3SCHA

Co(ii)-hppe with r-hpp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
194
structure length
194
Chain Sequence
KTASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of regiospecificity of a mononuclear iron enzyme in antibiotic fosfomycin biosynthesis.
pubmed doi rcsb
source organism Streptomyces wedmorensis
molecule tags Metal binding protein
molecule keywords Epoxidase
total genus 42
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature ec 1.11.1.23: (S)-2-hydroxypropylphosphonic acid epoxidase.
pdb deposition date 2011-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3schA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3schA02
4MCTA 2DCTA 2XHKA 1OCTC 4NDWA 2B5HA 5KBFA 3I7DA 4YRDA 5I91A 3QQ6A 4I0BA 2IVQA 4IEYA 5FQ0A 1WIZA 2QJVA 3IIAA 1CJGA 5CADA 5FDBA 2L8NA 1OI6A 5JR7B 1ZZ6A 1YUDA 1PRAA 1X82A 1XRUA 2PAMA 4Q0VA 1L1MA 5FQ0B 5C6CA 4X4DA 4P9GA 3DNVB 4XF0A 1O3SA 4X4IA 1ZRRA 3EBRA 2IXJA 4HLTA 5BXXA 4FBFA 1R63A 3JXDL 4KU7A 3M70A 2FJRA 1ZZ8A 4IVZA 3BU7A 5J7MA 4O9GA 2C0ZA 4IEQA 4ZU5A 3GBFA 5I8SA 4JTOA 1UPIA 3HZIB 4MGZE 4HMZA 3FZ3A 4KL1A 1JFTA 1UTXA 1QXRA 1I5ZA 3D0JA 5J3UA 1ZZ9A 2PUGA 1SFNA 1RUOA 4XF1A 2KEIA 3ZDSA 2LYQA 3BPZA 3CECA 2OA2A 1VR3A 2V09A 4AVBA 4PU7A 2EBYA 3HT2A 4E2QA 2LYJA 4IESA 1ZS4A 4PIYA 2BJCA 4K8FA 2BNOA 3GN5A 2IXHA 2OZJA 4QM8A 3QACA 1RZRD 3TRBA 1EY2A 1ZNPA 2GC3A 2HINA 3MLFA 1CAXB 3FWEA 3NJZA 5I93A 1QP4A 3BALA 3H50A 3QOPA 2PUDA 1DGWA 4UBHA 3EO6A 1G6NA 2XKOA 3RZZA 3E6BA 1QP7A 4JCYA 3S7IA 1Q43A 1UW8A 2PPXA 5A7LA 1I6XA 4YG7B 1JFSA 3BD1A 1L3JA 2OR1L 1XE8A 3TNQA 1NERA 4I09A 5I0SA 4LA2A 1LLIA 4I6UA 4L11A 2IVBA 5D1IA 2O38A 1NE4A 1NEQA 2R63A 5I0RA 2EVXA 4RD7A 1CAUA 1X7NA 4META 3LZZA 2P17A 2PFWA 2XIUA 1OD5A 4Z5HA 1GQHA 2CAUA 2PQQA 5I8YA 3OQOA 4AQ2A 4PU8A 3DKWA 1RUNA 5BY5A 1SQ4A 2EF8A 2AUWA 2GZUA 1SQ8A 4JV4A 3I54A 3KJXA 2QVSB 3H1YA 1H1MA 1YWKA 1PRVA 3M3IA 4HVRA 4E2SA 1V70A 1LCDA 1YSEA 3RYPA 2VECA 2EWTA 4FT8A 2AWIA 2BNNA 4BYYA 1ZUGA 1SEFA 4HBNA 4Z58A 4R8HA 4ZU7A 4N9IA 1LRHA 2O4AA 3FHIB 1Y9QA 3OQNA 3BB6A 3LA7A 3NW4A 1TQ5A 1Y7YA 3IBMA 4X4HA 3RNSA 1PMIA 1WH8A 4GHJA 1EPZA 3IWZA 5F1RA 2Q1ZB 2ICTA 3B02A 4WVZA 2O1QA 1RPEL 5K8SA 2QCSB 5K98B 3I59A 2B9UA 1OSLA 2L49A 1CAXA 2XI8A 4AVAA 2Q4SA 4Q0QA 3LOIA 3NSTA 1UXDA 1X57A 1CAWA 1X8EA 5T3NA 1BDIA 2EA7A 3FFQA 4TLFA 1CGPA 5JSRA 3PLQA 4XFCA 3H3UA 5KHGA 5KHJA 4LEJA 2MQKA 3SCGA 2N7GA 5KHKA 3OF1A 4FAHA 2AW6A 2O49A 3BS3A 1UD1A 1J3QA 2Z2SB 3ST7A 3OTFA 3WW2A 1GT0C 2Z69A 2Q0AA 4KWKA 2PUEA 4QX5A 5E16A 4EWAA 4I6RA 1UIKA 1RZSA 3MPBA 2ETEA 2IV1A 2FQPA 5LEJA 3IVPA 1LB2A 3E5QA 1RIOA 1RC6A 3TNPB 2MNGA 1QY4A 1LQCA 1IC8A 2D40A 4HN1A 4X4CA 2GC0A 3BDNA 4X6QB 1ZREA 3ZHIA 1PRUA 1O5LA 1QWRA 1WA4A 3CL1A 4Q0SA 1DGRA 4QGLA 2B5AA 3S7EA 4HVQA 1NYWA 3EUSA 1WH6A 1IPKA 3LA2A 