 4ZQEA 2YW9A 1SOVA 3W1VA 3OEWA 4BO8A 4CQLA 5CHEA 3GDGA 1E5LA 4RPGA 5CPBA 4DQXA 3MOIA 4K26A 4TMFA 2EKLA 4W4TA 1V9LA 4DRYA 2UVDA 5JDCA 3F46A 4D41A 1EUDA 3LT0A 3BMOA 2DBVO 1BW9B 4RPLA 3HDJA 4DUPA 5KJCA 1TT7A 3E5MA 4XYEA 1ZSVA 3JD0A 1ZK1A 4G2NA 5BSHA
chains in the Genus database with same CATH superfamily
3Q6IA 4RJ2A 2BBTA 3VAZA 2PAAA 3HZRA 4F4CA 1HQDA 1U1FA 3C6QA 3IDOA 1EE2A 2RHMA 3ASVA 4DQLA 1KVRA 3VR4A 1E2JA 2G6BA 3BMQB 4MDEA 2A0FA 3B51X 2ZUBA 3GBSA 4I55B 1IIBA 1S2LA 3R7SA 2XRFA 4WW0A 1IRIA 5LA6A 1XTSA 1W4BA 1MNAA 3SF8A 3T5PA 1M6HA 2C1XA 3TPCA 4ECEA 3PUIA 4XR9A 1N25A 1N2CB 1NN5A 3GJ6A 1G6KA 2E9SA 2I3AA 3FFWA 2BFDA 4GPAA 1HT2E 5JFTA 2NO5A 2HCFA 4WEQA 1E3DA 1ELOA 3CY6A 4G9BA 4DG9A 3BGWA 4NFYA 3TUIC 1C4KA 2WFLA 3AVYA 1Q1GA 3KPJA 1GAEO 2AXEA 2JFGA 1PWHA 4IFIA 2PS1A 5D01A 3UK0A 3NHMA 2BJVA 2JIBA 3HCFA 4IV5A 3TEJA 4CFSA 1G4AE 2G9UA 4COKA 4LF7B 2GM5A 4C0KA 5I5EA 2ZXFA 3ZVRA 4ZP1A 3G7UA 3HYNA 4ARBA 3IUEA 1QU2A 4JP8A 1JUDA 4E2ZA 4NZMA 3TAHA 4P08A 3QQ5A 4NK4A 2HZ7A 3DGEC 4DPLA 1RM5A 2X2EA 4RK6A 3PL5A 3K6SA 5TC4A 3FPSA 3ZZ1A 2IS2A 1KOJA 2EIXA 1QR2A 2C94A 1EVYA 4UTPA 3F3MA 3U7QA 1JMVA 4BTLA 4ZV7A 2ZAMA 3NHPA 3KHUA 3PNLA 5BRNA 3SS7X 1XZJA 2HCBA 1F8FA 3R5XA 4AUNA 2OCPA 2PLRA 3BN3A 2WSIA 4Q03A 4V0RA 3X1YA 5J4LA 5KQLA 2JVIA 4NMHA 5ALGA 3RQSA 4Z7QB 1I3OA 1B3BA 2NXJA 2QM0A 3ND8A 4AJKA 3L0SA 4EG7A 1KEVA 2HWYA 1O77A 2AA3A 4JGGA 5ALLA 1OXMA 5JMTA 1YGPA 4DV1B 1M6EX 3KJFA 3E9EA 3LGAA 1JEDA 3SE7A 3JPYA 1M0TA 3HBFA 4H6PA 5BVGB 1ZHOA 4HHEA 3G0HA 4OHPA 4Z86A 2ZDHA 2PK3A 2ZCJA 2XVXA 1MAUA 3QPAA 1RYZA 2QROA 3AVPA 4IHJB 4JQOA 4XIFA 3IJRA 4M1QA 1KKMA 3ZHTA 4MA5A 7REQB 1Y1QA 2FX3A 3QXSA 2YIMA 4MUBA 2X9QA 1X9GA 2XBMA 2GKOA 2LDXA 2ODWA 1GFZA 1C7JA 1L5QA 4TUYB 3PUHA 3ZXSA 4DBLC 3TD6A 5DNUA 1KI6B 5B3LA 2ILVA 2Q5QA 4MWEA 1MENA 4TUYF 1F20A 3I01A 2QRZA 2XDQB 3VZDA 4BEJA 3B1FA 1KI9A 2ZM5A 1RFGE 1LV8A 2FDXA 1XLVA 2QM7A 2X2PA 3EWIA 4LXQA 1RR6A 1U65A 2OHGA 1E0AA 3BBLA 1VJTA 4L5YA 1TAGA 1WAMA 3W5AA 4PZPA 1ZP6A 1IAQA 1K8QA 1OCEA 1S1CA 2CXQA 2Y0EA 3FWPA 4UOQA 1MX3A 4IQGA 1XTBA 3U4QA 3ASYA 5CBKA 3I39X 1O94C 2BD0A 2OO5C 5ALYA 3BH0A 3D0QA 4GMKA 4NMMA 1E7YA 1XT6A 3CRW1 4B7AA 3R23A 3TIFA 4YAUA 4F5YA 4NQZA 1PL8A 2BPOA 1VMDA 3COPA 1OX4A 4N0PA 5T8KC 4AU1A 3ESZA 1N7GA 2QN9A 3NT4A 3QUCA 4MJ7A 5ESRA 3D9QX 2WKWA 5KNCA 1XDDA 4R5MA 5JNTA 5C4MA 1XTZA 1ZXBA 3PIIA 4AS1A 3AJRA 3C5CA 4K1XA 4HJXA 3O6VA 5C1IA 4ML3A 1E3EA 4NXNB 4ZANA 1SA0B 1GGEA 