3SCHA

Co(ii)-hppe with r-hpp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 42
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3schA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3schA02
1CAXB 4IA8A 4FT8A 2AWIA 4YRDA 3NVCA 1WIZA 1X2LA 3VHRA 4YG4A 2GAUA 4XFGA 4JCXA 1RC6A 1NYWA 4FAGA 3OGJA 4WVZA 1OCTC 3CEWA 3U0ZA 4F7ZA 1GQHA 2HJIA 4X4IA 4MUVA 2Q4SA 3R1FA 1RZRA 1UXDA 4Z58A 1RIOA 2OR1L 3ROUA 2V09A 2GC1A 1O4TA 5K8SA 5I8YA 2BYVE 4QM9A 2CAUA 2XL7A 3DL3A 1IC8A 4UXAA 1X8MA 1ZS4A 3GN5A 2IXLA 4IWRA 4IEQA 3ELNA 1NE6A 1SFNA 2OFYA 5FQ0A 1NE4A 1H1IA 2BNMA 3B7HA 1DZRA 3H7YA 5BPXA 1WH8A 2QNKA 2MEZA 3IVPA 4XEZA 2HINA 1WETA 2LYRA 4AVBA 1YFUA 5JR7B 4X4CA 3R6SA 4FAHA 4QXKA 5FLIA 2ETEA 2PQQA 4KL1A 5E16A 3MZHA 3N4MA 2KZ8A 1O3RA 4BIFA 4F8AA 1LQCA 2BEOA 4CYDA 3PNAA 4MGYE 2F4PA 4JQDA 2K0GA 2IU7A 3CLPA 1UXCA 4I6UA 3ES1A 4LA3A 1YWKA 4IEZA 2ICTA 1ZAYA 3H1YA 2Q0AA 3NJZA 4E2SA 1WA4A 1RUOA 2GZUA 1WLTA 4B29A 5I0UA 5T3NA 1CAWA 2GC0A 2KXLA 3F52A 4MX3A 1CAVB 3PVBB 2AXVA 1GT0C 1JWLA 2IXKA 3CJXA 1IPKA 4XFBA 2UY9A 4YBAA 2JCGA 4FBFA 3WW4A 5FLJA 3OD0A 2QVSB 4KWJA 2UYAA 4FBIA 1CAUA 5HI0A 3FJSA 3WW1A 4KU8A 3KCCA 2GZWA 3D0JA 2PIJA 1EY2A 1CGPA 2Q30A 1Y3TA 4LUMA 1RZSA 3OQMA 1J1LA 1J3RA 1O4XA 2XLAA 5FQ0B 4R8HA 3E5QA 1RUNA 2LYKA 1VPWA 5JSPA 3BD1A 1ZZCA 1YHFA 4IERA 3NSTA 1RTVA 3EBRA 3RYRA 3ETQA 4J1WA 1O3SA 3LZZA 3QWGA 3E97A 1QP4A 3NW4A 1ADRA 2ET7A 4XF0A 2CGPA 1ZZBA 2HKXA 3I59A 1Y7YA 1DZTA 4XFFA 4DINB 3L2HA 2KEKA 1O3TA 2B9UA 3OF1A 5FCCA 2KEIA 3H5TA 2ATFA 4PIXA 4X4EA 2PFWA 5J7MA 3F6WA 4PU8A 3S7IA 2IUOA 3IDBB 1XWRA 1LLIA 1NEQA 1OI6A 5CVRA 5C6CA 4L11A 1I5ZA 2XKOA 3CO2A 1SQ4A 4FN3A 2Z2SB 3HZIB 4AVAA 2GH2A 2D93A 4ZU5A 3QACA 1G6NA 1QQAA 1ZX5A 4IVZA 2R1JL 3SXWA 3LA2A 1XE8A 5F1RA 5JAXA 4HN0A 4PJYA 1CAUB 1YFWA 4Z5DA 4JV4A 3OQOA 2IVQA 2BGCA 4IEOA 3CROL 3TNPB 1H1MA 2PA7A 4MCXA 1J3PA 3CL1A 3U11A 4QGMA 3H3UA 4Z07A 3U10A 5AVPA 3S8QA 1YUDA 5A7LA 2C0ZA 4Q0VA 1JFTA 2GRMA 1SEFA 4MGIE 4XFHA 1DWKA 3E5XA 1ZVVA 4P9GA 3E6BA 4MV2A 1CJGA 2IV1A 5LRSA 4Z59A 4D7TA 4GULA 5J3UA 3M70A 2UY8A 4Q29A 3BDNA 3RDIA 4AVCA 2PTMA 3H3ZA 4X6QB 2UYBA 5CU1A 2D40A 4OB4A 2PAMA 3G7DA 3H1WA 1AU7A 1BDHA 2D5VA 4E2GA 3M3IA 1YFXA 3UKTA 3ZDSA 2ZCWA 3D82A 4JCYA 2OZJA 3EJKA 3FWEA 5CADA 2EA7A 1J59A 2XLGA 1RZRD 2FQPA 5J48A 1YSEA 1OSLA 2XI8A 2JVLA 2R63A 4O8BA 2H6BA 3QF3A 3LA7A 2WC2A 3QOPA 2O4AA 2XSDC 1V70A 3PLQA 1UCXA 3LOIA 1CX4A 2ET1A 4IESA 4IEVA 3OTFA 1UIKA 5BV6A 4Z5CA 3E5UA 4PIZA 2A6CA 5BUVA 2H0VA 2ZKLA 2PAEA 2Q1ZB 3EHKA 1J3QA 3CECA 2AUWA 1PERL 5KHIA 4GQMA 3H50A 5BXXA 1ZUGA 4PU4C 3BU7A 4LTAA 2PUBA 1CAXA 2XL9A 1Q3EA 5KHKA 2PUAA 4JTNA 3WW2A 1ZRFA 2EF8A 4I6TA 3BPZA 3H8UA 2PHDA 4EWAA 1ZZ8A 4E2QA 4QMAA 4YSFA 4HMZA 4QGLA 2VECA 1FXZA 4Q0SA 1QWRA 4YG1A 2Y0OA 2IXCA 3KGZA 2PHLA 4AXOA 3S0MA 4WBBA 3QYXA 3GYDA 4KWLA 5FPZA 4NVPA 2XGXA 3H1MA 4HLTA 3NL1A 3HIFA 1XE7A 3CLCA 3KGLA 2LCVA 3TNQA 3JXCL 3HT1A 5FLHA 2IXIA 1DW9A 1UPIA 1U12A 2XHKA 1X57A 2QCSB 1O5UA 1JUHA 2LYSA 2CSFA 2IC1A 5E1RA 1ZVFA 2QDRA 5LEJA 1QXJA 1WH6A 4KWKA 1LRHA 2PUFA 1UW8A 2PAKA 4XF9A 3CF6E 4IEXA 4Q0PA 2GU9A 4I6RA 1LKNA 3FYAA 2D5HA 4QX5A 3SMHA 3MPBA 1EYBA 4LEJA 3DV8A 1TQ5A 3ZHMA 4HZFA 5C8WA 2IVBA 3ZKCA 1UD1A 4KU7A 2OYZA 1R63A 1E3OC 4NDWA 2HSGA 5LRRA 5I0RA 2BNOA 1OFNA 1POUA 2PE5A 1ZPQA 2Z69A 1ZNPA 2L8NA 4HBNA 3MYXA 3FX3A 4Z82A 5EFUA 1I6XA 4META 2KPJA 1NXMA 3JXBC 2VQAA 1ZZ9A 5JSOA 4IEUA 4IEWA 4XFIA 1NZCA 3KMHA 1O7FA 4N9HA 4TLFA 3TRBA 1ZREA 4I0AA 2B5HA 4BHPA 3KXAA 3D0SA 3ST7A 2XIUA 4ZU4A 3EQEA 5KBFA 4I3PA 2GC3A 1OD5A 2K9ZA 4RD7A 1PRVA 2PUDA 2O1QA 4QM8A 4I01A 1QPZA 4X4DA 3SHRA 2CAVA 2L49A 3SCGA 3LFPA 4L2NA 4N9IA 2BJCA 2EBYA 3OCPA 3OP9A 4I02A 5JCTA 1PMIA 1O3QA 1R69A 2B8MA 4YYOA 4IETA 3USSA 4XETA 1FI2A 1JH9A 3E6DA 1L1MA 1O5LA 4LUKA 2O8QA 1X7NA 1YLLA 1VJ2A 4MH0E 1X8EA 4Y42A 3VK0A 1X82A 3KJXA 5I8SA 4F8DA 1EP0A 4HSJA 3I7DA 4K8FA 3S7EA 5BY5A 2PUEA 5I91A 3IWZA 4WZCA 2GC2A 3UKVA 4J1XA 3EO6A 2QJVA 4X6RB 1VP6A 3C3VA 4Q0QA 3FMYA 1QQBA 2DCTA 2BNNA 2PUCA 1B0NA 2LYJA 4LLOA 3RPQA 1HW5A 3WW3A 4MZUA 4YARA 4UBGA 4EWEA 4HSLA 4HVOA 1YFYA 4XF4A 1GQGA 4OFGA 4I0BA 2AXZA 2CROA 1CAVA 2OPKA 3LA3A 5KHJA 4MGKE 4AQ6A 1J58A 2XCJA 1QXRA 1DGWA 5I93A 1NERA 1SQ8A 1ZRRA 3PXPA 2EAAA 3DN7A 3IIAA 3LWCA 3G5GA 2OZ6A 2LYQA 5FDBA 1ZRCA 2FJRA 1LR5A 2PPXA 5KHHA 3UKNA 3ACLA 3H7JA 3O14A 4HVRA 3DNVB 4XF1A 3I54A 1EPZA 2MHFA 1FT9A 4ZU7A 4QGNA 2MNGA 1QP7A 3H9AA 3FE5A 1CQTA 2D5FA 1LMB3 3RNSA 1ZRDA 3E6CC 2VPVA 5D1IA 5I0SA 3RYKA 4MGZE 4Q0UA 2EWTA 4XFCA 4BYYA 1HF0A 1RGSA 4LULA 3FZ3A 3JZVA 3BB6A 3KSCA 3ES4A 1CAWB 4I09A 3OMTA 1ZZ6A 4PU7A 4X4HA 4IEPA 4XF3A 5I0TA 3FFQA 4I2OA 2WIUB 4O9EA 3SCFA 1WGPA 4ORFA 4EWDA 4YG7B 3D1NI 1OMIA 1L3JA 1Y9QA 2AW6A 1PNRA 2GRLA 2IVGA 1LCCA 4IEYA 4R52A 4HN1A 3BS3A 3NKTA 4GHJA 4PU3C 3EUSA 5KHGA 4I8TA 4EV0A 4HVQA 5I8TA 2OA2A 4A2UA 1LB2A 1IPJA 4ONUA 2O49A 3BCWA 3U3WA 2XLFA 2WUSR 2EVXA 3B02A 3FYMA 2N7GA 3BALA 3OQNA 2LYPA 3MDPA 4Z5HA 4JVAA 2I45A 3GBFA 1VR3A 1EFAA 1PRUA 3L1PA 1Q43A 5EZWA 5JSRA 3HQXA 5K98B 1ZZ7A 5FPXA 2LYLA 2PUGA 4D7SA 3LAGA 3IBMA 2O38A 1XRUA 2P17A 2WFPA 4XFAA 4UBHA 2B5AA 3KZ3A 4MCTA 1Q5OA 4OLLA 1PRAA 4BH9A 3JXDL 1DGRA 2FMYA 3I59B 3MLFA 1RPEL 4AQ2A 4LA2A 5LEKA 4H7LA 1PM7A 4O9GA 4EROA 2IXJA 3DKWA 1RL3A 2XKPA 3SCHA 2AXUA 1BDIA 3F51A 3QQ6A 3HT2A 4X4GA 2E9QA 2IXHA 1UIJA 2H6CA 2CV6A 3GN5B 3RYPA 1UTXA 2MQKA 2ICPA 3UFDA 4YNIA 3O9XA 2PYTA 2MPFA 1QP0A 3IDCB 4X4FA 1S7EA 2H8RA 3RZZA 1LCDA 1QY4A 3FHIB 2XJ3A 4X4BA 4PIYA 3ZHIA 2KEJA 3LISA 1JFSA 4JTOA