4OFGA 5BV6A 4GULA 2WC2A 5I0UA 3ELNA 4YG1A 3BCWA 3FYMA 4IEOA 1ZZBA 5C8WA 4YBAA 3L2HA 4IETA 2HJIA 4EWEA 1YFUA 2H8RA 2ET1A 1PNRA 3PXPA 3KGLA 2XJ3A 2OPKA 4X4BA 3ES1A 3EHKA 3H3ZA 4D7SA 2HSGA 1CAVB 3LAGA 3CJXA 1NZCA 2AXUA 4BIFA 4F7ZA 2KPJA 4Q0PA 4Q0UA 4PU3C 5E1RA 3LISA 3R6SA 1VP6A 1DW9A 5FPZA 1J58A 2LCVA 1HF0A 3FMYA 4B29A 4XEZA 4A2UA 1YFWA 3ZHMA 4KU8A 4JQDA 3MZHA 2LYPA 3DN7A 4QXKA 3OP9A 4MCXA 3HIFA 3USSA 4HN0A 3WW3A 4O8BA 3U3WA 3CF6E 3QYXA 2D5FA 2LYLA 2UYAA 3ETQA 3IDCB 2HKXA 4LA3A 3RDIA 3WW4A 2OFYA 3KZ3A 3UFDA 2IXKA 3DL3A 1J59A 4X6RB 3LA3A 1YFXA 4KWJA 1UCXA 1EYBA 2XL7A 4X4FA 1R69A 3ZKCA 3D0SA 4OLLA 4XFGA 5BPXA 2UY8A 4Q29A 2LYSA 2PA7A 4UBGA 2I45A 4AXOA 4J1WA 2ZKLA 4IEZA 4WZCA 5AVPA 4IEPA 3NKTA 1ZX5A 4BHPA 2KXLA 4IEWA 2GAUA 4I02A 2PUFA 4XFBA 4IWRA 2OYZA 4QMAA 4EV0A 3UKNA 1ZRDA 2CGPA 5KHIA 4I2OA 1ZPQA 1OMIA 1FXZA 3FJSA 2O8QA 2D5VA 3WW1A 1CX4A 4XETA 4XFFA 2KZ8A 2LYRA 2IXLA 2VPVA 1FI2A 2MHFA 1WGPA 4J1XA 4MGIE 5LRRA 3NL1A 3U11A 2K0GA 3PNAA 3N4MA 1LR5A 1DWKA 4LUKA 3RPQA 2BGCA 3HQXA 2XCJA 4JVAA 4YNIA 5EZWA 5JAXA 2IU7A 1VJ2A 2Q30A 3H7JA 3F52A 4I0AA 3SCHA 3KCCA 2GH2A 4I6TA 5I8TA 2B8MA 4LUMA 3JXCL 4F8AA 4Z82A 2FMYA 1ZVVA 4YSFA 3F6WA 2PHLA 4X4GA 2AXVA 1WETA 5JSOA 4CYDA 1ZRCA 1WLTA 1PERL 4N9HA 2MEZA 4L2NA 1PM7A 3VK0A 4XFHA 3FX3A 4I8TA 1Y3TA 1DZRA 5CVRA 2BEOA 1O3RA 1ADRA 2IUOA 1QPZA 4MUVA 4XF3A 2ICPA 4I3PA 2QNKA 5I0TA 1NXMA 4LULA 3JZVA 3LFPA 3ES4A 1NE6A 3ACLA 4HVOA 4KWLA 2PAEA 4MZUA 3ROUA 3B7HA 4MGYE 4QGMA 2H6BA 1O3TA 5JSPA 1CAWB 2XGXA 3KXAA 1JH9A 1J3PA 3L1PA 2XL9A 1ZZ7A 4Z07A 4UXAA 1U12A 3G5GA 4AVCA 2PTMA 3KSCA 2PUAA 1O7FA 1RTVA 4I01A 3RYRA 4YYOA 1JUHA 3MYXA 2ZCWA 2E9QA 3H9AA 3OQMA 1QP0A 1QXJA 2XKPA 3JXBC 1LCCA 4EROA 2KEKA 4IERA 3E97A 1LKNA 4HSLA 2CAVA 4IEVA 4Z5DA 2LYKA 5JCTA 2ET7A 4PJYA 4LTAA 1VPWA 1HW5A 2K9ZA 5FLIA 5KHHA 2PHDA 4MH0E 4FBIA 3FYAA 3O9XA 3SMHA 1B0NA 4IA8A 1X8MA 5EFUA 4YG4A 3SHRA 4H7LA 3F51A 4QGNA 3OGJA 4AQ6A 1YLLA 3O14A 3U10A 1O5UA 1J3RA 1E3OC 3H1MA 3GYDA 2CROA 1QQBA 4HSJA 2PYTA 3OCPA 1YHFA 2UYBA 1XWRA 1ZAYA 3H8UA 3UKTA 2BNMA 2D5HA 4MV2A 2PE5A 2XSDC 3SCFA 3LWCA 2VQAA 3E6DA 4F8DA 2XLFA 3CROL 2CSFA 2XLGA 2WFPA 3DV8A 4BH9A 4MGKE 1JWLA 2GC1A 3C3VA 3U0ZA 3CLPA 2D93A 2XLAA 2ATFA 2JCGA 3UKVA 2BYVE 3CLCA 1ZZCA 4OB4A 1CAVA 5FLHA 3S0MA 2QDRA 2PAKA 4X4EA 1BDHA 4GQMA 2R1JL 2IC1A 4ZU4A 3QF3A 3MDPA 3VHRA 4EWDA 4Z59A 1YFYA 4XF4A 1J1LA 1ZRFA 1GQGA 1FT9A 1Q5OA 1OFNA 3D1NI 3E5XA 4IEUA 4LLOA 2KEJA 3PVBB 4HZFA 4FAGA 3E5UA 3SXWA 4D7TA 3H1WA 4XFIA 5HI0A 4O9EA 1EP0A 1S7EA 2AXZA 2WUSR 3EQEA 5J48A 2WIUB 2A6CA 2GZWA 3NVCA 5CU1A 1O3QA 3I59B 3H5TA 4XF9A 5FPXA 2JVLA 4PIXA 2PIJA 4Y42A 1DZTA 1X2LA 1RL3A 2Y0OA 3H7YA 3GN5B 1IPJA 4R52A 4E2GA 4FN3A 2CV6A 2GRMA 3OD0A 2GC2A 4ONUA 4QM9A 3KMHA 3QWGA 4IEXA 2F4PA 1O4TA 1UXCA 2GU9A 3RYKA 3IDBB 2UY9A 2MPFA 4PU4C 3D82A 4JCXA 3EJKA 1CQTA 1Q3EA 4WBBA 2PUBA 1RGSA 2EAAA 2PUCA 5FLJA 1CAUB 2IXIA 1H1IA 4XFAA 3OMTA 4Z5CA 3CO2A 2OZ6A 2H0VA 3E6CC 2IXCA 3KGZA 5BUVA 4DINB 5LRSA 3G7DA 1POUA 1AU7A 3S8QA 1XE7A 2H6CA 4NVPA 4PIZA 1O4XA 5FCCA 4JTNA 1LMB3 4MX3A 1QQAA 3HT1A 3CEWA 3R1FA 1UIJA 3FE5A 4ORFA 5LEKA 4YARA 1EFAA 2GRLA 2IVGA 1ZVFA 1RZRA