2IIPA 2O6HA 4L15A 2YZNA 4MR7B 3ZCRA 4EKIA 1O5TA 4LS3A 1GQ2A 2A9PA 4JBIA 1NASA 2ZULA 4Q1VA 1QS0A 1CF4A 3O38A 4K1LA 1AKTA 1Q15A 4F12A 2P0EA 1SUIA 1CF2O 2Y71A 1GV0A 1Z8HA 3SE0A 4TKLA 4BMDA 3QPUA 3L8ZA 5KWSA 3KKLA 4QM6A 4NCBA 1FFAA 2PGXA 2DHDA 2WIGA 5TARA 4MULA 4BFTA 3O3NB 3AINA 5KIAA 1ORHA 2AQKA 3E03A 4ZEWA 3AXSA 5IM4F 3OT1B 3H1AA 1QU3A 7YASA 3CWCA 4N41A 5DYYA 3ZWAA 3ZZUA 4JJIA 2OTCA 4H3VA 1PVVA 3QUAA 4EEZA 4L4YA 7GPBA 1BTOA 3IBSA 1GITA 2ZJZA 2O9JA 4HNVA 2JZNA 4CM7A 1GJRA 1KK3A 1VJGA 2Y9MB 3OZRA 1U0EA 4GLOA 1Q7GA 1GT6A 4PRZA 1F0KA 1YQWA 3CWZA 5TQ2B 2J5RA 4ARAA 1Z33A 2CXRA 3KPYA 3B13B 3QGMA 4NONA 3VGPA 4HNRA 1AA9A 1GG9A 2ID8A 3ANSA 1SN7A 2ZT5A 3DAOA 4LG1A 3UICA 4A3SA 4JEUA 4JD5A 1B14A 1T0JB 3K6SB 5AK4A 2Q1TA 2UVQA 3I6IA 1P4SA 3AY7A 1U7OA 2PUVA 4Q5IA 4YALA 1II0A 3VOBA 1KQ3A 4JT2A 1W5BA 1X0XA 2PS0A 2WSYB 4EL0A 1WB5A 1MC1A 1YL5A 5L3QA 1JIXA 1JEQB 2M1ZA 4TQUS 2BM8A 2R47A 3G9TA 3HUUA 3P9XA 5D2CA 1OUMA 3ZHUA 2C7BA 5P21A 1R37A 1HTTA 5KCMA 2V4ZA 4LOKA 2B0JA 2NU8A 4D9EA 4TN5A 1U3DA 1B41A 2H54A 2PGIA 5ES3A 1S6YA 4ITRC 1Z4JA 2XADA 1ZRNA 1W4RA 4DEVA 1YO6A 4DLTA 3Q11A 5BSVA 1VE5A 4AF7A 1Y7TA 4ETNA 2HGSA 1J49A 4C7OA 1PEYA 5C8VA 4A73A 3V3KA 1HGXA 5LM3A 1QM5A 2ANCA 2AEEA 3E5HA 3TS1A 4M8SA 1HDIA 2PRZA 4US0R 5EZ6B 3C1TA 4FYMA 3AH8A 1LQ2A 1MC8A 1N1EA 3HH8A 2ZKIA 4JX8A 4P4NA 3EPRA 4J1QA 3T3MB 1EFLA 1CZRA 2D7JA 3GGOA 5EZYF 1ZQ9A 4YIHA 1C9JA 2HB6A 4BMXA 1Y80A 1KZ4A 2WD8A 2XUQA 3IT1A 1DEKA 1O3YA 3QRWA 5EZYB 3OP1A 1QXSA 4IH1A 3PXDA 2Y05A 3SZOA 4AO8A 2BUCA 4AKEA 5LZ4A 2X9LA 5JPDA 2WB2A 5JQGB 2WD7A 2WYOA 2FZ5A 1OPRA 1R0WA 3TX2A 3K09A 5DNEA 4PN7A 5JWHA 5AM3A 1GTRA 3JD2A 3LZ6A 4LWPA 3K9HA 3RC1A 2Z3ZA 3OE5A 3WQBA 4BNGA 4IBOA 5A9SA 3I5YA 4JHLA 3D4BA 5JH7F 3K5HA 5HKLA 3I76A 4EPXA 1TM4E 1Q11A 3GJ4A 1Z47A 2EYUA 3WV4A 3F6PA 3V4VB 3F8TA 4BHTA 1XMVA 4MVJH 4MYTA 4RX1A 4EBFA 4F8JA 2O1XA 3TZ6A 4BPBA 3JAWB 4WBNF 3P7MA 1H2BA 3WTCA 5K8VA 2VT6A 4MVJM 1Z7GA 3WS7A 3NBUA 1U3FA 4JY7A 2ZSKA 3TVYA 3R7NA 4YYZA 1E5DA 2KB0A 4PC2A 3UJ7A 4C7OB 1ZOSA 4L51A 4R5HA 3A9SA 3CR7A 4IGEA 4J29A 4R8LA 1GCUA 1E58A 2CNWA 4JVMA 4HX9A 3ECSA 2WM8A 3M9WA 4YAEA 4N4AA 2YL2A 3EVDA 4H7PA 4IFEA 4S04A 1NJ1A 1IPEA 2YY5A 3MWDA 4M60A 4WXRA 1QWOA 2UVPA 3V4LA 1OFTA 2Y1GA 4CPDA 4BJHB 4JBHA 2BMEA 4NZPA 3U81A 4RZIA 1T5HX 2XCSB 4ISBA 3VVCA 4AKTA 4EAAA 5JC1A 2ESRA 4CKXA 3PT9A 1PFVA 3O4IA 3RKUA 3IEKA 5C7IO 4R3NA 4R8RA 1EP2B 1SJ9A 4RY0A 4EWLA 3TOCA 1AQUA 2NACA 5SY9A 1L7NA 