chains in the Genus database with same CATH superfamily
3HBKA 2XXAA 2PMWB 3N9LA 4CXYA 1V6LA 5F5AA 1PHMA 4YRDA 3ZXJA 1WIZA 4XZPA 3THTA 3V0AB 4FPLA 5FMOL 4AI0A 2OX0A 1NYWA 2Q1FA 3LCPA 1SDDB 4WVZA 5CKQA 5FMBA 3U0ZA 3VD9A 1W05A 2YUEA 1BXHA 5DZGA 2HJIA 3VD7A 4YW7A 4QKDA 4FP2A 3CJIC 5CFDA 1GFF2 4OUMA 2XJSA 4ZPIA 1UXDA 1PIV1 3PUIA 4Z58A 3FHAA 2YU1A 3PUAA 3IKWA 3LEKA 1RXFA 2OR1L 3OUJA 2V09A 1VIWB 3BOPA 1H6YA 2I2SA 2D6OX 5I8YA 1UZWA 2YFUA 2A3WA 1IC8A 2PXUA 4CCMA 2HLEA 4HL0A 3U07A 1SBFA 1ZS4A 1ZBA2 3ELNA 1FV2A 1RJ8A 4Y1YA 3VBUB 1NE6A 1SFNA 3WNNA 2ILMA 3NAPC 3O1VA 1MZ6A 1EV12 5FXWA 1OT5A 2WT1A 1WH8A 5LBEA 3FUOA 1ZRIA 5DRTA 3IVPA 2YG0A 2LYRA 4M3CA 5IJRA 2YB7A 4NHKA 3DPRB 1OC1A 4XQWA 4AGRA 4QXKA 4ER3A 2AEYA 1SPPB 3LIHA 2JE8A 1T6GC 3B5LB 1TNRA 2QQIA 1JYIA 4AQTA 3ZFEA 3VHNA 4L92A 1UY4A 2P1BA 2KZ8A 4E4DX 1H2KA 1O3RA 4IE6A 4BIFA 5F5QA 5FZKA 1R081 3N7MA 4AI3A 4DXSA 4MGYE 1OQ1A 2F4PA 2HEYF 4COVA 3TBDA 3ZYGA 3ES1A 1J84A 4IEZA 3S5QA 1AX0A 3CNAA 4XBQA 3NJZA 2WQZC 5DUUA 5A33B 2CL2A 2GZUA 1WLTA 4QXCA 4B29A 4GMP1 1QJZA 5I0UA 5T3NA 3ACIA 4B3NA 1RHI2 3PDQA 3ZYJB 4Q4Y3 1RUI2 1HB3A 1YYNA 3KM5A 1JWLA 3AMQA 4AHXA 2F6BA 3HNMA 2UY9A 2EIGA 3P5BA 3WEZA 1A8MA 2JCGA 2BFUL 2QUOA 2YBKA 4COZA 4FBFA 4KH9A 5FYUA 4CDWB 4ZXKA 3I3QA 5A7SA 3WW4A 2ARBA 2DU0A 2WS92 4IV3C 4A7KA 4FVVA 4B7KA 1D4M1 3BN6A 1JN2P 3VZOA 3FJSA 1ASJ2 3ILNA 4UW3A 1ENQA 4N53C 4YFZA 4DEVA 4LKFA 3GBWA 2TUNA 4YM2A 1JH5A 3T08A 1AR82 4MXWB 4K40A 4Y5SA 4C0BA 2E32A 1D0HA 2WZPP 1GKBA 4XQDA 1DHKB 3WF1A 2RR12 4AHWA 1MACA 2IWGB 1J3RA 2VUDA 2XLAA 4R8HA 1QNYA 4P9YA 5A3PA 2RMU3 1W2OA 3KF3A 5F2SA 5C3QA 5JSPA 4IERA 3NMBA 4ER7A 3AC0A 5DAWA 4URTA 3O1PA 2HWC3 3L2YA 3LZZA 3S5AA 4PCRA 1LAJA 2G9ZA 3IPVA 5GAGi 5LBBA 1COV2 3BTAA 2CGPA 3ZYFA 3S6PA 4JC1A 1NCRB 3EXUA 4A7ZA 2PELA 1Y7YA 3I59A 4N7UA 4XFFA 5FUNA 4C1WA 4DUWA 1YQ2A 3L2HA 2D97A 1RJ7A 4KBBA 4ZZ5A 4P00B 2KEIA 2ATFA 2ORZA 1XNDA 3ZIXA 3V64A 3ZYBA 3K77A 2R1BA 4MO3M 5FBJA 3C2UA 1OI6A 1TVGA 4GKXA 1W8WA 3JQWA 4MADA 3WP4A 1I5ZA 5JZGB 5GZFA 4FN3A 2Z2SB 4AVAA 1W03A 2ZS6B 3A0NA 1RUF2 2WZEA 4M00A 2D93A 2BV4A 2JG8C 2YFZA 1QJY3 2ZGOA 5L73A 3FLTA 2W52A 2ZTNA 4IVZA 2VZRA 4MYEA 1RUI3 5GZDA 4DRVA 5JMCA 2PLV3 3WNPA 4P9LA 5HCBA 3POFA 2BUKA 4EZIA 2D6KA 5F1RA 2R062 4PJYA 1ND3C 1SFPA 1WD3A 2WKKA 1UX6A 2VOXA 2BGCA 1ND3A 4D8MA 2ID4A 2PHUA 1WUVA 1XE0A 1HJFA 2D7FA 3ILFA 1XU1A 2HWE2 4IEOA 4ISQA 4RFRB 1IKPA 4AI1A 2JD9A 1QJU3 4QGMA 4IQPA 2ZGQA 1MS0A 1C8M1 2GMEA 1H0BA 5EWSA 2C0ZA 4ASLA 1JFTA 1HN0A 4NRQA 1CWPA 1D0GA 2JX9A 3ZSMA 1NCQB 1S0DA 3KWVA 5FZ3A 4ZS2A 1AR83 4CXWA 4EN9B 4YW2A 4NHYA 1JYVA 5IVCA 2XWBB 3VZJA 5CG9A 4GULA 2FZ2A 2A6WA 1WW5A 2PHFA 4OZOA 1WA6X 2E63A 3B93A 1LHVA 1V6JA 2CGOA 2JB8A 3M1HA 4NOTA 4G4FA 1ND3B 3ENRA 4XDPA 4LK6A 1H2NA 4NRPA 3U78A 1HXS2 2UYBA 1KJLA 3NJVA 1F4HA 1HQWA 4AWDA 2XJRA 4OB4A 5FIXA 1EAH1 2Y6FA 4DFSA 4EN8B 1BDHA 1AL22 4GD4A 2F17A 4E2GA 2WZ8A 3M3IA 1MS1A 3UKTA 1MS9A 4QDQA 3WNLA 3OBTA 5A6QA 2D44A 3AFGA 4QKBA 2XJUA 2IVJA 4QQLA 3THDA 2ZZJA 4CE8A 4EZHA 5SV8A 2J22A 1BBT2 1QDOA 3FWEA 2ZX2A 1C3HA 1X9TA 2EA7A 1FOD3 1UYXA 3PUQA 3Q8BA 5GM0A 5IT6A 1OVSA 5FYVA 4EK9A 1OSLA 1W0OA 2X5IC 1AR93 1GP6A 3LA7A 3AYCA 2AACA 1VBE3 4YG3A 4BK4A 2YGLA 2ZPXA 4E8DA 2CDOA 4QAWA 5IK8A 2ET1A 4D7YA 3ZYHA 2VVEA 5BV6A 4Z5CA 3E5UA 5L7OC 5F3IA 3D4KA 3I97A 3TN93 5C4WB 5L36A 2VY0A 1J3QA 5BNNA 2AUWA 4FFGA 3ZYRA 3MEPA 4GXLA 4CDUB 4GQMA 5BXXA 3SH4A 4OCTA 4ES8A 2XL9A 1HRI2 3WW2A 5J37A 3RFRA 1NLQA 2DVAA 5A7QA 1YQCA 5E8AA 3TRSB 3AP6A 3H8UA 1RUJ2 2A3XA 1BVP1 1HQLA 4OHZA 3VBHB 3QOWA 4P9JA 2XJTA 1BEV1 2P6CA 4Q0SA 1BBT1 1BJQA 1RB8G 2V5DA 4HETA 4JGYA 3RZMA 1SG3A 4PDWB 3S0MA 4WBBA 1BEV2 1MQTC 2WZR2 2CWMA 5FZCA 5FXZA 5LA2A 2XGXA 3BOWA 2ADEA 2QZ3A 2UWAA 2RJ2A 5AFBA 5JOXA 1OFSA 1QQP1 2ZA9A 4XAEA 2VTXJ 4AYUA 3CLCA 1DYKA 3J7NA 1OLMA 3ECQA 2J7WA 2DCZA 5K7PA 1MVQA 3HT1A 1UPIA 1WBFA 1Q8PA 1XXNA 4Y1UA 3KV9A 2YBDA 3ZMOA 2QCSB 1HXS3 1O5UA 1VAKA 4W50A 4XUNA 4XABA 5LBFA 3WHUA 1JZ4A 4URAA 1HQ1A 5F3CA 2DBNA 1KGYA 4AHZA 5JPMB 4FFFA 4Z92B 3VBFA 3O1TA 5JIAA 1IS6A 2D5HA 1OLQA 4Q4W1 3SMHA 4LT5A 2OVUA 5IK5A 5IK7A 1OPOA 5JMOA 1FNZA 4LOSA 2JDHA 4S2HA 3DXUA 1TQ5A 3ZHMA 3FFZA 4HZFA 5H9QA 5DAVA 5FP3A 5F7UA 5KXDA 1VBE1 4KU7A 2PXJA 1WLCA 1HB4A 1NY71 1UPSA 3KHBA 3NNGA 3TEYA 1UMIA 2BNOA 1OFNA 3SC7X 2PE5A 4EN6B 2A5ZA 2WNUC 4FTSA 2JG9B 3MYXA 1LOGA 3TYJA 4FTBA 2WNUA 2VMEA 4Q4W3 3OB8A 2RG4A 3IT8A 5FPAA 4AFDA 2FCUA 3O5SA 2VQAA 3PURA 1UU4A 3LD8A 3O12A 2QQUA 2YZ4A 1NZCA 3NDBB 4Z1VA 1ZREA 4I0AA 2B5HA 2XVGA 3N3HA 4AW7A 1WW7A 5KC5A 4CUBA 3VDCA 2V4VA 2XIUA 1VBA3 2VL4A 3P6BA 2EXIA 4JGZA 4SBVA 5M0TA 3EQEA 2FDFA 2GC3A 2G1MA 3K48A 4NMIA 3TB0A 