3SCHA

Co(ii)-hppe with r-hpp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 42
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3schA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3schA02
3MYXA 4XFCA 3S7EA 2IVQA 4HVRA 3ZHMA 5D1IA 4X4BA 2XL7A 1O3TA 4QM8A 4Y42A 4D7SA 4HSLA 4FBIA 1SQ4A 4AVCA 2MNGA 4XEZA 2KEJA 3E5UA 4IEYA 5JSOA 3TNPB 4ZU7A 3H1YA 3DL3A 2Y0OA 1LB2A 1OD5A 3H9AA 4PIXA 4P9GA 4AQ6A 1LCDA 2CV6A 1VP6A 3PNAA 1EYBA 4Q0UA 2FJRA 5BPXA 3ZHIA 4QGMA 3I7DA 4GQMA 2GU9A 2EVXA 1DW9A 4I6TA 1YUDA 1QP0A 4UBGA 2QCSB 1Y9QA 1CJGA 1EPZA 3OTFA 1OFNA 3E6BA 3LISA 5KHIA 1PRAA 1YSEA 4IA8A 2XLAA 3OQMA 3EBRA 3S8QA 2XCJA 3KSCA 5I8TA 2IVBA 2F4PA 3NKTA 3NW4A 1CAUB 4KWJA 1EY2A 2JVLA 4KWKA 5AVPA 1GQGA 1IPJA 3QF3A 2C0ZA 3RDIA 3BD1A 4MCXA 3UFDA 4KL1A 4N9HA 1Y7YA 1LKNA 3B7HA 4IVZA 1DWKA 5FLIA 4EWAA 4HBNA 4IERA 4YARA 3QQ6A 5J3UA 3IIAA 3LA7A 1DZTA 3ES1A 2PFWA 3B02A 3HQXA 1O3SA 1H1MA 2WFPA 3M3IA 4BYYA 1WA4A 2PUGA 4IETA 3CL1A 2KEIA 4I0BA 5I0UA 1UXDA 2FMYA 3CROL 3BALA 4L2NA 4LULA 4AVAA 1VR3A 2LYPA 5LEJA 2LYLA 1ZRRA 1ZRDA 2R1JL 3KJXA 4JCYA 2ZKLA 2D5VA 4XF4A 2IXKA 2PUDA 2OA2A 1CAWA 1V70A 3QACA 1YWKA 3D82A 2K9ZA 3I59B 1UCXA 1I5ZA 2PTMA 5T3NA 2VPVA 4QX5A 3DKWA 4Q0VA 2CGPA 2UYAA 3BPZA 3F6WA 3JZVA 3OP9A 4FAGA 1UW8A 2Q1ZB 4I09A 5I8YA 4CYDA 1POUA 1YFYA 2IUOA 3CLPA 1WLTA 1WH6A 2H6BA 4E2QA 2MQKA 2IV1A 4Q0PA 4F7ZA 2H0VA 3EHKA 3FZ3A 1UTXA 1XE7A 2MHFA 5CU1A 1CGPA 4ZU4A 2IU7A 1RZSA 3E5XA 5BY5A 5K8SA 3ZDSA 2QJVA 3KGLA 4HN1A 2BNOA 2R63A 4MV2A 4YG1A 1X7NA 5BXXA 2PUAA 2OFYA 2LYKA 1NE4A 3BB6A 1O4TA 4LTAA 2EBYA 1Q5OA 3LWCA 4I01A 4LLOA 4X4HA 2UYBA 1X8MA 1YHFA 1UD1A 4WBBA 3ST7A 2OZJA 1ADRA 3SXWA 5KHGA 1QWRA 2OZ6A 5KBFA 4YG4A 2PAKA 2BEOA 2XKOA 3SCFA 1YFUA 2Q30A 4XFIA 1B0NA 5KHJA 3CEWA 4IEPA 3UKNA 3U0ZA 2XKPA 1WIZA 3LOIA 4I3PA 4H7LA 2BNMA 1WH8A 3ACLA 2HKXA 5FDBA 2V09A 3JXBC 2FQPA 3QOPA 4Q29A 1CAUA 1PMIA 1QQBA 3S0MA 4I6RA 4KU7A 1AU7A 3LA2A 3MDPA 4QGNA 1YLLA 3USSA 3H8UA 4MUVA 4OFGA 5BV6A 2AXZA 2B5HA 5I0TA 2B9UA 4YRDA 1UXCA 4EROA 1CAXB 2Q0AA 3QWGA 5FPZA 4XFHA 3OQNA 2CSFA 1GT0C 1Q43A 1O3RA 3R1FA 4F8DA 4XF9A 1NERA 4J1XA 4FN3A 4IEXA 1QY4A 5FQ0B 2AW6A 1QPZA 3BS3A 4HSJA 1ZVVA 3LAGA 4EWDA 3EQEA 3SMHA 4AXOA 4HLTA 4FT8A 2PE5A 4DINB 2VECA 1PNRA 3S7IA 4IEUA 3FYMA 3U3WA 2IXLA 5HI0A 4BIFA 3H5TA 1EFAA 2ETEA 4Z5CA 3MLFA 3BDNA 2PPXA 4MZUA 1GQHA 1NEQA 1JWLA 3JXDL 1FI2A 4Q0QA 4AQ2A 2OR1L 3WW2A 4BHPA 1ZZ6A 4MCTA 5JSPA 3E6CC 2WIUB 4YSFA 4E2SA 4IEVA 2PHLA 4GHJA 1QXRA 2B5AA 1OCTC 3F52A 4IEOA 1VJ2A 3EO6A 4LA2A 4E2GA 1WGPA 4NDWA 3MPBA 4QGLA 5J7MA 4X4DA 2EA7A 2PUCA 2MEZA 4HN0A 2BGCA 2XLFA 1S7EA 2AWIA 4O9EA 1QP4A 5JSRA 4HVQA 3LA3A 2KXLA 2PHDA 1RZRD 1ZX5A 4WVZA 5FLJA 1RTVA 2XL9A 2XLGA 4Z5DA 4UBHA 5JAXA 1J3QA 3E97A 2KEKA 5I0RA 4X4GA 3RZZA 3G7DA 1LLIA 1J3PA 1ZZ7A 2O8QA 4QM9A 5JR7B 1BDHA 1JUHA 2LYRA 3TRBA 2PIJA 2JCGA 5I93A 5EZWA 5J48A 3VK0A 1OMIA 2QVSB 3UKTA 4D7TA 3EUSA 3ETQA 1ZRFA 3KXAA 1RGSA 3FJSA 2ZCWA 4LUMA 2MPFA 1IPKA 2IXIA 3C3VA 3OQOA 3R6SA 2A6CA 2Q4SA 1QXJA 3H3UA 4KU8A 3OF1A 1LRHA 1I6XA 1NYWA 2EAAA 4X4CA 1L1MA 3NSTA 2ICTA 1CAVB 1J59A 2IXCA 1SEFA 2GC2A 4KWLA 2LYJA 1FXZA 4IWRA 1J3RA 1NZCA 3U11A 1ZZCA 3KCCA 5C6CA 1ZZ8A 3I54A 4MGZE 2ET1A 4XETA 3D0SA 4NVPA 4OLLA 5FPXA 3PXPA 3OD0A 4LEJA 4PIYA 1XWRA 3LZZA 1LCCA 2GRLA 3NJZA 4X4EA 2EF8A 4L11A 1E3OC 3HT2A 2CROA 4XF0A 2IC1A 5I91A 1G6NA 3D0JA 2GZWA 3KZ3A 2ATFA 3FFQA 3ELNA 1FT9A 2B8MA 4MH0E 3VHRA 4Z59A 3H1MA 1RPEL 2PAEA 1CQTA 1CAXA 2H6CA 2N7GA 2WC2A 2HINA 4LA3A 3NVCA 5I0SA 4I2OA 1J1LA 2KZ8A 3U10A 4O8BA 1ZNPA 1NXMA 3CF6E 5FQ0A 5LEKA 2O1QA 4R52A 2LCVA 5E16A 4XFBA 5F1RA 2LYQA 1RIOA 1Q3EA 4Z07A 3LFPA 1ZVFA 2XJ3A 3HZIB 3DN7A 4PJYA 4YNIA 2L8NA 3E5QA 2PA7A 3CJXA 1O4XA 4I02A 4X4IA 1EP0A 1U12A 1RZRA 2XIUA 3RNSA 2LYSA 3IBMA 4MGKE 4EWEA 3SHRA 3CECA 2PUEA 1ZPQA 2KPJA 2E9QA 3G5GA 1OI6A 1PM7A 3HIFA 3UKVA 4IEWA 3H50A 2GC1A 2P17A 4PIZA 3FWEA 5A7LA 2L49A 2BNNA 4IEZA 1ZZBA 4JV4A 3NL1A 2D5HA 1JFTA 2Z69A 1TQ5A 2CAVA 2PYTA 4XF3A 4Z5HA 2HJIA 4YBAA 3FYAA 4A2UA 2PUBA 4X4FA 4RD7A 1OSLA 3WW1A 5EFUA 2Z2SB 3GN5B 3H7YA 4XF1A 1HF0A 4PU7A 2I45A 3KGZA 3WW4A 4EV0A 1ZREA 3O9XA 2D5FA 3ZKCA 4UXAA 4Q0SA 2D40A 3H1WA 4TLFA 5E1RA 1YFXA 5I8SA 4YYOA 1QQAA 3ROUA 5LRSA 4J1WA 1SQ8A 5BUVA 4MX3A 2UY9A 3I59A 3OGJA 2OYZA 3N4MA 4ONUA 3RYPA 4JVAA 2BYVE 4GULA 3DNVB 1CAVA 3D1NI 4MGYE 3O14A 1O3QA 3DV8A 2XI8A 3EJKA 4JCXA 2VQAA 1UIJA 2O49A 3RYKA 2IXHA 2EWTA 3M70A 3JXCL 3PVBB 3E6DA 1ZRCA 5C8WA 1NE6A 4JTOA 3CO2A 3IWZA 1Y3TA 3QYXA 3TNQA 1IC8A 3CLCA 4R8HA 4WZCA 4LUKA 4META 2D93A 5CADA 1BDIA 3MZHA 3FX3A 5CVRA 3L1PA 3PLQA 5FCCA 4YG7B 4X6QB 4Z82A 4JQDA 3OCPA 5JCTA 1XE8A 2PQQA 4XFGA 1CX4A 4PU4C 1DGWA 4JTNA 1QP7A 1VPWA 4X6RB 4MGIE 1WETA 1LMB3 1LQCA 2DCTA 3HT1A 4K8FA 1UIKA 2O38A 1JFSA 4B29A 1O5LA 4ORFA 4I0AA 2WUSR 1XRUA 2GAUA 1SFNA 1H1IA 4XFFA 3WW3A 4BH9A 1DZRA 1X8EA 1L3JA 2GH2A 4XFAA 1ZAYA 4QXKA 4HVOA 4FAHA 2XHKA 4QMAA 3GBFA 5KHKA 1O5UA 1HW5A 2PUFA 1RC6A 1LR5A 2HSGA 2CAUA 4HMZA 3OMTA 4ZU5A 2GC3A 2ICPA 4O9GA 2QDRA 4N9IA 4IESA 1X82A 4PU8A 4I8TA 2AXVA 4HZFA 4PU3C 2ET7A 3IVPA 4AVBA 2GZUA 1PERL 4F8AA 1PRVA 4Z58A 2QNKA 2IVGA 1RL3A 1RUOA 2XGXA 2BJCA 1R69A 3IDCB 3F51A 1DGRA 1YFWA 3FHIB 1X2LA 1R63A 2AXUA 2GRMA 1ZS4A 3BCWA 4IEQA 1UPIA 1ZZ9A 1J58A 1CAWB 4FBFA 2UY8A 3L2HA 1ZUGA 3KMHA 1JH9A 5KHHA 4OB4A 3SCGA 1X57A 5LRRA 3H3ZA 2GC0A 2OPKA 2AUWA 1RUNA 3SCHA 2K0GA 3GN5A 5K98B 3FE5A 3RPQA 3RYRA 2PAMA 2O4AA 3BU7A 3GYDA 1O7FA 3ES4A 4I6UA 3H7JA 2H8RA 3FMYA 2XSDC 2IXJA 1PRUA 3IDBB 5FLHA