1NF8A 2QVZX 4V0OA 4DAOA 2KSQA 1KYTA 1KK2A 1YKSA 2C2KA 1GZDA 1DRWA 4HNAB 4I4TA 4KVZA 4DLUA 1C1XB 1KA9H 3OZBA 2DBQA 1QNLA 2PLFA 4M1WA 3T5BA 4DMFA 4DZTA 5F7XA 1JKXA 2AL7A 3MBOA 1NQUA 3ISJA 3CT6A 1JWAB 4TL8A 4Y2SA 4EKNB 3IL2A 3VZPA 3E3MA 1XMOB 5FBLB 1OLUA 3FDZB 3TEMA 1V8PA 2XIJA 1G7TA 4HK4A 4NBSA 3TZBA 4BNUA 4M7WA 3D3QA 3HADA 4X95A 1CLUA 1UPTA 2V3VA 4V1CI 1Z9BA 1S7CA 4BNYA 4OOFA 5CLGA 1CJTC 1Q7EA 3MWGA 3I9FA 4AK9A 1AZLA 4CCYB 5AFSA 1G5HA 1JQAA 1WDWB 1M8KA 2H7VA 2Q9UA 5HIAA 2C7RA 4W5HA 4FP9A 3V8BA 3NBXX 3NXKA 2WUWE 4BB5A 1M66A 4C21A 2MSWA 4AG6A 5TLSA 4GMHA 1XC7A 2YY7A 1GEGA 4TWRA 5AVTA 4X8LA 1SOUA 1CC1S 1DEHA 1UBFA 4UVIA 1P2TA 5IJ0A 1HG1A 2IS6A 1KS2A 3AEXA 4TL7A 4C2TA 3D2CA 1WEKA 2OVFA 2PUTA 3BYZA 3MTIA 2NTVA 5DULA 4Q02A 1E1DA 2D1SA 3OMWA 2V7XA 1O4VA 3F9RA 3OX3A 4IY1A 4ZTBA 5JVDF 3ENZA 4JP2A 4L0DA 1IM2A 3C0KA 4AZ0A 1VYUA 2ZTLA 4CM9D 3DE1X 4IMPA 4DPKA 5JU6A 5LOVF 1YS2X 4ZDKA 1AQYA 2JI4A 4J91A 1ZRSA 1SCBA 1Z4KA 3WLHA 5ALIA 4MS3A 3TLMA 2FVXA 1SEPA 3RVOA 4DUGD 4F1WA 4ZZIA 3ESQA 2UAGA 2QBYA 4J94A 4QTZA 4ILKA 1R0RE 1LCIA 1QVVA 3AF5A 1X19A 3H65A 3I2FA 3NHAA 1JAYA 3O2SB 2BFNA 1OHHD 2CWWA 1OBFO 3CH5A 3X1ZA 2YY6A 4AJ4A 4F2WA 3R74A 1T3ZA 4Q7EA 3DV9A 3F7NA 2HMSA 4Q3BA 1L3IA 1U0SY 1DI0A 1XHLA 2P9JA 5CA0A 5JJCA 3ISTA 1MB2A 3P71T 3KZ1E 1U2GC 2HNAA 5LA6B 2VPQA 3N70A 1IVNA 3D3KA 2J0SA 3PNOA 4ND8B 4IDAA 4PR0A 5K0ZA 2NP6A 3KU4A 4BQSA 3KSBC 2QPLA 2QX6A 5AW0A 4D46A 1CDDA 5CPFA 1K4YA 1JILA 4UTRA 1PFYA 5C4IA 2X0IA 3G2MA 5HKAA 1UBHS 2FZ4A 2FPSA 2WKRA 1WB4A 1Z38A 2BEKA 1S8AA 2ZE6A 4WNYA 1MN6A 2GXSA 2P9ZA 4X1IA 2CVFA 1ZIYA 4KPUA 4NOMA 1XJ5A 4GX0A 5BURA 1RJEA 3IT0A 4Q9LA 5BV8A 4N12A 3ML1A 5EIHA 4QUEA 4ZYTA 1QPZA 4M1EA 3BB3A 2ZWVA 5JV5A 1F8UA 1EJ0A 1ZK2A 2DQZA 2PV7A 3FG9A 1KIFA 4IICA 4MR9A 3RU2A 1EM8B 3KQWA 1T2UA 5TPZD 4Q9DA 4CT4B 4YMSA 2IS4A 1NXOA 2H5JA 3L1VA 4R3WA 2ZPAA 2ZI3A 1FMLA 3UY4A 3C7AA 3W7AA 2C2ZA 3N87A 4INPA 2PIDA 4OHMA 5K0JA 1GAXA 4OI2A 1QGUB 4XB6B 3GEEA 4K05A 3L18A 3H5NA 5LQRA 3LOUA 4GX5A 2FOIA 1MW8X 3WTBA 1QWSA 3ADKA 4U5QA 2DYKA 2W2OA 2JGAA 5EKUA 3IR5A 1RPJA 1TJNA 3N2KA 3RRFA 5JZVA 2E4XA 2B1JA 2PJUA 3VR5D 2IGBA 4XAQA 3JWJA 5IVPA 2WDPA 5C5EA 4DR3B 4I46A 2XB2A 1DAGA 1DTEA 1Z3CA 1UIRA 4CV2A 2BFPA 4ID9A 3S99A 3KC2A 1E3WB 3IQFA 3EUWA 5IJXA 5IZCC 4N5NA 2C61A 2ES4A 2W6JA 4WK6A 1ZBQA 3EXFA 5A7FA 5C3UA 3TIGA 1GQFA 3ROGA 3NFRA 4M53A 4OP1A 3ZY6A 3RRYA 5DCLA 1WXEA 1J06A 3NOOA 2XWQA 3T7EA 1IBLB 4PSUA 3AERA 