4X8PA 3THCA 3ZM8A 2QQLA 2PUDA 1DGWX 4RS5B 5FOJB 2E33A 4O65A 3BGAA 3SHRA 3CU7A 1RUC1 4JKMA 4I0WB 1ODNA 4N9IA 5FRAA 5FZHA 2BJCA 1JZ5A 1NKGA 5K9YA 1AR63 2SBAA 1R69A 2AC1A 3VBRA 1G86A 4YYOA 3KB5A 4YZ3A 1REFA 3ZVXA 1FI2A 1OSGA 1VBD2 4GZ9A 4PI2A 4QPGC 3E6DA 4XXAA 2XJVA 2KM2A 2RS32 5FK7A 2MXDA 1LOCA 4Q4Y2 5T54A 3I8TA 3KJXA 5I8SA 4HSJA 3WP6A 4DO0A 2QQPA 2JWPA 2K46A 4K8FA 3ZR5A 3LOBA 1QZXA 1NQJA 2GC2A 4TLGA 5IVVA 1D2QA 2AUYA 3WDUA 4JGYB 4LMFA 1XNTA 5FYCA 3ZLIA 5FOBB 3ZN4A 1CJDA 5C9AB 2PUCA 1B0NA 2FCVA 3MIBA 3MLKA 4LLOA 1W8FA 3RPQA 3U14A 1D7PM 2EXJA 2ZGRA 3HQUA 2OW4A 1W8OA 3K46A 1DQ6A 1WMDA 4FPGA 1F35A 1JYCA 5HV4A 4LBOA 2IUWA 2YBPA 1GQGA 4QX2A 4WVWA 1W90A 3AVRA 4AI2A 3IAPA 4OFGA 3RZKA 1CAVA 2J7MA 3DYOA 1DGWA 2GNDA 1NERA 4L0PA 3G5GA 2OQ7A 5EIYB 2E26A 2VOWA 4YGBA 4BXFA 3H7JA 2FDGA 4HVRA 4LIVA 5C9AC 4NE9A 3LSDA 4QX3A 5L7OB 4RQPC 1OLRA 1OUSA 5A70A 1IKQA 1HKDA 4PBOA 3GZUC 2C1FA 2MNGA 1QP7A 2VR4A 3H9AA 3SQOA 2R071 1H6XA 1PNGA 2D5FA 3KZ4C 4QXBA 5C8CA 1ZRDA 5HBAA 4AHYA 3E6CC 2FDHA 5C8CC 1OH4A 2XBO3 1HF0A 2ZACA 1HN1A 3FZ3A 1D4M2 4ZXEA 3M2MA 4LPLA 3UWPA 4ATFA 3OMTA 4CP1A 4PU7A 2XMLA 4K6BA 2WIUB 2HWB3 2FD8A 2TEPA 5FBZA 1QOSA 2R043 3ZDVA 1IQAA 3BU0A 4YG7B 1QJX2 2R073 3I3EA 1RUF3 1GV9A 2GDFA 1GYKA 2D6MA 2MEV3 4LR4A 4QQPA 3AKSA 5A6YA 2XB6C 2J42A 4QQHA 1C5IA 4YW3A 3R4DB 1R091 4IEYA 2JDAA 4R52A 4DMIA 3Q9OA 1V9U2 4RHV3 4CP9B 4D6QA 4D6SA 3NKTA 4GMP3 1SLCA 1GP4A 3OPTA 3TELA 4UF0A 1GNYA 4JQRA 4I8TA 3SH5A 4ZONA 4Q4X2 4Q2FA 5BNNB 5I8TA 2B7YA 3AK0A 3GF6A 3IDAA 4A2UA 1IPJA 3FBYA 4LBQA 2YGMA 4B4QA 4CDWC 2RS11 3ACHA 3VBSB 5CFCA 1RUC3 4S2DA 1VPHA 1HIXA 4JGYC 3U3WA 2XLFA 1LECA 2N7GA 5DDJ1 3VN4A 1WWYA 3WF2A 4COUA 1S0EA 1PZ9A 4OVEA 4CA9A 4Z5HA 3UK9A 3MIGA 1LU1A 3AP9A 4W6XA 2UU8A 2RE9A 3L1PA 3HWJA 2W1SA 3HQXA 5E89A 3WG3A 3N9MA 1HX6A 1FAYA 4OI2A 2JDYA 4ARYA 1WMXA 3CKHA 2QQWA 1ZZ7A 4RHV1 2ERFA 1MS4A 2Y6JA 2LYLA 3F95A 4Y20B 5DRYA 5FPXA 1PMJX 2P3JA 3LAGA 3M3QA 5A7PA 1JZ7A 4KG0A 3OJBA 4K21A 3A9XA 4Q5OA 4UBHA 3KZ3A 4MCTA 2YHJA 1GICA 4RS5A 3O1MA 1F31A 1TEIA 1PRAA 3JXDL 2CYFA 1DGRA 1PVXA 2DF7A 2FMYA 5FYZA 3VBFC 3I59B 4RS5C 1RPEL 2J1VA 1URXA 5AC93 1PM7A 4H7MA 3KL4A 5DUXA 5LBCA 2VVDA 3O0VA 4I3GA 1GWLA 4FOQA 4XUOA 3MF6A 3KCXA 3LEIA 4LKEA 3VDAA 4NPMA 2XKPA 4B4RA 1Q8OA 1KFUL 2VQ0A 2VUJA 2OUHA 3QQ6A 3ZFEB 5T5JA 1IS5A 1F5JA 1W6PB 3QD6A 5DG2A 4C1XA 2CV6A 2YMZA 1SHWB 4JZRA 1AL21 1ULCA 1H8TB 2NMNA 4XURA 3NV4A 2CWSA 3IDCB 1QHDA 4BIOA 1NUKA 2WSVA 1C1FA 5GLTA 2XJ3A 2LCVA 2R32A 1NA1A 4JTOA 3HN1A 2OIIA 5DDJ2 4FT8A 2SLIA 1T2XA 2PXBA 1TE1B 1ZBE1 1NA1C 2YU2A 4YG4A 1DQ1A 1RUH2 2XQXA 4JCXA 4CEWB 3HNBM 1PX4A 1L7QA 5FZ0A 4BQ5A 2D6PA 3JCIA 3POWA 1H9PA 1GQHA 2IFRA 4EE2A 5C3RA 1US3A 4MUVA 2O14A 4OULA 4AOCA 4BOWA 4YW4A 5JDBA 4NWVA 1OPMA 4NR1A 3R1FA 2JKXA 1BK0A 1RIOA 3G6JB 3ZFGA 1AXZA 1O4TA 4AVTA 4CXXA 2XDVA 5K8SA 1D4VB 2B42B 2ZMKA 3WV6A 2BYVE 4QM9A 3ZX7A 4PLMA 2XL7A 3VKOA 5J96B 2GALA 1X8MA 1CN1A 1UMHA 1KRIA 2PXVA 3TN91 4IWRA 5EJZB 4LHNA 5C3PA 1NE4A 1WMEA 4K1ZA 2P5BA 3B7HA 3ZXGA 4TTGA 3A9YA 4RA0A 4MG2A 3KQ4B 1V6KA 3ZPOA 1NXD1 1G9BA 3GZDC 3OBRA 2HINA 1WETA 4CEYB 5CAZA 5JR7B 4EN7B 3R6SA 1QEXA 3GZDA 3FLRA 1XYOA 3PTRB 1GZ9A 1RUE2 2Q8DA 5FUPA 3KVBA 2XBO1 4BE3A 2VZ3A 3A9ZA 5C33A 4EQZA 5F32A 1VBC3 2JDUA 4MLOA 1LQCA 1W8HA 4JCKA 4XW3A 3PNAA 4OYUA 5FYBA 5A80A 4JQDA 1FV3A 1GU3A 1ZYBA 2NZ9A 3MO4A 5B4NA 4LA3A 2OQ6A 3SR4A 1RVF1 1ND2A 2Q0AA 3N9PA 2LUWA 3POSA 5JXHA 5F9TA 3UNPA 3M3EA 4BQXA 1RUH1 3NWKA 3RZJA 2PXLA 4QB2A 4E4SA 3ZXAC 2GC0A 2KXLA 5C9AA 3HEIA 1QOTA 3NAPB 4B7EA 2BP6A 5FZ8A 3CJXA 2VZVA 1HXS1 2HBTA 3CZJA 4YBAA 3BIEA 3OY8B 4NIHA 2OPWA 4RR3B 1K42A 5FY7A 2W9XA 4CRQA 5IVYA 5KXBA 3BTXA 2OXBA 2QVSB 4JDNA 4KWJA 4FBIA 1NCRC 1W06A 5KR7A 1CAUA 4ZKTB 3ILRA 3T4VA 4L9BA 2J1UA 4LBKA 5FWEA 3WP3A 5C71A 2VTFA 3N35A 3NV3A 1OOPC 1E5IA 4A7YA 5JZGA 3D0JA 5GALA 4NIAA 3WUDA 2Q30A 2PLV1 3KT4A 1O91A 1KS4A 4Q4Y1 1O4XA 1SPPA 5FQ0B 3AFKA 4GA9A 3SISA 4CEWC 1NAEA 1VPWA 5GLVA 1PGL2 1ZZCA 1MEC1 4JDMA 5DZEA 3PJQA 3EBRA 3RYRA 1XQNA 3GZTB 1UL9A 3WZ1A 5E6HA 4CPBA 4CU7A 1RITA 4J1WA 1O3SA 5C4WA 3M3OA 3NAPA 4N53B 2W08A 1NQDA 1CJPA 1RIRA 1R083 3NNJA 1S2EA 3NW4A 3ORJA 5C4WC 2R30A 3D3AA 2XWJB 2HKXA 3USUB 1UU6A 2DVDA 4DINB 3UJOA 4YZ1A 4IE5A 5CEHA 2KEKA 2WABA 2B9UA 2VO5A 3WR0A 3PMEA 2BBAA 2ZX0A 2D3SA 3ZFEC 5KWRA 5GLZA 3F6WA 4PU8A 5HV0A 3S7IA 1LOEA 2R7EB 5DTQA 5DAQA 4BLIA 1ODMA 4EQVA 5C6CA 4AEDA 5JPNB 4GB33 3T09A 4L11A 2XKOA 1BZWA 3VBOA 5FO8B 2BPA2 2GH2A 1BK1A 1KQRA 2Y33A 4GWMA 1G6NA 1VBB1 2ZX4A 1QQAA 1OA4A 1X36A 1ZBA1 3B00A 3GCWA 3JXSA 4FPEA 4OHYA 1MEC2 2AENA 3SXWA 4A3XA 1LU2A 3WD5A 1AYM1 3TEPA 5DABA 3VZKA 5IVFA 5JAXA 4YFWA 4Z5DA 4JV4A 5F6LB 1AYN2 3MLLA 3OQOA 3HBZA 3C7GA 2RM21 4Z2AA 1F8VA 3N9QA 2VZQA 3TNPB 2Q8OA 1C5HA 5A6ZA 1JU3A 5CB7A 3JBG1 3J26N 3ZFFB 3H3UA 3USUA 3QBQA 3R05A 1YUDA 4BMEA 4RR3C 5A7LA 4LBQD 5A33A 4DXZA 1O4YA 2W39A 4P9GA 3E6BA 2BERA 1PZ8A 4N53A 4CDXB 5LRSA 5DTMA 2DCJA 1DCSA 4D7TA 4Z8BA 1AX1A 1UZVA 4BU2A 1XB9A 4D69A 4ER5A 2Q1MA 3M70A 4Q4W2 5H9PA 2WIIB 3RDIA 3POBA 2XUMA 1V00A 2PN5A 5FZ9A 2RS51 2VOVA 