chains in the Genus database with same CATH superfamily
4MCTA 1WBLA 1UL9A 4PF5A 2Z5WA 4CDWC 2LS6A 3IPVB 5KBFA 1HB4A 4DQAA 2R041 1A6CA 2Y6HA 2PXUA 1YI9A 3KM5A 4MVTA 5FQ0A 1WIZA 1NLRA 2QJVA 1MEC1 1QIQA 3AX4A 1CJGA 2DVFA 3GZDA 2D6MA 2VCCA 2HFZA 2L8NA 3GZEA 1ULOA 1OA3A 2W95A 1POV0 4H7MA 2L9LA 3U75A 1RUF1 1N1TA 1XU1A 2ZGUA 2R072 2X05A 4YM2A 4OQ8A 5F5IA 1FMD1 1GV9A 5D8AB 1OQEA 2WS92 5FZ6A 3LQCA 5BXXA 1IG0A 2JDHA 4E4ZA 4KU7A 3M70A 3MF6A 4U36A 4AQSA 5AC93 5C4WA 4IVZA 2JDKA 5DZGA 5FP3A 1A34A 2WDBA 2C0ZA 4O9GA 1XYNA 1OHFA 4ZU5A 4LO4B 3WDYA 4LITA 3VDDB 1R091 5JOZA 1IGOA 1BEV1 5DMYA 3LOBA 2JD4A 4BQXA 4JAAA 1SDWA 3AMMA 5HCFA 5C9AB 5IK7A 3D0JA 1SFNA 5ANNA 4AHWA 5A33A 1VRH2 4CEWB 1WCKA 2Y6GA 1U2ZA 4YZ5A 2A7AA 2LYQA 2XB6C 3ZMNA 2FFHA 3CECA 4XE9A 4DRVA 3K4DA 3OPTA 4E2QA 4XACA 4OUEA 1NCQC 2WO1A 4NPMA 2PHRA 4U2AA 4W8JA 4D69A 3J9SA 1CPMA 1VRH3 2OZJA 1RXGA 2WZEA 1F15A 4QM8A 5F32A 4INDA 3GZCA 3TRBA 1RZRD 1WW4A 1ZNPA 3MLFA 2VXRA 2ZAAA 3EB7A 3MLKA 1CAXB 3BALA 3TB0A 1UU4A 1YRZA 3HMYA 4N43B 4Q27A 4YZ3A 4BXSV 3EO6A 4QQHA 2R32A 1G6NA 2XKOA 3IPVA 3RZZA 3NJXA 2G1MA 5E89A 5K0UA 4CCDA 4ZHNA 5B2GB 4XJUA 4YG7B 3BIEA 3GHNA 1WW7A 1R081 1L3JA 2OR1L 1QF3A 2YGMA 4LBKA 3SITA 1D4M1 4NPRA 4JDNA 4HKWA 2JQEA 1NEQA 2JDMA 1GLHA 1ZBA3 2XONA 3M3EA 4XIKA 1GICA 4RD7A 4AVTA 1X7NA 4META 3WNKA 5FZDA 2PFWA 1BEV2 2XDVA 1PVXA 2XIUA 1OD5A 4JRLA 4BCUA 2DFCA 2WJSA 3VN4A 3WHTA 3MLJA 3C7GA 5I8YA 2OKXA 3SISA 4R9AA 3FMGA 4P9JA 4FQ4A 5CFDA 2LW8A 4QT6A 3N9MA 4AEJA 4GH4C 1AR73 1SQ4A 2AUWA 1YO8A 2WS91 3APBA 2RVAA 3KV6A 3CZUA 5LY1A 5FZIA 2F6BA 1BYHA 1SQ8A 2SLIA 1KEXA 3GXUA 3LEKA 5B4NA 3H1YA 4BB3A 1YWKA 4KG0A 3M3IA 4WM8C 5FZMA 4P9YA 4OMDA 5FMDA 3VBOB 1YSEA 1BCXA 4WVVA 4D6QA 3RYPA 1UN1A 5CYYA 3SNMA 4FT8A 4BXFA 4YGBA 5A6ZA 2VQTA 3LQXA 3MV01 1ZUGA 4YW7A 1SEFA 5JOYA 4XTMA 4HBNA 5F3CA 5FYVA 1W8OA 3FHIB 1GBGA 2D6KA 3NW4A 3NMBA 1TQ5A 3AP9A 4PDWA 3OYWB 1I5PA 3UGGA 2VAUA 3CNAA 1BLZA 3ZFEC 5C4WC 1XNAA 4DOUA 3P1IA 3IWZA 5FBZA 2NPIA 4QPGC 2DUPA 3B02A 3CHXA 1YIFA 4UW5A 1COV2 1GUIA 1PIV2 2BDRA 2ZGTA 2L49A 1LHUA 5A6XA 2BFUL 4R4ZA 5GJ6A 3HN1A 4AAXA 1UX6A 5JLVA 3PU3A 3LEGA 1CAWA 3ME5A 4N90A 3GZDC 1BDIA 2EA7A 5T3NA 5JSRA 5DUUA 3RMYA 5KHGA 4GH4A 4LBJA 3VBUA 4JHTA 3ZYPA 3WR0A 1MACA 1SLLA 2MQKA 3B9CA 1GP6A 4RGGA 4QU2A 2BWCA 3OF1A 4JKLA 3BGAA 3VKFC 2QKDA 3HNBM 5A70A 4RQPB 4QDRA 3TBDA 4CDWA 3ZIXA 2ZZQA 4QWNA 3GJBA 5LBBA 3WW2A 2B46X 2Z69A 1L7QA 4LJHA 2PUEA 4OHXA 4QX5A 2WL1A 1UIKA 