2ECPA 2OGUA 5GONF 1CNMA 1U98A 4RIFA 3HXOA 1IAVA 5KYTA 1OH7A 3IOCA 4HQ0A 2FZCA 2J09A 4RKRA 4O08A 4K9QA 3QELA 5CDUA 5FADA 1GG8A 2R62A 4G8CA 2XH8A 4YGXB 3E9NA 2FGJA 1CR0A 1Y6RA 5J2TF 1C3XA 4AUEA 1IB6A 2ZIZA 1YBMA 1P0CA 2GZ3A 4D56A 2R6FA 3E0XA 1Q50A 2AUTA 4Y0VA 4FJ0A 3VHXA 2BF7A 4Y2YA 5DVZA 1MO3A 4RZSA 3GV0A 5LVAA 1Z4PX 2JI7A 3SZ3A 4DHWA 4RIEA 2WIKA 3RNLA 4NBRA 2X5XA 3ZDXB 4YQEA 1SVUA 1ZH4A 3KPVA 3RFTA 1W0KA 3ZWQA 3F5QA 4LHXA 4JVSB 4MMYB 2GEDA 3QVGB 1PEKE 3R5KA 4XVUA 2G0AA 3DHWC 3DTVB 4HB2A 4KVFA 5HMMA 1KY5A 4DV0B 1OVGA 1GPJA 3N7TA 3O5AA 1PR6A 3K9CA 3ZWYA 3T1TA 1WXFA 3A28A 2IYTA 3DM5A 4ABYA 1AN9A 1WRBA 2B35A 2YVKA 2O1SA 4LW8A 3QEBZ 2PGLA 1NMQA 4RPKA 1D1SA 2V3CC 1VJDA 1Y3BE 2GCIA 4RYLA 2QQFA 5T4BA 3UAWA 3T0GA 1OGIA 3RKSA 4M9CA 5CK5A 4EJ0A 2AMVA 5K01A 1P44A 3B1YA 4UVHA 1NOKA 4HGRA 1KY4A 3N3AC 2D3TA 5EZYA 2W58A 5ECGC 1V7PC 1A50B 3KYJB 6ADHA 1MGPA 3AI3A 2GCGA 3ECCA 3QXHA 5AT1A 1FLAA 4TTJA 3IUBA 1OA0A 5T57A 2X2OA 5EMMA 1HYEA 2QN6A 2X8BA 5EN4A 5AQ1A 4YTEA 5EZ5A 1SXGA 1SKBA 3CRRA 3QKSB 2B1RA 4FEAA 4GR4A 2FWJA 5ALHA 4D74A 1E99A 4Y6GB 3D43A 5AM1A 5TF0A 3WXMA 2FSFA 3CEAA 3E2IA 2R00C 4GWGA 4J03A 4NZOA 2CBGA 1P2SA 4NZNA 3W4IA 3KQSA 3OX2A 3T7SA 3PYLA 1ZCJA 3JQRA 1QKKA 3M89A 2YZMA 3K70D 2EFYA 4DR1B 2Q99A 5K45A 4RPHA 4TMWA 3AR8A 2WFMA 3TD2A 5JRDS 2RBGA 3GEIA 3I0MA 3TZHA 4BX9A 3DEJA 3A4NA 4J7AA 3MTBA 5GGYA 2RH4A 2P9HA 1LPSA 2CUNA 1GZ3A 4IIFA 3UXEA 4BQOA 4DYVA 1QCZA 3QVKA 3NHSA 3G23A 4NENB 3RUHA 2JIDA 3I04A 4URVR 3FR8A 3R40A 1M5RA 3HXPA 3QW2A 2JFOA 4WERA 1K89A 2W71A 4JEHA 4K46A 1C4XA 4C29A 3UJ9A 1AUXA 1EBFA 4C87A 4FXOA 3TRHA 2WUGA 4X84A 1UPXA 3HCRA 3JALB 3LUBA 4XVHA 1QUFA 2BEUB 3KJNA 1GILA 2GEVA 4IPTA 4KODA 5EG5A 1LLDA 3VAAA 3QLUA 2IP1A 2BEWB 1KDYA 1GUZA 4MUEA 5HKKD 2B4AA 3N7UA 4MV4A 1Y3CE 4U02A 5BXQC 1A9YA 4G0ZA 3ZDAA 1NNLA 3RYCB 2G1AA 2HCTA 2PMBA 4LRXA 3DF9A 3CUKA 3KSDO 4P0QB 5M3BA 1JWLA 4MUNA 1QCDA 3AQ4A 3C8ZA 3FMOB 2P11A 1Y81A 1FSGA 3BA6A 3VNBA 4V24A 3KPWA 3Q6MA 3M81A 1AKVA 2HT1A 1OI3A 2F64A 2PEYA 2AWOA 4YP0A 4ZDIA 3CONA 3NZEA 3WK6A 3KV1A 5JWRA 4XUCA 3SIWA 5LSAA 5EP1A 2WJHA 2JLQA 1QGAA 3K8YA 1G8FA 1M2OB 2FPGB 3L40A 3A1VA 5FHRA 1XYVA 5LMCA 3A04A 4PAQA 2YWRA 4BMOB 4KC0A 5AJTA 2LGJA 4DKJA 2XOEA 1EVIA 1LI4A 2PKEA 4GWKA 2WYHA 1ACJA 4UE2A 1GCIA 4BKPA 4R2MA 3PE4A 1IY9A 2D2EA 2UZ3A 2Q4BA 2ZSEA 4JI1B 4D4IA 4BO0A 3T35A 4K88A 3VZBA 5CDGA 4MA4A 2AR0A 2HN9A 5AJYA 2DB3A 4FEYA 2PH1A 4R69A 3DO8A 3IESA 1GTJ1 4FOPA 