2EF6A 1WW4A 2HWC2 3RGBA 1AU7A 3NQHA 1QQP2 2D5VA 2R49A 4L8QA 5FP4A 2LLVA 3JB8A 4KGGA 1SMVA 5LY2A 3PHMA 3OGVA 2VZSA 3D82A 4M4RA 1KITA 3KT7A 1OF4A 1DQ4A 3ZIWA 3EJKA 1LESA 5FZBA 3WT3A 1I5PA 1H8TA 1R082 1ZM1A 5CADA 5FZ4A 4GB31 2WYSA 4UAPA 2FQPA 1YSEA 3I49A 4FPJA 1DBNA 2H6BA 2NM1A 1S2BA 2RS12 3BODA 4WM7B 3A21A 2QKDA 2Z4FA 2O4AA 2WA3A 4ITCA 1UXZA 1V70A 2VM9A 1VBA1 3URFA 4QPYA 4CUAA 1W9SA 3LOIA 1CX4A 4IESA 5CA6A 4DE8A 1Q56A 2PHWA 2YBSA 3KS7A 1UIKA 1GMMA 3Q8AA 2RV9A 3QCWA 2PAEA 3AXDA 3EHKA 2WINB 3MIHA 4FQZA 4PDWC 4ARXA 5FFOC 5LASA 3NO8A 1L7LA 4M0NA 4R9CA 4RGKA 3MGUA 1AXKA 1TME3 2JG8A 1QH6A 3KVAA 4K7JA 4WM7A 2PUBA 3I4IA 1E5HA 1EPWA 2WBKA 1LEDA 2YDEA 4QPWA 4RQPB 4B1MA 5KHKA 5GLWA 3B7MA 1AHSA 4MGTA 1SCSA 4PLOA 4I6TA 3AZXA 2AYHA 1VE0A 3FMGA 2HWE3 2ZHMA 4E4HA 2FFHA 1AR91 3OYWA 2WNOA 3RMXA 4QGLA 1XC6A 2BOJA 1BCXA 2VECA 5GLUA 2HBUA 3VBSA 1CR7A 3AZVA 4AEKA 4QKNA 4Y26A 5CG8A 1PIV2 3DUIA 3LFMA 1ASJ3 2IXCA 3KGZA 2HEWF 5LCWL 3ZKUA 1KFXL 4NVPA 5JOWA 1K45A 3JBG3 4LKSA 3HIFA 4BCUA 2RJLA 1NCQA 3MFCA 3ZSLA 5JI9A 1X33A 1GZTA 1Z7S3 3ZPYA 1GLHA 2VULA 3VL8A 1YIPA 1LODA 5T5PA 1DW9A 1U12A 1G8WA 1VB4A 1W3XA 2WRAA 1X57A 1HLCA 1RUG1 1VB2A 3ZN5A 4XJAA 2BU9A 1H1AA 3J4UH 4M01A 4RFT0 4LBJA 2CSFA 4IL7A 3WF0A 1ZVFA 1LRHA 1RUG2 2RDRA 1Z78A 2A7AA 3LSEA 4UF0B 2PUFA 2HEVF 4XF9A 3SNMA 2HWD2 2VU9A 2GU9A 4TSVA 4BQYA 1NW3A 3LPGA 1VBC1 3SKJE 1EYBA 1F9KA 3RWKX 4OQ8A 1XBFA 4LEJA 1ASJ1 3AP5A 3DV8A 3GXUA 4AEMA 4WZFA 4XQ4A 1H9WA 4NIDA 3W59A 2D3RA 5AC91 3SX0A 2C4XA 4QHZA 5DSXA 1PGW1 5I0RA 1OOPA 1VMJA 1G7YA 2X5IA 2Z69A 4Y5Z0 1I1EA 2WFF2 2HWB2 2Z42A 2UWBA 1HRI1 4Z82A 1TMF1 2HWF1 2VGDA 3BVCA 4ER6A 4HONA 2MEV2 3HOBA 1R092 5ERLA 2R061 4IE0A 2DDUA 1XU2A 5JSOA 5LK5A 4XFIA 1W6MB 1HJGA 4G9SB 5JVVA 3ZO0B 1QB2A 1XNAA 1HRI3 3VBUA 1HB1A 1C1LA 1LENA 4BHPA 2PLV2 3D0SA 3WCRA 2HYKA 2WT2A 1W39A 3VBUC 3U4XA 1S2KA 2A6XA 2ZGUA 4LIUA 5A7WB 3OGRA 4I3PA 4WVMB 5IAXA 4Q4X3 5KBFA 5LY1A 1OD5A 2K9ZA 3AJZA 4RD7A 2ZGMA 1WLWA 3AZZA 1JTZX 2LTNA 2O1QA 4QM8A 1QPZA 5EJ3A 4X4DA 1KS5A 1NG0A 1IOAA 2VD7A 4CU9A 1COV1 2ARAA 4CTEA 1BVVA 2EBYA 1NT0A 1W6MA 3OP9A 3MW3A 1UU5A 4GWNA 1O3QA 3WDVA 3FBMA 4V2VA 1JOPA 1MQTA 4AEDC 3USSA 1W6NB 4XETA 1DQ5A 3AYDA 2JDZA 5FYTA 1L1MA 1Q8VA 1PM4A 4Q4X1 1O5LA 4LUKA 1RUD2 2O8QA 1VJ2A 2LALA 2VNOA 1X8EA 1JHJA 2VE1A 4Y42A 3VK0A 3SKVA 4TYSA 3S7EA 3BKZA 2XXQA 1N3OA 3AM2A 3MIFA 5I91A 2OS2A 2ZGPA 3AVSA 3O0XA 1U0AA 3PVOA 3UKVA 4J1XA 4B4PA 4XUPA 1GQPA 1Y43B 3C3VA 2DCKA 5DTRA 4Q0QA 1QMJA 1IQDC 2P2KA 2DCTA 1DYPA 1K3IA 1YJLA 1DZQA 2QQMA 2G4IA 3B01A 1GUIA 1TZOA 2BNNA 2ORXA 1AF9A 3OPZA 4IV3A 4UYBA 2LYJA 1FOD2 1TNFA 1HW5A 2D3PA 3WW3A 2CU5A 2Q5TA 4BQWA 4W8JA 3LQXA 2P37A 2YY1A 3AL5A 1IGOA 4EWEA 4HVOA 1PVC3 1UKRA 1IS4A 1GANA 1YFYA 2HWE1 1W8UA 1PMHX 4SLIA 2CSGA 4I0BA 5KHJA 5CYYA 5L19A 2BW8A 1Y4WA 2D6NA 1J58A 2EICA 2YYOA 4LO6B 5SV5A 3O1UA 2EAAA 3PXPA 1VMFA 3HR9A 3IIAA 2DU1A 3LWCA 1PGSA 2LYQA 3N9NA 3POEA 5G04L 4CUGA 2XH6A 3AMHA 5GAHi 1GZWA 2HH9A 2PPXA 4QX1A 5KHHA 3O14A 4XIOA 3TN92 2WYFA 4TWTA 3UKNA 1RUD1 1YXWA 3VDDC 4DRRA 3DNVB 2VZPA 4XF1A 2ZKNA 1VBA2 2KD7A 1RUF1 3I54A 5FMCA 1EPZA 4LBLA 1YQ5A 1UY0A 1FT9A 2MHFA 4ZU7A 5DPNA 4AQSA 1EAH2 1XNBA 3VHOA 4GALA 3DYPA 4UFIA 2LRPA 3PU8A 1CQTA 3ABZA 1LMB3 2HYXA 2X09A 4WVLA 3BPSA 4R9BA 3RNSA 3ZFFC 1WKYA 1ENXA 1RUJ3 2JG9C 2VPVA 2ZHLA 4PT6A 5D1IA 3ZOIA 1HRV1 4XFCA 1JZ2A 1RGSA 3V0BB 2Z5WA 2JG9A 1O4ZA 2CGNA 3BB6A 3WQ7A 1W0NA 3H0OA 1CVNA 1CAWB 2B39A 3ES4A 4XXPA 1DF0A 5F2WA 4XF3A 1REDA 5I0TA 4IEPA 4AZZA 1DDLA 4I2OA 3VBRB 2HWC1 5FY9A 1WGPA 5FPBA 2GP3A 4FPFA 2JB4A 3WNKA 1GSLA 1ZBE3 2L9LA 3ZPXA 1JZ3A 2R16A 2BGOA 2WDBA 5FYIA 1FMD2 1Y9QA 1PO12 2ZGKA 5A7NA 1PGL1 5FY8A 2WNEA 4WM7C 1P8JA 4F3JA 4PU3C 2ZMLA 4KQ7A 3OG2A 5C3OA 4W6YA 1CZTA 1AR61 1UX7A 2EXHA 4LE3A 5IFPA 3LDBA 5FUIA 3WOGA 4JDOA 4NPLA 3OUHA 4Y4RA 3WLUA 1CZVA 4OMDA 5FMDA 1RXGA 2VNRA 2PHTA 5FZ1A 4CDUC 3FYMA 1VLNA 1OA2A 1XOYA 2LROA 1U2ZA 4K9SA 2I45A 2P3YA 5IK4A 1VR3A 2VVFA 1A34A 3IN9A 1EFAA 5EZWA 2RMU2 4AI8A 2O0OA 3ON7A 4Y24A 1V6OA 3R4UA 1XPWA 2PUGA 3G0TA 1JHNA 5FYMA 3IBMA 1XRUA 2P17A 2WFPA 4XFAA 4DZGA 4EKIA 5HPOA 4DEQA 1GOHA 2B4KA 4XPVA 1EUTA 2CTVA 3L9JT 1H4HA 4FFIA 5ABJC 1JZ6A 3HNYM 4LBMA 3ASIA 5CFDB 2BWCA 2F4LA 4LA2A 1PO22 3J7HA 4QX7A 2Y6LA 5FZAA 2Q8EA 2XPJA 4O9GA 4OI0A 2WL1A 4UW5A 2GMPA 2W47A 3ZFGB 5A6XA 1L7RA 1NA1B 1U5ZA 5FP8A 1AR62 2AXUA 3F51A 1CZSA 2ZHKA 2IXHA 2E7QA 3B9IA 3CDZB 3GN5B 3RYPA 1UAIA 4PF1A 5F5IA 2MQKA 3KF5A 2ICPA 2PXKA 4FCAA 4IUGA 4YGDA 3LF7A 2FMDA 2XHNA 4CCNA 1S7EA 1AX2A 4AR2A 2H8RA 5H9SA 1LCDA 4FTEA 4IV1C 2VG9A 5L9VA 3LISA 5D8AC 1W6NA 1OD3A 1RMU3 1YC61 4XILA 4FPKA 3W9AA 2XJPA 1K5MB 2AWIA 1BQPA 4FFHA 5FZMA 3VHRA 1X2LA 1AR73 1ULOA 2KA3A 5J09A 2A1XA 2GAUA 4XFGA 1RC6A 5GJ6A 3H3LA 3OGJA 4Q8LA 1OCTC 2HWB1 4LHSA 2ZXQA 4F7ZA 4X4IA 3HN3A 1MFQC 4GWIA 3X29B 5FO9B 4OI4A 5G05L 5FY0A 5F3EA 4R9AA 3I2HA 3LGRA 1LGCA 4WM8B 2GC1A 3NRUA 1SACA 4Q26A 4QQ2A 3MV01 4CP2A 3AMPA 4NJ4A 1JS9A 2FZ1A 2RDQA 1S0JA 1PK6A 5EQUA 1W99A 3GN5A 2IXLA 1AL23 4PQQA 3TWIA 3WG4A 4ZY9A 1DQ2A 2OFYA 1I3HA 1PK6C 2BWAA 3DECA 