1CJDA 2WWUA 3MPBA 2WWJA 3AP7A 3WG4A 4PLOA 4CTEA 5GZDA 2FQPA 2DCJA 2WYFA 4PCRA 3U37A 2GH8A 2Y6KA 1RC6A 4NJ4A 1QY4A 4JGZB 3UV9A 4P9IA 1VBA1 5DABA 4AHXA 2FZ1A 4Y5Z0 1O5LA 1GR3A 1SBEA 4QGLA 2RM23 2C9KA 1W9WA 4PF1A 2B5AA 5L9VA 4CCLA 3BTYA 4GXLA 4FPLA 5D21A 2HWD2 4M3CF 5F6KA 1NYWA 4OFGA 5FYCA 1VPHA 2Y33A 3ENRA 1ENXA 5CBLA 3GJAA 4YG1A 1OUSA 5C3RA 4D94A 2V5DA 4IEOA 1BBT1 1RMU1 2ZGLA 3C7EA 2YU2A 4CDUB 5C5TA 3L2HA 2Y0IA 4IETA 1FV3A 4F3JA 2HJIA 4X8NA 4YG0A 2H8RA 2Q8CA 1D2SA 3L9JT 4XUPA 4URTA 2XJ3A 2OPKA 3WV6A 4E4HA 4X4BA 1US3A 3ES1A 4Q4V2 2E7TA 3EHKA 4XC9A 1W2AX 4JC1A 1AL23 1S0DA 5A32B 1K5MC 2D7FA 5LB6A 1SDDB 4C91A 3LAGA 1W8TA 2VZVA 4AFBA 2WS93 2X8KA 5DUVA 1W03A 2VULA 4E9KA 1MZEA 2XUEA 2KPJA 4OZOA 4CEYA 4LT5A 3J7NA 3R6SA 3I2JA 1VP6A 4OMCA 4WVWA 1J58A 4Y26A 4UW6A 2WNVC 4ARYA 4XEZA 1YFWA 1VBD1 2VTXJ 4LNVA 3ZHMA 4XHBA 1OURA 2LYPA 4YZ4A 5FZBA 3OP9A 4MCXA 1IS4A 1QJEA 3HIFA 4HN0A 3AJZA 3USSA 1V6MA 2WA3A 2HWC1 4FPFA 4RGKA 1GNHA 1OPMA 3CF6E 3CJIB 4YG3A 3VV1A 1QMJA 5LA1A 3RZKA 4ER3A 2HKXA 4JQTA 2A6YA 3OY8B 1UXZA 2OFYA 1RUE1 1VMHA 3I97A 4S2GA 3NO8A 1S4CA 1HJGA 3KZ3A 3HPNA 3N9PA 4XQ4A 3DL3A 3JB8A 1AYN1 2GNBA 4X6RB 4B7EA 4Q4Y3 3OGRA 5EIYB 1Q56A 3G6JB 3VL9A 5C3SA 2YYOA 5IVFA 2I74A 4YVWB 3D0SA 2WT0A 1APNA 1KS5A 1MZ5A 2YV8A 4M01A 5ANQA 5IYYA 2NZ9A 1H8TA 4UBGA 5ABJB 2AACA 3DPRC 4XW3A 1W39A 5F2SA 4IEZA 2RS51 1K5MB 4IDZA 3N7MA 5CKMA 1G9FA 4YW2A 1WZXA 5LA2A 2RMU1 1RUG3 4QMAA 1DQ5A 3ZN4A 3JBG2 5A3PA 3U1XA 3O1SA 1HB2A 2K2SA 3M3QA 3MUZ1 1C5HA 3AYCA 5T52A 5EP9A 1SZBA 1JZ4A 5A3OA 2D5VA 1AL22 1VBB1 1MS1A 2W92A 1QKQA 5IVCA 1OT5A 3O12A 5F2WA 4AVVA 4XETA 1SLBA 4MXWA 2IXLA 3LFMA 1HV0A 5FPUA 1XE0A 1RUD2 1WGPA 4MGIE 1LGBA 4N43C 3OBZA 2J1UA 2K0GA 1OF3A 4RS5B 5DQ0A 3ZYRA 1TME1 1BK1A 1DWKA 4XJ8A 3ZXKA 2PELA 5IUQA 5A7OA 1T6GC 3UGFA 4TN7A 2Y64A 1A8MA 2YC4A 1LHOA 3HQXA 4YNIA 3OG2A 5FKCA 5C3PA 3BU0A 2G19A 5KC6A 4I0AA 3SCHA 4B7KA 3KCCA 2GH2A 2O8OA 4EN7B 5IK4A 4QX1A 1S1AA 3V0BA 3JXCL 5A3LA 1J84A 1DQ0A 4Z82A 4OQ9A 5J37A 3JCIA 4N7UA 1UMHA 2YXSA 1YIPA 3LIHA 2JDYA 2AREA 3MGUA 2PHLA 4X4GA 3ZFFA 3NWKA 5SV5A 2AXVA 5JSOA 4AEDC 1WLTA 1WLWA 2WR9A 4N9HA 2VMFA 1PM7A 5KXEA 2JG9B 3FX3A 1Y3TA 4LR4A 2WAAA 2BOJA 2X53S 2IUOA 5FZHA 2WYSA 1LU1A 2VW0A 3I3EA 1RUJ3 4FPHA 4OHZA 4GMP1 1NXMA 4LOSA 2GNDA 3FC0A 1UY0A 3USUB 3NNMA 4MZUA 2LRPA 1AXKA 3B7HA 1LOEA 1CR7A 2H6BA 3OGGA 1PGL2 1FOD3 4XJZA 1RUG1 4Q4X2 1MQTA 5ACA1 5A3WA 1GSLA 3L1PA 2XL9A 2BW8A 2V3CC 2DVAA 3CJIA 4KNCA 4AWDA 2BRTA 2CU5A 3ZN5A 1VMFA 3IM0A 4QB2A 2J1SA 4NOTA 5FO8B 4QQOA 2JG9C 3PUQA 4I01A 2Y38A 3DYPA 4QPGB 1UO9A 1WCSA 2ZX0A 3J26N 2YY1A 4YW5A 1QP0A 4SBVA 1VBB3 2P1BA 2G4IA 1W90A 3VZMA 1AX1A 3T0AA 4AZZA 4NHXA 5F37A 2YUEA 4Q4Y1 4R4XA 2RR13 5LY2A 1GZWA 3WP4A 3ZXJA 4EROA 4MGTA 2KEKA 5DTMA 4W4ZA 4PT6A 5BNOB 2D6OX 2JX9A 5JZGB 