3SZGA 2R6DA 5EZQA 1DWQA 4XYGA 2H0QA 3W9BA 2F59A 3EB9A 2A7XA 2G67A 1YR3A 2VSYA 2ZT8A 3S2EA 1K8ZB 1I1NA 3IUJA 3P97A 5F77A 2X0FA 3EGOA 3NDBB 2C9MA 1D4FA 3I32A 4CEIB 3IVGA 3Q9NA 3COZA 3C5EA 4O4IA 2I9PA 3PA6A 1SQ5A 1A2QA 1WZUA 2CMGA 4S1OA 2VRWA 3GA7A 4C6TB 2WF5A 1QGDA 4HDMB 4LZJA 3H8SA 3VR3A 3AFHA 4ALNA 1V48A 4O63O 1LC0A 1PUXA 1EQUA 2XE8A 3F3YA 4PV7A 5G02A 5GAJA 2PT7A 1QZTA 4Z9XA 1EVZA 2F9FA 3EHDA 3ESXA 3H7IA 2QG4A 3BCUA 1Y3IA 1BWRA 1DKQA 3NUQA 2OV4A 3DLCA 2HD4A 2CLLB 5DX1A 4ACBA 3OCCA 3VYVA 1FVOA 1EG7A 2VCHA 4IDEA 1G0OA 1XFAA 1ND6A 3DAHA 4NEGA 2DY0A 1STOA 4X93A 5DH9A 4XARA 2JW5A 5ENZA 1N2JA 3RAFC 1G59A 3BDAA 3VC3A 2VDQB 1SOAA 1C3JA 1E62A 3VJLA 2HFKA 2C3PA 4ARUA 4QEZA 3AKCA 1MJGA 2A84A 1BU5A 1LI7A 3UGJA 4L5CA 1LDGA 5DB4A 4LBYA 4C9BA 4BNHA 2CYCA 4BB6A 3P4UA 4W7SA 5T8KA 2I76A 2YJNA 2C5FA 3CT4A 5FFMA 3RRJA 4BAGA 4AY2A 1TUIA 3JVVA 4LDNA 4Q3CA 2X0KA 4KITB 3ER8A 1OBHA 3RG2A 3TF5A 5C51B 2SHKA 4H18A 1ETHA 4AMVA 1T6YA 1RHMA 4GXQA 4NCNA 4Y2JA 4QVKA 4AZTA 2A86A 3I6MA 5CVVA 4JSYA 2KWIA 2VA8A 2Z9DA 5CNIA 2BHRA 2QAJA 2G5PA 3OT5A 1SHUX 3DE6X 3IPAA 4LJ9A 4P83A 1J2EA 4YRNA 5ADHA 2QQ5A 4Y2UA 5IVHA 3NHZA 5F78A 3C8MA 1VLVA 2I7CA 4Q4AB 1LTHR 3JARA 4P4TA 3RVDA 1SB9A 2DPXA 2O5VA 3ABIA 5JCOC 1K92A 1R8SA 1L1EA 3INGA 3PFIA 4AP6A 2HXGA 2D1YA 4ARIA 3GCDA 4RV4A 4YVFA 2PRSA 3KVYA 3VSBA 3II6X 3KOXA 4JOSA 4G1UC 3BSYA 4IMIB 4LC9A 4DEYA 1UMKA 4IJMA 3EHEA 2ZEJA 2AI2A 1L7QA 1KZGB 2R8YA 2OHXA 2OFXA 2Q0XA 3RS7A 1NATA 3HYTA 4MZDA 1J70A 2YRFA 4LF5B 4XM0A 4D5EA 4CMHA 3IKVA 2CB0A 2ACVA 2YYSA 2F1KA 1RYHA 1J39A 1SAYA 2WIJA 4O2BA 5C0OE 3UIEA 2QP3A 4MRSA 3LLUA 5B7GA 1B42A 5K8LA 3TIVA 4ZOLF 2PD6A 5FUWA 2C2MA 2HOQA 5E38A 4HNUA 3H18A 5KU1A 2LVBA 3B2NA 1UJCA 1NAHA 4BMNA 3LCCA 4FBGA 3HQ4O 3LE8A 4P3NA 4HADA 2GTPA 1PJAA 3K8QA 2VDNB 5DU2A 4MJXA 3U7IA 4UVDA 2BHLA 4FS8A 2DWCA 4R98A 3OF5A 1Y8QB 2M2IA 2GEBA 1EJ6A 1IEVA 3PC8A 4I55A 2G09A 2RAUA 4Q1AA 5HW0A 3LX8A 1FUIA 1BGVA 2ZWMA 4XXHA 5AKIA 4CMAA 4C4PA 4ALKA 1NSYA 2YQ5A 3QFSA 4TTQA 4HKTA 5ECDA 5A3SA 3VR6A 2QV0A 4UULA 4P9NA 3PEUA 1KEWA 5B57C 3OZFA 2YRWA 4KG7A 1QMPA 1E6MA 4EI7A 5GOZA 3AB7A 3CPEA 1V1MA 3FDFA 1OI2A 1FDRA 2Q3HA 3AR5A 2NUTB 4OJNA 1MQ8B 3H6HA 4L0MA 1G6Q1 4LQ4A 5JSQA 3CN9A 2EBFX 1YCDA 4Q66C 3QFTA 3LX4A 3ZDYB 4H35A 2VJLA 3TSWA 2GYVA 4J0DA 2KPOA 2X9GA 1GPNA 1KETA 2GK7A 2JKYA 3T5MA 3QU4A 5ITZA 4JSTA 4UU7A 1M73E 3HYLA 2RCNA 4U7DA 3A9TA 3UXHA 4NYIQ 4G4JA 3TW0A 2OWDA 2CY0A 2WZQA 1U7ZA 