4BQ2A 2BNMA 3VUOA 5EP9A 3S57A 2QZ2A 3JUUA 5BPXA 2QNKA 3CJIB 1FYUA 2MEZA 2XXPA 1A78A 1GZCA 1W2AX 3RVHA 4XEZA 3M7AA 1YFUA 2QFEA 2FDKA 5FLIA 1OA3A 4UW6A 4HKOA 4UT5A 2VCCA 4AFBA 4XC9A 2GN3A 4RGGA 1VRBA 2PQQA 3N7KA 4C91A 3N4MA 1XNKA 2VCBA 1R1ZA 1R64A 5K0UB 1N3QA 2WS91 2BEOA 1E5SA 2WFF3 4CYDA 3AB0A 4YVWA 5A3NA 5C5TA 2E31A 3RMYA 3ZXFA 2IU7A 3CLPA 1AYM2 1RINA 1UXCA 4I6UA 1YO8A 1YWKA 5L9BA 4MXVA 4RYDA 3PMSA 3H1YA 5A1AA 1XYNA 1ULEA 2R072 2BJSA 2EAKA 2C26A 4RSUA 4A3ZA 4COYA 2RM22 4E2SA 1WA4A 2GSYA 4OI1A 4EYUA 1RUOA 3FN9A 3AP7A 3TOJA 1OKQA 2WO2A 4CDXA 1HB2A 1US2A 3F52A 2GNBA 1CAVB 1FPN2 3IM0A 4MX3A 4IE4A 3EYPA 5LB6A 3T4HB 5ANQA 2WWUA 2IXKA 1EV13 5T5OA 4XFBA 4M4PA 2WT0A 3P3NA 5FY5A 2C6SA 1JW6A 5HXVA 1UZYA 2WN3A 4J6GA 4TN7A 4XCBA 5L9RA 4A45A 3MUY1 4AVSA 3BIWE 2UYAA 4FI9A 3UETA 1POV1 2JDKA 1IHMA 2JENA 3AYEA 1SZBA 3J9SA 4KU8A 1QU0A 4P08A 1FNYA 2PXTA 4XMAA 1C8M2 3A4UA 5A3UA 4R4ZA 3KCCA 4DUXA 3BTZA 4ZS3A 4CCKA 2ARCA 4O7XA 3DYMA 2PIJA 4W4ZA 5FR3A 1O59A 2QDNA 1F4AA 1NX9A 1RZSA 3NNLA 4LUMA 2BVVA 3OQMA 2W91A 2W1WA 4MGQA 5FKCA 4DY3A 1TME1 2WO7A 5KXCA 2ODRD 4AEDB 1NLRA 1SLIA 1ULFA 3GJAA 1RUNA 4XBNA 5J1XA 2QQOA 5FJKA 1QJY2 3MLJA 1ONAA 2MEV1 3UGGA 4WM8C 3NSTA 1CIYA 1LJ7A 1RTVA 3B9CA 4BM8A 2XVLA 5DG1A 4WM8A 1WCQA 1W9YA 5DUWA 3VDBA 4PQ9A 3ZYPA 2VMHA 3FL7A 1WCUA 1OUXA 1TMF2 1QP4A 2HWF2 1ND2B 2LM3A 4S2FA 5A3LA 4XF0A 3HQRA 3LDRA 2BRTA 1ZZBA 4FP3A 3WDTA 1DZTA 2WAAA 4P02B 1UWWA 5AC92 1VRH3 3K3NA 1PVC2 4CVUA 4JGZB 1ST8A 4ISRA 3OF1A 1SLAA 2GNMA 2ZGNA 3A23A 1JI6A 3I2JA 5J7MA 4YVSC 3T2OA 3ZMNA 5CNAA 5EJ1B 2VXJA 2IUOA 2JE9A 3I2DA 4KMQA 1LLIA 1NEQA 3RJRA 1Z7S2 2AGSA 3M4FA 1DG6A 2E6VA 2P6HA 2W2IA 1S0CA 1DU3D 4Q1RA 1WCSA 5A3WA 3PE5A 3HZIB 2RS53 1ND2C 1H8VA 4ZU5A 2Y38A 3M9LA 1AJKA 1JOJA 3QACA 3JQXA 5DQ0A 2A73B 1FPN3 3T1MA 4NIGA 1ZX5A 1PZ7A 4FOVA 2GNTA 2W46A 1MPXA 3OUIA 3VKNA 2R1JL 3D5OA 3U75A 1CAUB 4OUEA 2X05A 3A0KA 5ANNA 5ABJA 4IV1B 1RVF3 5T5LA 4CCCA 2IVQA 3LFIA 2RDNA 2WJSA 2DWRA 5IVBA 4ES9A 2PA7A 1N1TA 1WLDA 3CL1A 2C5DA 3U11A 2IVIB 4Z07A 4J25A 5ACA3 1NCRA 3S8QA 5IVEA 3J8F2 1SEFA 1VBE2 2QQVA 5CKNA 1OXCA 1ZVVA 2E7TA 3E5XA 3CIHA 4MV2A 3W58A 2IV1A 1VBD3 4NHXA 4NROA 3JU9A 4DXRA 2BTVC 1X50A 4LO7A 5T52A 1ZBA3 2DVBA 2A6ZA 5DZFA 3T1LA 1B35B 4AVCA 2PTMA 3H3ZA 5FYYA 4TXWA 1S0BA 1R1A2 5CU1A 1QIQA 2PAMA 3G7DA 1KXGA 2WLQA 5BNPB 3C8XA 3B3QE 4QHOA 3OYWB 4JCYA 2OZJA 2R063 5EYXA 5HCAA 3GZAA 3VWSA 5IAVA 3ZXDA 3WX5A 4BISA 2EALA 3VGIA 1XSQA 1UZ0A 4YGCA 5FPVA 1DGLA 1UOGA 4CEYA 1LNSA 1WW6A 4H2AA 4XHXA 3QH7A 2WNUB 1J59A 2NP0A 1G9AA 5C7GA 1M4WA 4HRAA 3I2OA 3KQRA 4LO4B 2JVLA 3H8RA 4YM0A 3RRDA 4KWUA 3Q8FA 4WV8A 4BMBA 5FXXA 2ZHNA 3T0DA 5GZGA 5APAA 2VEOA 2XSDC 4QD2A 3PLQA 1DYOA 1UCXA 4JRAA 2JEMA 4IEVA 3OTFA 5C3SA 3D8CA 3ZXEA 5A3MA 3RQ0A 1NZIA 2DUPA 2H0VA 4Y4YA 1RUD3 1RMU1 4XUQA 4NN0A 1PERL 1AZDA 2XG3A 2IZWA 4QX8A 1I9RA 3H50A 2NMOA 2WA4A 4YVWB 4Y3OA 5FKBA 5F3GA 3W21A 2JIGA 5J36A 1R1A1 3BU7A 2GP5A 4LTAA 4CZSA 1GWKA 4GKYA 4XJ9A 1Q3EA 5LZ6A 2VCAA 2EIDA 1ZRFA 3KHCA 1AXYA 3BPZA 2JDPA 3R0RA 5JUVA 1DLCA 2GN7A 3WF3A 1ZZ8A 1POQA 3TFLA 1YEWA 3N9OA 4HMZA 3GBGA 4Q1PA 4CSWA 1FXZA 4E2QA 2VUAA 2BGPA 2R6QA 4YG1A 1ZA4A 3J8F1 4JQTA 3CJIA 4LOTA 2PHLA 3VHPA 4AXOA 5ACA2 3QYXA 3GYDA 4KWLA 2FDJA 2ZMNA 3J7MA 2YC4A 2RR13 3H1MA 1QJU1 4P5YA 1UY2A 3NL1A 3PIJA 4RR3A 2H0BA 1H30A 3MHZA 2V4AA 3VD3A 3WQBA 2ZX3A 4A6OA 1XE7A 3E1F1 3AKTA 4OBMA 1SLBA 2WNVB 3R4SA 2Y6KA 1QF3A 5FLHA 2IXIA 1BYHA 2A70A 4Y5TA 1N1VA 3RSJA 1BHGA 3ZKYA 1LTEA 3ALQA 2O8OA 3ZXKA 2W87A 2VC9A 4XJUA 4CDXC 3PL0A 4BWOA 5BNOB 5HCHA 2IC1A 4K1YA 3GJBA 4LO5B 1WH6A 4QU2A 2Y6GA 3FHQA 4IW3A 4AFAA 4DOUA 2W5FA 2PAKA 2BBVA 4IEXA 3IMMA 4GWJA 3V65A 1N47A 2ZX1A 1MS3A 1W04A 3VL9A 3FYAA 2G9GA 3LEMA 4QX5A 3UT0A 2WO1A 3GHMA 1RUC2 3GDBA 2YPJA 5A32A 3WG1A 1COV3 4YZ2A 4ET7A 1B35C 4Y22A 3GZCA 1UD1A 1JYNA 1R63A 1E3OC 2HSGA 1AUYA 3V0AA 4QKFA 2JDMA 3H8OA 4IDZA 4MHUA 2R0FA 3FC0A 3I3MA 2L8NA 3D6EA 1CD3G 3FX3A 2VBBA 3OGGA 3UYJA 3FLPA 5EFUA 3TAYA 3U4SA 1I6XA 4XOGA 1ZBE2 4UWDA 3J7LA 1UOJA 2V73A 2KPJA 3JXBC 1W8NA 5LEJA 4HK8A 1PO13 1YQ6A 1ENSA 4N9HA 3TRBA 1OVPA 2RS31 3KT1A 1V0AA 3KXAA 1MEC3 1VAVA 3RG0A 4N7IA 1ULDA 1UOFA 5H9RA 1PGW2 3K4ZA 4ZU4A 4EJRA 2WAOA 4R9DA 1AYN3 3AKQA 2W1UA 4F83A 2VMCA 2ZABA 2VCMA 4I01A 1MR5A 3WNXA 3BTYA 2CAVA 2L49A 3LFPA 5DT2A 2ZZQA 3QH6A 3JBG2 2WWSA 4I02A 1ALYA 1PMIA 1QJU2 3JD72 2W68A 1W28A 5JIUA 1C8NA 4UI9L 3NJXA 4CCJA 1JUIA 2IFWA 3T2QA 1W0PA 4YLZA 1JH9A 1HRV2 4AFMA 4H3WA 4E9KA 1NCQC 1C4RA 1RHI1 3LEGA 4M3CB 5JR2A 3RWNA 1WD4A 5J3UA 4FPCA 1EP0A 3I7DA 4P5HA 1NLSA 4CCEA 3OOXA 2HWD3 2VOTA 2JIJA 3ZSEA 4ASMB 1JYTA 1MVEA 2QJVA 4CDQB 1RUH3 1VP6A 3NROA 3WXPA 3IZOA 5IYYA 3PVEA 4K20A 3FMYA 1QQBA 3DCQA 3NV2A 2VOKA 3CHXA 1CQ9A 4AAPA 2ZEYA 3IMNA 1JBCA 3VKMA 3JD71 4XBLA 2P34A 4AGGA 1AR92 1BBT3 4MZUA 1FATA 2VH9A 4CCLA 2ZGTA 1PVC1 4AI9A 4O61A 4UBGA 4XF4A 4NUBA 3T30A 2A6VA 4LE4A 5JXJA 2PXQA 4FPYA 1HQNA 5JZGC 2CROA 1VALA 2AR6A 2OPKA 3LA3A 4B1LA 4MGKE 4AQ6A 1UYYA 3IDEA 4UFHA 2B45X 1SQ8A 4XZUG 1ZRRA 3DN7A 5J98B 5FDBA 2OZ6A 3GHNA 3LB9A 4HXCA 5FJHA 2FJRA 