chains in the Genus database with same CATH superfamily
3V0AB 4XFCA 4QQPA 5HCAA 3S7EA 1GZWA 3ZHMA 2VOWA 5D1IA 2E53A 2LS6A 3KWVA 2BBAA 5A32A 4DY5A 1XU1A 4FBIA 2JE9A 2PXQA 4HKWA 4D69A 2Y64A 5JSOA 3GJBA 5FZBA 4EQZA 5FXWA 2VTXJ 1W3XA 2WNVC 2ZAHA 3AJZA 3DL3A 2RM23 3H1YA 4WM7A 1ULFA 1HB1A 4BMEA 2Y0OA 2D7FA 4Y20B 1C8M3 3RQ0A 2WNUA 4FPCA 1W8HA 1Q8PA 3L9JT 1RVF3 1S0EA 1LCDA 1RUC2 4HONA 3JB8A 2E33A 5FZ0A 4FOQA 1FPN1 5D8AC 4Q0UA 1VBA2 2VMDA 5BPXA 4DPNA 3ZO0B 3RZHA 1WCSA 4QGMA 2TUNA 1TMF2 3THTA 3ZKYA 5L9VA 5B4XA 2L9LA 2P37A 4B3NA 3RZJA 1AL22 2YGLA 4B1MA 5AC91 2EXIA 3E6BA 2VZ3A 4JKKA 4IA8A 1YSEA 1EAH3 4OHXA 2WZPP 2W95A 4KI5M 2W92A 3ZYRA 4YW5A 4CEYB 5I8TA 2IVBA 2F4PA 1ZRIA 3PTRB 5JDBA 4Y1YA 3SC7X 1ASJ3 4KWJA 4N90A 3BKZA 2A3YA 4JZRA 1TME2 4IE4A 2QQKA 1D4M1 4XUQA 3O5SA 4G3YC 1STMA 3HQRA 3VHOA 1GQGA 3MIDA 2B4KA 4P00B 3QF3A 2C0ZA 3FC0A 5J09A 3ZPXA 3BD1A 4MCXA 3KV9A 3LPGA 4N9HA 4BK5A 4YZ2A 4FOYA 5DXDA 3B7HA 2EIGA 4CP9A 1F8VA 2IWGB 4IERA 4LKSA 4YARA 3ZM8A 5J3UA 1D7PM 2ENRA 4NHYA 1F35A 2AEYA 1O3SA 2Y6JA 2OXBA 4BYYA 4GH4B 4LIUA 2W94A 2ZHLA 4UFIA 4IE7A 1UXDA 5FMCA 4ER7A 4BOWA 3VBFB 1SLBA 3CROL 1V6JA 2FMYA 4UFJA 1NY72 4BDVB 4LE4A 2DF7A 2G19A 2JG8A 3MEPA 4XC9A 3WG4A 1PHMA 1FPN3 2NP0A 4XDPA 5FY8A 4XF4A 3Q8CA 2RS12 3QOXA 2B7YA 1SLIA 2I07B 2DCJA 2W2IA 1YWKA 5G04L 3VBSB 4AEMA 2K9ZA 3I59B 4QX5A 3VGIA 2DU1A 1PO12 1MS4A 5EHDA 1VB2A 3BPZA 1BEV1 3POWA 3JZVA 3OP9A 4OMCA 2ZABA 4L9BA 1DGLA 1UZWA 2QQPA 2GNTA 4CYDA 1WCQA 1X9TA 2IUOA 1YFYA 5FWJA 4M3CB 4A3XA 1F15A 4IE6A 2VOKA 3D8CA 2H6BA 2HEVF 3VL8A 4ZHNA 1JTZX 3BVCA 3NAPA 1RIRA 5EYXA 2RE9A 2MQKA 2IV1A 3AP7A 2JDUA 4CUBA 3EHKA 4MADA 2WNEA 1Y9MA 3LQXA 4N7IA 3ZN6A 4YGEA 4Y3OA 3ZXGA 3WT3A 1SDDB 4I0WB 3O1PA 5JMOA 2DCYA 2RJKA 3E5XA 5K8SA 2RHPA 2AACA 3NV1A 5C4WB 4WM8A 5DUWA 2QJVA 1R1ZA 3GZUC 2BNOA 3KGLA 2R63A 4HRAA 3CNAA 3NJYA 3OUJA 4HN1A 4N53C 4O65A 4HL0A 2OFYA 1NE4A 1OQDA 3BB6A 4LBQD 4R9BA 2WT2A 2EBYA 3LWCA 4I01A 4QB1A 4FTBA 4X4HA 1Q8VA 2FD8A 4DXRA 4WBBA 3SXWA 4XIOA 1LEMA 3KB5A 1QWRA 2BFUL 1XYOA 3HWJA 3KCXA 3ZFFB 4YG4A 2PAKA 2XJRA 2Y34A 1HRI3 1VALA 4XFIA 4C91A 1OURA 4EN0A 3WQ0A 3MFAA 5H9QA 4A42A 4IEPA 1UZ0A 2D6KA 1A78A 2Z5WA 1GZCA 4CCCA 2GNBA 4Q2JA 4RHV1 4V2WA 2QZ3A 2XKPA 2CGNA 2R063 5IATA 4TXWA 1UYZA 4YVSC 4I3PA 3VBHC 4XHBA 1NCRC 2GNMA 4H14A 5FZGA 5IT6A 5FDBA 2V09A 2VCAA 1S0JA 3POYA 2BZDA 1W2AX 5A3UA 1W8WA 2B42B 1POV1 4QWNA 1BEV3 3R4SA 4RYDA 1H8VA 2JDMA 4YWAA 3NRUA 3PMEA 4MUVA 4QPIC 1BCXA 2AXZA 5I0TA 2B9UA 5A3NA 4QDRA 3EYPA 4YRDA 3GUUA 4N43C 5FPZA 1PGW2 1DLCA 3WCSA 3ZYPA 2AREA 1C5HA 1EV12 2EIEA 2W1SA 2ZGMA 4GMP0 4AEDB 4FPEA 4KBZA 1NERA 3ZYFA 2CNAA 4FN3A 4FQ4A 4IEXA 5FQ0B 1OOPA 3UGGA 3LAGA 3PVOA 4EWDA 5GLWA 3T3YA 2PXPA 1SLAA 3M8LA 5FYHA 5GZDA 5H9PA 2VECA 5FZCA 2QDNA 3J8F3 1IGOA 4F83A 5CAZA 3PUAA 3SH5A 4XBQA 2NMOA 2ZBJA 4Q4X2 2O8OA 1R1A3 2Y60A 5JZGB 4MZUA 2DBIA 4PHZA 3O1TA 4AQ2A 4YM2A 1ZZ6A 2P1BA 4IE0A 4Q4V2 1AYM1 3U37A 4COZA 4L99A 3W9AA 4EK9A 2B5AA 4Q4W3 1MZ5A 3TN91 4BJ0A 1OH3A 2DU0A 3IZOA 2D3PA 4Z1VA 3C8XA 1WGPA 3PJYA 3BTAA 3DYOA 1S1AA 4K9SA 3P6BA 4C0HA 1UU5A 1PNFA 5JPNB 4A4AA 2EA7A 1B35A 2PUCA 2RS51 2MEZA 5A32B 4B7EA 5KXCA 1W03A 2XQXA 2XXZA 2VMFA 2CWMA 1UF2C 1RUI3 5FY9A 3IPVA 5IJRA 3J9SA 2E51A 2PHDA 5A7OA 2ZHKA 4LE3A 3WG2A 2XLGA 4CDXC 1H2KA 2GNDA 1A8MA 2KEKA 4INDA 4QKDA 3ZSEA 4A44A 1PO21 2ORXA 5BNQA 4FPLA 3RZZA 5A1FA 1DGWX 4GWMA 3V0BA 5T5LA 2P3IA 5IVJA 5C9AB 1W8UA 3AFGA 1LLIA 4ER5A 1W6PA 2WS92 3OPWA 5AC92 2O8QA 4QM9A 5FK8A 5F32A 1BDHA 4LKFA 5GKAC 5HBAA 1JUHA 2LYRA 4XHXA 3LDRA 4ASMB 2D6OX 2YPDA 1YQ2A 5FY0A 1ND2C 5A6ZA 2C24A 1ZRFA 5IK8A 2Y6KA 1RGSA 1BYHA 1F31A 2ZCWA 1AR82 1WW5A 2MPFA 1IPKA 2W39A 2QQNA 3OQOA 3MIGA 4PI2A 4CDUA 5FREA 3SH4A 3UL2A 2A6CA 1W8NA 1QXJA 1D4M2 1W6NA 2P3JA 1LRHA 2Q4SA 3OF1A 4FPFA 4XQDA 3S5AA 4R9CA 1OBNA 1AXYA 1ENRA 1SEFA 1AX0A 3OD4A 1ND3A 1QJY1 1FXZA 3T4HB 4ES8A 4K3UA 5FZOA 1URXA 2VBBA 1FATA 1AYM3 1QF3A 2JXAA 2YPJA 3PVEA 4QB2A 1WLWA 2QQUA 3CKHA 4ARXA 3OBRA 2QQMA 3I54A 4MGZE 1HN0A 3TN93 1POQA 3D0SA 3A4UA 5LA1A 3OD0A 4PIYA 3LZZA 1OSGA 1UPSA 2YY1A 1LCCA 1VBC2 3NJZA 5CFCA 5IYYA 1IQDC 2RS53 4L11A 1E3OC 2MEV2 1VAVA 4CU9A 4FOWA 3T4VA 2C6SA 4IW3A 4GXLA 5ABJA 3WDTA 4K7JA 2ATFA 3K4DA 1S0DA 4JRAA 5JOWA 3W5NA 1DCSA 2HBUA 3ZFEC 2R49A 1DU3D 1GLHA 5LBBA 1RHI2 4PF5A 1RPEL 1C5IA 1CAXA 2N7GA 2JG9A 2WAOA 2WC2A 4NPLA 2FDKA 1W90A 5DZFA 5LB6A 2DVBA 1PO23 4W6YA 4CPBA 4B8EA 4S2FA 4OCTA 3U10A 4O8BA 1W04A 3CF6E 2O1QA 4R52A 1VBB1 3AZVA 4JQTA 4W50A 1AXKA 4CCDA 1RIOA 2WQZC 1Z78A 4BLIA 3LFPA 1ZVFA 4Q2FA 1PIV3 2UWCA 1H8TA 3WV6A 3DN7A 4FTSA 1IQAA 2WL1A 4MG2A 4QAWA 3E5QA 4LORA 4AHWA 2J1UA 4PCRA 3CJXA 