1NAEA 2IFWA 3AVSA 2ET7A 3ZO0B 1HW5A 3NV4A 5FLIA 4YLZA 3JUUA 2PHDA 4ZXKA 1LJ7A 4MH0E 5GLVA 3THCA 3FYAA 3O9XA 3VLBB 4ES9A 4EZHA 2Y6LA 4IA8A 4NHKA 5EFUA 1CWPA 4YG4A 1HRV1 4H7LA 3F51A 5FYTA 1UXXX 3MUY1 3OGJA 3TEZA 3KL4A 3MIDA 3DPRB 5FUNA 2ENRA 3NZLA 2Y34A 3I3DA 3O14A 3NNFA 1XSRA 3H1MA 3GYDA 1HQWA 1M4WA 1DIWA 2HEWF 2J1AA 2NN8A 3KCXA 1XWRA 1ZAYA 1W8WA 1BK0A 1D7PM 1S0JA 2VMCA 1NCRA 3NV2A 3A9XA 4MV2A 4H2AA 5FYZA 4Y22A 1I1EA 4RHV1 3NXHA 3ZN6A 5EJ3A 3N9OA 4F8DA 5E6HA 5FY5A 2WFPA 1A8DA 4MGKE 5JR2A 4Y22B 3C3VA 1QQP1 1UY1A 5EHDA 4OZXA 3ZKYA 1NUKA 2XLAA 5L9BA 3TOJA 4LO8A 2ATFA 2JCGA 1STMA 3AMPA 4XJAA 2CWMA 1R1ZA 3GALA 5FTTC 3S0MA 2WO3A 1PO23 1TME2 2OW4A 4FQZA 2RS13 1Y43B 2RV9A 4GQMA 2VOWA 2P37A 3POGA 4FCAA 1TEIA 2DBIA 3OPZA 3MDPA 4YVWC 4ZU4A 2HYKA 1ZM1A 2I07B 2XJVA 3AYAA 3OUJA 4XF4A 1J1LA 3WG2A 3WNPA 3ZPYA 1LEDA 2TBVA 1A3KA 1NCQB 4LLOA 5A3TA 2YFUA 5LK7B 3M3CA 4FAGA 1GWLA 3RSJA 3GCXA 3H1WA 3BOWA 3RS6A 4XFIA 1VBE3 4Y33A 2RS12 2XXAA 4LBLA 1S7EA 2UURA 1OF4A 3TAYA 1NCQA 4AHZA 4CCCA 3O1PA 1Z78A 4Y1YA 2A6CA 4HKOA 5C7GA 2CWSA 2XQRA 4XF9A 4XBLA 1NZIA 4OVEA 5HCBA 2RMU2 5IJRA 4AW7A 1JI6A 4KMQA 2Q8EA 1KD7A 3OD0A 2BTVC 4UFMA 1QXPA 3J7MA 2WNUB 3PIGA 3VBFA 2HWF3 2E53A 4Q26A 2EIEA 3CZJA 4QM9A 4YVWA 4RSUA 1HB1A 3B69A 4IEXA 4IE5A 5T55A 2GU9A 5C4WB 1AUYA 4V2VA 3HR9A 5GLTA 3WP6A 4YVSA 4JCXA 1UU5A 1UYPA 1RGSA 1U5XA 2JKXA 2J1RA 4B3NA 2P3KA 2IXIA 1ASJ1 2VL4A 1QH7A 2VCBA 2VUDA 3LSDA 5FZAA 4FVVA 4ET7A 4FI9A 3QFIA 1KFXL 2VNGA 5BUVA 2RS31 3POJA 5C8CC 4ISRA 4BQ5A 1AU7A 1V6IA 1XE7A 4PBOA 4XJWA 3SEPA 3NQHA 1FMD2 5A7NA 3KS7A 2EALA 1AL0G 4PIZA 5FCCA 2CGOA 3W5NA 4NIAA 3OBRA 1GP5A 3SH4A 1V6OA 1ACCA 3IAQA 4DXRA 5LEKA 3VBOC 5EJ1B 4YARA 1YQ8A 4IQPA 4OUMA 1ZVFA 3VDCA 5DUXA 1TME3 5F8PA 1EFAA 3I2DA 4FOWA 5I91A 4FTSA 4H14A 1RZRA 1KDKA 2XHKA 1OCTC 4GKYA 2WNEA 2YFZA 3KHBA 3PUIA 1SACA 2XHNA 3I7DA 3WZ1A 3AYDA 1DYKA 2AC1A 2DBNA 4M3CA 1HXS2 2ZEYA 5JXIA 3VB9A 1JUIA 5FJKA 3IIAA 3LDBA 4MXVA 1OI6A 2JG8A 3PURA 4XBNA 3EXUA 4GKXA 4Q4W1 5JR7B 2A3WA 3VBRC 1X82A 3ZFFB 1XRUA 5FQ0B 5T54A 4BWOA 3A0KA 4LKSA 1F2NA 3FLRA 4Y1VA 4P9GA 1LODA 3V65A 4Y20A 4IL7A 1ZBA2 4LBQA 2WNUA 4X4IA 3EBRA 4HLTA 3S57A 1QHDA 2TUNA 2Q1MA 3N7LA 1F9KA 2FJRA 3ZMOA 2OUJA 1DU3D 1RHI3 4R9BA 4FOYA 3A0NA 3BU7A 1TE1B 2J1VA 2VGDA 2ZGOA 3I2IA 5FY8A 1D4M3 1V6NA 2PXDA 5I8SA 4JTOA 4WM7C 2W94A 3HZIB 2VO5A 4HMZA 4P9WA 2ARCA 1ND3B 3Q9OA 1CX1A 1W6MB 4CCMA 1JZ5A 4P00B 5IAVA 1ZBE2 4WZFA 1UTXA 2MEV2 1WWYA 2ZTNA 2B45X 5CB7A 2VJXA 5DZFA 5J3UA 1ZZ9A 2PUGA 1VBC2 5A6QA 3N35A 2RR12 1BQPA 4HXCA 5T50A 3ZDSA 2ZOEB 4PI0A 1HRI3 5EQUA 3WUCA 3AMHA 4CXXA 1VR3A 2V09A 3WG3A 1LOAA 1QJY2 1MS0A 4OULA 3MIFA 3U4XA 4AGVA 1W8HA 2W68A 2LYJA 5IVJA 2BNOA 3W9AA 2VY0A 2IXHA 1XOYA 2QQIA 2VZSA 5FY0A 3POIA 1W6OB 2GC3A 2HINA 4AGGA 1W2OA 2R16A 5I93A 1MS3A 1QP4A 