1MZFA 4A41A 1SLLA 3ACLA 2W94A 5ISLA 1V6IA 4JAAA 2K2SA 2RHPA 4HKWA 5FYSA 3AL6A 1V9U3 4N43C 2UWCA 3ZN6B 4FO9A 4QGNA 2GMMA 3T0AA 5F37A 5FZ7A 1REEA 3KCYA 4JRLA 4ZHNA 4CEYC 1F2NA 4COWA 1VBD1 2EWTA 2RJKA 2BDRA 2VQTA 2WZR3 4UFMA 5FP9A 1YQ8A 4BYYA 4LULA 3HJRA 3JZVA 3N7JA 4R4XA 5FV3A 1A8DA 1RUE3 3DKQA 4KI5M 4MXWA 4I09A 3UJQA 1ZZ6A 4X4HA 1C57A 2VUCA 5KXEA 1W2TA 3FFQA 4YSFA 1VBC2 2Q8CA 3WQ1A 4O9EA 3SCFA 1UY1A 4ORFA 4BDVB 2RS52 3ETPA 1OMIA 4M0HA 4NIIA 2DVFA 3UGFA 1SCRA 3VBOC 3VZMA 4QPIB 2ZEWA 1L3JA 2XR4A 3M8LA 5F6KA 2NPIA 2VJXA 2WLPA 2W3JA 5FK8A 3LKJA 2AW6A 3MI8A 1EV11 2GRLA 1YIFA 4DB5A 3OWQA 1OH3A 1KEXA 2JKBA 4IXLA 5HCFA 4QPGB 4HN1A 2ZEZA 2LS6A 2WSUA 4GHJA 1HV0A 5KC6A 1RVF2 2D98A 4AK3A 5KHGA 4IGOA 2BOIA 2ES3A 2JXAA 4DPNA 1ULGA 2WO3A 2R0HA 2OA2A 3SEPA 2JICA 3NV1A 4HVQA 2TBVA 4ONUA 3AP4A 4U2AA 1STMA 2X8KA 5CFDC 4QQOA 4QX0A 4Y20A 1W8TA 3AYAA 3HD8B 3B02A 5HXMA 4GQ7A 2WQ4A 1QKQA 1Z0HA 2JE7A 1AJOA 1OF3A 1UNBA 4Y1VA 2R042 4LQRA 4Z2WA 2ZAHA 4IGPA 3OPWA 1PRUA 4BJ0A 2QQNA 5AVAA 5JSRA 2I07B 5L7OA 2J1EA 4OQ9A 1OKOA 4JX0A 5CBLA 1GWMA 2VZTA 3ZYIB 2HWD1 3VB9A 3WP5A 2O38A 1SBEA 3NJYA 4RHV2 2B5AA 3T2TA 4OLLA 3KD4A 5D8AB 3DXTA 4BH9A 4QWNA 3HMYA 1H8TC 4DY5A 3GZEA 1GZWB 1N1SA 1H2LA 4IE7A 1GNHA 2GH8A 4AQ2A 5LEKA 4H7LA 3ZFFA 1DP0A 2IXJA 5IW0A 2NLRA 2B46X 3MFAA 3I2FA 3HVDA 1RL3A 4XCAA 3RI8A 3QFIA 1C8M3 3SCHA 1E5RA 3GM8A 1XSRA 4Q4V2 2WZR1 3HT2A 2FCTA 1WMFA 4X4GA 4DE9A 1W6QA 2EIEA 4NHLA 1POV3 4EZ4A 2PXEA 4DUVA 3FUQA 3GNEA 1LHOA 3OSDA 4AAXA 3BUCA 1W9WA 1K12A 3QOXA 3UFDA 5FYHA 4HPKB 4YNIA 3O9XA 3KLSA 2MPFA 5JOZA 2ZGLA 1S55A 1QP0A 4X4FA 2X5IB 4OUSA 3OEBA 3RZZA 3FHIB 5C5UA 4PIYA 2X10A 1FMD1 2KEJA 2AH2A 2LW8A 4QU1A 4LBQB 4AEJA 1CAXB 4IA8A 1W6QB 3NVCA 2XOMA 5A7OA 4BK5A 3POGA 4PLNA 4FAGA 4FSJA 1S0GA 2J1TA 5JLVA 2VAUA 3CEWA 4Y33A 4DQAA 5ACA1 1CPNA 1MS8A 4DXTA 4P9IA 2Q4SA 2WS93 2XJQA 4D3WA 4DIQA 3PTYA 1RZRA 3WSOA 1LHWA 4P14A 3AMMA 4ER0A 3SLIA 4P9XA 4BQ1A 4CDUA 3ME5A 3ATGA 3ROUA 3AZYA 4C90A 4QB6A 4BQ3A 2VMIA 2CAUA 1ACCA 3DL3A 4UXAA 3B94A 2DUQA 3MV11 1UOBA 4AF9A 3POIA 1QGLA 4IEQA 4N43B 4DNYA 5LW9A 5FQ0A 4FPHA 1POV0 1H1IA 3I3BA 2D43A 2LNMA 4D0QA 1DZRA 3H7YA 3F2ZA 1JMUB 1UMZA 4XJ8A 3UGHA 4AE2A 2YV8A 3CMGA 2VXRA 4FXKB 4AVBA 3OGSA 2J1SA 4YW1A 1U5XA 5B2GB 4X4CA 2XBO2 4FAHA 2J1RA 2Y34A 1Q8SA 1GNZA 5CKMA 2ETEA 1JZ8A 3K51A 4OHVA 4KL1A 2C9KA 5E16A 3MZHA 3DGTA 2VNVA 4F8AA 3GGLA 3J8F3 1KDMA 1CPMA 1UXXX 2R1DA 2WR9A 2CNAA 3AZWA 3OBAA 4Q4V3 4LNVA 3VBRC 4A42A 1D4M3 3OY8A 3BI3A 1BMV1 2K0GA 2RS13 5A32B 5F5CA 3TEWA 2G19A 4CUCA 4FQ4A 3AX4A 1S0IA 4XJZA 2ICTA 1ZAYA 1V6NA 3IPVB 1NOVA 5EHDA 4FOYA 2VZOA 3ACFA 4LHKA 2JJ6A 4OHWA 5DMYA 1QJX3 5FPUA 3THPA 4H14A 1JYWA 2VTXA 2KR2A 1CAWA 1QOOA 1FMD3 1A6CA 1R1A3 3JB4C 3K3OA 3PVBB 2AXVA 3EB7A 1GT0C 3VLBB 1VBB3 3QLQA 4PF5A 5LK7B 1IPKA 1DGRN 1TME2 1QJX1 4IV1A 3IIIA 4NRMA 5FLJA 3DEMA 1W6OA 2W92A 3OD0A 3VD5A 2W95A 5HI0A 1AVBA 2XUEA 2OKXA 1WCDJ 1UF2C 5DAPA 3WW1A 3VD4A 5K0UC 1W3VA 2UURA 2ZGSA 2GZWA 4EKGA 3ITQA 1EY2A 2EIBA 4Q8KA 4XDOA 5JXGA 4D94A 1CGPA 1Y3TA 4GB32 2DURA 1LHUA 1J1LA 2I74A 1W6OB 3E5QA 3CQOA 4IGQA 4E8CA 2LYKA 5FXVA 5FY1A 5IATA 3BD1A 4U36A 1YHFA 2QQKA 4MHRA 4ASKA 1K5JA 1MS5A 3DM5A 3A22A 3ETQA 2X53S 5JWPA 4QXHA 3QWGA 3E97A 2E53A 1IG3A 5IVJA 2P4EA 1ADRA 2ET7A 1N3PA 1KJRA 4OHXA 1LULA 2VMDA 1LGBA 2XXZA 4P9WA 1VRH1 1C28A 1PO23 2ZOEB 3PJYA 2RR11 4XHBA 2WWJA 4RGAA 1O3TA 3RJ2X 1NY72 1SLTA 3LIGA 5FCCA 3H5TA 4PIXA 3W20A 3WF4A 4X4EA 5GZEA 4CDQC 2PFWA 2ZBJA 3LE0A 3IDBB 1YCIA 1XWRA 1M06G 4YG0A 5CVRA 4RL7A 2DCYA 1IS3A 1CESA 2WUHA 3ME2A 3PVNA 2AEZA 3VZNA 2XQRA 5BNNC 3CO2A 1SQ4A 1G9FA 4HK9A 3WNOA 4HFSA 4QT6A 2Y6HA 4XTMA 1VMHA 4BQ4A 5FO7B 3VDDA 4G3YC 3ZSJA 2PXFA 1OQDA 3C7HA 4LLFA 4RN5A 1VBB2 5LA1A 2HCNA 3LA2A 1XE8A 2DFBA 4HN0A 4HOOA 1O6UA 1YFWA 2X29A 4GIQA 4LK7A 5DDJ3 3MIEA 3T3YA 2XVKA 4CDWA 3CROL 3O1SA 3BYWA 3AXEA 1H1MA 1JYXA 4MCXA 1J3PA 3UESA 4D6RA 1LOFC 2P3KA 3H42B 4L97A 5AVPA 3U10A 5TSWA 3O1RA 4Q0VA 3P1IA 2GRMA 1LOFA 4XFHA 4MGIE 1DWKA 2A3YA 1CJGA 1LOBA 1KDKA 1W8ZA 1UQXA 2A6YA 3I2GA 4Z59A 3LQCA 1BKZA 1RUJ1 4YZ5A 1S1AA 5IFTA 2ENRA 1GOGA 5ABJB 2UY8A 1H4GA 2V5YA 4Q29A 2NYYA 3KV6A 3BDNA 1CONA 1OOPB 4X6QB 2VNGA 3CBNA 2D40A 2NQYA 2YC0A 3NNFA 3H1WA 4JHZA 3AKRA 4N90A 1AL0G 1UKGA 3LPFA 3WDYA 3OD4A 1YFXA 4NHMA 3ZDSA 2ZCWA 4AGVA 3UL2A 4MVTA 1DIWA 2VW2A 4LO8A 2ZJCA 1W2UA 4X8NA 2RVAA 4BPZA 3ZSKA 1SFYA 3DPRA 4W65A 2VBDA 2XLGA 1KD7A 1RZRD 5I0DA 5J48A 4GH4B 1PIV3 1GR3A 3M3CA 3K4DA 4KG8A 2A75A 2XI8A 3ZR6A 2HCSA 2R63A 4O8BA 1GP5A 3INAA 2AZ5A 3WDXA 3QF3A 1AYN1 1O8PA 2WC2A 3N36A 3QOPA 5EYYA 1DLLA 1E57A 1OURA 1PX3A 4S2GA 5A3OA 1W6PA 2E51A 5D21A 1AYM3 1Y7BA 3GALA 4YM1A 3OEAA 4M3CF 4LKDA 4CU6A 1PNFA 1O8SA 2BZDA 4PIZA 5FREA 2A6CA 1YJKA 2DV9A 5BUVA 2CY6A 2ZKLA 3O1OA 2Q1ZB 3SITA 4K3UA 2OUJA 4YVSB 3CECA 5FPLA 5T50A 5IWFA 2JD4A 4AL9A 5KHIA 3WVJA 5FZLA 3R09A 1ZUGA 2QE3A 3KV5A 1S0FA 3NNMA 1EAH3 4PU4C 3MUZ1 4GH4C 4JGZC 3VDDB 1CAXA 2VMGA 4BA6A 4BXSV 2PUAA 2HFZA 3MBWA 4JTNA 1GBGA 4NAOA 5T55A 3TEZA 4TZDA 2EF8A 1HV1A 4Q4V1 4BLJA 1QXPA 2PHDA 4MOAA 4EWAA 4QMAA 