4RQPA 5FMBA 2AYHA 4Q26A 1X33A 2EF6A 4GD4A 2VL4A 2XR4A 4EWEA 4FPYA 3ZPYA 3NAPB 1E5IA 1MVEA 3POGA 1PM7A 3GDBA 1AUYA 1REEA 4IEWA 4M3CE 1GP6A 1OVSA 1W2OA 3SEEA 3T09A 1L7LA 4LBLA 1KDMA 3MICA 2FDFA 1PK6A 2VXJA 1VRH3 4RS5C 3DPRA 4WM8B 5F3EA 4XDOA 4LHLA 4XF3A 3WX5A 1V9U2 4H2AA 4GJZA 4YBAA 5JXIA 2VZPA 2PUBA 4OQ9A 1GNYA 1JYXA 4DS0A 5FRAA 5C3OA 4URAA 5EFUA 1LHVA 2RS33 1A8DA 2VZOA 3CU7A 2B45X 3I2DA 4NHMA 1Q8OA 4E27A 3J26N 3Q8EA 1QQP2 3ABZA 5EWSA 2YG0A 1CPNA 1QJU1 3CBNA 3LSDA 2D5FA 3MF9A 1UOGA 1GKBA 5FPAA 4RHV2 1GZ9A 3BIWE 2X5IC 4Q5OA 4Q4Y3 4CE8A 2Z4FA 1KDKA 3AFKA 1QQAA 5LRSA 4J1WA 1FMD1 1VBD2 2BERA 1W9YA 1VRBA 3WDWA 4DXSA 1OQEA 5BUVA 2HLEA 2UY9A 5BNOC 4EZ4A 2A6WA 2ZX0A 1OQ1A 5CKMA 4ONUA 4SBVA 3RYPA 3VBUA 4LBKA 4JAAA 1UYPA 4GULA 4LXLA 2ZX2A 5M0TA 1CAVA 4MLOA 3PIJA 3EJKA 5F5AA 4JCXA 5IAXA 1RYYA 2ORZA 5A80A 3GNEA 1JI6A 4N8MA 5A7QA 4OHZA 3PVBB 4JKMA 3E6DA 3M3QA 1ZRCA 1YQCA 2JDPA 4GALA 1AVBA 5A1AA 4WVLA 1Y3TA 5FYMA 4BQ5A 1GNZA 1D4VB 1O8SA 2WNVA 4R8HA 2D93A 4CXWA 4Z92B 1OKOA 1H4HA 5FMDA 3R09A 3K48A 2PXDA 1JN2P 5FCCA 5D8AA 5SV8A 2JKXA 1HRV1 1UNBA 4LHKA 5A3LA 4XFGA 3I2JA 2WQ8A 5CYYA 3VZOA 1D0HA 3OBZA 4JTNA 3FBMA 2WO7A 4X6RB 4X8PA 3VHPA 1LQCA 3HT1A 4GIQA 2O38A 1O5LA 5C3PA 2KM2A 4XFFA 3H3LA 1X8EA 3RMXA 4AVSA 1QJU3 1C4RA 1RUG2 3BI3A 4YFWA 2YFUA 3ON7A 1SLCA 3OY8A 1RUD1 1NXD1 2HBTA 2JKBA 4XYXA 5KHKA 5LY1A 1JS9A 2HH9A 2HWC2 3HNMA 3T30A 1B35B 4P9XA 3ZYHA 1E57A 1N1SA 3OMTA 5GLTA 5E6HA 1WCKA 2VAUA 3IMNA 5DAVA 1FV2A 5F8PA 3WP3A 4A3ZA 2JICA 3OKZA 4I8TA 3JCIA 5J98B 3W59A 2P6HA 4KBBA 2X8KA 4YM1A 4B1LA 2EICA 5CZKA 4F8AA 5LW9A 4CCOA 5FO8B 2QNKA 3K2OA 2ERFA 2IVGA 4FPJA 2WFF3 3V0BB 4AEJA 5CB7A 4CVUA 4HXCA 1Y7BA 1PVC3 3UV9A 2HFZA 1COV2 2WWSA 4D0QA 5JXGA 3OUIA 1VBA1 4Q1RA 2AXUA 1ZS4A 5BNPA 4DXTA 1UPIA 1RB8G 2EALA 4FBFA 2UY8A 5FP4A 1GZTA 3K51A 3KMHA 1TMF1 1VPHA 4GKYA 1FYUA 2NYYA 1KS4A 4W6XA 1R092 2PXVA 1AR72 3VDDC 1W6NB 2GMPA 1HRV3 1YQ6A 1NA1C 3N35A 3R0RA 1QJY2 1UY0A 2K0GA 3GN5A 2MXDA 5K98B 1CZVA 2FCUA 3RYRA 5A6YA 2PAMA 1VBE2 2XJSA 4LMFA 1O7FA 3ES4A 3HQUA 3R4DB 4K40A 1ND3B 1UY1A 3T2PA 2OKXA 2H8RA 3FMYA 2XSDC 3UJQA 1TME1 2HEYF 1FOD2 1UX6A 1REDA 1HX6A 3C7GA 3MYXA 4W4ZA 1A3KA 1AZDA 4P9WA 4BQYA 4Y42A 4D7SA 2RDRA 4M00A 2BGPA 4HSLA 2XXAA 2A6XA 4QKBA 4AVCA 2V4VA 3KV6A 3TNPB 3ZMOA 5BYNA 3ZPOA 1WW7A 4GQ7A 5HXMA 5FMOL 1LB2A 4NPMA 4NAOA 4P9GA 1GWKA 3AVRA 5ANNA 1QJFA 4QX1A 1MS3A 1MEC3 2JG9B 3ORJA 4NIIA 1CD3G 5A3WA 4J6GA 1LCLA 1RUF3 1I1EA 1NY71 4N53A 1RUC3 1Z7S2 5F9TA 1Y9QA 2IFRA 3MLJA 1CJGA 1JYTA 1EPZA 2X05A 3PTYA 3H8RA 4LQRA 1OLQA 4LITA 4NWWA 4RGGA 3GZDC 4DQAA 5F3GA 2RS11 5CBLA 1TMF3 2HWD2 4JGYC 4FP3A 1A34A 3LEKA 1WW6A 1EPWA 4Z8BA 4RQPB 4OZXA 1Y43B 3KF3A 2R1BA 1AL23 3ACFA 3VZJA 3ALQA 2HWF2 1PO11 1UMIA 3JQXA 2JVLA 2WT1A 4K8RB 2VZUA 4KG8A 5AVPA 4CUGA 2G1MA 4YVSA 3VBHA 4LBNA 1NCRA 3N9QA 3LOBA 3OEBA 1ENSA 3DKQA 3JD73 5LY2A 5L7OC 1Y7YA 2W47A 1LKNA 5T5OA 5A3MA 3PU8A 2P2KA 5FLIA 2VNRA 1PK6B 4IGOA 4AHZA 1JODA 5EP9A 3PU3A 2RMU3 5FPVA 2D3SA 1HQWA 5FJKA 1V6LA 5KXEA 3M4FA 3LA7A 4QPIA 1FAYA 3SLIA 2PFWA 1DHKB 2Y6HA 4YVWB 3M3IA 3MW4A 3NROA 4N43A 1LECA 1RJ7A 1WA4A 2WZR2 4KH9A 3VLBB 5A3PA 1SACA 2M4HA 1WWYA 1N3OA 3B00A 2FDHA 3TOJA 2KEIA 1SLTA 4S2HA 5I0UA 1AR61 1U5XA 2J7MA 1YRZA 1E5HA 4C1XA 2ADDA 3HJRA 1IG0A 1VR3A 4U2AA 5LEJA 2LYLA 1ZRRA 2WA3A 4XTPA 4JCYA 1DDLA 2ZKLA 2NLRA 2D5VA 1W6QB 5CA6A 3K77A 2ODRD 4A6SA 3A22A 2VBDA 1NLQA 5EJZB 3NV4A 1V70A 1KFXL 1BK1A 3LFMA 1UL9A 4YZ3A 3VDBA 1UX7A 2A7AA 2AZ5A 2XUMA 4LHSA 3D4KA 3GCWA 5JI7A 4DMIA 1UCXA 4AI3A 4YM0A 2CGPA 3FLPA 4AZZA 3N7KA 3MIEA 1UMZA 4R9AA 2ZMKA 2RS13 4FAGA 3U78A 3CZJA 1RUH2 2VTFA 1POUA 1U2ZA 1WLTA 1NQJA 1RUJ2 4GZ9A 2Y8KA 1IOAA 4BZ4A 3TEYA 4IXLA 1PGL1 4BA6A 3NXHA 3WNPA 4Q0PA 1QXPA 4D94A 2VOXA 4V2VA 3DXTA 1UTXA 3FZ3A 1XE7A 3VDCA 1QH7A 2WAAA 5CU1A 3SEPA 1DULA 2YZ4A 3NJVA 4Q27A 3ZN5A 2IU7A 3OGGA 2LRPA 3NMBA 1PGW1 4AYUA 1OLME 1EV11 3U4SA 2CDPA 3BU0A 4ATFA 4CDXA 1XNDA 1OH4A 3O0VA 5T5JA 4MV2A 2PUAA 2HWE2 1GSLA 4AHYA 5JMCA 2TEPA 3I2IA 1C3HA 4LTAA 4D3WA 1Q5OA 2CDOA 4LLOA 1NT0A 4KGGA 3KT7A 1PMHX 3QD6A 3TEPA 1XSRA 2VZSA 2BVBA 2SLIA 2OZJA 3IT8A 3K3OA 1LAJA 1GU3A 5FXZA 4CDWB 3R4UA 4Q4X1 1K42A 4X8NA 4XAEA 5K7PA 1ND2A 1S2EA 3AL6A 3OWQA 3SCFA 4MXWA 3M2MA 3PL0A 4XJAA 1B0NA 3U1XA 4IV1B 4UFLA 3AVSA 4Q4V1 3T1LA 3CEWA 1HV1A 3WDUA 3UKNA 2E63A 2QQOA 3O1VA 1WIZA 2LLWA 2BGOA 5DDJ1 3SH3A 1ZBA2 1W9SA 4P9LA 4H7LA 2BNMA 2QQLA 5GZCA 3LF7A 2V3CC 3KL4A 4Z2WA 1C28A 3N9MA 4QXBA 3WNLA 2EIBA 3QOPA 1PMJX 5FKBA 3ZXFA 1CAUA 1G9AA 1AL0G 2YYOA 1SLLA 1AU7A 3MDPA 1O59A 4XCBA 3USSA 4AHXA 3H8UA 4ZXKA 4OFGA 1OD3A 4LKDA 1ODNA 2PXJA 3AMHA 4EN7B 3OGVA 3QWGA 4QPGB 3CJIB 4ES9A 4EKIA 1VAKA 2C26A 3KS7A 2IUWA 3WHTA 1O3RA 3O1UA 2VUCA 1XNBA 2JWPA 5BNPB 5JI9A 5LZ6A 3HN1A 1QY4A 3WY6A 1QPZA 3BS3A 4BQ3A 2WS91 1ZVVA 3TEWA 5A6XA 1GR3A 3EQEA 3VN4A 4HLTA 3ZFEA 2Q1FA 1QJX2 1WA6X 3S7IA 1PNRA 3FYMA 3U3WA 1SPPA 1ULCA 4BIFA 2WUHA 3H5TA 1WKYA 1YIFA 3AK0A 5DN2A 3AKRA 4TZDA 3BDNA 2VZQA 4MHRA 4W65A 1JBCA 1GQHA 1NEQA 2PN5A 3JXDL 2XG3A 3NNMA 3NQHA 1AR81 4BHPA 1JZ2A 5FO7B 1CONA 