3SCHA

Co(ii)-hppe with r-hpp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
b'KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epoxidase
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
total genus 42
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3schA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3schA02
3UFDA 4H7LA 1Y9QA 1QP7A 1Y3TA 5FLIA 4X6RB 4XFGA 4HVOA 4LA2A 3S0MA 1X8EA 3NSTA 3VK0A 1ADRA 1ZNPA 4WZCA 1CX4A 3DV8A 1YFUA 4Q0UA 4KU7A 1VPWA 2PIJA 2CAVA 5FPZA 2IV1A 2I45A 2Q4SA 3EO6A 4LUKA 3TRBA 2XLGA 3QOPA 4O9GA 3N4MA 1EPZA 3CJXA 4XF9A 4QGNA 2WC2A 3OQMA 3F51A 2IU7A 4FN3A 1PRVA 2PUEA 3BCWA 1UW8A 2D93A 2PUFA 1SEFA 2MPFA 2PUDA 2WIUB 3OQOA 1OSLA 4R52A 2ZKLA 1LRHA 1Y7YA 1RTVA 3D0SA 4OB4A 1IC8A 3BDNA 5BXXA 2XSDC 3DNVB 1ZREA 3H1YA 2AUWA 2GC2A 5I8SA 3MDPA 4IEUA 1EY2A 3DL3A 4KU8A 1JUHA 2ICPA 4PJYA 2LCVA 2EWTA 4IEXA 1WETA 4Q0QA 1RZSA 3S7EA 4Z59A 1GQGA 3JXCL 4AQ6A 4E2QA 3H8UA 4E2GA 4AVCA 3IWZA 4Z82A 3BU7A 1CAVB 2XLAA 4EROA 3G5GA 2MQKA 4PU7A 4ZU7A 1CAWA 1OI6A 5JSRA 1I5ZA 2R1JL 3BALA 5CVRA 2QCSB 4F8AA 5J3UA 1CAXA 2ZCWA 4YSFA 2N7GA 3E5QA 3HT2A 4XEZA 3MLFA 1J3QA 4MCXA 2ETEA 1HF0A 1IPJA 4Z58A 1UIKA 3UKTA 1EP0A 1XWRA 3E6BA 1J3RA 1U12A 3DKWA 4YG7B 3ZDSA 2FJRA 4JQDA 2EBYA 2ET1A 1DZTA 2AXVA 2XL9A 1CGPA 3FHIB 3OF1A 3ZHIA 3WW1A 4QM8A 1ZRCA 3D82A 4K8FA 5J7MA 3CECA 2UYAA 3FYAA 1YFWA 3IIAA 3H1WA 2CAUA 2PFWA 4JTNA 4Q29A 1CJGA 2IXLA 1E3OC 3M3IA 3KXAA 5LRRA 4TLFA 2O49A 2GRLA 4BYYA 3NJZA 3SCGA 4Z07A 2GC0A 4F7ZA 4Q0SA 4Q0PA 1UTXA 1HW5A 2AXZA 1VP6A 3ZHMA 1XRUA 4QGLA 1R69A 1OCTC 1QQAA 3QWGA 3FYMA 1QY4A 4N9IA 3QF3A 2LYJA 4PIXA 1R63A 4X4IA 4JV4A 1QPZA 4QGMA 4I2OA 1NE6A 2F4PA 4IWRA 2H8RA 1CAUB 1NE4A 3H50A 4XFIA 4X4HA 5JR7B 4Z5CA 1LQCA 5FLHA 1UPIA 2FMYA 1YWKA 4EWAA 2VQAA 4F8DA 2XJ3A 1PMIA 4X6QB 1YUDA 1LCDA 4MGZE 1UXCA 3PNAA 4BHPA 4EWEA 3QYXA 5BY5A 2BNMA 5BPXA 5JCTA 2LYSA 4I6RA 3CO2A 1NEQA 4O8BA 1PRAA 3IDBB 3L2HA 4RD7A 1WH6A 4JTOA 3ES4A 3RYRA 5KHKA 4I6UA 2ICTA 4HN0A 2IUOA 4GHJA 2B5HA 2L49A 1L1MA 2ATFA 3R1FA 2E9QA 3B02A 3EBRA 1YFXA 3H9AA 3PVBB 4GULA 4ORFA 4A2UA 3SMHA 1JFSA 2QJVA 2KEIA 1DWKA 3HZIB 4IEVA 5I0RA 4PU3C 4I01A 3EHKA 2GH2A 2B8MA 2XL7A 3IDCB 4KWKA 5KHJA 3OTFA 2Q0AA 4GQMA 4PU8A 1ZVFA 1ZRDA 2EF8A 3MPBA 4BIFA 2K9ZA 4B29A 2KPJA 3LOIA 4HMZA 4ZU5A 2O8QA 1OMIA 2EA7A 4FBIA 2Z69A 2IXJA 2O38A 1O4TA 3SXWA 3RZZA 5E1RA 2PHDA 4LUMA 3GYDA 1ZZ8A 3BS3A 1RL3A 5J48A 5K8SA 3H5TA 1SQ4A 5BV6A 1EYBA 1OFNA 1GT0C 4IETA 2IVQA 3CROL 4UXAA 4LULA 3RPQA 4BH9A 3LFPA 1BDHA 4XFCA 2XGXA 4LEJA 2K0GA 4HVQA 4HSLA 3USSA 2PYTA 2VECA 3E5UA 4EV0A 2H0VA 5FQ0A 4OFGA 3B7HA 5EZWA 4QM9A 2EAAA 2ET7A 1ZRRA 2IXKA 2HINA 3C3VA 5I93A 4UBGA 5JAXA 4I02A 2H6CA 2O4AA 3RYPA 4CYDA 2JCGA 3FMYA 2BYVE 1EFAA 3FWEA 3ACLA 2B9UA 1YFYA 2GU9A 1LB2A 1WA4A 3MYXA 1YSEA 1DW9A 2BNOA 1NYWA 1UCXA 4HZFA 3O14A 1L3JA 4HVRA 2IXCA 3H3UA 3RNSA 4FBFA 3BD1A 3UKNA 4ONUA 4IVZA 5I0UA 3TNQA 3KCCA 3KGZA 4Q0VA 4QX5A 2GC3A 4MGKE 2L8NA 1UIJA 1FXZA 1GQHA 2Y0OA 2IC1A 3O9XA 2OZ6A 4I3PA 2PAKA 2PUCA 2FQPA 3CL1A 2PAEA 1DZRA 1RZRA 1IPKA 3E6DA 1NERA 4YARA 4XETA 4AVAA 3OD0A 1V70A 2GAUA 2GZUA 3ELNA 1O3QA 3GBFA 2LYLA 2IXHA 4IEYA 4DINB 1LLIA 4NVPA 1CAUA 1LCCA 2CGPA 3CLPA 1X2LA 4X4BA 2KEJA 1QP4A 3KJXA 3I59A 4EWDA 2UY9A 2PPXA 2LYQA 1ZS4A 4HBNA 1Q5OA 2WUSR 4QXKA 1YHFA 2OR1L 5BUVA 2P17A 2Q30A 3WW3A 1J59A 4IERA 4XF0A 1WIZA 2CROA 3WW4A 2EVXA 3KZ3A 1S7EA 2JVLA 2B5AA 1G6NA 2UY8A 3HT1A 5I8TA 2XHKA 4YRDA 1QXRA 3IVPA 3OCPA 4KL1A 1H1MA 5D1IA 1I6XA 2KEKA 4JCYA 5I0SA 2O1QA 2PUGA 3E5XA 5LRSA 2C0ZA 4META 5FLJA 4MCTA 1ZZCA 1RUOA 2VPVA 1O7FA 1AU7A 3LZZA 3NVCA 4X4CA 1JFTA 1FT9A 3PXPA 3OP9A 2R63A 2QVSB 4I6TA 4QMAA 2PE5A 4L2NA 4N9HA 3TNPB 1QWRA 2XKOA 3CEWA 1LR5A 4FAGA 1ZZ9A 2AWIA 2A6CA 4X4FA 4MZUA 5C8WA 4YG4A 3LWCA 5KBFA 1O5UA 1WH8A 4R8HA 5K98B 3UKVA 2PAMA 2PA7A 5T3NA 5FDBA 2UYBA 3GN5B 1RPEL 4IEOA 1POUA 4MGYE 5F1RA 3JXDL 2BNNA 5I91A 4X4GA 1WGPA 4PU4C 2GC1A 3FFQA 1BDIA 3EUSA 5LEJA 2GZWA 3NKTA 5CU1A 5C6CA 1O3TA 3ETQA 3D0JA 2KXLA 3FE5A 3IBMA 5AVPA 2BGCA 4D7SA 4XFAA 3LAGA 2OFYA 1ZUGA 1CAVA 3FJSA 4WBBA 4I09A 4XF3A 4XF1A 1H1IA 2HJIA 1DGWA 2DCTA 1NZCA 2OA2A 1FI2A 4X4EA 1PM7A 1UD1A 1RC6A 3D1NI 3JZVA 4JVAA 4J1WA 3OMTA 3LA3A 2XIUA 3PLQA 2AXUA 4Y42A 1X8MA 4LLOA 1UXDA 1PNRA 1Q43A 2MNGA 1JH9A 4P9GA 4YBAA 4XF4A 4PIZA 4HN1A 4HSJA 4LTAA 3LA7A 2QDRA 1ZVVA 4ZU4A 5FPXA 1O4XA 1PERL 3CLCA 1TQ5A 3H7JA 4FAHA 3OGJA 3U11A 2D5HA 2PQQA 2IVGA 3I54A 3QQ6A 5HI0A 5A7LA 3H3ZA 1ZX5A 2D40A 3NL1A 1ZPQA 1X57A 3U10A 1QXJA 2V09A 4X4DA 1ZZ7A 3FX3A 3H7YA 1LMB3 3ST7A 3DN7A 1ZRFA 4NDWA 1ZZ6A 3VHRA 3FZ3A 3HIFA 1X7NA 3ES1A 4YYOA 3G7DA 2PUBA 1X82A 3U0ZA 4IEQA 2D5VA 2LYRA 3M70A 5FQ0B 1WLTA 3E6CC 4MUVA 5CADA 5I0TA 1XE8A 2IXIA 2LYKA 1SFNA 2CV6A 1QP0A 1RIOA 4XFHA 2XCJA 3RDIA 4Z5DA 1CQTA 2Q1ZB 4AQ2A 5I8YA 4PIYA 1CAWB 5KHHA 1ZAYA 1J58A 4XFFA 4HLTA 2MEZA 4YG1A 3JXBC 2BEOA 5EFUA 3SHRA 5JSOA 2OPKA 3R6SA 1CAXB 1J1LA 4WVZA 4I8TA 4E2SA 2LYPA 2D5FA 2BJCA 3S7IA 3U3WA 1RZRD 4J1XA 3QACA 2IVBA 3MZHA 4UBHA 2PHLA 5KHGA 3E97A 1PRUA 2HKXA 3L1PA 1SQ8A 4I0BA 3WW2A 5LEKA 3BPZA 4O9EA 3ZKCA 1O3SA 2H6BA 4XFBA 3EQEA 2KZ8A 2XI8A 3KGLA 3ROUA 2HSGA 4D7TA 5E16A 4YNIA 2XKPA 3F6WA 3SCFA 4IEPA 4IESA 3I7DA 1ZZBA 2OZJA 4LA3A 3RYKA 4KWJA 4IA8A 4Z5HA 3KSCA 3NW4A 4MV2A 1RUNA 1LKNA 4JCXA 3OQNA 1RGSA 1NXMA 2AW6A 1Q3EA 3LA2A 3GN5A 2PUAA 4L11A 2Z2SB 4IEZA 4OLLA 1O3RA 2MHFA 1YLLA 3I59B 4I0AA 4MH0E 5KHIA 1DGRA 4FT8A 5JSPA 1VJ2A 3H1MA 2WFPA 1VR3A 3F52A 2GRMA 2QNKA 1QQBA 2PTMA 3LISA 2OYZA 4AXOA 1O5LA 1XE7A 2CSFA 4AVBA 3S8QA 1OD5A 1JWLA 3KMHA 3CF6E 4KWLA 5FCCA 1B0NA 4MX3A 3SCHA 2XLFA 4IEWA 4MGIE 1J3PA 3BB6A 3HQXA 3EJKA