2FBEA 1N1YA 3U1XA 4GJZA 1GOFA 5JUWA 1QWRA 2NN8A 4YW5A 2Y0OA 4YM3A 2Y0IA 4YWAA 3WHTA 4QB1A 3P3PA 1HDKA 1PK6B 5FPZA 1LHNA 5BNQA 5JOYA 3PUSA 3SEEA 3NKGA 4HLTA 2VMFA 4QPGA 2V3CC 2C9AA 1S4CA 2P3IA 3KGLA 3N7LA 3TNQA 3HPNA 2JQEA 3JXCL 5EV7A 1LOAA 3W5NA 5B4XA 3MF9A 4Y1ZA 1R093 5FMOS 2L1PA 1FX5A 1YNAA 2XHKA 4Y22B 1JUHA 2LYSA 5E1RA 1OHFA 2RS33 5CFCB 2QDRA 1IZ3A 1QXJA 4KWKA 2WN2A 1UO9A 1OLME 2DFCA 1UW8A 5D8AA 2FDIA 3CF6E 4Q0PA 1F5FA 3MPPG 3GUUA 1YI9A 4I6RA 1LKNA 1TMF3 2HWF3 3MPBA 2VBPA 3WUCA 4CP9A 4INDA 2PHXA 1ENRA 1Y9MA 2ZAAA 4WVMA 5FWJA 3K2OA 5C8WA 2E7AA 2ZEXA 2IVBA 1UY3A 5BNOA 1VAMA 3ZKCA 4PHZA 5K0UA 2OYZA 3ACGA 4NDWA 2YXSA 2BFUS 5IUQA 2CHHA 5LRRA 4C0HA 4HANA 2C24A 4QDRA 2WNVA 1B09A 1POUA 2Y26A 5A3TA 1ZPQA 1JXNA 2AREA 4I30A 5F8PA 3SH3A 5BNPC 1ZNPA 4HBNA 5DAXA 5FZGA 3C7EA 5BNPA 3VKFC 1AR71 1UYZA 1FPN1 4XAAA 5BYNA 3I2KA 4BZ4A 4META 3UV9A 2W0XA 1NXMA 1EUUA 4RQPA 5FP7A 1ZZ9A 1D2SA 2JDNA 4CPBD 1G9CA 1SDWA 4IEUA 4IEWA 1H2MA 3KMHA 4LBNA 1O7FA 1SBDA 3APBA 2W1QA 4TLFA 5GKAC 4A4AA 5A1FA 2D6LX 3I3DA 4NPRA 3NZLA 3ST7A 1X9PA 3AJYA 4FPOB 3K75B 5FZFA 2XONA 3MEJA 1TG7A 3EMRA 1QJEA 1YRZA 2B9VA 4V1PA 4AG4A 1Z7S1 1PRVA 2R041 5K4LA 2G9FA 1G9DA 4AVVA 4UFKA 2VQUA 4L2NA 3SCGA 1AR81 4QPIA 5E88A 2QTWB 3OCPA 4QDSA 5JCTA 4QPIC 3POJA 2VW1A 1APNA 2B8MA 4PBPA 4YVWC 4CDQA 3WNMA 4IETA 5CZKA 2BQPA 2J1AA 4L99A 1WCKA 2Y8KA 1X7NA 1YLLA 4MH0E 4XACA 4NWWA 5FZOB 4CEWA 4LITA 4NO4A 4WVVA 1X82A 5LWBA 3VV1A 4F8DA 5BY5A 1RUI1 4LJHA 1LGNA 2PUEA 3C7OA 3H8XA 4E4ZA 1A3KA 3IWZA 3I2IA 3OBZA 4JKKA 4WZCA 4UFJA 1QJY1 2YC2A 3EO6A 4X6RB 1AR72 2Z79A 3IB3A 4ZZ8A 1QQP3 4MSVA 4A44A 1YI7A 2ADDA 5CFCC 1RMU2 4OMCA 2M4HA 4YW6A 2VW0A 3K4AA 1UZZA 2PHRA 4YARA 2J7UA 1T6BX 3MICA 4NAMA 2LLWA 2EXKA 4HSLA 1B35A 4YZ4A 1Q8QA 3VBFB 4LXLA 2AXZA 4XVHA 2QQJA 5JI7A 2XCJA 1QXRA 5I93A 3WINE 3NXHA 2VZ1A 5EPAA 1ZRCA 4LHLA 2PXPA 2Y60A 1LR5A 4GAZA 4YGEA 5CIRA 4K8RB 5LA9A 4EN0A 4MGSA 1LCLA 1CIWA 5FY4A 3U37A 3TEXA 2DVGA 4W6WA 3LDKA 2DTWA 1RYYA 2A71A 1QH7A 4A6SA 4HG6B 3PUHA 4HPKA 1CX1A 3FE5A 3RZHA 2WFF1 4V2WA 3O7OA 4CP0A 4KNCA 2ARXA 3DPRC 3PU3A 4GJYA 5FZDA 5I0SA 2DUOA 1QJFA 1UYPA 3PIGA 4JHTA 4MGZE 2V72A 4Q0UA 3RYKA 4N8MA 3JD73 1PO21 3VKLA 1BMV2 1JODA 1FOD1 1LEMA 4UOJA 3KSCA 1XNCA 4UFLA 3WCSA 4YVSA 5FZEA 1HRV3 3GCXA 1Y9GA 2PQSA 5DUVA 2YROA 3ZN6A 3ZXLA 1IG0A 1ZA7A 2RM23 1MQTB 1U5YA 4DS0A 4EWDA 3D1NI 5C70A 5FTTC 4ATEA 2DYCA 3WQ0A 1WBLA 3C7FA 1RUG3 4XDQA 3RZLA 4Q27A 1PNRA 4XTPA 2FHRA 2IVGA 1LCCA 1W9TA 3POYA 5FZ6A 3T0BA 2DTYA 2OT7A 1QNWA 4GH4A 4XYXA 3BS3A 1QDCA 2JG8B 3IAQA 4HT1T 4IV3B 2DBIA 3VZLA 3AKPA 5GZCA 1V6MA 3EUSA 1XYPA 2WQ8A 4EV0A 4GMP0 1W9FA 4QHBA 5AFEA 1LB2A 2PXDA 3MIDA 3Q8EA 4XIKA 1DQ0A 2O49A 2JECA 4H55A 3BCWA 4CCDA 2WUSR 2EVXA 3Q8CA 5JXIA 3BALA 3T2PA 5A1LA 1U5IA 3OQNA 1JU4A 2LYPA 1RUE1 3ZFGC 3V0BA 4AFCA 5FAXA 3MDPA 3WDWA 4JVAA 1DFQA 4FOWA 3GBFA 4B8EA 4XMIA 1V9U1 1OBNA 5CISA 3VBOB 1Q43A 3MW2A 1PO11 4C8DA 3S30A 4CU8A 5K98B 4PDWA 3HAGA 3VBHC 2CDPA 1W2NA 3CZUA 4YPJA 3WG2A 4D7SA 3VBHA 2QBXA 1WZXA 3DF0A 2RDSA 3V56A 1J83A 3A7QA 4FXGB 5LA0A 1Q5OA 2BVBA 4LORA 3O0WA 1UN1A 5DXDA 3KV4A 4KGQA 4N43A 5LATA 1JOBA 3MW4A 4Q2JA 3MLFA 5A7WA 1VRH2 3W5MA 3VBSC 4BB3A 3B69A 2Y64A 4E27A 4EROA 4HKLA 4YG6A 5FZIA 3DKWA 1F15A 4XUTA 2VZUA 2YPDA 5BNOC 1ULPA 4XE9A 4Y1XA 5F39A 3WY6A 1K5MC 4M3CE 1XJAA 1BDIA 2WNVC 5D2AA 1BEV3 1J1TA 1K5MA 3RS6A 5EXOA 1MZ5A 4JKLA 2E9QA 3RZGA 1UIJA 4KBZA 2H6CA 1DULA 2TNFA 5DN2A 3RI9A 1OQEA 1UTXA 4PI0A 1MZEA 4XJWA 2PYTA 2RMU1 1IPSA 1RHI3 5FZOA 5C8CB 3OKZA 4OZXA 3AMNA 5IHRA 1QY4A 4CCOA 4UW4A 4X4BA 3ZHIA 1BLZA 1JFSA
chains in the Genus database with same CATH topology
1V6LA 3ZXJA 1PHMA 4YRDA 1WIZA 4XZPA 3THTA 3V0AB 4FPLA 5FMOL 4AI0A 1NYWA 3LCPA 4WVZA 3U0ZA 5DZGA 2YUEA 1BXHA 2HJIA 4FP2A 3CJIC 5CFDA 1GFF2 4OUMA 2XJSA 1UXDA 1PIV1 4Z58A 3IKWA 2OR1L 2V09A 1VIWB 3BOPA 2I2SA 2D6OX 5I8YA 2A3WA 1IC8A 3U07A 4HL0A 1SBFA 1ZS4A 1ZBA2 3ELNA 1FV2A 1RJ8A 4Y1YA 3VBUB 1NE6A 1SFNA 2ILMA 3NAPC 1MZ6A 1EV12 2WT1A 1WH8A 3FUOA 3IVPA 2LYRA 4M3CA 4NHKA 3DPRB 4XQWA 4AGRA 4QXKA 1T6GC 3B5LB 1TNRA 1JYIA 4AQTA 3ZFEA 3VHNA 4L92A 2KZ8A 4E4DX 1H2KA 1O3RA 4BIFA 5F5QA 1R081 3N7MA 4AI3A 4MGYE 1OQ1A 2F4PA 2HEYF 4COVA 3TBDA 3ZYGA 3ES1A 4IEZA 1AX0A 3CNAA 4XBQA 3NJZA 2WQZC 5DUUA 5A33B 2CL2A 2GZUA 1WLTA 4B29A 4GMP1 1QJZA 5I0UA 5T3NA 4B3NA 1RHI2 3ZYJB 4Q4Y3 1RUI2 1YYNA 3KM5A 1JWLA 3AMQA 4AHXA 2F6BA 2UY9A 2EIGA 1A8MA 2JCGA 2BFUL 2QUOA 4COZA 4FBFA 4KH9A 4CDWB 4ZXKA 3WW4A 2ARBA 2DU0A 2WS92 4IV3C 4A7KA 4FVVA 4B7KA 1D4M1 1JN2P 3VZOA 3FJSA 1ASJ2 3ILNA 4UW3A 1ENQA 4N53C 4YFZA 4YM2A 3GBWA 2TUNA 1JH5A 1AR82 4MXWB 4K40A 4C0BA 1D0HA 2WZPP 1GKBA 4XQDA 1DHKB 2RR12 4AHWA 1MACA 2IWGB 1J3RA 2XLAA 4R8HA 1QNYA 4P9YA 2RMU3 5JSPA 4IERA 4URTA 2HWC3 3L2YA 3LZZA 4PCRA 3IPVA 1COV2 3BTAA 2CGPA 3S6PA 4JC1A 1NCRB 3EXUA 4A7ZA 2PELA 1Y7YA 3I59A 4N7UA 4XFFA 4C1WA 3L2HA 2D97A 1RJ7A 4KBBA 2KEIA 2ATFA 1XNDA 3ZIXA 3V64A 2R1BA 3C2UA 1OI6A 4GKXA 3WP4A 3JQWA 1I5ZA 5JZGB 5GZFA 4FN3A 2Z2SB 4AVAA 3A0NA 2ZS6B 1RUF2 4M00A 2D93A 2JG8C 2ZGOA 1QJY3 5L73A 3FLTA 2W52A 