5JSPA 3E6CC 4L8QA 4YSFA 2QQJA 4UW4A 2EAKA 3Q8BA 4TSVA 2V73A 1IKPA 1BMV2 4CPBD 3MLKA 3VD5A 3F52A 1DGRN 3JU9A 3SX0A 4FFIA 1TE1B 4LA2A 3ZSLA 4E2GA 3VL9A 2P3YA 2ID4A 2GP3A 2J1VA 5FP3A 4MHUA 3WG3A 2VO5A 3POBA 4Q4V3 3O12A 4XUNA 2ZX1A 5DUXA 2R041 1WD4A 2A75A 1IS5A 1KITA 5A3TA 2Y26A 2XLFA 2VMCA 1E5SA 1XB9A 4CRQA 2KXLA 4P14A 3PUQA 4QQLA 2ARAA 3S30A 5IUQA 3B9CA 1QH6A 1VBC1 4UW5A 3C7OA 4Z5DA 4UBHA 2MEV1 1FNZA 4X4GA 5FZ8A 3KM5A 4RS5A 5FFOC 1DQ5A 3T1MA 2YC2A 5JR2A 5K0UC 5DT2A 3UWPA 1SFPA 1ZZ7A 3OPZA 1GFF2 5FY5A 3N7MA 3TAYA 5JIUA 1RHI1 2A6YA 3TRBA 1DZQA 5FYYA 5GAHi 4YPJA 2JCGA 3IDEA 5J48A 2OX0A 3SKVA 4QKNA 5CFDB 3UKTA 4D7TA 1Q8SA 2VG9A 1XJAA 3ZFGC 2WS93 1QOOA 5AC93 1ENXA 1S2KA 2VULA 3T2TA 1LULA 3H3UA 4RA0A 1I6XA 4CCJA 3O1RA 1L1MA 3FBYA 2X5IA 1FNYA 1CN1A 4TYSA 1J59A 4CEYC 1RUE2 2GC2A 4ZZ5A 1J84A 4H7MA 2J1AA 4ZY9A 3WQ1A 4EJRA 2RR12 1J3RA 1HLCA 2B46X 2Y6LA 4FO9A 4KG0A 1D4M3 1F5FA 2VMIA 3Q8AA 1CZSA 5BNOA 1JYIA 1BXHA 2CY6A 4E4ZA 3VD4A 1ZZ8A 2ET1A 1OPOA 4JCKA 2ILMA 2YU2A 2OQ6A 4NAMA 1H9WA 4OLLA 3PXPA 2VD7A 5HCBA 3CQOA 4IE5A 4LEJA 1QEXA 3WINE 4CDQC 1ACCA 4QPIB 2GRLA 4X4EA 1LGCA 3BYWA 1H6XA 1XXNA 1AR62 2CROA 1HXS1 3D5OA 3FFZA 4N43B 2IC1A 3PMSA 4URTA 2ZGSA 4LR4A 4CEWB 5JPMB 4GWJA 3RWKX 3D0JA 3TBDA 3KZ3A 3WVJA 5K0UA 1V9U1 3URFA 4PQQA 3VD3A 3LD8A 1PNGA 3ZR6A 1FT9A 4MH0E 2RDSA 1W05A 1VBC3 1LOFA 2R6QA 4LA3A 3IM0A 2HINA 2E6VA 3ILFA 1AR92 3OYWB 4I2OA 3APBA 4XMIA 2EIDA 4XE9A 3VBFC 1ZNPA 1QQP1 3HVDA 5KWRA 1NXMA 3AZZA 4EN8B 2I2SA 3ME5A 1RHI3 1UQXA 2LYQA 3AYCA 1ZBE2 4IDZA 5F1RA 1SMVA 1CJPA 1H1AA 3AKTA 4Y22A 5F5CA 3HZIB 2UU8A 2J22A 4QB6A 1VMJA 4AVTA 2ZMLA 2ZPXA 1VBD1 1W6OA 2DUQA 4PT6A 1O4XA 3VBSC 3WP6A 4I02A 3CMGA 3A7QA 2DBNA 3TWIA 1PGL2 2WZEA 2WO2A 4OHYA 2YBKA 5DABA 3ILNA 2XBO2 3AYEA 2PUEA 5FK7A 5LA9A 3SHRA 2KPJA 2DYCA 3HOBA 4KQ7A 1V6MA 3I3DA 1OI6A 1N3QA 1SHWB 2D6LX 3I8TA 2ZGNA 3PUSA 3A9XA 2BUKA 2RM22 3FL7A 2ZGOA 2XUEA 5IWFA 5LA2A 1QHDA 3LEIA 5FOJB 4NJ4A 3P3NA 2PXKA 1SBDA 4JQRA 4IV3B 4ZONA 5K9YA 5KC5A 3QLQA 5JWPA 1W9FA 4IEZA 4FSJA 1GOGA 2ZX3A 4K20A 1T6BX 1V6OA 2CAVA 2A6ZA 2PYTA 1GBGA 5L9RA 1YC61 5FO9B 4Y1XA 5A7WB 5A1LA 1WMFA 1OSLA 3WW1A 1DQ4A 1LHOA 2A5ZA 3ZXLA 5LBCA 1IS3A 2Z2SB 1UY3A 5FKCA 4XF1A 2JD4A 2WR9A 2G9ZA 5J37A 2DUOA 2I45A 2OT7A 3AJYA 5FP8A 3WR0A 3WNKA 4BPZA 4E8CA 1IPSA 1YI9A 3O9XA 4WVMA 2PXLA 2BVVA 4MXWB 4NIDA 1GMMA 5DDJ2 3VBOB 2R0HA 3NKGA 3O0XA 3H1WA 4CCKA 5IVFA 4BQ2A 3VDDA 1ASJ2 1YFXA 2E7AA 4UW6A 1GZWB 4GWNA 3QOWA 1NA1A 5GJ6A 3ZFFC 1SCRA 3TELA 2ES3A 2AR6A 1RUG1 3C7HA 2QFEA 5A3OA 2PHUA 4RHV3 3BGAA 4JVAA 2HWC1 4QDSA 3NNFA 1O91A 3KT4A 3WD5A 4NOTA 3PJQA 4WM7B 4UT5A 3O0WA 4YW2A 3D1NI 3DEMA 2WNUB 3DV8A 3IKWA 5FY4A 5IK4A 2BWAA 5CG9A 1UIJA 2NN8A 2EWTA 1POV3 5JLVA 1UMHA 1S4CA 4Q8KA 1XQNA 4RGAA 4AOCA 4OI0A 1V6IA 2ZEXA 4PDWC 2G4IA 3KCYA 5FZ7A 1FV3A 1AYN1 3TNQA 1O4YA 3MEJA 4WZCA 3MHZA 4KWUA 3L2YA 5CADA 4BQXA 3HD8B 1COV1 2ZX4A 3ETPA 4OHVA 4QQ2A 3ZFEB 4DEVA 1L7RA 4AEDC 4YG7B 1WMXA 4JX0A 4JQDA 1XBFA 3I3EA 4YG0A 3VDAA 1SPPB 1UO9A 1YQ8A 4AGGA 2JJ6A 2ZXQA 4Y5TA 4Q1PA 4PU4C 3P1IA 4JRLA 1QP7A 3RJRA 1JHJA 5FZAA 4MGIE 4PF1A 2C9KA 2PXUA 3ZSMA 4CZSA 3MUZ1 4K8FA 1R091 3RWNA 1JFSA 1AR71 5HCHA 4AAPA 2WUSR 2DCZA 3WQ7A 1NLSA 3HN3A 4E4HA 4YZ5A 4LT5A 1O4ZA 5JZGC 5JXHA 3GZDA 3RI8A 3LFIA 2GH2A 1ZAYA 1MS0A 1VBE1 4QXKA 5DAQA 1S55A 2R042 4HVOA 4JGYA 2EXKA 4QMAA 1XOYA 2YFZA 5CIRA 5FP7A 4FAHA 4OULA 1HW5A 1JYCA 1SZBA 2HCNA 2PUFA 3AMQA 1LR5A 2VE1A 2HSGA 1W2NA 3KLSA 4P9YA 5FZEA 1FOD1 2O0OA 2Z79A 2GC3A 5IVYA 3EB7A 5L73A 1H9PA 2QDRA 1JUIA 4IESA 5BNNC 1X82A 1DQ1A 2TNFA 2ZGQA 4CCEA 4HZFA 4YM3A 1GOHA 2VH9A 1PERL 1PVXA 1K3IA 4AVBA 1REFA 2R071 2BWCA 4Y5Z0 4M0NA 1OA4A 2HWB2 2UWAA 2JG8B 4WV8A 4BQWA 1UU6A 4COWA 4ZZ8A 2BJCA 4W6WA 3LDKA 4P5HA 2YBPA 3F51A 4ISQA 4NWVA 1GP5A 2Q8DA 1X2LA 1RXFA 2JDKA 4FVVA 3BCWA 2BP6A 4MYEA 2ZAAA 1J58A 4CCNA 4YW1A 3FUQA 4M01A 5C9AC 3A9ZA 2XH6A 2Y33A 4MGQA 4OB4A 3SCGA 2A73B 1X57A 1Z7S1 2OPWA 1COV3 1HRI2 1VMFA 1JYVA 1A6CA 3IN9A 3S57A 1C1LA 2RDQA 2AUWA 5J1XA 3UK9A 2X5IB 4O7XA 4TLGA 5G05L 1JXNA 2HWD1 3HMYA 1N3PA 2R062 1AX1A 4QHOA 3KHCA 1DQ6A 2E7TA 2K46A 5FP9A 4I6UA 3M9LA 1CIWA 3O1OA 1TZOA 3AKPA 4ITCA 5JXJA 2HWF1 2PXBA 3IDBB 1W0OA 1S0BA 1YJKA 5FLHA 1QJY3 3OB8A 5FUNA 4NN0A 2AGSA 4HVRA 3ZN6B 3SITA 4RR3C 1O3TA 4QM8A 1W9TA 3IMMA 5L19A 1HXS2 4AI8A 5DZGA 3E5UA 3Q9OA 4HPKA 2DTWA 4QT6A 2W08A 5FYUA 1GOFA 2OQ7A 5FPLA 2A70A 1XNAA 4DNYA 3H9AA 2HYKA 4PIXA 1TG7A 4DRVA 4ASKA 1AX2A 2XJUA 3N7JA 2ZGLA 4NRMA 2CV6A 5B2GB 3NO8A 1RMU2 1VP6A 3PNAA 2GMEA 4AE2A 3U4XA 3LB9A 2WZR1 1KRIA 2FJRA 3ZSJA 1PX4A 2VNGA 2D3RA 1JOJA 1OUXA 1MPXA 2BRTA 2DDUA 3I7DA 4GQMA 1GNHA 1OPMA 2EVXA 1DW9A 1YUDA 2W46A 1QP0A 3GM8A 3J8F2 3KVBA 3QH7A 4UBGA 5GZEA 3VUOA 3A23A 3H0OA 1R1A2 3AC0A 4QU2A 1CR7A 4DXZA 1OFNA 1ZA4A 5JUVA 1PRAA 3EBRA 1H30A 4Y22B 3GALA 3S8QA 1MQTC 2XCJA 1RXGA 1VBB3 1W06A 2JIGA 2WQ4A 3KSCA 2PHWA 3ZKUA 4AFMA 4Q4W2 4NHKA 2VU9A 3ZX7A 2RG4A 3NKTA 3NW4A 1Z7S3 1OA3A 2VY0A 4DRRA 3RSJA 3DM5A 4LK7A 2V72A 1SCSA 1DYPA 4M3CF 3WNMA 2LNMA 3AYAA 2ADEA 4KWKA 3BUCA 3RZMA 1HIXA 2HWD3 3LKJA 