4A7KA 3H50A 1DLLA 3PUSA 3MW3A 1DGWA 3D5OA 2VZ3A 1PX3A 1QGLA 5DDJ2 1AYM2 3E6BA 1QP7A 3S7IA 5A7LA 2ZAHA 1BJQA 2YBSA 4Y1UA 4EN8B 1JYIA 2ZPXA 1XE8A 3BD1A 2E6VA 4W6YA 3TNQA 4HG6B 3T30A 3R4SA 4FFFA 5J96B 1AZDA 4L11A 2IVBA 2O38A 4ISQA 4N53A 2LLWA 3D4KA 4RQPA 1JZ3A 2PXQA 3VD5A 3ZYJB 3GF6A 1RUG2 3ZKUA 2BOIA 2XJUA 3KT1A 2DFBA 4OI0A 2WFF1 5BNOC 2ADDA 2X29A 1H2NA 2CNAA 3K51A 1DF0A 2Y8KA 1GQHA 4K20A 3AFGA 3P5BA 5IVEA 4IE0A 2ZS6B 2PXJA 5FZGA 4AQ2A 2JENA 2R0HA 5D8AA 4DY5A 3DKWA 3RZLA 1RUNA 1C57A 1JOJA 4LO6B 3ZYGA 4CUBA 2PHUA 2W2IA 3NRUA 4XMAA 4JGZC 4YFWA 3T08A 4LORA 2YROA 2RM21 1FOD1 2GZUA 3VUOA 3I8TA 1WMDA 3B93A 3RJRA 2DUOA 3LF7A 5A3UA 2R49A 4FPJA 1B35A 2ZXQA 2ZBJA 1VAKA 1PK6B 3SH5A 3A9ZA 1OH4A 5F6LB 3AC0A 3J7HA 1R093 4HVRA 4IV1C 1H4GA 3UL2A 1V70A 3WSOA 4NIGA 1H30A 2YG0A 2XVGA 1UMZA 1VBC3 2VECA 4QX2A 1BKZA 2BU9A 1LNSA 2YGLA 3DPRA 2BNNA 2XJTA 4BK5A 1GQPA 1JOBA 1DQ4A 2FDHA 3LEMA 3JQWA 4R8HA 4S2FA 1SFYA 4Q8KA 1GZCA 1W9SA 1LRHA 4FPKA 2UWCA 1R64A 3LA7A 3A23A 4KI5M 1N1YA 2QQJA 1C8M3 2ZACA 4OHWA 5F5CA 4CU8A 4IV3A 1OLMA 2BJSA 4LPLA 4JQRA 3AKSA 4YGDA 1V00A 5F1RA 2Q1ZB 3T2PA 2ICTA 2BP6A 5T5LA 4WVZA 4NIHA 4LHNA 3KV4A 3QOXA 5K8SA 1RUH3 2QCSB 5DPNA 3I59A 3R4DB 3PMSA 5IAXA 1CAXA 2XI8A 3RG0A 4OHYA 2HWC2 2A5ZA 3ZFGC 2WBKA 2Q4SA 4CEYB 3IKWA 4CEYC 4L9BA 2P34A 1PVC3 1X57A 2JD9A 1FOD2 1X8EA 1VBD2 5FYSA 4CSWA 3FFQA 3DCQA 4TLFA 3H3UA 1H9PA 4KG8A 5JI9A 1IKQA 3SCGA 2N7GA 4FPCA 2XVKA 1ST8A 3ME2A 3PVNA 1PNGA 1N1VA 4CEWA 5A33B 5JMOA 1J3QA 1LOFA 1ND3C 3OGSA 1WLDA 1GT0C 4DFSA 2Q0AA 3H8RA 4IGOA 5JZGA 1G9CA 2QTWB 4I6RA 1U5ZA 4AR2A 1RZSA 4DMIA 5A7PA 1HJFA 2Y6FA 4H3WA 3VKMA 3A7QA 5CG8A 5LEJA 3IVPA 1E5HA 4QHZA 3ZVXA 3E5QA 5LWBA 1W04A 3BVCA 2NP0A 4CP1A 5LBCA 1W9TA 2MNGA 2D40A 4HN1A 5FXVA 5AVAA 4FFGA 1ZREA 3BDNA 1V6KA 4N8MA 3ZHIA 1AJOA 4FPYA 1QWRA 2VMEA 5CZKA 2JE7A 5FYMA 5EXOA 4NHLA 2WN3A 3POBA 4QKBA 3S7EA 3EYPA 5M0TA 3A9YA 4GULA 2OPWA 3Q8EA 3SEEA 5J1XA 1XJAA 1DGLA 1RUF2 5C8WA 4YBAA 2VTXA 3RZGA 1IHMA 3H8XA 5FMOS 1AR82 2B9VA 1AR81 1WCDJ 2R7EB 2WFF3 4IV3B 2BV4A 4P9XA 1JZ6A 2W87A 5GAHi 4UFHA 4YW3A 4RR3A 5H9RA 3RJ2X 1POV1 1H2MA 4QXBA 3H3ZA 4D7SA 2HSGA 5ABJC 3MV11 4Q4W3 1Y4WA 2HBTA 5L7OC 1EUTA 3ILRA 4TSVA 1VMJA 4RHV2 4XDQA 1Q8PA 3K4ZA 2BPA2 4ARXA 4COZA 4QD2A 3TELA 2R073 1FAYA 4Q0UA 3FUQA 5E1RA 3LISA 2IVJA 5HXVA 3I3MA 1HF0A 2HLEA 2A3YA 2YZ4A 5FYIA 1BMV2 1ULPA 1Z7S1 4JQDA 4KU8A 3KZ4C 3MZHA 1PO11 2PHTA 3WW3A 3VHPA 1YJKA 5FREA 3ZXGA 1H1AA 4RFRB 4GD4A 1XNBA 1NT0A 4XDPA 2D5FA 2UYAA 3WY6A 3IDCB 4K1YA 3TEYA 4LA3A 2DCKA 1RINA 5KXCA 2FDIA 5C9AC 1GNYA 2ZHLA 1W2TA 1HX6A 1PO22 1MFQC 1IKPA 4QPGA 4XUOA 1VRBA 1W8NA 2PXEA 5I0DA 1YFXA 1RIRA 2XL7A 4G3YC 2VBDA 4GWMA 1VAMA 4CCJA 5FP7A 5C71A 1E57A 2UY8A 2X5IA 2LYSA 2PA7A 1PX4A 3TEWA 1RUC2 4GMP3 1OVSA 4AXOA 5AVPA 2ZKLA 1Z7S2 5JI7A 