chains in the Genus database with same CATH superfamily
2PXKA 4H7LA 1W2OA 5JOXA 5FPVA 4HKLA 3PMSA 4BQ2A 2RMU2 5AC93 2A73B 2JG9B 5A6YA 3S0MA 2PXFA 5DZEA 3VK0A 1T6BX 4XJZA 1BYHA 4GJYA 4XILA 3JD72 2D6MA 1XNKA 5LASA 4CDWB 5CEHA 4Q1RA 5D21A 3T4HB 1YFUA 2R041 2RS51 5C70A 3AKRA 3G0TA 5GAGi 3L9JT 1LODA 5FZAA 1VBD1 1ONAA 2ERFA 3VN4A 3VD5A 1K5MA 4M4PA 3FHAA 3OBAA 4GKXA 3N9MA 3O7OA 5FZ6A 5DMYA 2I45A 3LGRA 3TRBA 1M4WA 1EPZA 4EYUA 4COZA 4QGNA 1Y7BA 4EN6B 1AR72 1CONA 3J26N 2GMEA 5JZGB 1IG3A 5JOWA 1UW8A 3DXTA 2PHUA 3ZXEA 3UGHA 5B2GB 3AP5A 1NCRC 1SEFA 1GNHA 2PUDA 4Q4X2 2WIUB 3OQOA 1W6OA 4XUTA 1MPXA 2ZKLA 3T1MA 1C28A 1LRHA 1L7LA 1OLME 4ASKA 2BW8A 1HQNA 1RHI2 3I2KA 3QD6A 2J7MA 3NQHA 5A80A 3DF0A 5BXXA 4N53A 1JUIA 3VBFB 2I07B 1OKQA 1RJ8A 2AH2A 4BB3A 2W87A 2HWF3 4XUPA 5I8SA 3MDPA 5DG1A 5A7PA 1U5IA 3TN93 4KU8A 1JUHA 1W9FA 2C24A 4ZZ8A 2XVGA 3LE0A 2ICPA 4PJYA 1PO11 5FZBA 1QJFA 4IGOA 2B39A 5DABA 3S7EA 1R091 2Y64A 4W6WA 1NA1B 4QPGC 2J1UA 2LTNA 4E2QA 1OQ1A 5IVBA 3H8UA 4AVCA 3AZXA 3VBHB 3ZN5A 3BU7A 2XLAA 2R061 2VMFA 1DF0A 2RJLA 3O0WA 4XW3A 5A7WB 4ZU7A 2E7AA 5IVYA 4ZS2A 1PGL1 1JYVA 4OULA 1HJGA 1TMF1 1OVPA 1CAXA 2QCSB 2ZCWA 5IUQA 4YSFA 4YGBA 1GMMA 1J3QA 1UU6A 2ETEA 1W0NA 5IJRA 4YFWA 1BBT2 1TVGA 5EQUA 3UKTA 4OHYA 2J7WA 1EP0A 4AGVA 3RZHA 1J3RA 2JE7A 3PUAA 4MLOA 1RUJ3 2VQUA 2DVFA 4JQDA 4QQHA 5T5JA 2ODRD 1IPSA 1CGPA 1JI6A 2W0XA 3AL6A 3FHIB 5FYMA 1CQ9A 2XQXA 2VJXA 4A6SA 2PHFA 1GANA 2VMHA 3ZHIA 3O1TA 1KEXA 4CPBA 1B09A 3N9PA 5JR2A 4EJRA 5LB6A 5FZ9A 3CECA 1AX2A 4FQZA 3WG3A 3FYAA 3NXHA 1QJEA 2JDPA 4LK7A 2CAUA 4CEWC 3QCWA 4JTNA 5GLZA 5C3PA 4CDXC 1OOPA 2IXLA 2WT1A 3NAPA 1ND3B 1E3OC 2DVDA 3A0KA 4LKSA 3KXAA 4QHOA 5LRRA 2O49A 1UNBA 2F6BA 4S2HA 4C1WA 5FXXA 2A3YA 1SLTA 4Z07A 4A4AA 1CWPA 3T2QA 1SPPA 3CZUA 4YM2A 5FYZA 4OI0A 1YYNA 2VUJA 3I2IA 4P02B 1QQAA 3S5AA 1QY4A 4AF9A 2P37A 4E4ZA 5AC91 4QKFA 2R32A 1C8M3 4TWTA 2VZTA 3TEYA 4LNVA 4JV4A 3HD8B 2WWSA 3WP4A 4DE8A 3I97A 4IWRA 1NE4A 1TG7A 4AHXA 4UFLA 4X4HA 3CMGA 3WQ7A 1POQA 3JB8A 5A33A 1E5RA 1W3XA 1OA3A 3GZAA 4NIGA 1BBT3 5FZFA 3D4KA 3POSA 2W08A 3OGVA 4F8DA 5C7GA 1FAYA 1NAEA 1RUC3 1W8HA 2AREA 2Y0IA 4PQQA 4B4RA 1DBNA 3AVSA 1YUDA 1UXCA 4GB33 4DPNA 4QXBA 1VBB3 2ID4A 3TRSB 1MS9A 1UY4A 4YFZA 3ALQA 1B35B 2NZ9A 3URFA 1HRI3 4AG4A 2DWRA 3IDBB 1RUF3 1X36A 5A32A 3L2HA 5HV0A 4CU9A 3KT4A 3NJYA 3J7LA 1PK6B 2ZX2A 4CA9A 2LROA 2WBKA 2ZGNA 1LULA 3MO4A 4JTOA 4WM8A 5FWJA 2AGSA 4PDWA 2JD9A 3ZFGA 1PO23 4MG2A 4HN0A 1H4HA 1S0FA 2VO5A 1MQTC 2HWF1 2IUOA 4P9XA 3B02A 1L1MA 5FP3A 2ATFA 3R1FA 3TN91 3PVBB 4GULA 5J3UA 2WNEA 4CCKA 2JKBA 4A2UA 3SMHA 4ER3A 3PURA 3FBYA 3LCPA 3RSJA 4I01A 1UZ0A 2XL7A 2ZTNA 2PELA 5JXJA 3OYWB 1A3KA 3WOGA 3ZXAC 3MPBA 3MUY1 3VD4A 5D8AA 3LOIA 4BE3A 2FCTA 1UYYA 5JVVA 1OF3A 2E33A 5FO8B 1O4TA 5H9RA 3O1MA 3D5OA 4AFCA 1KRIA 2PHDA 3ZN4A 2V4VA 5FR3A 3BS3A 5J48A 4IUGA 1H8TA 3F95A 3O5SA 2JXAA 3OD4A 1ULOA 2OPWA 2R16A 3GZTB 3WLUA 4CDWA 1RUJ1 5BV6A 5DTRA 1EYBA 5FBZA 2IVQA 2DU1A 2VNVA 2W91A 3N9LA 2WNVC 2VMCA 4DXRA 2BP6A 4YVSC 5C33A 3I3MA 2A6VA 4AEDC 1JHJA 1QDOA 5FZ7A 5EWSA 1NCQB 4PLNA 4EV0A 1XB9A 2RS33 4EN9B 1COV2 1WA6X 5EZWA 2SLIA 5AVAA 4ZY9A 2ORXA 1GU3A 3MV11 3TOJA 1EV12 1WD3A 2Y6LA 4AAPA 4KQ7A 4ZONA 2ZGQA 5JXIA 3IDAA 2EAAA 4YZ2A 3TEWA 3FFZA 3ZPYA 2AC1A 2HINA 4TN7A 2VEOA 3K75B 1CIYA 4UBGA 5JAXA 2O4AA 1S0CA 3RYPA 1JYCA 3NV4A 2FBEA 2GNDA 3FWEA 4ISRA 2GU9A 3VWSA 1HRV3 1WCKA 2VCAA 4CU7A 3R4DB 2WFF2 1C8M1 4HZFA 3WINE 3O14A 4LBQB 5FBJA 2JG8B 4YW5A 3SH3A 4EN0A 3P3NA 1FPN2 1H2LA 1HB4A 2VMGA 3B01A 4NE9A 4ONUA 2A5ZA 2QDNA 1LGBA 3WEZA 2L8NA 1SCSA 1KDKA 2FCUA 4IQPA 2FHRA 4K20A 1KS5A 5FP8A 3ITQA 3UJOA 2DVAA 4DMIA 2RM23 4GWIA 1H4GA 4OVEA 5FP7A 1RUC1 5BNPB 2PAEA 1DZRA 1RUG2 5FOBB 3J9SA 4FPOB 4GB31 2UURA 1VBB1 2XUEA 5JXHA 2YBKA 2ZACA 5B4NA 4FTSA 2GZUA 2FCVA 3ELNA 1Q8PA 1HRI1 4INDA 2C9AA 4IEYA 1RUF1 3HVDA 5TSWA 1AJOA 4NVPA 5F3IA 5FYCA 4MGTA 1ASJ3 3NO8A 4P9JA 2ZPXA 2W95A 4LLFA 5L19A 1X2LA 4FFIA 3ZYJB 3KJXA 2LYQA 1PO21 4X8NA 2D3PA 5A7NA 2XVLA 1K3IA 2IVJA 3ACHA 4XZPA 1YIPA 3KF5A 1YHFA 3RI8A 2OR1L 2Q30A 2P3KA 3ORJA 3GM8A 2PHRA 3AMNA 3PUSA 3ZIXA 1J59A 2VBBA 1ND2B 3N7LA 3NWKA 2CROA 2DBNA 2JQEA 1S7EA 2JVLA 3POBA 3VDAA 1FNYA 2UY8A 4Y22B 5I8TA 5E8AA 2BFUS 2WFF3 2RDNA 2HWD2 1QXRA 3IVPA 4KL1A 4BZ4A 1W8TA 5CFDC 1I6XA 3U4XA 3AYAA 3I2FA 3PUQA 3ASIA 2VXJA 3ENRA 4RQPC 1FPN3 3E5XA 5CKQA 1NQJA 1HN1A 4WM7C 4XVHA 2W68A 5FLJA 4M0NA 3BN6A 3WF4A 5DAPA 4CDQA 2WNUC 3LZZA 4RHV2 1QDCA 4X4CA 1FT9A 1ULGA 1Y9GA 5KR7A 1T6GC 1AYN2 3KV9A 5CFCB 3ZFEB 4NWVA 1UZVA 1GWLA 1JZ5A 