2YWHA 3JCZA 3NHRA 3V1YA 1SH7A 1ZK3A 5F7ZA 4KE6A 2PMFA 2N3ZA 5I9MA 1TL7C 4WOPA 3EK2A 4FBMA 1JTVA 1DAMA 4DFDA 4O4IF 2POCA 3HK2A 1HNXB 2AW5A 4NEHB 1W96A 1AZSC 1QBGA 3B3QA 4LYGA 1RI3A 3CNNA 3QF4B 4QYTA 2Q3MA 4X7PA 3E84A 4IVRA 1NN3A 2ZWAA 3JYOA 3RFFA 3UV6A 1A2KC 2E4VA 4QHSA 1L7PA 2H59A 1YZUA 4KSBA 1VJCA 3WYBA 3FHOA 4QSHA 4GM4A 1UWCA 3JQ7A 3DS8A 1R0KA 1V8OA 3VVLA 4I99A 2X3YA 4G0QA 2QJOA 3E9RA 4RHUA 3C3WA 3FAKA 1PI3A 1Z15A 4C1NA 4FNGA 5AJWA 1NG9A 3HCNA 3UFXA 3EDCA 1RYDA 3HL4A 2HDHA 1CQJB 1P62B 3IR7A 2GETA 2R7MA 1VPVA 4YBRA 4ASUD 3WLTA 5B36A 5TIIA 4XH9B 5DGXA 2P4UA 4BASA 4C4OA 1IPHA 2B5VA 2Z8ZA 4FSDA 1LB1B 1VRCA 5MN6A 3B5IA 4HSEA 4DV2B 2XDQA 2WNSA 1SQGA 2R4QA 3FCUB 3IQZA 3EGWA 3L02A 4G4SO 4YI3A 1AB6A 3E53A 3TGLA 2DFNA 4EYOA 1SCUB 5A7GA 3K9NA 2CLKB 5CLJA 1TIPA 2WMYA 3S2IA 2WUVA 3AU8A 4I36A 5I4BA 1TUGA 1NWCA 1H6CA 1QG2A 5AJXA 1ZGCA 2OZLB 1I2CA 3GRFA 2OXIA 4BLVA 3DE4X 2A1TR 3KQMA 1E69A 3N75A 3WBKA 1FTNA 1ONOA 2WTMA 3QPBA 4Z3DA 4P92A 3AFMA 5KX5A 3L7BA 5LZ8A 2AIRA 1AXRA 2DBYA 3HJRA 4Y9SA 3VX4A 1EWTA 3WGLA 3FPAA 1GNSA 2O8FA 3R4CA 1SXJD 4YCJA 2VPYA 2PEZA 3AP2A 8MHTA 3HTXA 1ZMXA 2PS9A 2C58A 4ZEOA 2WG0A 3ROQA 4QEKA 3RCBA 3PRYA 4N5LA 4EVIA 4EFNA 3OURA 1MFZA 1XTKA 3DDOA 3HCOA 5FF9A 1E5TA 1TCBA 3A6HA 3DT8A 2LNDA 4LJYA 4H1HA 4AJJA 4BNDB 1BXKA 2OAQ1 1H85A 2UUOA 4IMJB 2LRHA 2YN4A 4DIKA 1U63A 4PIVA 3O8NA 4D0RA 1KIMA 3I1JA 3JW8A 1DAHA 2H4WA 2RGAA 3ORQA 3OY7A 4G0PA 2H4FA 3D4NA 4Q4HA 5IG2A 5KSPA 3GLUA 2BRUA 5LCXA 3LCUA 1B74A 2VHZA 5AQEA 3STHA 3FFAA 4HWGA 3ZY4A 2GN8A 4KRYA 5EQTA 4UUAA 1JPUA 4DA7A 5F4ZA 4ZOAA 5TQVA 1W4LA 1UWVA 3ZUGA 3LXRA 4MKIA 4EMUA 2AMLA 4N6GA 1V5EA 4B3GA 3AEKA 5DI3B 5I7FA 3IP6A 4UZFA 3PLRA 4F9GA 3FVVA 3ZI0A 5LMZA 2R0QC 4UVEA 1EB9A 3NBAA 3W5SA 4QHTA 1ZM9A 5C1PA 2WQ7A 5EGSA 3D8BA 4Z0PA 1QGED 2RHOA 2W4MA 1U6JA 3IULA 3NNDA 1GRVA 2NQ8A 2P2GA 1X42A 3TE6A 5KDDA 5MFPA 2IUFA 4B35A 4JP3A 4NAHA 2WYIA 1UP6A 1X7WA 3BZBA 3NAMA 1XVUA 1LDYA 3K9FC 4F4DA 3W5IA 1U8EA 2NUTA 4B47A 3AEZA 4AURA 4IDHA 3SEQA 2C97A 3FGNA 3S70A 3DR3A 4FFDA 1ILWA 1PT7A 3OP4A 2BGKA 4BWGA 3A25A 3JATA 3A4MA 4FFMA 3FIJA 3O73A 5KC9A 2WU4A 1T6XA 4PC6A 1KC1A 4FYHA 3HRHA 2J30A 3JRWA 2NQ2C 4UOZA 4QLAA 5KKCA 4LCEA 1Z2AA 4HB0A 2O2ZA 3FHCB 3KLPX 3M1LA 4OQZA 3ODPA 7AT1A 1JU3A 1O0CA 3QBEA 4JUFA 2GBLA 3PG5A 5JR3A 1ECBA 1YS4A 2JJ1D 3GK3A 5CURA 2IYLD 5COQA 1BZYA 1V3VA 5AHRA 2P9BA 2X76A 4J1TA 3T1VA 2GNAA 1FBTA 3N2LA 4YCMA 2HIGA 4LSZA 1DPGA 1H1LA 2XT0A 