3NKTA 1ZX5A 1EV12 1WW5A 2KXLA 1F31A 2GAUA 2QQMA 2PUFA 4IEWA 3TEXA 1OQ1A 4JGYA 2CL2A 4XCAA 4IWRA 4LHKA 2OYZA 1ZRDA 2CGPA 1JYNA 1PNFA 2GMMA 1DP0A 5KHIA 2FDFA 3VZLA 4XUNA 5FPLA 4DB5A 1BBT3 1RMU3 1OMIA 1FXZA 1SLTA 4IGPA 4YW4A 1CPNA 4CDWB 4UW4A 2AH2A 2EXJA 4Y4RA 2O14A 4B4QA 3AP5A 3HWJA 4ES8A 1W99A 5FOBB 1V6JA 4DNYA 2KZ8A 4GB32 2HEYF 1GNZA 2PHXA 3WDTA 2NMNA 1JH5A 5K7PA 4J1XA 2B4KA 5GLWA 3ZSEA 1SPPA 2WAOA 3U11A 2SBAA 3LE0A 1C4RA 3VKOA 1ZA7A 4SLIA 4CUGA 1H6XA 2ZEZA 3RPQA 4Q1PA 2VZ1A 2XBO3 4D6SA 4P9LA 1WA6X 5FZKA 3W59A 2XCJA 5EZWA 2IU7A 3POWA 1IG3A 2Q30A 1SFPA 2YMZA 1QJY3 2ARXA 4DUWA 1GWMA 1H8VA 3WDXA 4B1LA 4Z2AA 1JW6A 2BBAA 1CZTA 2RS53 5BNPB 5GLUA 1UYYA 2FMYA 5A7QA 1UYXA 2DWRA 5FZLA 3LB9A 2RDNA 4GWJA 3D3AA 4FTBA 1CIWA 3H8OA 3CDZB 1W0PA 4CYDA 1VBE1 2L1PA 1JMUB 1AF9A 2XJSA 2VMIA 4AK3A 2ZEXA 4XFHA 2Z42A 4I8TA 5IK5A 1QPZA 2QUOA 1LESA 4J25A 4MUVA 4XF3A 5A32A 5HV0A 1RHI1 5I0TA 4W65A 5A80A 2JDNA 3WNMA 1JODA 2BERA 2OX0A 4Q4W2 4KBZA 1C1FA 3ES4A 3ACLA 1X50A 1O8SA 1ULFA 1W3XA 3ZM8A 2HBUA 4AEDA 5DDJ3 4QGMA 1VBD3 4DE9A 4IE7A 3A22A 2E26A 4QPIB 4E27A 5JSPA 1PO21 4CXYA 4DO0A 1XC6A 2XWJB 4UXAA 5DXDA 1U12A 2D97A 1D2QA 2WIIB 2YC2A 1W9YA 1HRI1 3M9LA 1RUE3 1W0OA 2DF7A 4GH4B 1R082 4K7JA 4Y24A 2V73A 1COV3 2V5YA 2PUAA 4D8MA 1O7FA 1RTVA 3DYMA 3M2MA 5H9PA 4P5HA 2Y6JA 2ZCWA 1PO12 3A21A 4F83A 2E9QA 4KWUA 4XYXA 4XUTA 3SKJE 5DZEA 2ZGMA 4COUA 1QXJA 1SPPB 3VBHA 4WM7A 1XBFA 3JXBC 3SKVA 4KH9A 3VZOA 4ER6A 1QOSA 1UY2A 3O7OA 1NKGA 4Q5OA 3VZKA 4HPKA 5GZGA 5CG9A 5DTRA 2A6VA 2QFEA 3J8F1 1AR71 1Z0HA 2GDFA 3I2KA 4BQ4A 1QZXA 1E5SA 1LKNA 1MR5A 2CAVA 4HSLA 1C3HA 4IEVA 4N43A 4UYBA 2IFRA 5FAXA 5JCTA 4LTAA 4MG2A 2ZHMA 5GM0A 5A6YA 3AL5A 3N9LA 3ZLIA 1RVF1 4FBIA 2A6WA 1QJFA 1C28A 1X8MA 1KXGA 2FMDA 2JECA 3U4SA 1VBB2 1O5UA 3DUIA 4GWNA 3KQRA 3KF3A 4QXHA 5GZEA 2XJRA 5J98B 3OCPA 1YHFA 2UYBA 3OD4A 1AR62 5DG2A 2DVGA 3WF4A 2F4LA 5IFPA 2BNMA 1GZTA 2XSDC 2RE9A 1A78A 2XH6A 1HN0A 1KQRA 2B39A 2ZGQA 5DAWA 4CCNA 1PVC2 3VKLA 2DDUA 1MVEA 1HDKA 3CROL 2KM2A 2KA3A 3DV8A 5FV3A 3B01A 4K6BA 1JWLA 4QDQA 5BNNB 3PIJA 1RJ8A 2P5BA 4NE9A 4V2WA 4BA6A 2D93A 4GA9A 2HWF1 3CKHA 4RQPC 1DYOA 1UQXA 2E32A 4UF0A 3RZHA 2J1TA 2HCNA 1Q8VA 2VOKA 1O6UA 2BYVE 1ZZCA 1HQLA 1CAVA 1REFA 2VZTA 5EJZB 5IWFA 3S30A 2PAKA 4X4EA 3IMNA 2R1JL 3VHRA 3QF3A 2CYFA 2R042 4Z59A 1YFYA 2JDAA 2RS32 5FMBA 1LTEA 1FT9A 4QPYA 1OFNA 2EF6A 4IEUA 2R043 1S0CA 5JPNB 2KEJA 1C8M1 5DRTA 1HIXA 1GWKA 1UAIA 1WCUA 3NNJA 4RN5A 5DAQA 3EMRA 1PZ9A 2WZPP 2JEMA 1EP0A 2AXZA 2WUSR 2WZ8A 1R092 3I2GA 5JOWA 3VBRB 2WIUB 2GN3A 2VQUA 2ZZJA 3J4UH 4NRPA 3SH3A 3ZFFC 4UFKA 1FPN1 5CU1A 2AGSA 5IVBA 1NG0A 5IK8A 3H3LA 4AFDA 2PIJA 3KF5A 4Y42A 1DZTA 1RL3A 2JDZA 2Y0OA 3H42B 3GN5B 4R52A 4RYDA 4E2GA 2MEV1 2CV6A 3M3OA 4E8DA 3K48A 3CIHA 4QX7A 2VC9A 5CA6A 5GZCA 3KMHA 5FMOL 