2BFUL 1DP0A 1QWRA 1YIFA 3D8CA 2X5IC 3OY8A 4JKKA 3T2PA 3U78A 1S0DA 4B1LA 2CHHA 3CEWA 1LR5A 2V72A 4LE3A 1ZZ9A 4MZUA 3ILFA 5A6QA 2A6XA 4NIHA 3H42B 4L99A 1O5UA 4YGDA 1TME3 3NMBA 4R8HA 4BK4A 3MIGA 4JKLA 2RS31 1RUD2 3I3EA 5T5OA 3POJA 1ENSA 3WX5A 2K2SA 5EHDA 4FPGA 3GN5B 4CCDA 3V0AA 3B93A 1BMV1 4H2AA 1CJPA 4GKYA 2GALA 5JLVA 2R6QA 1H6YA 3VD3A 3H3LA 3JB4C 3GZDA 1YQ8A 2HWC2 1VMJA 2JENA 3JBG2 3I49A 3BTXA 3T30A 1HRV1 3NKTA 3B5LB 4QDSA 5HI0A 1Y4WA 1GZCA 1HQWA 4R4XA 1UY2A 2EXJA 3FE5A 3IBMA 4MHRA 5FRAA 5AVPA 5CNAA 3UGGA 3WDVA 4WVMB 2RR11 2R073 2YBPA 4UF0B 4XFAA 5DAVA 4FPCA 3FHQA 4QDRA 1QEXA 1GLHA 5DUVA 5G05L 3VV1A 3BU0A 4NR1A 4JKMA 1I1EA 4LORA 2RM21 3TAYA 3VKLA 1Z7S1 2AACA 4GWNA 4AI2A 1PM7A 5KXDA 1UD1A 1PZ8A 1YNAA 4NAOA 2LUWA 5DUUA 1HB3A 1DQ6A 2VW0A 4QX2A 1X9PA 3O1OA 3OMTA 3SR4A 4N53C 3T2TA 4AI0A 3DUIA 1OBNA 1Q43A 2RDSA 3OBRA 1NKGA 2AR6A 3AP6A 5APAA 1DQ4A 3AZVA 3HQRA 4PIZA 4DNYA 1ASJ1 5DRYA 3NV2A 5IVJA 2QQOA 4UFJA 1HB1A 1JHNA 3JXSA 1NLRA 4ZU4A 5FPXA 3BYWA 3BIEA 3EMRA 1QJX2 1TQ5A 5BNNB 3VBUB 3U11A 2JDYA 2D5HA 2WUHA 4CSWA 5FY8A 2RG4A 2VVDA 2XBO2 4W6YA 5FOJB 2VC9A 4CDUB 4NHXA 2WJSA 4P00B 1KJLA 4OUMA 4PF1A 4ZHNA 1NCRB 1QXJA 2DV9A 2WAOA 1E5IA 2HWC3 2DUQA 3FX3A 3H7YA 3ST7A 4Q4W2 4CZSA 4DUWA 4G9SB 5L9RA 1SG3A 5C71A 3HIFA 1JYTA 2JICA 4HK8A 4UFIA 4HKOA 2JEMA 5DTMA 1X82A 3VZLA 3DXUA 1DLCA 5GZEA 3UV9A 1NY72 1SLLA 1WLTA 5LK5A 3SKVA 3Q9OA 1WLWA 1POV1 5E88A 4XXAA 2CV6A 3VZMA 2ZHLA 3AM2A 4XQWA 2G4IA 3ME5A 4S2DA 4Z5DA 1MFQC 1CQTA 4CDXA 5DXDA 4AQ2A 2EXKA 3FLPA 3NNLA 4PIYA 2WNOA 4C91A 1CAWB 4GD4A 4M4RA 2P5BA 1ZAYA 1LJ7A 2OXBA 1H9WA 2BEOA 1MEC3 1WW7A 3KZ4C 3OEAA 5FYSA 3SHRA 2OPKA 3KT7A 2QZ2A 3VBRB 4D69A 1J1LA 1DHKB 2D3RA 3K3OA 3R4SA 4LPLA 2ZMLA 3VKOA 4I8TA 2CWSA 1OOPC 4YM0A 2D5FA 3NAPC 3R0RA 2B9VA 3SQOA 1TME1 4LK6A 2WL1A 4NAMA 3QACA 5A3UA 3H8OA 1NXD1 1HJFA 4JZRA 3V56A 3VD7A 5KHGA 1PRUA 4UW3A 1GSLA 1QQP2 1SZBA 5CB7A 2RHPA 3L1PA 1EUTA 1ZBE1 1SQ8A 1ULCA 2DUOA 3CJIB 5F2WA 3WW2A 5L9BA 2C9KA 3PTYA 2Y6HA 4O9EA 2GN7A 4IE6A 1W0OA 5H9SA 2A6YA 2JE8A 3KHBA 5CKNA 1MR5A 2XI8A 5L7OA 1WCDJ 1S0BA 1GKBA 3GXUA 5LW9A 4Q2JA 3AZYA 3N7KA 4JQRA 4A7YA 4AW7A 4FPEA 1H9PA 4XE9A 2DTYA 2OZJA 2XUMA 4Q4W3 4UFKA 4LA3A 3RYKA 2PXEA 1XYPA 1A8MA 4DRRA 4MV2A 4IV1B 3C7OA 5FO7B 3OQNA 1K45A 1NXMA 2AW6A 3NZLA 1Q3EA 2ZMNA 4DFSA 1RVF2 4JGZC 3GBGA 3IM0A 2WS92 4IEZA 4K9SA 1O3RA 2R071 2A6WA 2MHFA 5GZFA 4I0AA 2EXHA 2VTFA 3HN3A 3W58A 1CR7A 3DYMA 1BVP1 4COVA 1UN1A 5IFPA 5LA1A 3BODA 2QNKA 3DYOA 2C5DA 4WM8C 2YDEA 4AXOA 2PN5A 4BLJA 4W65A 3T0DA 1K42A 4PDWC 2GNTA 5FXZA 5JIAA 2WA3A 2Y6FA 3AYCA 1AX1A 4KWLA 1TNRA 3VZKA 4AVVA 4MX3A 2RS52 4DUVA 2FZ2A 1Z0HA 3BB6A 5FPLA 1VBD2 2QQNA 5FKBA 4FFHA 2OX0A 4X6RB 3QOXA 2ZHKA 2ZBJA 4LA2A 2MXDA 1X8EA 3WNXA 2W1UA 4ET7A 1W6NB 2X09A 1HXS3 1XNCA 2Q8CA 3VDDC 1CX4A 1R1ZA 3DV8A 1HKDA 2GSYA 1KJRA 3LD8A 1N47A 3DPRB 3OJBA 5D8AC 4KU7A 5T5PA 4HPKB 4D7TA 3PHMA 2PIJA 4MHUA 1FMD3 4XAAA 1RUI3 3C7HA 5F5AA 4R4ZA 3V64A 2HCSA 4BK5A 4Z2AA 3EO6A 3N4MA 4Y20B 2XLGA 5HBAA 3CJXA 2L1PA 3AKTA 1S0JA 4XF9A 4FOVA 2WC2A 4M3CB 3RWKX 4URTA 3OQMA 3F51A 3I2GA 1V6MA 5J96B 3BCWA 3MIEA 3MIHA 2WNVA 4LBKA 2GN3A 5A1FA 3PU3A 1H8TC 5KXBA 3ZMOA 2AEZA 1HV0A 2BPA2 1YXWA 5BNOB 1OSLA 4HKWA 4B4PA 3R09A 3OKZA 1PO12 4QQLA 3TB0A 3A7QA 2J1TA 3MLJA 4OB4A 1R092 2SBAA 3P1IA 5C9AA 3ATGA 2NP0A 4HOOA 3M3EA 3C2UA 2XSDC 4B3NA 2ZGOA 3A23A 3IPVA 3ZYIB 4D6SA 1ZREA 3WG4A 1MEC1 1WCQA 1LOFA 2B42B 4CE8A 3DL3A 4NHMA 2R062 2ZOEB 3AMQA 2VUDA 5I0DA 1W9TA 2BZDA 1PGL2 2QZ3A 3ZYGA 2EWTA 5D2AA 5FYUA 2J1AA 2VQTA 4GWMA 1JBCA 2O14A 1TMF2 4C0HA 2CU5A 1PHMA 1VBD3 2X8KA 1W6PB 2HYKA 3MEJA 4D6QA 2ARXA 1WD4A 1BKZA 1CAVB 2MQKA 4PU7A 4FOWA 2O0OA 5ACA3 1QU0A 4LO5B 3BALA 5CVRA 1QXPA 4F8AA 2Q8EA 3LDBA 2BBAA 1Q8SA 3HT2A 4XEZA 1PZ9A 2DFBA 1JU3A 4MCXA 1IPJA 5FWEA 1UIKA 2M4HA 1W6MB 2A3WA 4GH4B 3W20A 4BXFA 1A78A 1XWRA 5IK5A 3AYEA 1AJKA 1FV3A 1U12A 4ARXA 5M0TA 3WDUA 5GKAC 1UYXA 2FJRA 5C8CB 2XL9A 3POWA 4MGQA 4BMEA 3MPPG 3VUOA 3UWPA 1MZEA 3RJRA 2W2IA 1JZ3A 5SV8A 1DQ2A 1FX5A 1YC61 4P9LA 3W5NA 1DDLA 4FOYA 1A8DA 2J22A 3U37A 1JU4A 1OVSA 2WLPA 4M00A 4O65A 2UYAA 1F15A 1JTZX 3IIAA 4IV3A 3ZYHA 5JPMB 3RZKA 2IFWA 2ZAAA 3ZX7A 5EIYB 5FQ0A 1CJGA 3AB0A 1LESA 4RS5B 5AC92 4Y5SA 5DT2A 1W0PA 2J42A 2PHXA 1S1AA 2GRLA 4YG0A 2R063 3NJZA 2XJQA 5C5UA 2HYXA 3SCGA 4F7ZA 4KWUA 3WUDA 1MZFA 4RR3A 1AR83 4XZUG 1UOGA 3KQ4B 3ZHMA 2ZMKA 1UL9A 1LOAA 2QBXA 3FYMA 5ABJC 4N9IA 1LECA 2VZ1A 4GAZA 2YU2A 4XUNA 4PIXA 1HXS1 1R63A 1S55A 1L7QA 1H0BA 1RIRA 2XH6A 2ZGUA 2YB7A 4WM7A 3IDEA 1NE6A 3JCIA 5ISLA 4LMFA 5FYIA 2H8RA 1CAUB 4C90A 4CUGA 2WNUA 4BISA 4XFIA 3N9NA 4Z5CA 1FMD1 1RUI1 1NQDA 4Y3OA 2FMYA 5EJ1B 3VBSC 5FZDA 3WHUA 4CEYB 1BJQA 2VQAA 2X05A 3AKPA 3IMMA 3PL0A 1HB2A 4ER6A 3VBOB 4X6QB 2Y34A 4MGZE 1O4YA 5JUVA 3AC0A 4PHZA 2JG9A 3AP4A 1NX9A 4ZS3A 3QYXA 3VDCA 3ZSJA 4BHPA 2BNMA 1GNYA 2EXIA 2HWF2 1UF2C 3K77A 2A3XA 3OPZA 4ZXKA 3TN92 1KFUL 2LYSA 4I6RA 3BPSA 3OGGA 4MO3M 1H30A 4RGGA 1NEQA 1VBA3 4BQ5A 2WDBA 4HT1T 4JRAA 2AEYA 2Q1MA 4Q8KA 2Y6KA 4ITCA 2B45X 1S0GA 4QX8A 3W21A 4DS0A 3JQWA 3RYRA 2DCKA 2XDVA 1XNTA 