2ZTNA 4IVZA 4MYEA 5GZDA 1RUI3 4DRVA 5JMCA 2PLV3 4P9LA 5HCBA 5F1RA 2BUKA 2D6KA 2R062 4PJYA 1ND3C 1WD3A 2WKKA 1UX6A 2VOXA 2BGCA 1ND3A 4IEOA 2PHUA 1WUVA 2D7FA 3ILFA 4ISQA 1XU1A 2HWE2 1IKPA 4AI1A 1QJU3 4QGMA 4IQPA 2ZGQA 1MS0A 1C8M1 2GMEA 1H0BA 5EWSA 2C0ZA 4ASLA 1JFTA 1D0GA 2JX9A 3ZSMA 1NCQB 1S0DA 4EN9B 1AR83 4YW2A 5CG9A 2FZ2A 2XWBB 3VZJA 4GULA 2A6WA 1WW5A 2PHFA 2E63A 3B93A 1LHVA 1V6JA 2CGOA 4NOTA 3M1HA 4G4FA 1ND3B 3ENRA 1H2NA 1HXS2 2UYBA 1KJLA 1HQWA 4AWDA 2XJRA 4OB4A 4DFSA 1EAH1 4EN8B 1BDHA 1AL22 4E2GA 3M3IA 1MS1A 3UKTA 1MS9A 3OBTA 2D44A 3AFGA 2XJUA 4QQLA 1BMV1 2ZZJA 5SV8A 3FWEA 1BBT2 1QDOA 2ZX2A 1C3HA 2EA7A 1FOD3 5GM0A 5IT6A 1OSLA 1W0OA 2X5IC 1AR93 3LA7A 3AYCA 1VBE3 4YG3A 2YGLA 2ZPXA 5IK8A 2ET1A 4D7YA 2VVEA 5BV6A 4Z5CA 3E5UA 5L7OC 3D4KA 3TN93 5C4WB 5L36A 2VY0A 1J3QA 5BNNA 2AUWA 3ZYRA 3MEPA 4GXLA 4CDUB 4GQMA 5BXXA 3SH4A 4ES8A 2XL9A 1HRI2 3WW2A 5J37A 2DVAA 3TRSB 5E8AA 3AP6A 3H8UA 1RUJ2 2A3XA 1BVP1 1HQLA 4OHZA 3VBHB 4P9JA 2XJTA 1BEV1 1RB8G 4Q0SA 1BBT1 1BJQA 4JGYA 4HETA 4PDWB 3S0MA 4WBBA 1BEV2 1MQTC 2WZR2 2CWMA 2XGXA 3BOWA 2QZ3A 2UWAA 5AFBA 5JOXA 1OFSA 1QQP1 2ZA9A 4AYUA 3CLCA 1DYKA 3ECQA 2DCZA 5K7PA 1MVQA 3HT1A 1UPIA 1WBFA 1Q8PA 1XXNA 4Y1UA 3ZMOA 2QCSB 1HXS3 1O5UA 1VAKA 3WHUA 4AHZA 5JPMB 4Z92B 3VBFA 5JIAA 1IS6A 2D5HA 1OLQA 4Q4W1 3SMHA 4LT5A 2OVUA 5IK5A 5IK7A 1OPOA 1FNZA 4S2HA 1TQ5A 3ZHMA 3FFZA 4HZFA 5H9QA 5KXDA 1VBE1 4KU7A 1WLCA 1NY71 1UPSA 2BNOA 1OFNA 2PE5A 4EN6B 2A5ZA 2WNUC 4FTSA 2JG9B 3MYXA 1LOGA 3TYJA 4FTBA 2WNUA 4Q4W3 3IT8A 4AFDA 3O5SA 2VQAA 1UU4A 3O12A 2YZ4A 1NZCA 4Z1VA 1ZREA 4I0AA 2B5HA 2XVGA 3N3HA 4AW7A 1WW7A 5KC5A 2XIUA 1VBA3 4JGZA 4SBVA 2EXIA 3EQEA 2GC3A 3K48A 3TB0A 4X8PA 2PUDA 1DGWX 4RS5B 5FOJB 3SHRA 3CU7A 1RUC1 4I0WB 4N9IA 5FRAA 2BJCA 5K9YA 1AR63 2SBAA 1R69A 3VBRA 1G86A 4YYOA 3KB5A 4YZ3A 1REFA 3ZVXA 1FI2A 1OSGA 1VBD2 4QPGC 4XXAA 3E6DA 2XJVA 2KM2A 2RS32 1LOCA 4Q4Y2 5T54A 3I8TA 3KJXA 5I8SA 4HSJA 3WP6A 2QQPA 3LOBA 4K8FA 1NQJA 2GC2A 1D2QA 2AUYA 3WDUA 4JGYB 5FOBB 3ZN4A 1CJDA 5C9AB 2PUCA 1B0NA 3MIBA 3MLKA 4LLOA 3RPQA 2ZGRA 2EXJA 2OW4A 1DQ6A 1WMDA 4FPGA 1JYCA 4LBOA 4AI2A 1GQGA 4WVWA 4OFGA 1CAVA 1DGWA 2GNDA 1NERA 3G5GA 2VOWA 4YGBA 3H7JA 4HVRA 5C9AC 3LSDA 5L7OB 4RQPC 1OLRA 1IKQA 1HKDA 4PBOA 3GZUC 2C1FA 2MNGA 1QP7A 3H9AA 2R071 1PNGA 2D5FA 3KZ4C 5C8CA 1ZRDA 5HBAA 4AHYA 3E6CC 5C8CC 2XBO3 1HF0A 2ZACA 3FZ3A 1D4M2 4ATFA 3M2MA 3OMTA 4CP1A 4PU7A 4K6BA 2WIUB 2HWB3 2TEPA 5FBZA 1QOSA 2R043 1IQAA 4YG7B 1QJX2 2R073 1RUF3 1GV9A 2GDFA 1GYKA 2D6MA 2MEV3 4LR4A 4QQPA 3AKSA 2XB6C 4QQHA 1C5IA 4YW3A 3R4DB 1R091 4IEYA 4R52A 4DMIA 3Q9OA 1V9U2 4RHV3 3NKTA 4GMP3 1SLCA 4JQRA 4I8TA 3SH5A 4Q4X2 4Q2FA 5BNNB 5I8TA 2B7YA 3AK0A 3GF6A 4A2UA 1IPJA 3FBYA 4LBQA 2YGMA 4B4QA 4CDWC 2RS11 3VBSB 5CFCA 1RUC3 4S2DA 1HIXA 4JGYC 3U3WA 2XLFA 1LECA 2N7GA 5DDJ1 3VN4A 4COUA 1S0EA 1PZ9A 4OVEA 4Z5HA 3UK9A 3MIGA 1LU1A 3AP9A 4W6XA 2UU8A 2RE9A 3L1PA 3HWJA 3HQXA 5E89A 3WG3A 1HX6A 1FAYA 4OI2A 1ZZ7A 4RHV1 2ERFA 1MS4A 5FPXA 2LYLA 4Y20B 2P3JA 3LAGA 3M3QA 4KG0A 3OJBA 4K21A 4UBHA 3KZ3A 4MCTA 2YHJA 1GICA 4RS5A 1F31A 1TEIA 1PRAA 3JXDL 2CYFA 1DGRA 1PVXA 2DF7A 2FMYA 3VBFC 3I59B 4RS5C 1RPEL 1URXA 5AC93 1PM7A 4H7MA 5DUXA 2VVDA 3O0VA 4I3GA 4FOQA 3MF6A 3KCXA 2XKPA 4B4RA 1Q8OA 1KFUL 2VQ0A 2VUJA 2OUHA 3QQ6A 3ZFEB 5T5JA 1IS5A 1F5JA 1W6PB 3QD6A 5DG2A 4C1XA 2CV6A 2YMZA 1AL21 1ULCA 1H8TB 2NMNA 3NV4A 2CWSA 3IDCB 1QHDA 4BIOA 2WSVA 1C1FA 5GLTA 2XJ3A 2LCVA 2R32A 1NA1A 4JTOA 3HN1A 2OIIA 5DDJ2 4FT8A 2SLIA 1TE1B 1ZBE1 1NA1C 4YG4A 1DQ1A 1RUH2 4JCXA 4CEWB 2D6PA 3JCIA 3POWA 1H9PA 1GQHA 2IFRA 4MUVA 4OULA 4BOWA 4YW4A 5JDBA 4NWVA 1OPMA 4NR1A 3R1FA 1RIOA 3G6JB 3ZFGA 1AXZA 1O4TA 4AVTA 5K8SA 1D4VB 2B42B 2ZMKA 3WV6A 2BYVE 4QM9A 3ZX7A 4PLMA 2XL7A 3VKOA 5J96B 2GALA 1X8MA 1CN1A 1KRIA 3TN91 4IWRA 4LHNA 1NE4A 1WMEA 4K1ZA 3B7HA 3ZXGA 4RA0A 1G9BA 1V6KA 1NXD1 3OBRA 2HINA 1WETA 4CEYB 5CAZA 5JR7B 4EN7B 3R6SA 3FLRA 1XYOA 1GZ9A 1RUE2 2XBO1 4BE3A 5C33A 1VBC3 4MLOA 1LQCA 4JCKA 4XW3A 3PNAA 4JQDA 1FV3A 1ZYBA 2NZ9A 4LA3A 1RVF1 1ND2A 2Q0AA 2LUWA 3POSA 5F9TA 3M3EA 1RUH1 3NWKA 4E4SA 3ZXAC 2GC0A 2KXLA 5C9AA 1QOTA 3NAPB 4B7EA 3CJXA 1HXS1 4YBAA 3OY8B 4RR3B 4CRQA 5KXBA 2QVSB 4JDNA 4KWJA 4FBIA 1NCRC 1CAUA 4ZKTB 3ILRA 4L9BA 4LBKA 3WP3A 3N35A 3NV3A 1OOPC 4A7YA 5JZGA 3D0JA 5GALA 3WUDA 2Q30A 2PLV1 3KT4A 1O91A 1KS4A 4Q4Y1 1O4XA 5FQ0B 3AFKA 4GA9A 3SISA 4CEWC 1VPWA 5GLVA 1PGL2 1ZZCA 1MEC1 4JDMA 5DZEA 3PJQA 3EBRA 3RYRA 1XQNA 3GZTB 1UL9A 3WZ1A 1RITA 4J1WA 1O3SA 5C4WA 3M3OA 3NAPA 4N53B 2W08A 1NQDA 1CJPA 1RIRA 1R083 3NW4A 5C4WC 2R30A 2XWJB 2HKXA 3USUB 1UU6A 2DVDA 4DINB 3UJOA 4YZ1A 2KEKA 2B9UA 3WR0A 3PMEA 2ZX0A 5KWRA 2D3SA 3ZFEC 5GLZA 3F6WA 4PU8A 3S7IA 1LOEA 4BLIA 5C6CA 4AEDA 5JPNB 4GB33 4L11A 2XKOA 1BZWA 3VBOA 5FO8B 2BPA2 2GH2A 1BK1A 1KQRA 4GWMA 1G6NA 1VBB1 2ZX4A 1QQAA 1OA4A 1X36A 1ZBA1 3B00A 4OHYA 4FPEA 1MEC2 2AENA 3SXWA 4A3XA 1LU2A 3WD5A 1AYM1 3VZKA 5JAXA 4YFWA 4Z5DA 4JV4A 5F6LB 1AYN2 3MLLA 3OQOA 3HBZA 2RM21 1F8VA 3TNPB 2Q8OA 1C5HA 5CB7A 3ZFFB 3JBG1 3J26N 3H3UA 3USUA 3QBQA 3R05A 1YUDA 4BMEA 4RR3C 5A7LA 4LBQD 5A33A