4PZAA 1YBVA 5EYPB 5ALQA 1K97A 1K5GA 5HQ3B 4Q3EA 3QBDA 4C06A 4YRCA 3JSXA 1IN4A 2W2NA 4YJDA 4DSUA 2ZUCA 3NI2A 1T8WA 1Y6FA 3PFWO 1RAEA 4PQRA 5IBPA 4O1HA 5A5VA 2F3UA 2Y92A 3R8FA 2XF8A 3WYEA 2I1QA 3OD5A 3OM0A 2JBWA 2V3WA 1T36A 3GAMA 3M6VA 5LBIA 3LBAA 4AJNA 5K5EA 4ZAFA 3ZS9A 2ZYGA 1MIOA 4ETIA 3L1KA 1R27A 2J9ZB 4LECA 3EUEA 2FEWB 2ZI5A 3CGGA 5BR7A 1MJGM 2Y0PA 1XD8A 2UUPA 2Z2XA 4YYEA 1XHFA 3UFXB 3PQ6A 1XDZA 4FUQA 4HY3A 1OT5A 4DCMA 5ALFA 2COUA 2CJXA 1EFTA 3T3HA 4RD6A 4DLZA 2PGNA 3HV2A 3U26A 5H7XA 1V3TA 4NBVA 4GOJA 1KFKB 4MW0A 4GMDA 2Z6VA 4D92A 4QU5A 1VZ2A 4QULA 2BFEB 3STUA 2FUKA 2RGEA 4QUJA 2PM8A 4M99A 3WNVA 1N2CA 4MI1A 2PMKA 1U11A 3DWFA 1T5LA 1XA4A 3DUWA 1WXDA 3KLNA 1O57A 2PSEA 4AN1A 5E7QA 2PUAA 2Q6TA 1R5OA 4YRPA 3DNFA 3MT9A 1O03A 3Q8WA 1F38A 1I1OA 1LD3A 5L7TA 4OLJA 1IJFA 1K5HA 3U4AA 5B7PA 2X23A 4IVNA 4L57A 2IPOA 1RBQA 3NV9A 3Q2OA 3TE7A 4F71A 4ND2A 4FOOA 5DE3A 4C0BA 2MYUA 1YR1A 1ADJA 3AEUA 4HJRA 3X43A 4C04A 4LQCA 1E79D 2PUBA 2QTCA 4G5QA 5JQGF 1L0BA 5K2MA 1GDDA 2ZUDA 3EASA 4IIGA 3ORFA 3S0JA 3K53A 1XCPA 5DJ5A 4NNOA 1EWRA 4ZMRA 2ZYHA 4BX3A 1JNYA 1U3VA 3FZEA 3QU5A 3RS4A 3RJ5A 5B3JA 3SJAA 2DPMA 2BKLA 1CVIA 1H3EA 2R6HA 2ZSAA 2Q1YA 3AXTA 4KQ2A 4UNIA 4A7PA 1TNDA 1GUYA 1HV8A 1GV1A 3EXHA 3GFOA 4IXWA 4Y1EA 5EIOA 4OMUA 5EJFA 2EJTA 1OA1A 3GG9A 5D84A 3WJAA 4ALMA 1WMEA 4C76A 1X2BA 5LQNA 2G5CA 3PCTA 2UU9B 4L7QA 2JGIA 4X44A 1BJRE 1Z7WA 1X38A 4P98A 2A6PA 5LR6A 3S55A 1PVOA 1IDN1 4U7WA 3WKAA 3D1JA 3CLSD 3L8DA 4PHFA 5AICA 1OI4A 2R48A 2EGGA 3EOBI 3MXTA 4ZQFA 4BKQA 1OJLA 5JPCA 2YWFA 1C2TA 2ABWA 2YFYA 1UKAA 5KOYA 1M7HA 4DREA 3ZJVA 2VZLA 4M8LA 1UZLA 2QTAA 4UCXA 4GECA 4BP9A 4EUFA 2VPWA 4ZU6X 3TRFA 2NV0A 3E4CA 3MEQA 4KWEA 4L85A 3RABA 5E1OA 5KJ6A 3W4JA 1NI4A 1VRWA 1UXOA 4DTIA 1GNPA 4K03A 4EY5A 3VZCA 2V6MA 2C95A 3UEOA 2HRZA 2V97A 3WJ7A 1WD5A 3SX0A 2G1PA 1L1QA 2RGGA 1DS6A 3NHUA 3PNVA 4FJ1A 3AILA 3FIUA 2CSXA 1AGPA 1QOZA 2CW5A 2VSXA 4R84A 5JAUA 1YZNA 2QRHA 2ZSBA 1WCWA 2O4CA 1PT6A 1IQPA 2BT4A 4TLDA 1Y4ZA 3J7TA 4FFWA 2NO4A 1L5HA 1FA9A 1J0BA 3TD9A 4YQYA 4FZJA 2NMVA 1SPXA 2AK2A 2TECE 3KDAA 2NTEA 3O4RA 2BFFB 3CMMA 1Q7TA 2YOHA 1EHYA 5GQSA 3SIRA 3TSYA 4KAXA 3B12A 5C80A 1NVBA 3L8EA 1WV0A 1FFGA 3Q8KA 1HDZA 3E3LA 3S7ZA 2C5HA 2I0FA 4ZQBA 4P3OA 4B6RA 4FR0A 4OHVA 2ZI4A 4YIKA 2WABA 4GMGA 2B99A 1NC1A 4KO8A 2CD7A 4B3DA 3QP9A 3GLFB 5AR1A 1SC9A 2NPOA 5KOJB 1UWKA 4GH5A 1SG6A 1VL8A 1H8HA 4Y6RA 2REQA 4W5JA 3O9VA 2ZAOA 4QAQA 4JT8A 2IVZA 