3K46A 3AMMA 1VMFA 3ZSLA 1S0EA 2NN8A 1GZTA 5T5LA 4GHJA 3GF6A 2E9QA 3DECA 4BWOA 5JZGA 1RYYA 4ORFA 5IW0A 5JSOA 4ISQA 5CFDB 3AL5A 3GZEA 1DWKA 3KV5A 4GMP3 4W50A 5DZGA 4E27A 3G6JB 4MADA 2L9LA 1GZWB 2GH2A 3IDCB 5FZ8A 4CCEA 4Y4YA 4TZDA 4KWKA 2JD4A 1ZVFA 2B46X 2XQRA 1QNYA 1D7PM 1UPSA 4FFGA 4J6GA 2K9ZA 3V0BB 4YW6A 3GZDC 1YI7A 4HMZA 2O8QA 4YM3A 2YUEA 2EA7A 3PVEA 4URAA 4FBIA 1RUJ2 1UXZA 3W59A 5ACA1 4H3WA 1XNAA 3M3QA 2ZGLA 4QB6A 3THPA 1GWMA 5CIRA 5IVEA 3SEPA 2YFUA 4XMAA 1D2SA 1AYM3 5CG9A 1QF3A 1RL3A 1W04A 1AX0A 2R0FA 4AHYA 2YGLA 2OQ7A 4DEVA 3THDA 1NA1A 2J1SA 2BBVA 2CDPA 3PE5A 3OBTA 5G04L 3VBHA 1D0HA 4GXLA 3ZKYA 5FY4A 4UXAA 4Q2FA 2WQZC 4XFCA 2YPDA 3OUHA 2XGXA 3CIHA 1OLRA 2DVBA 2K0GA 3U75A 3AXEA 2Y60A 2H0VA 1AR91 4Q4V1 3B7HA 2W1WA 5SV5A 2ARBA 4AFDA 4ARYA 2J1RA 2Y6GA 3APBA 3MIDA 2DF7A 4HXCA 1C8M2 1K5MB 2TBVA 2VQ0A 3USUA 1GOFA 1JZ4A 2H6CA 1YO8A 1AR81 2CDOA 2JCGA 4CYDA 2YFZA 4ATFA 4NIDA 3ACLA 5CYYA 1YFYA 3O1SA 1UO9A 3N7JA 4LBMA 1AVBA 3WNPA 2BNOA 1L3JA 2E7TA 2PMWB 1RUC2 3BTZA 3H3UA 3RNSA 4AQTA 2H0BA 2VW1A 2VMEA 3CHXA 4FBFA 5L9VA 3BD1A 3KM5A 4GB32 3LIHA 4CP9B 1ND3A 1VBB2 1LNSA 5I0UA 4QX5A 2HCNA 1LGNA 2WQ4A 1HRI2 1C5HA 2VUAA 2Y0OA 5K4LA 2QQUA 1QGLA 1RUF2 5FIXA 3O9XA 1S2EA 2BGPA 2JB8A 2PAKA 3DCQA 3C7EA 4I3PA 4XBLA 3SH5A 4YGCA 4CCJA 1IPKA 3E6DA 3JQXA 1NERA 4AVAA 4C1XA 1PO22 2ES3A 3LEKA 3M2MA 5A3MA 2WT2A 5J09A 3PUIA 2GAUA 4M3CE 1IQAA 3ZFFB 1CESA 2LYLA 3MW2A 5FZEA 4MSVA 3WD5A 1VBA1 4LOSA 2XWJB 2W1SA 1LCCA 1MZ5A 2P3IA 4RFT0 4BQ4A 1VAMA 1NT0A 2XJUA 2V4AA 4D8MA 1BLZA 4IW3A 2WUSR 3MIFA 2G9GA 1OH3A 4YVWC 5BUVA 2I74A 3O1PA 4YZ3A 3I4IA 1C1FA 4GMP1 3KL4A 1A6CA 1N1VA 4XF0A 5F32A 3LDRA 4R9BA 4XAEA 4KI5M 1LU1A 3KZ3A 3GDBA 2WO2A 2B5AA 3HT1A 1PX3A 2WA4A 4F83A 2HEYF 4XOGA 1DG6A 4K1YA 5L7OC 2XHKA 3LEIA 2XXAA 2YC4A 3OCPA 3WVJA 4JGZA 1I9RA 1F2NA 2VM9A 3P5BA 5I0SA 3KV6A 5E89A 2PUGA 1CZVA 5LRSA 2C0ZA 2WIIB 4MCTA 1N3QA 1VBE3 2VZPA 3RMXA 1RUOA 2VPVA 2ZS6B 4CTEA 3AVRA 1O7FA 1AU7A 1AYM1 1C3HA 1OA4A 2D98A 4HRAA 2QTWB 2BWCA 2AENA 2WO7A 3ZKUA 4I6TA 4EE2A 4QMAA 2RS32 3OYWA 4PQ9A 2PXJA 1UMZA 2QQIA 3OPTA 2XG3A 4Y24A 4OUSA 2XXQA 1BMV2 2AWIA 4X4FA 1QJY3 3WUCA 5KBFA 1N1TA 2WR9A 1A34A 4FI9A 3GHMA 1W9YA 3K48A 5K98B 3UKVA 4QHBA 2PA7A 1SMVA 4LBOA 1W05A 2VGDA 2UYBA 1HRV2 5DUWA 1O8PA 3VDDA 2W3JA 5HCHA 1DFQA 3WSOA 4IEOA 5F1RA 2BNNA 5FMCA 4ZXEA 4XCBA 2WZ8A 4X4GA 3ZVXA 2RR12 3HQUA 5GAHi 5LY1A 1BDIA 4OHXA 2LLWA 2JWPA 1XQNA 4FOQA 3T2OA 3J4UH 4JGYB 5CU1A 3RQ0A 4P14A 2OUHA 1NCQA 5FPUA 3J7MA 2RM22 4BCUA 1O3TA 4EN8B 4KGQA 1Z7S2 3ETQA 5IATA 3NROA 2KXLA 1H2MA 1JYXA 2JX9A 1DU3D 2NPIA 1WW6A 3CQOA 1SLIA 2XJVA 3FLTA 1S2BA 4LKDA 4D7SA 2Z42A 4P9YA 4PDWB 3AFGA 1LOBA 4EZ4A 5K0UC 3FJSA 3ZFGB 2W94A 1KITA 1UX7A 3LF7A 3MFAA 3N9QA 4KBBA 4XF1A 4DZGA 2ZXQA 2PXUA 4JDNA 2HJIA 1O4ZA 1DGWA 2OA2A 3WNLA 3ZPOA 1FI2A 5LZ6A 1ASJ2 1G86A 4GWJA 3VZOA 1EAH3 3WQBA 4DIQA 1N1YA 1HIXA 5A3WA 4E4HA 4L9BA 1ACCA 3JZVA 4A3ZA 3NNFA 4CXWA 5C9AC 4LBQA 4J1WA 1MZ6A 4QPIB 2LRPA 1W9WA 2JG8A 2AXUA 2ZGSA 4XJUA 4UOJA 5FK7A 2LALA 3B7MA 4A3XA 5JXGA 2MNGA 1JH9A 1LOFC 1ZYBA 4P9GA 4ES8A 5DPNA 1IKPA 3UESA 2VZQA 5JMCA 3J8F3 4K7JA 5A7QA 5C3QA 3I2HA 3MHZA 4PF5A 4A45A 2WRAA 1N3PA 2V73A 5JOYA 3OSDA 1OPOA 1O4XA 3H7JA 3U14A 1DGRN 3KD4A 3FC0A 2WN2A 1PMJX 3VB9A 5BNPA 1JH5A 3IT8A 3DKQA 3MUZ1 2VOTA 3DEMA 4GJZA 4JHTA 1UYZA 3IAQA 4LKFA 2YYOA 1GICA 2D40A 2VH9A 2RR13 1OSGA 2CL2A 2W47A 1QOSA 4CUAA 1ENQA 1LMB3 4RGKA 4OI1A 3HWJA 2O8OA 4NDWA 1ZZ6A 1BEV1 3CZJA 3FMGA 4HK9A 3FZ3A 5EXOA 1ST8A 2JIJA 1Z7S3 2WYSA 4NROA 3SKJE 3RFRA 4IEQA 2D5VA 1WKYA 4NRMA 4QB2A 5L36A 1W99A 4N43B 5H9QA 1OT5A 1VBE1 4Y1XA 4XQDA 2RDQA 1QP0A 1RIOA 4XFHA 5H9PA 4P9IA 4DQAA 1TME2 1ND2A 1X9TA 1JOBA 2RDRA 2YV8A 5DAXA 1UY3A 3MF6A 3W9AA 1ULEA 2D97A 2Q1ZB 3GHNA 4QXCA 3HBKA 5FYTA 2WYFA 5KHHA 2EIGA 1R1A3 4LO6B 2KR2A 4Y22A 4HLTA 5GLTA 4YG1A 3RS6A 3WP6A 3A4UA 3DGTA 1E5HA 3WNNA 3MBWA 4IV3C 1MACA 3R6SA 4LQRA 3GZCA 1PVXA 1TE1B 1ZBE2 2X10A 1QJY1 4RGAA 1VB4A 2BJCA 4YLZA 4Y33A 3WT3A 3JUUA 4AI3A 5ABJA 3MICA 4B7EA 4U36A 5FUPA 3ZN6B 2A75A 4YW3A 4DXSA 1XE0A 2HKXA 1OUSA 4RR3C 2G19A 2AUYA 3ZSKA 2VMDA 2VW2A 2YROA 5C4WB 3ZFEA 3A9XA 3TBDA 4XIKA 3KVAA 1VMHA 1WCUA 1X50A 3BIWE 4XDOA 3KHCA 3VBSA 3ZKCA 4CVUA 2AZ5A 2G9FA 4SBVA 4TSVA 4XFBA 3RZGA 3I3BA 1H2NA 1PIV3 2HSGA 4JC1A 2R072 2IVIB 3M3OA 4YNIA 1POV3 5E6HA 4AFMA 2VZSA 4IEPA 1GUIA 1PGSA 3BOWA 4FTBA 3I7DA 1W8NA 1Y9MA 3KVBA 1REFA 4KWJA 1RUNA 5LY2A 2XJPA 1LKNA 4JCXA 1QH6A 1RGSA 2PQSA 3KF3A 4MOAA 2FD8A 3LA2A 3GN5A 1ZBA1 2PUAA 1UOFA 1QJU1 1BK1A 1LCLA 1OH4A 4UWDA 3VKMA 2Z4FA 2JG9C 1JXNA 1DGRA 1OXCA 3PVOA 4W8JA 1GP6A 1VJ2A 5DDJ3 4CDWC 3OWQA 3F52A 1QQBA 1EAH1 4EQVA 4BMBA 4W6XA 2OYZA 3QLQA 3SITA 1NOVA 5A70A 3ZO0B 1W39A 4AVBA 3S8QA 4HFSA 1JWLA 1ENRA 1ZBE3 4ASMB 2JJ6A 1B0NA 4SLIA 4WVMA 2JDZA 3H0OA 4MXWA 1D2QA 5JZGC 3HQXA 2A6ZA 2ZZQA 3UFDA 3J8F1 2LM3A 3H8XA 1BK0A 2KD7A 2ZHMA 1UZWA 1J84A 1W6QA 4D3WA 2GDFA 1ZNPA 2WZR3 2VULA 2X29A 3VKFC 4CDQB 1DYKA 4WZCA 1RXFA 1WCSA 4FQ4A 4Q0UA 4Q1PA 1TZOA 5JPNB 5FPZA 1D4M3 3AFKA 3UK9A 3QOPA 4O9GA 1W03A 1GR3A 2D7FA 3LQXA 2IU7A 4FN3A 4DXZA 