1RUH1 3UETA 2QZ2A 2IFWA 4XXAA 1MS8A 4RGKA 1RUJ1 3UFDA 1RUI2 3OBAA 1NZIA 3DCQA 4KL1A 3VBRC 2ZEWA 2YC4A 4IVZA 1DWKA 1PZ8A 3NAPC 1OOPB 3CDZB 4KNCA 4YZ1A 3QQ6A 3FMGA 5FUPA 5FPBA 2F6BA 5A33A 2XVLA 1DZTA 3ES1A 2JB8A 4QX2A 3B02A 3LIHA 4UWDA 3WG1A 1LHWA 5FYSA 3GZAA 4XQWA 5EPAA 3GJAA 3AZYA 4LBQA 3A9YA 3CL1A 5FZ6A 4I0BA 3BTYA 5ERLA 5LK5A 3T2QA 1QNYA 1KQRA 1XU2A 4L2NA 2HWE1 2WLQA 3ZOIA 3KHBA 4LULA 3WCRA 4AVAA 4LKEA 2LYPA 1SBEA 4WVMB 2R1JL 3KJXA 2WZR3 1L7QA 2BOIA 2P3KA 2VBPA 3NJXA 2IXKA 5F6KA 5T54A 5C70A 3VD9A 4LO4B 4O61A 3MIHA 2YDEA 4OI4A 3VZMA 1CAWA 3KV4A 4DO0A 1NA1B 1OF3A 2WWJA 2VTXA 2LTNA 2VZTA 2PLV2 3MGUA 1I5ZA 5T3NA 1C8NA 2VPVA 4YGCA 3DKWA 3MUY1 1FMD3 4Q0VA 3WP4A 2UYAA 2ARCA 2NZ9A 4NROA 3F6WA 3LE0A 4PI0A 5IFTA 4PQ9A 4YW3A 1UW8A 3IPVB 1ZBA1 2DV9A 4I09A 5I8YA 1LOGA 3M3OA 5LBFA 4KGQA 2EXJA 3IIIA 1KD7A 2W5FA 4CU7A 1AYN2 5C8CC 3AKSA 1SDWA 4GKXA 3NWKA 1HKDA 1CWPA 1O6UA 1XYPA 4LNVA 5FZ3A 4I3GA 1DYKA 1UOJA 2BJSA 5KXBA 1W6PB 3V0AA 1UN1A 2I74A 3K75B 1WLCA 1POV0 1RUH3 1CGPA 1WUVA 3ZVXA 4LO7A 2YMZA 3IAPA 3J7MA 3LDBA 4NPRA 4PBOA 2LLVA 5BY5A 1GUIA 1LEDA 2EXHA 3HAGA 4IL7A 4DFSA 2R30A 1Q8QA 2ZZJA 3BOWA 4XBLA 4ZS3A 4BM8A 3RJ2X 4P02B 3VHNA 2QUOA 4YG1A 1G8WA 1PZ7A 2J1RA 3FHQA 3V65A 5BXXA 3ZSKA 4CDUB 2LYKA 1F2NA 1YNAA 3AP9A 2JDZA 1MZEA 1O4TA 2FZ1A 2WJSA 1V6KA 2XONA 4Y20A 5D2AA 5SV5A 2WBKA 3AX4A 2YBDA 1MS5A 5FYTA 1QJX1 1X8MA 1YHFA 1UD1A 2VGDA 1GWMA 1W8FA 1ADRA 1C1FA 3GCXA 3WNOA 1FX5A 1F4HA 2OZ6A 5KBFA 1PIV2 1LOAA 2BEOA 1OUSA 2XKOA 4EKGA 5FZOB 4XPVA 1DP0A 2R16A 4QX8A 3WLUA 3ZFGA 5F37A 4XJ9A 3S5QA 2QTWB 5FAXA 2D97A 5F7UA 2DWRA 4P9JA 1BMV1 3TRSB 2VZVA 1AJOA 3ZXDA 1RUD3 1F4AA 3LOIA 1JH5A 4ARYA 4CEYA 1WH8A 3ACLA 3B01A 5CFCB 3K4ZA 4JHZA 2R072 2W0XA 4AI1A 4Q29A 3DF0A 5F5IA 3THDA 2WLPA 1PMIA 1QQBA 1B35C 2VUDA 4UF0A 4I6RA 3S0MA 4KU7A 5ABJB 2CYFA 1YLLA 1OF4A 1VRH2 1H6YA 4J25A 4ASLA 2ZGUA 5F3CA 4XJUA 5F39A 2XQRA 1CAXB 2OVUA 3RGBA 4XFHA 3WF1A 2ZGKA 2ZHNA 4CDQA 1Q43A 3I2FA 2Q8EA 3G0TA 3R1FA 4F8DA 4XF9A 3N9LA 4JC1A 2WSUA 4A45A 3IDAA 3WDVA 3PE5A 1IKQA 1N47A 3ACIA 2AW6A 3MW2A 5FBZA 4HSJA 3UGHA 4P08A 1VBA3 2HYXA 1SFYA 1QGLA 4AGRA 1H2NA 4AXOA 4E8DA 4DE8A 2UWBA 2PE5A 1QOSA 2PXEA 1H8TB 1OLRA 3AP5A 4ATEA 4DINB 1I3HA 3ZMNA 4Z5CA 5FZMA 3MLFA 4Q4Y2 4HK9A 3ZN4A 1S0CA 3JBG2 2OR1L 4XJWA 3WW2A 3INAA 1AHSA 1KJRA 1W39A 2WIUB 3I2KA 1S0GA 4FP2A 4E9KA 5ACA1 4E2SA 1ULDA 2LW8A 3HNYM 1UYYA 4GHJA 1QXRA 2FDIA 1OCTC 1H2MA 1US2A 2JENA 1VJ2A 4ISRA 4Y26A 5DZEA 4OI1A 1CPMA 2JQEA 3GZCA 1QZXA 1LODA 1RUE1 3QH6A 1Z0HA 3ACHA 4MO3M 4NDWA 3H42B 1W2UA 1QDCA 2DFCA 4AFCA 1G7YA 4QGLA 5L36A 1TME3 2RR11 3VBSA 4YGDA 3VKOA 4QKFA 4YG3A 3DPRB 5JOZA 2DUPA 4N7UA 1Y9GA 4QD2A 2BGCA 2VZRA 1GWLA 1S7EA 2YHJA 1LOEA 2AWIA 4WVWA 1VB4A 4O9EA 4OUSA 5JSRA 4AI9A 3RZKA 1K12A 2VMHA 4HVQA 3OJBA 4WVZA 1ZX5A 4GMP1 5DRTA 1IG3A 2VNVA 3W21A 1D0GA 4M3CA 4U36A 3ZIWA 1OHFA 3E97A 1WW4A 1W0PA 5H9SA 3RMYA 2CTVA 5CKQA 1NAEA 3P3PA 2C1FA 1J3PA 2RV9A 3AP4A 3KD4A 3FHAA 4XACA 2NPIA 5DPNA 4ZXEA 2PIJA 1JZ8A 1UOFA 4Y33A 5I93A 1AR91 1OMIA 4D6SA 4EYUA 2QVSB 1QKQA 3EUSA 3ETQA 4FFFA 4LPLA 3KXAA 3GZEA 2FDJA 3R6SA 3C3VA 1IZ3A 1QB2A 5EQUA 4FCAA 3VBUB 1GQPA 1ZBE1 5GAGi 5FYVA 1NYWA 2EAAA 3PDQA 4X4CA 4RSUA 5EV7A 4ER6A 2ICTA 1CAVB 2LUWA 3OGSA 3RS6A 5EIYB 4KWLA 4LHNA 4M4RA 3KQRA 1NCQC 2RVAA 4TWTA 3SKJE 2LYJA 1PO13 3NDBB 2K2SA 3ZYGA 1V0AA 3U11A 1W3VA 3KCCA 2QQIA 3LQCA 3KV5A 5C6CA 4CUAA 2VOVA 4D6QA 1EUTA 2WINB 4BXFA 3BIEA 2XBO1 2WNVB 2VVEA 1NUKA 3B7MA 5DAWA 1RUE3 5EXOA 5FBJA 4CUCA 5FPXA 1XWRA 2RM21 4D6RA 2WFF2 3C7EA 4IUGA 2J1EA 1H4GA 4MGTA 1XNTA 3HT2A 3MO4A 5D8AB 1CJDA 1I9RA 1RVF1 2E32A 1PVC2 3ME2A 1KXGA 5I91A 1H0BA 4PDWA 4AW7A 1G6NA 3UYJA 2W9XA 1AJKA 3FFQA 1LJ7A 1XNCA 3POEA 1TVGA 3MPPG 3ELNA 4UFKA 4XVHA 1W99A 3FLRA 2ZZQA 1MFQC 2B8MA 4YVWC 3VHRA 3H1MA 1V00A 4ZPIA 1CQTA 5B4NA 2GDFA 2X53S 2A71A 1AR63 2JDNA 3OEAA 3PUHA 5FYCA 5I0SA 1DQ2A 2CHHA 2ZA9A 1J1LA 1LU2A 3LSEA 4AEDA 2JECA 2FFHA 4LO6B 4BMBA 1R082 5FQ0A 1UZVA 5LEKA 2DURA 3OY8B 2LCVA 1G9FA 3FN9A 4GA9A 4YW6A 1QJZA 1MZFA 5E16A 5FZKA 4DE9A 2R0FA 1Q3EA 4Z07A 4FXKB 2DFBA 3RFRA 3THPA 4QHZA 4AG4A 1KS5A 4Y1UA 1ASJ1 5FYZA 2L8NA 1CVNA 2JX9A 1MS1A 2P5BA 1QDOA 2PA7A 2VCMA 5JZGA 5DAXA 4JGZC 1IS4A 4X4IA 2J1SA 1YCIA 4HK8A 5HXVA 1RZRA 2XIUA 3RNSA 2LYSA 3IBMA 4MGKE 2A3XA 4M0HA 2Z42A 4AVVA 4H55A 5FZDA 1ZPQA 2E9QA 5A7NA 3VZKA 4FFGA 3USUA 1ULPA 2FHRA 4Y1VA 3UKVA 3WNXA 4CSWA 1JMUB 3AP6A 3NNLA 1QMJA 1NQDA 5C3RA 2P17A 5BNNA 2WNOA 4ZS2A 4PIZA 3PVNA 3FWEA 4OYUA 4S2DA 5A7LA 2WN3A 2XBO3 3POJA 1NLRA 1ZZBA 4JV4A 3I97A 1MEC2 1US3A 2BU9A 1JFTA 3GBGA 4MGSA 3WDYA 1WZXA 5AFEA 1JYWA 4Z5HA 1EV13 1HDKA 3FYAA 4GJYA 1RUF2 5K0UB 1Q56A 4BWOA 1LHUA 5LASA 3LPFA 4XBNA 5FIXA 4Y5SA 2XB6C 3MBWA 3GN5B 3H7YA 1HF0A 4PU7A 2PHFA 2C9AA 3KGZA 2FDGA 3WW4A 4EV0A 5C9AA 3RVHA 3AB0A 3MI8A 4UFMA 3ZKCA 2AH2A 2JDAA 3MW3A 2KA3A 4Q0SA 4UXAA 3ZFGB 2IVIB 1K5MC 1UYXA 4Q4X3 5C3SA 2E7QA 3P5BA 4XJ8A 5E1RA 4ET7A 1DBNA 1KJLA 3HR9A 4YYOA 4CDWC 2DVFA 2OS2A 3GBWA 3BTXA 5LWBA 1SQ8A 1YIPA 4COVA 4MX3A 3ECQA 2PXFA 3OGJA 4D8MA 2D6PA 3N4MA 2DTYA 4IV1C 