3QEJA 1R4MB 1ZM4A 1QE3A 2C5SA 2A33A 3NBFA 2DWUA 1CDOA 1JDBC 1MRSA 2IHJA 4RK4A 3UMYA 4ZGBA 4D9NA 1OY1A 3PIRA 1IZYA 4BIMA 1ULZA 5J59A 3M70A 3VAYA 3UJAA 3BXPA 5BXYA 4XB1A 3M2TA 4HFJA 1FXWA 1N8NA 2O2EA 4L8LA 2DFPA 5TS2A 4DM3A 3ZQUA 3PNMA 1Z5PA 2H00A 3VTFA 3DBLB 3ICCA 3VPDA 2IOHA 1AV7A 1W46A 2Q5HA 1SXHA 2Q0HA 4IKEA 2AMJA 4PYLA 1OBOA 5FUYA 2I3ZA 3NIBA 4EGJA 5B30A 1V2GA 1IYZA 1EG2A 2IF0A 5EMNA 5LQAA 1QIMA 3AB3A 1BOFA 2H06A 1Z0JA 4D81A 3KAQA 4IQ0A 1KZYC 3BFKA 4CMKA 4KGZA 1ZYUA 4YAJA 1FYWA 2NZUG 2PXHA 1Z0ZA 1TM1E 4J7CA 3DFIA 4P53A 3TH5A 1G55A 1J2YA 3BMNB 3KEFA 2EGUA 4XEHA 4FDVA 3QMMA 5HG0A 4Y9UA 4NJOA 2I3DA 3DMTA 3KQOA 3ED5A 2CE7A 5JJBA 2AXPA 3KL4A 1POWA 5K8CA 1NKVA 3V8EA 4X97A 4MGKR 1IWPB 1M6WA 2QYOA 3W04A 1KF0A 1UL1X 2W48A 1SXIA 1GPAA 3BJMA 2FFQA 3C4VA 4OXYA 4PFSA 2YBEA 3KQQA 4V1CA 4EW3A 5MF6A 4P22A 5C1BA 1WDTA 1RE1A 2G17A 2Q4DA 4X63A 1N2SA 1NVVR 1RQLA 3V1KA 5A4JA 5HRCA 4FFLA 3T0IA 4S1VA 1RQ7A 3ZGVA 3PWSA 4S1PA 3I1YA 1Q1AA 5C35A 1Q0SA 1RMYA 4U8HA 1FOEB 3R0IA 2YNMA 4FGLA 4GP6A 2G9NA 1X1TA 1F7VA 3AGPA 3ABSB 4C30A 5J3JA 3CVVA 4KPFC 1KR5A 3FPEA 4EMSA 1YBFA 1OAAA 1L4NA 2H4JA 3ZWVA 2R44A 3AK4A 1F9AA 1KAGA 4IF4A 4P5EA 5CD1A 3RYHB 3PUKA 2QZ9A 4PLTA 3VNSA 3JQ7B 1UADA 2JGMA 1IY0A 5WRFA 1L5RA 2OP1A 3PE3A 5JLAA 3TMYA 1RP7A 4FHCA 5E7JA 1YUBA 4PGAA 2Y6UA 1Z26A 4AL4A 4D8VA 4BVAA 1CRLA 2AB0A 1AIPA 2B61A 1DC5A 1GXSB 2WP0A 3K2EA 3TTXA 1JIKA 1VIAA 4CCYA 3NU1A 3NCTA 4MW1A 4AMZA 2J6BA 5F12A 1YCGA 1E2PA 3PFKA 5G1OA 4GKAA 4TZTA 2Z2JA 2OPHA 2FMFA 3EOZA 2GZRA 1B2RA 4QC2A 4B7UA 3KJXA 5CTJA 5BYJA 1RLIA 4K87A 1GKIA 3URKA 5JNLA 1ZN9A 2IITA 3OM9A 2PWAA 2CXTA 4P54A 4Q21A 2IV2X 1E1QA 3AUUA 3RIHA 2ECKA 4KXYA 1F4VA 2I4MA 1DLIA 1ZLYA 4HAWA 2ADOA 3LK7A 4F04A 3HKCB 2BMFA 5IT9A 4OHOA 1LPPA 3LV8A 4R8MA 4M8IA 2GPBA 2X0RA 3M6IA 1ZZGA 2FMTA 1LQTA 4CDNA 2M6LA 1QAQA 5GONA 1THTA 1Z29A 5L7WA 3S5JA 2GEFA 2RFLA 1WZ2A 1G21A 1C41A 2R60A 2EFDB 3D8HA 3JZDA 4LNUA 1ZKDA 2PYZA 4P35A 4ZO6A 1HEYA 4JLPA 1WHTA 4MDYA 5CEJA 2QT0A 3PIDA 1QQTA 1RWBA 1E4VA 2XMQA 2Q4TA 2QRMA 3ZV3A 3KCNA 2X0EA 4F11A 3AP1A 2PMWB 3C8HA 3IAXA 2QTNA 5GJVC 1R4MA 4B71A 4YCCA 4TYWA 1HBJA 4FQ5A 4UU0A 2JLWA 1P2DA 3CTMA 4IRXA 1M67A 5DKFA 3SHVA 3L1HA 2QENA 2TRSB 2Z1DA 1V37A 4IDGA 4RCVA 3T9AA 5J4YA 4TZ6A 5B2FA 1FMTA 4QBFA 1KMHB 1KTVA 3U7GA 2GM4A 3CB4A 5L3RA 1AUVA 1IFXA 2QTLA 1NNI1 2PLAA 5JI2E 3DLHA 1RAIA 4QVGA 4KE7A 1OTHA 2Q2OA 2BGMA 4PGGA 4FU0A 1D5WA 4Q3KA 3GRZA 1XWIA 4JLJA 3CX8A