1PRVA 2PUEA 2P6CA 3LEMA 4YM1A 5IVCA 2ZEYA 3QH6A 1RUH3 2D93A 3WF2A 1DQ1A 2R49A 2HWB3 3T3YA 1MEC2 1BXHA 1KS4A 2PUFA 1NA1C 1RMU3 4JDMA 3TWIA 3HPNA 2MPFA 5FXWA 3VBUA 2ZJCA 3OGSA 4R52A 3VBHC 3ZXFA 4CDUA 4FP3A 3CKHA 1RTVA 1W8FA 3UYJA 1IC8A 4CCLA 2RS13 2CNAA 2C26A 3U1XA 1S0IA 4BDVB 3DNVB 3VGIA 1R1A1 3H1YA 3SLIA 3AP7A 3IZOA 4FPFA 4GIQA 5IK4A 1SDDB 4M01A 4OYUA 4V1PA 2FDHA 4QB1A 2LCVA 4XHBA 2YHJA 1HN0A 4IEXA 1WETA 3VZNA 3B3QE 5FYYA 2OUJA 4Q0QA 3AJYA 3QBQA 3VLBB 4D94A 3BI3A 4LIUA 3JXCL 1R083 5LBEA 1Q56A 1QJZA 4LBQD 4AQ6A 3LIGA 2X53S 4OUEA 4M0HA 3IWZA 5A7OA 1LEMA 2VZVA 4EROA 2IUWA 3ZDVA 2ZX4A 1CAWA 4ER5A 3R4UA 1XNBA 3U07A 4AYUA 4DB5A 1JZ8A 5JSRA 2R1JL 1VE0A 1XU2A 3HOBA 3VBRA 4FPHA 3SH4A 2N7GA 4XC9A 3E5QA 4NUBA 1UKGA 1V9U3 1PIV1 2JDMA 1HF0A 1ND3C 2XWBB 1N3OA 3L2YA 4CU6A 3DYPA 4IE0A 4OI4A 2WKKA 3IB3A 3E6BA 4A7KA 2P3JA 2OIIA 3DKWA 4YG7B 3Q8CA 4V2WA 5GZGA 2EBYA 3LFMA 2XJTA 2ET1A 3B69A 4QPGB 4QKDA 1DZTA 3AJZA 5FZGA 1G9CA 3GJBA 1W28A 5LATA 5IK7A 5JIUA 2WZPP 1QHDA 4EKGA 4I3GA 3WW1A 4AE2A 2J7UA 4Y4RA 4C8DA 1ZRCA 4PCRA 3D82A 2EIBA 4K8FA 1OLMA 4K8RB 5DDJ1 5J7MA 1U0AA 1WMFA 2ADEA 3H1WA 4XMIA 3LQCA 4OCTA 1XOYA 3HMYA 4Q29A 2RJ2A 3ACIA 5IFTA 2NM1A 4YVWA 1H8VA 4TLFA 1ENXA 4IV1A 4R9DA 4UAPA 1HXS2 2JDUA 4AVTA 4EK9A 3JU9A 5HCAA 4Q0PA 1UTXA 1HW5A 1V6LA 5A1LA 2WO3A 1VP6A 1MS0A 1XSRA 1HLCA 4QGLA 2YU1A 1R69A 1OCTC 1FMD2 1RUI2 3QWGA 1E57A 1JOPA 3QF3A 5J98B 1PGW1 5GZDA 5LWBA 2DBIA 1SLAA 2VOKA 3ZLIA 2LYJA 2WZR1 4KGGA 4ZKTB 1QB2A 2ZX1A 4ER0A 4HANA 1PK6C 5DQ0A 4CEWB 2WWJA 4I2OA 2YG0A 2ZA9A 4CDXB 3NJXA 2BOIA 2PXTA 1YQCA 5FLHA 1UPIA 1VBC3 2CGOA 4RA0A 5EYXA 1D4M1 1IGOA 1SCRA 4EWAA 2ZX3A 3TEPA 1QOTA 2BJSA 3N9OA 1PMIA 2UWCA 3C7GA 5GALA 3O0VA 4GZ9A 3RZMA 5FYVA 4CRQA 3BOPA 1RUH1 4EWEA 4DOUA 2HWB1 1V6KA 1W6NA 1RMU1 1Q8QA 1XSQA 3RRDA 5BPXA 2VZ3A 3CO2A 4O8BA 5FZHA 2PHWA 4XIOA 3DPRA 3IN9A 2VZOA 4RD7A 1U5ZA 4HPKA 5LBBA 4V2VA 1IS4A 2RS11 4I6UA 1NW3A 2ICTA 1DYPA 5CKMA 4AVSA 3EBRA 4M3CA 1GV9A 4YYOA 1W2UA 4OBMA 2VL4A 1MS5A 4A7ZA 1YFXA 2XR4A 4FO9A 3VHPA 3QH7A 1AR62 1RB8G 2XJSA 1P8JA 2E7QA 5ACA2 2KEIA 4IEVA 5EV7A 1ZM1A 4Y26A 4PU3C 1KD7A 1FV2A 3EHKA 4O7XA 2VTXA 5BNOA 5FK8A 2BU9A 1RITA 1R081 1DGWX 2QFEA 1LOCA 4GQMA 4JHZA 2EF8A 4BIFA 1AXZA 1VB2A 3INAA 4AFAA 2YBSA 5CISA 1NCQC 2IXJA 2UU8A 2ZEXA 5K0UA 3NDBB 1WLCA 2O38A 1CZSA 3N3HA 1MQTB 1EPWA 5ERLA 1V9U1 2OVUA 4K1ZA 3SXWA 2FDFA 5E1RA 1VIWB 1XU1A 4LUMA 3KB5A 1ZZ8A 4LR4A 5IK8A 2WAAA 1GP5A 1AR92 4Q4V2 2P3YA 3OEBA 3H5TA 5FZLA 5JMOA 1F4AA 1W6PA 2D44A 2TNFA 1F8VA 4XABA 3RGBA 2GMPA 1CPNA 4B4QA 4BH9A 1XPWA 2ZAHA 1BDHA 1ODNA 2FDIA 3ZXLA 4NIAA 4HSLA 3USSA 4NHKA 1C8NA 1CIWA 2VECA 3WQ0A 1VRH3 1AR82 1LHOA 5JUWA 1YCIA 2B7YA 2JG8C 2QQMA 2VVEA 3I8TA 5F6LB 3PJYA 2W9XA 2MEV3 4QM9A 4QAWA 3A9YA 1BQPA 2JDKA 1HV1A 4FSJA 2ET7A 3FUOA 1ZRRA 3ZXGA 5C5TA 1AR63 1U5XA 5A3TA 3C3VA 1MS1A 4I02A 5BNPC 1OLQA 2OT7A 3ME2A 1IOAA 1WMDA 2BYVE 1EFAA 2B9UA 1IHMA 2RJKA 2WNVB 1MS3A 3GJAA 3J7HA 3LPFA 4Q5OA 5DN2A 4YVSB 5GLVA 4COYA 1YSEA 2GP3A 4AEDB 1DW9A 1UCXA 4Y5Z0 3CBNA 5FUNA 4XACA 2IXCA 3BGAA 3O0XA 4XTPA 4AAXA 4DY5A 1S2KA 5FY1A 1SBFA 5FYHA 3TNQA 2JE9A 3D6EA 2GC3A 4MGKE 5F3CA 1UIJA 1FXZA 1VBC1 4DO0A 2IC1A 3WNOA 3OUIA 4BQYA 1VBA2 2EAKA 2V5DA 2OZ6A 1NG0A 3AZZA 2FQPA 2HWE3 3CL1A 5HCBA 2ARCA 1AR93 5B4XA 1GBGA 4LHLA 4Q4V3 4A41A 4AR2A 4YARA 3AYDA 1ND2C 1ULFA 3OD0A 4XETA 3WXPA 5JOZA 1V70A 4OZOA 2BUKA 3PIGA 4QD2A 1BHGA 4COWA 4L0PA 4AI9A 2IXHA 1CZTA 2JECA 4DINB 2WSVA 3RZLA 1CAUA 2VE1A 3CLPA 3ZIWA 4X4BA 3NJVA 3MI8A 4RFRB 3UT0A 1QP4A 1JYWA 4W4ZA 3I59A 4EWDA 2UY9A 2PPXA 2FMDA 4D7YA 2DDUA 1IKQA 4L92A 2A7AA 3MW3A 4P08A 3VBOA 3CU7A 2GMMA 2P17A 3WW3A 4DXTA 3ZFEC 4IERA 3SNMA 5J1XA 4R9CA 2WN3A 4QWNA 2EVXA 5HXMA 1G6NA 4RYDA 4BM8A 1AYM2 3K4DA 4CCCA 4I30A 2BERA 4WVLA 1AXKA 2Z5WA 4K3UA 5D1IA 3M1HA 4JCYA 5FZOB 2QQJA 2FZ1A 1C5IA 4CCNA 3A21A 4A42A 4BQXA 2D6OX 4JDOA 1ZZCA 2ZGMA 4LE4A 3ZXKA 1J1TA 2BWAA 2JDHA 4CP0A 3NVCA 1WW4A 5DG2A 5FYBA 3PTRB 3S57A 1GZWA 1G9DA 3AX4A 2QVSB 3GALA 5ANQA 5A3NA 1W8UA 3NNGA 3Q8AA 2PE5A 3NKGA 1EUUA 2D6LX 4N9HA 1FOD3 2CTVA 3ZSMA 2XKOA 1RUE3 3V0BA 1STMA 1GOGA 3HAGA 4GALA 4U2AA 4FAGA 4OI2A 3TELA 1YEWA 4YG4A 3LWCA 1PNGA 1AL23 5FXVA 1YJLA 1GZ9A 4LITA 3RJ2X 4CCMA 5K9YA 3HBZA 3LEGA 4YZ1A 1VRH1 2PAMA 4RQPB 2A1XA 4WM7B 5FDBA 2MEV1 4NRQA 2WNUB 5T52A 3W5MA 1RPEL 2VCCA 1DULA 2DUPA 3AXDA 3P3PA 2ILMA 4AK3A 4HL0A 3O1VA 3JXDL 1AR61 4EQZA 3C7FA 3M3CA 4X8PA 3VBFA 2D6KA 4YZ4A 5I91A 4FPYA 4ZPIA 4E4SA 1YQ5A 2X5IB 1PNFA 2DTWA 2QQWA 3PMEA 4N7UA 4XCAA 2GZWA 3N35A 5FREA 4S2FA 5C6CA 1W90A 4JCKA 2G1MA 3D0JA 4XUQA 1ODMA 1QOOA 3EYPA 3I2DA 2BGCA 1CPMA 3H8RA 1UWWA 3D3AA 2OFYA 1ZUGA 3LAGA 3M4FA 4Z8BA 2VOXA 5A7WA 3N36A 4I09A 4LO4B 4XF3A 1H1IA 2PLV3 5BNNC 4XPVA 3VBUC 4EN7B 2QQLA 3HNMA 1CN1A 1GWKA 1SFYA 2DCTA 2HWE1 2EICA 2DYCA 1GQPA 2R1BA 3AMHA 2DVGA 4CDUC 3FLRA 1RC6A 3D1NI 1VAVA 1I5PA 3AKQA 5FAXA 2RE9A 1F5JA 1OURA 3PLQA 2XIUA 3ZYRA 3GCXA 2FDGA 4CP9A 3ETPA 1LTEA 3I2OA 1YQ6A 2YBDA 3KWVA 1XBFA 4YBAA 3WP3A 4XF4A 2VVFA 5FO9B 4HN1A 4HSJA 3VKNA 4LTAA 3MLKA 3UJQA 3UNPA 3WDWA 2QDRA 4WZFA 1C57A 1W06A 