1CX1A 4LJHA 5DDJ3 3UT0A 3MIFA 3J7NA 2VQ0A 5HPOA 1WMDA 4HETA 3JD72 4K21A 1YJLA 4UF0B 3DNVB 1HB4A 4OHWA 5LCWL 3TEZA 5C7GA 1O3QA 2XI8A 3WOGA 2VQTA 3VZNA 2C4XA 2RMU2 4RR3A 2O49A 4AAXA 1ONAA 3JXCL 4FXGB 1X9PA 3MIBA 4GB32 3BTZA 4YG6A 4CDQB 5C8WA 3TYJA 5LBEA 1P8JA 3CO2A 4AR2A 3QYXA 1IC8A 1OVPA 4LUKA 4META 2HWB1 4N53B 2RJ2A 4RFT0 1OFSA 1BDIA 2PXTA 3MZHA 1TNRA 1JU4A 2WYSA 1WCDJ 4LBMA 4QPGC 3CJIC 3FX3A 4XCAA 5D21A 5APAA 2CU5A 5TSWA 3L1PA 5DTRA 1BBT2 3MLLA 3PLQA 4A7YA 2Y6FA 4BIOA 1VAMA 2VR4A 5BNPC 4A41A 3G6JB 4CU6A 3WSOA 2PQQA 3NNJA 1UOBA 1VIWB 4R9DA 5ACA2 1UKRA 1DGWA 2GP5A 2P34A 5IVVA 3VKMA 1G9CA 1VPWA 2ZMNA 1WLDA 1WETA 1HRI1 1LMB3 2DCTA 4BXSV 3CZUA 3SISA 5DSXA 3NNGA 5DAPA 3UJOA 3VD7A 2GAUA 1SFNA 3WXPA 1AR83 3B9IA 4HOOA 4BH9A 4CP2A 1MQTA 2BFUS 4YVSB 2H0BA 3OSDA 1LHNA 1NCRB 1RITA 2R061 1C57A 1OC1A 2XHKA 1NG0A 2WKKA 3BPSA 3DGTA 1O5UA 2VVDA 3MV11 1OXCA 4FOVA 3RI9A 2PQSA 4JKLA 2VW1A 3PHMA 4ZU5A 3X29B 4XILA 1LGBA 2XJQA 4BK4A 2ICPA 2WO1A 4O9GA 3HBZA 4F3JA 1BQPA 2R043 3ZXKA 4XJZA 4PU8A 3BOPA 2AXVA 4DY3A 4PU3C 2ZEYA 2ET7A 2A6VA 4UAPA 3VBRA 2FMDA 3IB3A 1PRVA 4Z58A 5C3QA 1DQ0A 1BJQA 1W0NA 2B39A 4ER0A 1GP4A 1RL3A 4LO8A 2MEV3 4GH4C 4C8DA 1R69A 3IDCB 1RUOA 2VMEA 1OT5A 2D6NA 4XUOA 1RMU1 4CXXA 1QIQA 5I0DA 1YFWA 2GRMA 4K1ZA 1WBLA 3J8F1 2HWB3 3GF6A 1ULEA 5A7SA 4WZFA 4AK3A 1W28A 1R1A1 2BV4A 5FZ1A 5LRRA 2ZJCA 4NIAA 5KR7A 2A3WA 2OPKA 4A7ZA 1T6GC 5JOXA 1YO8A 1JZ6A 1RUNA 3SCHA 1UU4A 1S0FA 2ZS6B 5CFDC 3RPQA 3FE5A 1ALYA 5A7PA 4YLZA 4QU1A 4Q4W1 5FXVA 3GYDA 2PHXA 4QQHA 2JDYA 5K4LA 5FV3A 4Y24A 5JVVA 2XVKA 4XTMA 3A0KA 1PM4A 1PRUA 3WF2A 1I5PA 3C2UA 3WZ1A 3ZXJA 5FJHA 2IVQA 3JB4C 1D2SA 3I49A 4X4BA 2XL7A 4YW4A 1W6MA 1C8M2 1HJFA 2O14A 1RVF2 3GHMA 5FZIA 3KT1A 1BZWA 1SQ4A 2GSYA 2VUAA 1RUI1 4EQVA 5CEHA 2MNGA 2ARXA 2JD9A 4XEZA 4CDXB 2KEJA 3I2OA 4IEYA 3WDXA 5C8CA 1F5JA 3OOXA 3OBTA 4OI2A 4ZU7A 1E5RA 4FPOB 1W9WA 4PDWB 3KF5A 1TNFA 1OD5A 2ZHMA 4BISA 3WUCA 5C33A 5C4WC 4AQ6A 1BK0A 1HXS3 2ZKNA 1GICA 2BDRA 1EYBA 1LU1A 2F17A 2XVGA 1EAH2 2NMNA 2BW8A 3NV3A 1OLMA 3ZHIA 1ST8A 5GALA 2YC0A 4CEWC 1V9U3 3WF0A 1PGSA 3THCA 1ND2B 2GU9A 1TEIA 2ZGPA 4I6TA 3N9PA 3EXUA 1HB2A 1CIYA 5CISA 4NRPA 2QCSB 1RMU3 3OTFA 1SG3A 5KHIA 3LISA 2XLAA 3OQMA 5FZHA 1QQP3 1YQ5A 2VW2A 5LATA 4FFHA 2JE8A 5LK7B 3N3HA 3POFA 5DG1A 3KZ4C 1LENA 3U75A 2NQYA 2WABA 2PLV1 1CAUB 1ULOA 2DVGA 2DVAA 3D3AA 3W5MA 4B4RA 1EY2A 3V64A 4BU2A 1DG6A 1VBD3 4HANA 5DUUA 2FZ2A 5IK5A 3AKQA 1HN1A 2OIIA 2PHTA 3M3CA 2J1TA 1JOPA 4Y4RA 3USUB 1IPJA 3RDIA 4CP0A 5C5UA 3OGRA 4AQSA 3AMPA 5BNNB 1MVQA 4EZIA 2BTVC 4EWAA 4HBNA 4M4PA 4DB5A 5A6QA 3IIAA 3AM2A 4P5YA 5F2WA 4BCUA 1LESA 2LALA 3HQXA 3LEGA 5GM0A 1H1MA 2WFPA 4ZKTB 1FPN2 5T52A 1LGNA 2AEZA 5F6LB 4IV3C 2PUGA 4XIKA 2WYFA 4IETA 3ZLIA 4QXCA 2X09A 4XW3A 1YI7A 2A1XA 2JEMA 3BALA 3WNNA 5FYBA 3BODA 5IAVA 2VCCA 1IS6A 2VXRA 3V56A 4B4QA 4RL7A 1ZRDA 2VCBA 3ASIA 3S6PA 1R64A 2PUDA 1BVP1 2OA2A 1PIV1 4K6BA 4RN5A 5C71A 3T0BA 2P4EA 3QACA 2E31A 3MF6A 4UOJA 3D82A 1J83A 4HFSA 5LA0A 2PTMA 3VBOC 1XYNA 2QQVA 2G9GA 2V5DA 1DIWA 3ZXAC 2WZ8A 4SLIA 2L1PA 1RUG3 1BLZA 2J42A 2ZEZA 5IVEA 2Q1ZB 3HNBM 3OPTA 1JZ4A 3CLPA 2HWC3 5DRYA 5L7OA 1JW6A 2PLV3 4RR3B 1WH6A 1W8TA 2PELA 3WQBA 2HCSA 2TBVA 5GLVA 3I3BA 4QX3A 4E2QA 4WM7C 4RS5B 4BQ1A 3RZGA 5AVAA 2H0VA 4FI9A 1U5IA 4F7ZA 2WT0A 4G9SB 2MHFA 2WNUC 1VRH1 1RJ8A 3B94A 5CNAA 2XJVA 2WDBA 2RDNA 1APNA 2VNOA 2WWUA 1IHMA 4ZU4A 3I2HA 5FPUA 4PLOA 4LK6A 1RZSA 1UZZA 4LO5B 4QPWA 1AYN3 1OA2A 2BQPA 2XXQA 4QPYA 2DCKA 3KVAA 3ZDSA 1QNWA 4GAZA 4R4XA 3CIHA 1X7NA 4LLFA 1ZYBA 2RS31 4NE9A 4NHXA 5CG8A 4MOAA 4COYA 2UYBA 2QKDA 3AL5A 5GLZA 3ITQA 2ZOEB 3ST7A 4G4FA 2IVJA 3VB9A 1X50A 5KHGA 4FQZA 1N1YA 4Q4Y1 4FPKA 4UW3A 1YFUA 4XAAA 1MQTB 3A0NA 1J1TA 2Q30A 3JBG1 1R093 3U07A 1AR73 1K5JA 2JIJA 5BNOB 4Z2AA 5J36A 3PIGA 5IVCA 1UY2A 5KHJA 1XE0A 2X29A 2AC1A 4FPHA 2D44A 3U0ZA 2P6CA 3F95A 4B7KA 1BEV2 4CU8A 1VBE3 5KXDA 2WA4A 3H8OA 2W1UA 4C90A 3O1SA 5C5TA 1K45A 5A70A 2WO3A 4PLMA 2HKXA 2OUHA 1NCQA 1DLLA 1W8ZA 2XMLA 3JXBC 1N1TA 2FQPA 4TTGA 1FOD3 4PBPA 2Y0IA 3VBRB 3LA2A 4JHTA 2OUJA 2W1QA 3AMNA 3N36A 4QGNA 3AZXA 5BV6A 1BHGA 3M3EA 4IQPA 2B5HA 4AFAA 3K3NA 2J7UA 2QBXA 2XOMA 4UFHA 4YFZA 1UXCA 2BOJA 3VWSA 2Q0AA 2R073 3VKNA 3OQNA 2YROA 2CSFA 1GT0C 4AI0A 3UGFA 2CSGA 3ZXEA 5FZLA 4MXVA 2XWBB 4J1XA 5FUIA 3AMMA 5T5PA 2JG8C 5FY7A 2Q8OA 4XOGA 3SMHA 3ZR5A 5DMYA 1DYOA 4OQ8A 3I4IA 2XJPA 4NHLA 4FT8A 4YVWA 3HPNA 3HBKA 2KD7A 4IEUA 2IXLA 4KMQA 5T55A 5HI0A 1EFAA 1QOTA 2ETEA 2SBAA 4OZOA 2VM9A 4XURA 4OVEA 3J7HA 2PPXA 3QCWA 1W6OB 3NV2A 3B3QE 1JWLA 1FI2A 4Q0QA 5EYYA 2XHNA 3UESA 4MCTA 5AFBA 3H8XA 3JXSA 2GMMA 1MS9A 1S2BA 4IEVA 2PHLA 1UXZA 2YUEA 4AEKA 1CZTA 2XWJB 4S2GA 1W6QA 2W52A 4IEOA 4D7YA 1U5ZA 3EO6A 3ZIXA 1VE0A 1XC6A 1HJGA 3Q8FA 1S0IA 3JBG3 3O7OA 3MPBA 5J7MA 5HV0A 1W6MB 4X4DA 1W8OA 2HWF3 4JGZA 4AL9A 4EN9B 3K4AA 4HN0A 2D6MA 4C1WA 1U5YA 5C8CB 3D6EA 2XPJA 1QP4A 4EROA 3LA3A 1LOCA 3MV01 4XDQA 3ZYIB 4YGBA 1RZRD 5E89A 3DUIA 1NX9A 2WFF1 3ENRA 1RTVA 4IGPA 1DF0A 2VJXA 5FLJA 2XL9A 4WM8C 3WEZA 5JAXA 1G9DA 1J3QA 1ZA7A 4WVVA 1PVC1 5EJ3A 3PUIA 