1ZVVA 2Q5TA 3SC7X 1BEV2 1PERL 3ILRA 4FAHA 1IQDC 2VTXJ 4Q4Y1 4GMP0 4IE4A 3OGJA 4AEMA 1YJKA 1OUXA 1W6OB 3QQ6A 2D3SA 1NLQA 1Q8VA 5A7LA 4YWAA 3U4SA 3H3ZA 4Q26A 3ZFFA 4CUCA 2RV9A 1ZPQA 3U10A 4LBNA 4X4DA 1ZZ7A 1VBE2 4YPJA 4N53B 1ZRFA 2RMU3 3EB7A 4QX7A 4QT6A 4YG6A 3VBRC 1SDWA 2DCZA 3S30A 3VHRA 3POGA 1JZ6A 1DIWA 1UOJA 3JD73 3OPWA 2HEVF 2Y26A 4HONA 2WO1A 3G7DA 1MS4A 5FZ1A 2BV4A 4Z1VA 4IL7A 4CP2A 5EYYA 5CADA 2XOMA 1D4VB 2XHNA 3HJRA 2IXIA 5I0TA 1QJY2 2R1DA 1ULDA 2P1BA 2XCJA 2EF6A 3RDIA 4FXGB 4UFMA 3CJIC 2VNRA 3USUB 1AR73 2A70A 2WSUA 2DURA 4PBOA 3OOXA 1FOD1 2Z79A 1PZ7A 1VPHA 1RUE1 2BTVC 5EFUA 4UYBA 3IIIA 1N1SA 1CAXB 3ABZA 3MFCA 4Q4X3 3A0NA 4QQ2A 4WVZA 2VCMA 3THTA 5T50A 3N7MA 3E1F1 4AGGA 1AL21 5ANNA 3WF0A 1DQ0A 1GFF2 4J1XA 1RHI3 2VXRA 2IVBA 3CDZB 3ILNA 4IV1C 1H1AA 4BA6A 5CA6A 2PHLA 1B35A 3E97A 4K21A 2W39A 4AL9A 2DFCA 2VOVA 1O91A 4QU1A 4OHZA 4LHSA 1TNFA 4LOTA 4QQOA 2YC0A 1APNA 5A1AA 1BEV3 1PK6A 2VBPA 4KH9A 5F5QA 4IGQA 4I0BA 1DZQA 3O12A 3BPZA 5HCFA 2YPJA 1O3SA 2H6BA 1ZBA2 3EQEA 1S4CA 4AOCA 2KZ8A 1QJU2 2P4EA 1IS6A 1K5JA 2WABA 3KGLA 4MGSA 1FNZA 2XKPA 4YW2A 4FPJA 2PXPA 2JKXA 2NMNA 3LSEA 4QX1A 1OOPB 1ZZBA 1W2TA 3NAPB 4Q27A 3NW4A 2OKXA 1IG0A 4ASLA 4YW4A 5A6ZA 1W8ZA 1EAH2 5KXEA 1SPPB 2BRTA 2Z2SB 5DZFA 1YLLA 4GA9A 4EZIA 4XUOA 5IYYA 5KHIA 2QQVA 2CY6A 2R30A 1QZXA 1OQDA 2PLV1 4FT8A 3M7AA 4BQWA 3H1MA 2WFPA 5FFOC 1HX6A 2GRMA 1FYUA 3DPRC 3J8F2 3KV4A 4XJAA 4WVVA 3T1LA 2ZGRA 4JGYA 4XBQA 4QX0A 5J36A 1JN2P 3BTAA 1DQ5A 2CSFA 4NHLA 1SBEA 3RG0A 1OD5A 5AFBA 3KMHA 4LHNA 3SISA 5A33B 2E63A 5FCCA 2XLFA 4IEWA 4MGIE 1PM4A 2HEWF 4PI2A 1J3PA 5CZKA 3EJKA 3MF9A 4JGZB 1JS9A 2WINB 1Y9QA 1QP7A 1F31A 1KQRA 1Y3TA 1YI9A 2VD7A 2VR4A 3AZWA 4XFGA 2DCYA 5FLIA 4HVOA 5GLWA 1GNZA 3NSTA 1G8WA 1F4HA 1YRZA 5BNOC 1ADRA 2J1VA 1PMHX 4AQSA 4JAAA 3I3QA 5A32B 2V5YA 1Y43B 1PVC2 4J25A 4L8QA 5DAQA 1VPWA 1ZBA3 2XXZA 3J7NA 3PDQA 4QPIA 1AZDA 1QJU3 3FBMA 2C4XA 4WM8B 4FTEA 2CAVA 2IV1A 4UI9L 1MS8A 2Q4SA 2RMU1 4LUKA 3OG2A 3WZ1A 3KT1A 3JD71 3M9LA 3CNAA 1V6IA 2ZZJA 3BKZA 2E32A 3ZPXA 5DUXA 1GP4A 1R1A2 2HLEA 5FY0A 1D0GA 1WWYA 3MW4A 2QQPA 5IHRA 3ZXJA 2ZEWA 3ACFA 4BIOA 5FZ0A 3VDDB 3R05A 1Y7YA 5LBCA 1JOJA 1JW6A 3D0SA 2PXDA 4LKEA 4NPLA 1AR71 1QH7A 5D8AB 3WG2A 3BDNA 4E8CA 2DCJA 3VZJA 4XDPA 5A3OA 4E4DX 2NMOA 3K4AA 4O61A 1C1LA 2AUWA 3ZM8A 5C3OA 2GC2A 1K12A 3KLSA 4IEUA 1EY2A 4Q4X1 2ZABA 3NRUA 3GUUA 4GH4C 5FZ4A 1AUYA 5LBFA 1UKRA 3IKWA 1SACA 1JYNA 1RHI1 1RZSA 2ZGKA 4Z59A 2NYYA 5C8CC 4N43A 2PXLA 1GQGA 1H8TB 3ZR5A 4IGPA 1PIV2 2BQPA 1BZWA 1GYKA 2ZEZA 4E2GA 4NPRA 4Z82A 5IAXA 3G5GA 3OBZA 4AEJA 5C3RA 2VAUA 5F8PA 3FL7A 3UGFA 1OI6A 4QU2A 1I5ZA 4PLMA 1PVC3 2ADDA 2YGMA 3MLFA 1WBFA 2XPJA 4RS5C 4Z58A 4FPLA 5FPBA 3RZJA 1LAJA 2VY0A 1O8SA 4I0WB 1JYIA 3ZDSA 5DDJ2 3F2ZA 1ZA7A 3ZN6A 1F5FA 2OW4A 1HQLA 2LNMA 1W3VA 3VHOA 1X33A 2WWUA 3LKJA 5FZ3A 1SBDA 1M06G 2AXVA 1V00A 2XXPA 5FZKA 5C4WA 4DEQA 1G9BA 4M3CF 2ARAA 3OF1A 4BLIA 4ER7A 2AYHA 1BBT1 2ZX0A 3GGLA 4QM8A 3S6PA 2FDKA 3WDTA 1XXNA 3MV01 5FP9A 5FMDA 1US3A 4N8MA 5JDBA 1YFWA 1VALA 2WLQA 1SLBA 2PFWA 1VAKA 1PGW2 2WQ8A 3M3IA 4NMIA 4CCOA 2P2KA 5CFCA 5K7PA 4CEYC 5JWPA 2WZR2 2BDRA 2ZGPA 4BYYA 1LOGA 1UY1A 2GC0A 2K46A 3MIBA 4Q0SA 4CUBA 4OMCA 2W52A 4JX0A 5KC6A 3IAPA 3VBOC 2AXZA 1COV3 1XRUA 1CJDA 3ON7A 3GZUC 5F5IA 4Z92B 1D4M2 1EV13 4CPBD 4D0QA 4MVTA 3AK0A 3THCA 1IS5A 4X4IA 3WR0A 1QPZA 4XJWA 4QGMA 2VNOA 1RUH2 2F4PA 2G9ZA 4FFFA 2HWB2 1UU5A 3H50A 4WVWA 1RMU2 5JR7B 2VBDA 1LQCA 1LHUA 2LS6A 1MVEA 1YWKA 2Y8KA 2XVKA 4BQ3A 3NNMA 3LOBA 4LIVA 1G9AA 2VMIA 3LB9A 2VUCA 4XJ8A 2XJ3A 2QQKA 2RS12 2JB4A 1LCDA 5CAZA 1WUVA 3Q8FA 5F37A 3PNAA 4LBJA 1LHVA 3ZYBA 1ZA4A 5BY5A 5ABJB 3QFIA 1W8WA 5F2SA 5JCTA 3BVCA 2E53A 5IVFA 4B1MA 1PRAA 2LLVA 3HNYM 4Y5TA 1JZ2A 1WH6A 2UWAA 2W1QA 3ES4A 1RUG3 5KHKA 4UF0A 4P5YA 2PXQA 4OZXA 1R082 3VBSB 2D43A 2VU9A 2Q8DA 1LGCA 4H55A 1JMUB 4KNCA 1GOHA 1XNDA 2L49A 1ZRIA 1LOEA 2B5HA 1DCSA 3H9AA 4S2GA 3WP5A 4QQPA 2GP5A 4DY3A 3UETA 1G7YA 4EKIA 3T0AA 5IT6A 2CYFA 1JFSA 2QJVA 1PX4A 4IDZA 3HZIB 4LT5A 2VG9A 5FY7A 3MLLA 5I0RA 3WNKA 2B8MA 2YXSA 5BNQA 4Y1UA 1V9U2 2WZEA 4E8DA 3VBFC 5KHJA 1UZZA 3OTFA 2Q0AA 4PU8A 3RVHA 1ZRDA 3OY8B 4B29A 4AHZA 4XBNA 2KPJA 1IZ3A 1OHFA 4ZU5A 5FPAA 3ZXDA 1LU2A 4PBPA 1OMIA 1UMIA 1CX1A 2XMLA 3AP9A 4LO8A 2Z69A 1KXGA 5LK7B 2E31A 1QIQA 1SLCA 5GZCA 5F9TA 1DYOA 4Y1VA 1POV0 1PVC1 4XYXA 4FVVA 4IXLA 1W8OA 1XC6A 2DU0A 3RZZA 1DLLA 4Z2WA 3B00A 3GNEA 4P9WA 4ZZ5A 5BNNA 4DUXA 3RMYA 3GYDA 1CD3G 1K5MC 4GQ7A 4BPZA 2F17A 1BCXA 2HWD3 1JZ7A 4LBLA 3V0AB 1DGLA 4RL7A 5K8SA 5FMOS 1SQ4A 1NCRA 2W46A 3A9ZA 1OFNA 1GT0C 4MXWB 4FP2A 2VNGA 2HFZA 4IETA 3CROL 4LULA 4YW7A 2E6VA 3RPQA 1O59A 3LFPA 3BUCA 1UMHA 4L97A 1AXYA 3WF1A 4RHV3 2P34A 4LEJA 4F3JA 4HVQA 5J37A 1W6QB 1AYN3 2PYTA 2YMZA 3HNBM 3E5UA 4QPYA 5FZCA 5FY5A 2YC2A 2CWMA 3OB8A 5DRTA 1UQXA 4OFGA 4B7KA 5HV4A 5IVVA 4LXLA 2OQ6A 4TXWA 5HXVA 3C8XA 4NRPA 2VZRA 2GNMA 2QE3A 1WW5A 5FMOL 3B94A 3NV1A 2IXKA 5F39A 4QPGA 3X29B 1QKQA 1LHWA 5I93A 3ZYFA 1I3HA 2QKDA 3FMYA 1RUD3 1COV1 3K4ZA 4UW6A 1ALYA 5F3GA 1VBC2 4QPWA 1LB2A 1QNWA 1EV11 1WA4A 2JDNA 3MEPA 3MYXA 3ZFFC 4AEKA 1HQ1A 1JODA 1KDMA 1NYWA 4CXYA 4HVRA 1UY0A 2E26A 3POEA 4CXXA 3AKSA 4UW4A 3RI9A 3DM5A 3UKNA 3ZOIA 4IVZA 2LW8A 3KCCA 3KGZA 4DE9A 4Q0VA 5EP9A 2UWBA 3LDKA 2EIDA 3JBG3 4CP1A 5EJ3A 3CJIA 1GQHA 2ZHNA 4AI1A 3B9IA 4G4FA 2WFF1 2IWGB 4OMDA 1REDA 2PUCA 1US2A 2CGNA 4XTMA 4KMQA 1RZRA 1FPN1 2Y33A 3B9CA 4XXPA 1O3QA 3GBFA 2YZ4A 3O1UA 5FZMA 3TYJA 3I2JA 3MGUA 4AI8A 4CEWA 1LLIA 1OFSA 2CGPA 2BVBA 3K3NA 3T4VA 3RWNA 4QKBA 1RUG1 5FP4A 4KG8A 2KEJA 5A6XA 3ZYPA 1U5YA 4H14A 1ZS4A 2HBTA 4HBNA 3PJQA 2IZWA 3GBWA 5EJZB 1B35C 1Q5OA 5CG8A 3POYA 4QXKA 4LO7A 4HG6B 4PLOA 2FDJA 4QHZA 1U2ZA 2PHTA 5FZIA 2NQYA 3BTYA 3I3DA 3P6BA 4JRLA 1WIZA 5C3SA 4IE7A 1L7RA 3ECQA 1WLDA 3SX0A 3V65A 3WW4A 4NHYA 4CU8A 5GJ6A 2ORZA 2KA3A 2QUOA 4KBZA 1QJX3 4BU2A 5FJKA 4LJHA 2XB6C 4YRDA 2BVVA 3POIA 1H1MA 1W9SA 2XBO3 2KEKA 5EPAA 2O1QA 2Y6JA 4XURA 4META 1W2NA 2CSGA 2IFRA 3OUJA 4XHXA 1H6XA 5FY9A 1OC1A 1WBLA 5DSXA 4Y1YA 1JFTA 4YVWB 2VCBA 3PXPA 3OP9A 2HWD1 5FV3A 2R63A 1VRH2 2B4KA 2VZUA 3PU8A 1E5SA 4K6BA 4L2NA 4WV8A 3TNPB 2MEV2 1Q8OA 4Y20A 3TEZA 4DRVA 2A71A 4UT5A 5F7UA 4N90A 5L7OB 2A6CA 5C8WA 4ES9A 4JGYC 1REEA 1VLNA 4RHV1 1WH8A 2PXVA 3K2OA 3IMNA 1AYN1 5A3PA 5LCWL 5CBLA 1MQTA 4FCAA 4C0BA 4NO4A 5T3NA 4FPKA 4YZ5A 4KG0A 3EXUA 3WNMA 1IS3A 2TEPA 2RVAA 2VOWA 4Q8LA 3NV3A 4RSUA 2HBUA 3A22A 4TLGA 3ZFGC 3ZSEA 5HPOA 2Y38A 4MGYE 1POUA 2R042 3TFLA 2E51A 2C1FA 1KGYA 1WGPA 4PU4C 2GC1A 1RXGA 2Q1FA 1RUD1 2BOJA 2KM2A 3FFQA 3EUSA 1QQP3 4N7IA 5LEJA 3WHTA 4K40A 3WDXA 1NZIA 4QPIC 3S5QA 4QX3A 5FJHA 3HR9A 2HWE2 4OHWA 4TYSA 1OKOA 1Z78A 3VHNA 5F3EA 5LA2A 2NLRA 1RINA 3ZMNA 3GCWA 1G9FA 1RJ7A 2HWC1 4COUA 1CAVA 3JBG1 1AHSA 1OPMA 4WBBA 5T54A 5BYNA 4YG3A 3SEEA 1NZCA 5FTTC 1QMJA 3ACGA 4YGEA 3WDYA 4X4EA 3KQRA 4A44A 3T0BA 4E9KA 4AWDA 2EALA 3POFA 1UXXX 1RVF3 2BGOA 4YVSA 1BVVA 4IE5A 1W6MA 4GH4A 4AEDA 4JVAA 2WS93 3T08A 4TTGA 1NLSA 2J1EA 3KS7A 3LA3A 4NJ4A 4Y42A 1X8MA 4LLOA 4Q4Y2 1UXDA 1CVNA 1PNRA 3VL9A 5LA0A 2OS2A 5C8CA 2C6SA 1XJAA 3M8LA 5T55A 3LA7A 3NNJA 3OGRA 3K51A 1UX6A 4ATEA 1TEIA 5K0UB 3O1RA 2XJRA 4N43C 1J83A 3CLCA 5FUIA 2F4LA 1SFPA 5KC5A 2TUNA 4AGRA 2HH9A 2IVGA 1ULPA 2PQQA 2R043 2RS53 2W5FA 3FN9A 3I54A 4JQTA 5JI7A 3LPGA 1F9KA 4RS5A 1ZX5A 1YQ2A 3NL1A 4G3YC 1X57A 2JIGA 5IAVA 1WMXA 5DAWA 2V09A 5C9AB 1LENA 4YW1A 4OQ8A 3DN7A 3LSDA 4NOTA 2PXBA 3IPVB 4XDQA 5KXCA 1QJX1 1R64A 2YY1A 4QDQA 3VD9A 1MVQA 3HN1A 5FKCA 1X7NA 3ES1A 3FUQA 3QOWA 2XBO1 2PUBA 3U0ZA 2LYRA 1FOD2 3M70A 5FQ0B 1RUE2 1XYNA 5IWFA 4B8EA 3E6CC 2ENRA 4UFHA 4MUVA 3WCSA 4QKNA 3Q8EA 1XE8A 2LYKA 1SFNA 1F35A 4Q4W1 1AL22 1LEDA 5C4WC 4R9AA 4AZZA 5A3LA 1OQEA 3VDBA 5I8YA 1UZYA 2V3CC 2P6HA 4NN0A 3HEIA 3AMPA 4D6RA 1J58A 4XFFA 4CEYA 2MEZA 3JXBC 1NY71 5A7SA 1VRBA 3WV6A 4Q4Y3 2Q8OA 4HETA 3TEXA 5FZOA 2LYPA 1PO13 4UW5A 4NIIA 3S7IA 4E2SA 1V6OA 3U3WA 1AF9A 1RZRD 2XONA 5L73A 4XJ9A 3WQ1A 3PUHA 1R093 3WCRA 5CFCC 3MZHA 1W2AX 1AL0G 4UBHA 4A6OA 2D6NA 3KCYA 1V0AA 4BQ1A 4MXVA 1SHWB 1UAIA 1V6JA 3PVNA 2I2SA 3VL8A 3WF3A 5FMBA 5AFEA 1URXA 2W92A 5LEKA 1XYOA 2GH8A 2GNBA 1OA2A 2JDAA 2ZGTA 1OF4A 4BOWA 3UL2A 5F5CA 4FXKB 1TMF3 1UU4A 1OD3A 3ROUA 4IV3B 5E16A 5GM0A 3F6WA 3SCFA 1QQP1 4NPMA 5CFDA 4IESA 2PLV2 3Q8BA 4IA8A 4Z5HA 3KSCA 4RQPA 5DTQA 4XQ4A 2R7EB 4BJ0A 4NWWA 1KFXL 1LHNA 4OHVA 4OQ9A 1UOBA 5LA9A 4RR3B 1WMEA 3PIJA 4L11A 4P5HA 3WY6A 4OLLA 2EIEA 1FATA 3ZR6A 3I59B 1WZXA 4MH0E 4EZHA 4LHKA 4MYEA 3LFIA 4Y1ZA 4AFBA 1NUKA 2FFHA 1C4RA 5JSPA 2X5IA 4CDQC 5KWRA 1VR3A 2PTMA 4H7MA 3LISA 3KCXA 4AHWA 5JI9A 2R0HA 1RVF1 1O5LA 1XE7A 4QXHA 4RN5A 2WS91 3T09A 3WG1A 2D6PA 1HDKA 5F6KA 1UYPA 1T2XA 1O6UA 1V6NA 3CF6E 2ZKNA 4PI0A 4BXSV 1H2KA 3SCHA 5GLUA 4PT6A 2WT0A
chains in the Genus database with same CATH topology
4H7LA 5JOXA 4HKLA 3PMSA 5AC93 2RMU2 2A73B 2JG9B 3S0MA 5DZEA 3VK0A 4XJZA 1BYHA 4XILA 3JD72 2D6MA 1XNKA 4CDWB 4Q1RA 1YFUA 2R041 2RS51 3AKRA 3L9JT 1LODA 3VN4A 1VBD1 1ONAA 2ERFA 1K5MA 4GKXA 3O7OA 2I45A 3LGRA 3TRBA 1M4WA 1EPZA 4COZA 4QGNA 1Y7BA 4EN6B 1AR72 1CONA 3J26N 2GMEA 5JZGB 5JOWA 1UW8A 2PHUA 3ZXEA 5B2GB 3AP5A 1NCRC 1SEFA 1GNHA 2PUDA 4Q4X2 2WIUB 3OQOA 1W6OA 2ZKLA 3T1MA 1C28A 1LRHA 2BW8A 1HQNA 1RHI2 3QD6A 3DF0A 5BXXA 4N53A 1JUIA 3VBFB 2I07B 1OKQA 1RJ8A 2AH2A 2HWF3 5I8SA 3MDPA 5DG1A 1U5IA 3TN93 4KU8A 1JUHA 2XVGA 2ICPA 4PJYA 1PO11 2B39A 3S7EA 1R091 4W6WA 1NA1B 4QPGC 2LTNA 4E2QA 1OQ1A 3H8UA 4AVCA 3AZXA 3VBHB 3ZN5A 3BU7A 2XLAA 2R061 3O0WA 1DF0A 2RJLA 4XW3A 4ZU7A 2E7AA 1PGL1 4OULA 1TMF1 2QCSB 5IUQA 1CAXA 2ZCWA 4YSFA 4YGBA 1J3QA 1UU6A 2ETEA 4YFWA 1BBT2 3UKTA 4OHYA 1EP0A 4AGVA 1J3RA 2JE7A 4MLOA 1RUJ3 5T5JA 2DVFA 4JQDA 4QQHA 1CGPA 2W0XA 3FHIB 1CQ9A 2PHFA 1GANA 2VMHA 3ZHIA 1B09A 3CECA 1AX2A 4FQZA 3WG3A 3FYAA 4ASMB 2CAUA 4CEWC 3QCWA 4JTNA 5GLZA 4CDXC 1OOPA 2IXLA 2WT1A 3NAPA 1ND3B 1E3OC 2DVDA 3A0KA 3KXAA 5LRRA 2O49A 2F6BA 4S2HA 4C1WA 2A3YA 1SLTA 4Z07A 4OI0A 4YM2A 1YYNA 2VUJA 1QQAA 1QY4A 4AF9A 2P37A 4E4ZA 5AC91 2R32A 1C8M3 4TWTA 4LNVA 4JV4A 3HD8B 2WWSA 3WP4A 4IWRA 1NE4A 4AHXA 4X4HA 3WQ7A 3JB8A 5A33A 1OA3A 3GZAA 1BBT3 3D4KA 3POSA 2W08A 4F8DA 1FAYA 1RUC3 2AREA 2Y0IA 4B4RA 1DBNA 1YUDA 1UXCA 4GB33 4DPNA 3TRSB 