5I0RA 1PX3A 4NIHA 2W91A 3QBQA 3ILRA 5FZFA 3G7DA 3WF4A 4BLJA 5JOYA 2FBEA 4ER3A 5FR3A 3EMRA 4LOTA 4CTEA 3B5LB 4YZ4A 5JR7B 3QFIA 1KFUL 3RZLA 1LOFC 3WF3A 1MZ6A 2KR2A 3VDDB 5EZWA 1G86A 2YGMA 3VK0A 3I2GA 4UI9L 5DQ0A 4AQTA 2WRAA 1V6NA 1R081 1ULGA 3FJSA 1JYNA 2X10A 4LUMA 1HB3A 2IXIA 2PHRA 1AYM2 4NR1A 4KU8A 5EJ1B 5T50A 2CGOA 4XZPA 2FCVA 3NSTA 2ZGRA 1K5MA 4XZUG 3TN92 5HCFA 2IXCA 2PMWB 1ODMA 1T2XA 3A21A 4CDWA 4RFRB 2BBVA 3SQOA 3E1F1 4IWRA 1N1VA 3LEMA 1NZCA 2RS52 4IV1A 1ZZCA 4XMAA 4LOSA 2JDHA 5F3IA 3RG0A 4DUVA 5F2SA 3VKFC 3TB0A 2BPA2 1KGYA 1W2TA 2VC9A 4NMIA 3LIGA 4XETA 4NVPA 1RUJ3 4R4ZA 5DUVA 4JDOA 4COUA 5GLUA 3ACGA 5IFPA 4AWDA 2GN7A 1NOVA 2VZ1A 2EF8A 1OKQA 2NM1A 1G9BA 1M06G 1PO22 2C5DA 4XF0A 3MFCA 5JIAA 4BQ4A 4FTEA 1OOPC 3WHUA 4QQOA 1MEC1 5E88A 2GZWA 4Q8LA 4IGQA 2R1DA 5FMOS 4DZGA 4Z59A 1QJEA 1RUF1 2PAEA 3U14A 2H6CA 4EE2A 1NKGA 1GANA 4QPGA 3CJIA 1RUC1 3NVCA 5DG2A 1UWWA 2HWE3 2ZGTA 1JZ3A 2KZ8A 3VZLA 2ARBA 5IVBA 3T0DA 2ZACA 1BVVA 4JGYB 5IW0A 4AI2A 3ATGA 3W58A 4LBJA 1VLNA 4FPGA 3TEXA 4XFBA 1B09A 1WCUA 2XJ3A 1AL21 4PJYA 3B93A 3DXUA 3GGLA 4YNIA 4E4SA 5FY1A 1LOBA 1R083 1ZM1A 5GZFA 2Q5TA 4L92A 3RRDA 1EP0A 1U12A 2E26A 4C0BA 4HG6B 4QX7A 5L7OB 1VMHA 3C7FA 2B9VA 4UYBA 2VVFA 2GN3A 5L9BA 1ZBA3 5H9RA 3BN6A 4XXPA 3JD71 3CECA 3HEIA 1QU0A 3GHNA 4CXYA 4NUBA 1NW3A 2V5YA 4AGVA 3G5GA 3HIFA 3IAQA 1WBFA 3POSA 4H3WA 2F4LA 2RMU1 1X36A 3H50A 2YB7A 3VV1A 3POIA 1UKGA 3TFLA 2GC1A 2GALA 3KQ4B 4E4DX 4HKOA 4GWIA 4GB31 5J96B 4OMDA 4JDNA 2L49A 2G9FA 2BNNA 2RS32 4EZHA 3I3MA 5E8AA 3NL1A 2D5HA 2VQUA 2Z69A 1TQ5A 2Q1MA 4DEQA 3JUUA 1MACA 2HJIA 4NRQA 1GV9A 1JU3A 4X4FA 2W87A 4GH4A 4RD7A 4A2UA 4XUPA 2Y6GA 2RJLA 1BBT1 5FXXA 1DFQA 2XJTA 3VBFA 3ZDVA 2LROA 1LTEA 1UY4A 2XDVA 4L0PA 2R32A 4CDUC 3M7AA 1ZREA 1QJX3 1VBB2 3OUHA 2Y38A 2VMGA 4CP9B 2D98A 1HV0A 2D40A 4P9IA 4TLFA 5I8SA 4QDQA 2CL2A 2XXPA 1ENQA 1YYNA 3ROUA 1ND3C 5CFDA 3OG2A 1YEWA 3W20A 2AENA 1BKZA 3I59A 4NO4A 2OYZA 2YU1A 5JUWA 1NCQB 5DTMA 1D2QA 2V4AA 4HPKB 4OUMA 2VEOA 1MR5A 2DVDA 2BYVE 3N9OA 4MGYE 2LM3A 3O14A 3M1HA 1GYKA 1EUUA 3DYMA 2CWSA 1RINA 4MSVA 4BE3A 4DIQA 2VOTA 4I30A 2VQAA 1YXWA 5F5QA 3RYKA 3ZYBA 5CFCC 2IXHA 3B69A 3M70A 2JE7A 3PURA 4CCMA 4YW7A 1NE6A 4CCLA 3CHXA 4JTOA 5FYIA 5ABJC 5IHRA 1LNSA 3IWZA 3JQWA 1HQLA 3CLCA 3I3QA 4AFDA 5DTQA 3T2OA 4TN7A 1F9KA 3O1MA 1U0AA 4XABA 1H2LA 2ZTNA 3LCPA 5C4WA 2JG9C 3T0AA 2R7EB 3J4UH 2AUYA 3LGRA 4K1YA 5CVRA 4GB33 2HEWF 3VKLA 3AXDA 4DOUA 4X6QB 4Z82A 3NZLA 2W1WA 3OCPA 5JCTA 4Y1ZA 1XE8A 3GXUA 4LBOA 4CEWA 4DUXA 1CX4A 4AF9A 1QJU2 2FCTA 1M4WA 4L97A 1SBFA 4A6OA 3FUOA 4CA9A 3DECA 2IZWA 1H8TC 4B29A 1BBT3 1UIKA 1AF9A 4MVTA 4QHBA 3ZFFA 4ORFA 4I0AA 1XRUA 3WW3A 1H1IA 3OYWA 1CQ9A 3WP5A 1DZRA 1Y4WA 4RQPC 1FMD2 1L3JA 4XFAA 5ACA3 3T08A 3UNPA 2VUJA 2YBSA 3ZYJB 4PLNA 4QXHA 3GBFA 5ISLA 1XPWA 4W8JA 4CP1A 4HT1T 4JGZB 5FOBB 3SNMA 1RC6A 2CAUA 1HQ1A 4HMZA 5FZ4A 5A33B 4NIGA 2RR13 5FZ9A 5FTTC 3WUDA 3DYPA 1C8M1 1XSQA 1JOBA 4N9IA 1PK6C 1JZ7A 3J7LA 2Q8CA 3IVPA 3DPRC 4HKLA 4LBQB 2GZUA 1PZ9A 1WMEA 5KC6A 1WD3A 4DUWA 5CKNA 2WN2A 1HQNA 3FLTA 2J7WA 4GMP3 5GZGA 4QX0A 4V1PA 2XGXA 4XUTA 1O8PA 1JHNA 1DGRA 1KEXA 2QE3A 1JZ5A 4LIVA 3FHIB 1R63A 4IEQA 1EAH1 1XNKA 4OUEA 3GZTB 1HRV2 2YXSA 4IV3A 4Y4YA 1ZZ9A 4OBMA 1CAWB 2W3JA 4B4PA 3VBHB 3R05A 1AXZA 1ZUGA 2JB4A 3AYDA 3AXEA 3L2HA 5FWEA 2VW0A 3F2ZA 4AFBA 1JH9A 5KHHA 5HV4A 3AZWA 1AR93 2OW4A 5A7WA 3H3ZA 2GC0A 2WSVA 4EN6B 1UZYA 2YV8A 5IK7A 5ANQA 1K5MB 3K46A 2D43A 2UURA 1CESA 2O4AA 1UAIA 1ZBE3 2GH8A 3BU7A 4A7KA 3N9NA 1RUD2 3SR4A 3VBUC 3H7JA 3N7LA 2W68A 4BB3A 2QQWA 2WIIB 4XQ4A 2IXJA 3VBOA 1UXXX 4JDMA
chains in the Genus database with same CATH topology
3V0AB 4XFCA 4QQPA 5HCAA 3S7EA 1GZWA 3ZHMA 2VOWA 5D1IA 2E53A 5A32A 4DY5A 1XU1A 4FBIA 2JE9A 4HKWA 4D69A 5JSOA 2WNVC 3H1YA 2ZAHA 3AJZA 5T5PA 3DL3A 2RM23 4WM7A 4BMEA 1ULFA 2Y0OA 2D7FA 4Y20B 1C8M3 3RQ0A 2WNUA 4FPCA 3L9JT 1Q8PA 1RVF3 1S0EA 1LCDA 1RUC2 3JB8A 4FOQA 1FPN1 5D8AC 4Q0UA 1VBA2 5BPXA 4DPNA 3ZO0B 1WCSA 4QGMA 2TUNA 1TMF2 3THTA 2P37A 4B3NA 1AL22 2YGLA 5AC91 2EXIA 3E6BA 2WZPP 4IA8A 1YSEA 1EAH3 4OHXA 3ZYRA 4YW5A 4CEYB 5I8TA 2IVBA 2F4PA 4Y1YA 1ASJ3 4KWJA 4N90A 2A3YA 1TME2 1D4M1 3O5SA 4G3YC 3VHOA 1GQGA 3MIDA 5J09A 3QF3A 2C0ZA 3FC0A 4YZ2A 3BD1A 4MCXA 4N9HA 4FOYA 5DXDA 3B7HA 2EIGA 2IWGB 4IERA 4YARA 5J3UA 2ENRA 1O3SA 4BYYA 4GH4B 2ZHLA 1UXDA 4BOWA 3VBFB 1SLBA 3CROL 1V6JA 2FMYA 1NY72 4LE4A 2DF7A 3MEPA 2JG8A 3WG4A 1PHMA 1FPN3 2NP0A 4XF4A 2RS12 2B7YA 1SLIA 2I07B 2DCJA 3VBSB 1YWKA 4AEMA 2K9ZA 3I59B 4QX5A 3VGIA 2DU1A 1PO12 1MS4A 1VB2A 3BPZA 1BEV1 3POWA 3JZVA 3OP9A 2ZABA 4L9BA 1DGLA 2QQPA 2GNTA 4CYDA 1YFYA 2IUOA 4M3CB 4A3XA 2VOKA 3D8CA 2H6BA 2HEVF 3VL8A 1JTZX 3NAPA 1RIRA 5EYXA 2RE9A 2MQKA 2IV1A 3AP7A 3EHKA 2WNEA 4N7IA 3ZN6A 4YGEA 3ZXGA 3WT3A 4I0WB 2DCYA 2RJKA 3E5XA 5K8SA 2RHPA 3NV1A 5C4WB 4WM8A 5DUWA 2QJVA 1R1ZA 3GZUC 2BNOA 3KGLA 2R63A 3CNAA 4HN1A 1M06G 4N53C 4HL0A 2OFYA 1NE4A 1OQDA 3BB6A 4LBQD 4R9BA 2WT2A 2EBYA 3LWCA 4I01A 4FTBA 4X4HA 1Q8VA 4WBBA 3SXWA 4XIOA 1LEMA 3KB5A 1QWRA 2BFUL 1XYOA 3HWJA 3KCXA 3ZFFB 4YG4A 2PAKA 2XJRA 1HRI3 