1VBB3 1MS9A 4YFZA 3ALQA 1B35B 2NZ9A 3URFA 1HRI3 4AG4A 2DWRA 3IDBB 1RUF3 1X36A 5A32A 3L2HA 3KT4A 1PK6B 2ZX2A 4JTOA 2ZGNA 4WM8A 1LULA 2AGSA 4PDWA 3ZFGA 1PO23 4HN0A 1H4HA 1S0FA 1MQTC 2HWF1 2IUOA 4P9XA 3B02A 1L1MA 2ATFA 3R1FA 3TN91 3PVBB 4GULA 5J3UA 2WNEA 2JKBA 4A2UA 3SMHA 3FBYA 3LCPA 3RSJA 4I01A 2XL7A 2ZTNA 2PELA 3OYWB 1A3KA 3WOGA 3ZXAC 3MPBA 5D8AA 3LOIA 4BE3A 5JVVA 5FO8B 1O4TA 5H9RA 3D5OA 4AFCA 1KRIA 2PHDA 3ZN4A 3BS3A 5J48A 1H8TA 3O5SA 3OD4A 2JXAA 3WLUA 2R16A 3GZTB 5BV6A 1RUJ1 1EYBA 5FBZA 2IVQA 2DU1A 2WNVC 4YVSC 5C33A 2A6VA 4AEDC 1QDOA 5EWSA 1NCQB 4PLNA 4EV0A 2RS33 4EN9B 1COV2 5EZWA 2SLIA 5AVAA 3TOJA 1EV12 1WD3A 4KQ7A 2ZGQA 2EAAA 4YZ2A 3FFZA 3ZPYA 2HINA 4UBGA 5JAXA 2O4AA 1S0CA 3RYPA 1JYCA 3NV4A 2FBEA 2GNDA 3FWEA 4ISRA 2GU9A 1WCKA 1HRV3 3R4DB 2WFF2 1C8M1 4HZFA 3WINE 3O14A 4LBQB 2JG8B 4YW5A 3SH3A 3P3NA 1FPN2 1H2LA 2VMGA 3B01A 4ONUA 2A5ZA 2QDNA 1LGBA 2L8NA 1SCSA 1KDKA 4IQPA 4K20A 2FHRA 1KS5A 3UJOA 2DVAA 4DMIA 2RM23 4OVEA 1H4GA 1RUC1 5BNPB 2PAEA 1DZRA 1RUG2 5FOBB 3J9SA 4FPOB 4GB31 2UURA 1VBB1 2ZACA 4FTSA 2GZUA 3ELNA 1Q8PA 1HRI1 4INDA 2C9AA 4IEYA 1RUF1 5TSWA 1AJOA 4NVPA 1ASJ3 3NO8A 4P9JA 2ZPXA 4LLFA 5L19A 1X2LA 3ZYJB 3KJXA 2LYQA 1PO21 4X8NA 2D3PA 2XVLA 4XZPA 1YIPA 1YHFA 3RI8A 2OR1L 2Q30A 2P3KA 2PHRA 3AMNA 3ZIXA 1J59A 1ND2B 3N7LA 3NWKA 2CROA 1S7EA 2JVLA 1FNYA 2UY8A 4Y22B 5I8TA 5E8AA 2BFUS 2WFF3 2HWD2 1QXRA 3IVPA 4KL1A 4BZ4A 5CFDC 1I6XA 3U4XA 3AYAA 3ASIA 3ENRA 4RQPC 1FPN3 3E5XA 1NQJA 4WM7C 5FLJA 2W68A 4M0NA 4CDQA 2WNUC 3LZZA 4RHV2 1QDCA 4X4CA 1FT9A 1ULGA 1T6GC 1AYN2 5CFCB 3ZFEB 4NWVA 2BFUL 1QWRA 1YIFA 3D8CA 2X5IC 3OY8A 1S0DA 3CEWA 1LR5A 4LE3A 1ZZ9A 4MZUA 3ILFA 2A6XA 4L99A 1O5UA 4YGDA 1TME3 4R8HA 3MIGA 2RS31 1RUD2 5T5OA 1ENSA 3WX5A 2K2SA 4FPGA 3GN5B 3V0AA 3B93A 1BMV1 1CJPA 4GKYA 2GALA 5JLVA 2R6QA 3JB4C 2HWC2 2JENA 3JBG2 1HRV1 3NKTA 3B5LB 1GZCA 1HQWA 4R4XA 2EXJA 3FE5A 3IBMA 3WDVA 5FRAA 5AVPA 5CNAA 4WVMB 2RR11 2R073 4XFAA 3RMYA 3VV1A 4FPCA 5DUVA 1GLHA 4NR1A 1I1EA 2RM21 3TAYA 3VKLA 1Z7S1 4GWNA 4AI2A 1PM7A 5KXDA 1UD1A 1PZ8A 1YNAA 2LUWA 5DUUA 1DQ6A 2VW0A 3OMTA 4N53C 3T2TA 4AI0A 3DUIA 1Q43A 3OBRA 2AR6A 3AP6A 1DQ4A 3AZVA 4DNYA 4PIZA 1ASJ1 3NV2A 1JHNA 1NLRA 4ZU4A 5FPXA 1QJX2 1TQ5A 5BNNB 3VBUB 3U11A 2D5HA 2VVDA 2XBO2 4W6YA 5FOJB 4CDUB 2WJSA 1KJLA 4OUMA 1NCRB 1QXJA 2DV9A 2HWC3 3FX3A 2DUQA 3H7YA 3ST7A 4Q4W2 4CZSA 4G9SB 3HIFA 2JICA 4HK8A 4HKOA 2JEMA 1X82A 3VZLA 5GZEA 3UV9A 1NY72 1SLLA 1WLTA 5LK5A 3Q9OA 1WLWA 1POV1 5E88A 4XXAA 2CV6A 3VZMA 2ZHLA 3AM2A 4XQWA 2G4IA 4S2DA 4Z5DA 1CQTA 4CDXA 5DXDA 4AQ2A 2EXKA 3FLPA 4PIYA 4C91A 1CAWB 1ZAYA 1LJ7A 3SHRA 1H9WA 2BEOA 1MEC3 1WW7A 3KZ4C 4D69A 5JSOA 2OPKA 3KT7A 2QZ2A 3VBRB 1J1LA 1DHKB 2D3RA 3R4SA 2ZMLA 3VKOA 4I8TA 2CWSA 1OOPC 4YM0A 2D5FA 3NAPC 3R0RA 1TME1 2WL1A 3QACA 1NXD1 5KHGA 3V56A 1PRUA 4UW3A 1GSLA 1QQP2 5CB7A 2RHPA 3L1PA 1ZBE1 1SQ8A 1ULCA 2DUOA 3CJIB 3WW2A 3PTYA 4O9EA 2GN7A 1W0OA 5H9SA 2A6YA 1MR5A 2XI8A 5L7OA 1WCDJ 1GKBA 1S0BA 3AZYA 3N7KA 4JQRA 4A7YA 4AW7A 4FPEA 1H9PA 4XE9A 2DTYA 2OZJA 2XUMA 4Q4W3 4LA3A 3RYKA 1XYPA 1A8MA 4DRRA 4MV2A 4IV1B 5FO7B 3OQNA 1NXMA 2AW6A 1Q3EA 2ZMNA 4DFSA 1RVF2 4JGZC 3GBGA 3IM0A 2WS92 4IEZA 4K9SA 1O3RA 2R071 2A6WA 2MHFA 5GZFA 4I0AA 2EXHA 3W58A 1CR7A 1BVP1 4COVA 1UN1A 3BODA 2QNKA 2C5DA 4WM8C 2YDEA 4AXOA 2PN5A 4BLJA 4W65A 4PDWC 2GNTA 5JIAA 2WA3A 3AYCA 4KWLA 1AX1A 2FZ2A 1TNRA 3VZKA 4MX3A 2RS52 1Z0HA 3BB6A 1VBD2 4X6RB 2ZHKA 2ZBJA 4LA2A 1X8EA 3WNXA 1W6NB 1HXS3 1XNCA 3VDDC 1CX4A 1R1ZA 3DV8A 1HKDA 2GSYA 1KJRA 3OJBA 1N47A 3DPRB 5D8AC 5T5PA 4KU7A 4HPKB 3PHMA 2PIJA 3V64A 1FMD3 4EJRA 1RUI3 4R4ZA 3EO6A 3N4MA 4Y20B 2XLGA 5HBAA 3CJXA 3AKTA 4XF9A 1S0JA 4FOVA 2WC2A 4M3CB 4URTA 3OQMA 3F51A 1V6MA 5J96B 3BCWA 3MIEA 3MIHA 2WNVA 4LBKA 2GN3A 1H8TC 5KXBA 3ZMOA 1HV0A 2BPA2 1YXWA 5BNOB 1OSLA 4HKWA 4B4PA 1PO12 4QQLA 3TB0A 3MLJA 4OB4A 1R092 2SBAA 5C9AA 2NP0A 3ATGA 3M3EA 3C2UA 2XSDC 4B3NA 2ZGOA 3ZYIB 3IPVA 1ZREA 3WG4A 1MEC1 2B42B 1LOFA 3DL3A 4NHMA 2R062 2ZOEB 3AMQA 1PGL2 2QZ3A 3ZYGA 2EWTA 4GWMA 1JBCA 1TMF2 4C0HA 1PHMA 1VBD3 2X8KA 1W6PB 2HYKA 2ARXA 1WD4A 1BKZA 1CAVB 2MQKA 4PU7A 4FOWA 2O0OA 5ACA3 1QU0A 4LO5B 3BALA 5CVRA 1QXPA 4F8AA 1Q8SA 3HT2A 4XEZA 1PZ9A 2DFBA 4MCXA 1IPJA 1UIKA 1W6MB 4GH4B 2A3WA 1A78A 1XWRA 5IK5A 3AYEA 1AJKA 1FV3A 1U12A 3WDUA 5GKAC 2FJRA 5C8CB 2XL9A 3POWA 4BMEA 3MPPG 3VUOA 1MZEA 3RJRA 5SV8A 1DQ2A 1FX5A 4P9LA 1DDLA 4FOYA 1A8DA 4Q4V3 4M00A 2WLPA 4D3WA 2UYAA 3IIAA 1JTZX 4IV3A 5JPMB 2IFWA 2ZAAA 3ZX7A 1CJGA 3AB0A 1LESA 4RS5B 5AC92 1W0PA 2PHXA 1S1AA 2GRLA 4YG0A 2R063 3NJZA 2XJQA 3SCGA 4F7ZA 3WUDA 1MZFA 4RR3A 1AR83 3ZHMA 2ZMKA 1UL9A 1LOAA 3FYMA 5ABJC 4N9IA 1LECA 4PIXA 1HXS1 1R63A 1S55A 1H0BA 1RIRA 2XH6A 2ZGUA 4WM7A 3IDEA 1NE6A 3JCIA 2H8RA 1CAUB 4C90A 2WNUA 4XFIA 3VBSC 4Z5CA 1FMD1 1RUI1 1NQDA 3WHUA 2FMYA 4CEYB 1BJQA 2VQAA 3AKPA 3VBOB 4X6QB 4MGZE 1O4YA 2JG9A 3AP4A 3ZSJA 4BHPA 3QYXA 4CP1A 2BNMA 2HWF2 2EXIA 3OPZA 1UF2C 4ZXKA 2A3XA 3TN92 1KFUL 2LYSA 4I6RA 3OGGA 4RGGA 4CDWA 1H30A 1NEQA 1VBA3 4HT1T 4JRAA 2Q1MA 4Q8KA 4ITCA 2B45X 1S0GA 4DS0A 3JQWA 3RYRA 2DCKA 3AMMA 3ZSLA 1S0EA 2NN8A 5T5LA