1VALA 4XFIA 4C91A 4EN0A 3WQ0A 3MFAA 5H9QA 4IEPA 2D6KA 1A78A 2Z5WA 1GZCA 2GNBA 4RHV1 2QZ3A 2XKPA 2CGNA 2R063 4YVSC 3VBHC 4I3PA 4XHBA 1NCRC 2GNMA 4H14A 5IT6A 5FDBA 2V09A 1S0JA 3POYA 2B42B 1POV1 1BEV3 3R4SA 1H8VA 3PMEA 4MUVA 4QPIC 1BCXA 2AXZA 5I0TA 2B9UA 4YRDA 3ZYPA 4N43C 5FPZA 1PGW2 4EROA 3WCSA 2AREA 1C5HA 1EV12 2ZGMA 4GMP0 4AEDB 4FPEA 1NERA 2CNAA 4FN3A 4FQ4A 4IEXA 5FQ0B 1OOPA 3LAGA 3PVOA 4EWDA 5GLWA 3M8LA 1SLAA 5GZDA 5H9PA 2VECA 2QDNA 3J8F3 1IGOA 4F83A 5CAZA 3SH5A 4XBQA 2NMOA 2ZBJA 4Q4X2 2O8OA 1R1A3 5JZGB 4MZUA 4AQ2A 4YM2A 1ZZ6A 4Q4V2 1AYM1 4COZA 4L99A 3W9AA 2B5AA 4Q4W3 1MZ5A 3TN91 2DU0A 2D3PA 4Z1VA 1WGPA 3PJYA 3BTAA 4K9SA 1S1AA 4C0HA 1UU5A 1PNFA 5JPNB 2EA7A 1B35A 2PUCA 2RS51 2MEZA 5A32B 4B7EA 5KXCA 2CWMA 1UF2C 1RUI3 3IPVA 3J9SA 2E51A 2PHDA 2ZHKA 4LE3A 3WG2A 2XLGA 4CDXC 1H2KA 2GNDA 1A8MA 2KEKA 4INDA 3ZSEA 5BNQA 1PO21 4FPLA 3RZZA 1DGWX 4GWMA 3V0BA 5T5LA 2P3IA 5C9AB 3AFGA 1LLIA 1W6PA 2WS92 5AC92 2O8QA 4QM9A 5HBAA 1BDHA 5GKAC 1JUHA 2LYRA 4XHXA 4ASMB 2D6OX 1ND2C 1ZRFA 5IK8A 1RGSA 1BYHA 1F31A 2ZCWA 1AR82 1WW5A 2MPFA 1IPKA 2W39A 3MIGA 3OQOA 4CDUA 5FREA 3SH4A 3UL2A 2A6CA 2Q4SA 1QXJA 1D4M2 1W6NA 2P3JA 1LRHA 3OF1A 4FPFA 4XQDA 4R9CA 1AXYA 1ENRA 1SEFA 1AX0A 3OD4A 1ND3A 1QJY1 1FXZA 4ES8A 4K3UA 1URXA 1FATA 1AYM3 1QF3A 2JXAA 2YPJA 3PVEA 1WLWA 3OBRA 3TN93 3I54A 4MGZE 3D0SA 3A4UA 3OD0A 4PIYA 3LZZA 1OSGA 1UPSA 2YY1A 1LCCA 1VBC2 3NJZA 5CFCA 2RS53 4L11A 1E3OC 2MEV2 1VAVA 4FOWA 4GXLA 5ABJA 3WDTA 4K7JA 2ATFA 1S0DA 4JRAA 5JOWA 3ZFEC 2R49A 1DU3D 1GLHA 1RHI2 4PF5A 1RPEL 1C5IA 1CAXA 2N7GA 2JG9A 2WC2A 5DZFA 2DVBA 1PO23 4W6YA 4B8EA 4S2FA 3U10A 4O8BA 3CF6E 2O1QA 4R52A 1VBB1 3AZVA 1AXKA 1RIOA 2WQZC 1Z78A 3LFPA 1ZVFA 4Q2FA 1PIV3 2UWCA 1H8TA 3WV6A 3DN7A 4FTSA 1IQAA 2WL1A 3E5QA 4AHWA 4PCRA 3CJXA 4RQPA 2AYHA 4Q26A 1X33A 2EF6A 4EWEA 4FPYA 3ZPYA 3NAPB 1MVEA 1PM7A 1AUYA 1REEA 4IEWA 4M3CE 4LBLA 1KDMA 3MICA 1PK6A 1VRH3 4RS5C 3DPRA 4WM8B 4LHLA 4XF3A 3WX5A 1V9U2 4YBAA 2PUBA 4DS0A 5FRAA 5EFUA 1LHVA 2RS33 1A8DA 3CU7A 2B45X 3I2DA 4NHMA 1Q8OA 4E27A 3J26N 1QQP2 5EWSA 1CPNA 1QJU1 3LSDA 2D5FA 3MF9A 1GKBA 4RHV2 1GZ9A 3BIWE 2X5IC 4Q4Y3 1KDKA 3AFKA 1QQAA 5LRSA 4J1WA 1FMD1 1VBD2 5BUVA 3WDWA 1OQEA 2UY9A 5BNOC 2A6WA 2ZX0A 1OQ1A 4ONUA 4SBVA 3RYPA 3VBUA 4LBKA 4JAAA 4GULA 2ZX2A 1CAVA 4MLOA 3EJKA 4JCXA 3GNEA 4OHZA 3PVBB 3E6DA 3M3QA 1ZRCA 4GALA 1AVBA 1Y3TA 1GNZA 1D4VB 2WNVA 4R8HA 2D93A 4Z92B 1H4HA 3K48A 1JN2P 5FCCA 5D8AA 5SV8A 1HRV1 4LHKA 5A3LA 4XFGA 3VZOA 1D0HA 4JTNA 3FBMA 4X6RB 4X8PA 3VHPA 1LQCA 3HT1A 4GIQA 2O38A 1O5LA 2KM2A 4XFFA 1X8EA 3RMXA 4AVSA 1QJU3 1C4RA 1RUG2 4YFWA 1SLCA 3OY8A 1RUD1 1NXD1 2JKBA 4XYXA 5KHKA 2HWC2 1B35B 4P9XA 1E57A 1N1SA 3OMTA 5GLTA 1WCKA 3IMNA 1FV2A 3WP3A 2JICA 4I8TA 3JCIA 5J98B 3W59A 4KBBA 2X8KA 4YM1A 4F8AA 5FO8B 2QNKA 2ERFA 2IVGA 4FPJA 2WFF3 3V0BB 4AEJA 5CB7A 1Y7BA 1PVC3 3UV9A 2WWSA 1COV2 1VBA1 4Q1RA 2AXUA 1ZS4A 5BNPA 1UPIA 1RB8G 2EALA 4FBFA 2UY8A 3K51A 3KMHA 1TMF1 4GKYA 1FYUA 2NYYA 1KS4A 4W6XA 1R092 1AR72 3VDDC 1W6NB 2GMPA 1HRV3 3N35A 1NA1C 3R0RA 1QJY2 2K0GA 3GN5A 5K98B 3RYRA 2PAMA 1VBE2 2XJSA 1O7FA 3ES4A 4K40A 3R4DB 1ND3B 2H8RA 3FMYA 2XSDC 3UJQA 1TME1 2HEYF 1FOD2 1UX6A 1REDA 1HX6A 3MYXA 1A3KA 1AZDA 4P9WA 4Y42A 4D7SA 4M00A 4HSLA 2A6XA 4AVCA 3TNPB 3ZMOA 5BYNA 1WW7A 4GQ7A 1LB2A 5FMOL 4P9GA 1MS3A 1MEC3 2JG9B 1CD3G 4J6GA 1LCLA 1RUF3 1I1EA 1NY71 4N53A 1RUC3 1Z7S2 5F9TA 1Y9QA 2IFRA 3MLJA 1CJGA 1EPZA 3PTYA 1OLQA 4RGGA 4NWWA 4DQAA 2RS11 5CBLA 1TMF3 2HWD2 4JGYC 4FP3A 1WW6A 1EPWA 4Z8BA 4RQPB 4OZXA 1Y43B 2R1BA 1AL23 3VZJA 3ALQA 2HWF2 1PO11 3JQXA 2JVLA 2WT1A 4KG8A 5AVPA 4YVSA 3VBHA 4LBNA 1NCRA 3LOBA 1ENSA 3JD73 5L7OC 1Y7YA 1LKNA 5T5OA 5A3MA 2P2KA 5FLIA 2VNRA 1PK6B 4AHZA 2RMU3 2D3SA 1HQWA 5KXEA 1V6LA 3M4FA 3LA7A 4QPIA 1FAYA 3SLIA 2PFWA 1DHKB 4YVWB 3M3IA 3MW4A 4N43A 1LECA 1RJ7A 1WA4A 2WZR2 4KH9A 3VLBB 1DDLA 1SACA 1N3OA 3B00A 3TOJA 2KEIA 1SLTA 4S2HA 5I0UA 1AR61 1U5XA 1YRZA 4C1XA 1VR3A 4U2AA 5LEJA 2LYLA 1ZRRA 2WA3A 4XTPA 4JCYA 2ZKLA 2NLRA 2D5VA 1W6QB 5CA6A 3NV4A 1V70A 1KFXL 1BK1A 1F8VA 1UL9A 4YZ3A 2A7AA 2AZ5A 2XUMA 3D4KA 5JI7A 4DMIA 1UCXA 4AI3A 4YM0A 2CGPA 3FLPA 3N7KA 3MIEA 1UMZA 4R9AA 2ZMKA 2RS13 4FAGA 1RUH2 1POUA 1WLTA 1NQJA 1RUJ2 1IOAA 4BZ4A 1PGL1 4IXLA 4BA6A 4Q0PA 1QXPA 4D94A 2VOXA 3FZ3A 1UTXA 4ATFA 1XE7A 4BLIA 1QH7A 5CU1A 2YZ4A 4Q27A 3ZN5A 2IU7A 3OGGA 1PGW1 4AYUA 1EV11 4CDXA 1XNDA 3O0VA 5T5JA 4MV2A 2PUAA 2HWE2 1GSLA 4AHYA 5JMCA 2TEPA 1C3HA 4LTAA 4D3WA 1Q5OA 4LLOA 4KGGA 3KT7A 3QD6A 3IT8A 2BVBA 2SLIA 2OZJA 4CDWB 3R4UA 4Q4X1 4X8NA 5K7PA 1ND2A 3SCFA 4MXWA 3M2MA 4XJAA 1B0NA 4IV1B 4Q4V1 3T1LA 3CEWA 1HV1A 3WDUA 3UKNA 2E63A 1WIZA 5DDJ1 3SH3A 1ZBA2 4P9LA 4H7LA 2BNMA 5GZCA 4Z2WA 1C28A 3QOPA 3ZXFA 1CAUA 1G9AA 1AL0G 2YYOA 1SLLA 1AU7A 3MDPA 3USSA 4AHXA 3H8UA 4ZXKA 4OFGA 3AMHA 4EN7B 3QWGA 4QPGB 3CJIB 4ES9A 1VAKA 3KS7A 3WHTA 1O3RA 1XNBA 5BNPB 5JI9A 3HN1A 1QY4A 3WY6A 1QPZA 3BS3A 2WS91 1ZVVA 1GR3A 3EQEA 3VN4A 4HLTA 3ZFEA 1QJX2 3S7IA 1PNRA 3FYMA 3U3WA 1ULCA 4BIFA 3H5TA 1YIFA 3AK0A 4TZDA 3AKRA 3BDNA 4W65A 1JBCA 1GQHA 1NEQA 2PN5A 3JXDL 2XG3A 1AR8