3ACFA 3QWGA 1NOVA 2HWF2 2F4PA 4M4RA 2VOXA 1T2XA 3WUDA 3IDBB 2YDEA 4BU2A 1YCIA 2FZ2A 1FNZA 1CN1A 1DYPA 3MW2A 4CDUA 2WQ4A 1ULCA 1X9TA 2ZMNA 1CQTA 4QKDA 4WBBA 1RUD1 2QQVA 2PUBA 2EAAA 2RS11 1XU2A 1BBT2 1RMU2 4QB1A 5DAXA 1QB2A 1H1IA 2HEVF 3ACHA 1UZYA 3JBG3 4LE4A 4N53B 5FP8A 2H0VA 1OPOA 5FZEA 3LDKA 4EZ4A 3KGZA 3W58A 3K3NA 3VD7A 3N9NA 1UU6A 3TN91 4C0HA 2LLVA 4RA0A 1UPSA 2RDRA 3TN92 1YQ2A 3LPGA 1VBA2 1QOOA 3BUCA 3ZXEA 3CEWA 3V0AB 3AJYA 3FLPA 5HV4A 3I2OA 2ZGPA 2W1SA 3ZSMA 5FMCA 3WQ0A 2RS52 4NUBA 3ZIWA 2VZPA 4RS5A 1XB9A 4DPNA 3HQRA 1V9U3 2V4AA 3OUHA 3LDRA 3JXDL 1ZBE1 2DCTA 2PXBA 2XOMA 4GJZA 4QX8A 4QQLA 2B5HA 1GMMA 2UU8A 4CE8A 5FYHA 1G86A 3F2ZA 3VBSC 4YWAA 4AI1A 5CAZA 1PGW1 2WRAA 3OKZA 1LENA 1PZ8A 1NCRC 1EAH3 4AI9A 4DZGA 2IVQA 5JPMB 4UAPA 3VBUC 1PMHX 2ILMA 4HK8A 4RR3B 1R1A3 3IMMA 4GALA 1RUD3 3ZSKA 3PU8A 4COVA 2JWPA 4NN0A 4XAEA 2QZ2A 2TNFA 4CCEA 3LKJA 1ZZ6A 1AYN3 1PRAA 1W3VA 2PAMA 3NV3A 3ABZA 4L0PA 1V0AA 2E7AA 2X5IC 4Q0VA 2QQWA 1PGSA 3ZYIB 2RJLA 4X4DA 5C6CA 3FN9A 4ASLA 1AR63 3QLQA 1QQP3 2IVIB 2I2SA 2VBPA 3DNVB 1NQJA 4XF0A 1N3QA 1QJU3 4MSVA 3MHZA 4EQVA 1R63A 1C1LA 5H9QA 4NRMA 1ZZ8A 5T5OA 3AZWA 4I0WB 4LBQB 1UYZA 1DDLA 1CVNA 5C9AA 5J7MA 4COYA 4IEQA 1QJY1 1S55A 1WMFA 2CGNA 2RJ2A 2W1QA 4MGZE 4EQZA 4KL1A 1JFTA 3VBFC 5CFCA 3WP3A 5FZ0A 3CBNA 1I5ZA 2OS2A 4BLIA 5BNPA 3O1MA 4XF1A 1GOGA 2Z4FA 1OA4A 3D8CA 4WVMA 5CKQA 5K4LA 1AVBA 3BPZA 4CP2A 4L97A 1K45A 4PU7A 2YBDA 2EBYA 3HT2A 1LHNA 1W6OA 1ONAA 4YZ1A 3WG1A 2D3SA 4IESA 4IW3A 4PIYA 4K8FA 3GN5A 1YQ5A 4P5YA 2R0FA 3QACA 4I30A 1FX5A 1OLQA 2MEV3 2PXTA 1SBFA 3FWEA 2DVBA 4AF9A 4Q4X3 2YBKA 3KHCA 1S0GA 1OA2A 4UBHA 4BK4A 1FMD3 5IHRA 3RVHA 1F4HA 1REDA 3FUOA 3RI8A 2PPXA 3OEAA 4CXWA 1PHMA 1NXD1 2ES3A 3URFA 3U14A 1DGRN 5ACA3 1OOPB 2LNMA 2VE1A 4UOJA 5FR3A 1LLIA 4XQDA 5I0SA 4AHYA 3N7KA 5D1IA 4CDQC 2UWAA 4CDQB 2Q5TA 4EKGA 2VZRA 1QQP2 1B09A 5FK7A 2PN5A 3LZZA 5DN2A 2P17A 4CPBD 4CUAA 4MGQA 5DSXA 2A6ZA 1TG7A 1RUJ1 4GQ7A 2PQQA 3OQOA 3BN6A 4PI2A 4PU8A 3KWVA 1NA1C 2C9AA 4JHZA 4FPOB 1HXS3 2VMGA 4JGYC 1HKDA 1HQ1A 5AC91 1F8VA 3JD71 2VUJA 3IB3A 5B4XA 1UX7A 4CZSA 2HWB1 4JV4A 2M4HA 5F5AA 3I54A 3KJXA 4XJ9A 1S0FA 1HRV2 2D3PA 2QVSB 1ND3A 3AM2A 3GHMA 3O1VA 3VL8A 2VNVA 3ZR6A 4CVUA 1LCDA 1YC61 2VVFA 4QDSA 3NJYA 1PZ7A 4WVMB 5C3OA 5F9TA 2A70A 1D4VB 2NMOA 4BYYA 3HEIA 4LK7A 1LOFC 4Z58A 2GP5A 1O4YA 4FSJA 4N9IA 2R1BA 2O4AA 2WUHA 4C0BA 2J7WA 5BYNA 1XXNA 5EYXA 2GP3A 4H55A 4ZZ8A 1Y7YA 3IBMA 4X4HA 3ZFEB 5FUIA 3RNSA 1PMIA 1WH8A 1EPZA 4PQ9A 5FK8A 3J8F3 1RYYA 4ZXEA 2O1QA 3PJYA 1RVF3 3AZVA 1V6LA 3HAGA 5A1AA 5C3QA 1GANA 2XQXA 5K98B 3O0VA 2B9UA 1ENRA 1OSLA 1WKYA 2GNTA 2J7MA 3U07A 5LCWL 1LHVA 3OJBA 4RGAA 1NX9A 2AEZA 3AMNA 3WINE 1JZ2A 3LOIA 1LULA 3NSTA 4AVSA 3RMXA 1UXDA 4NAMA 1MQTC 1EV13 1QJZA 1MQTB 1W2UA 1XYPA 5CFCB 1Z7S3 3I3BA 5LBEA 3PLQA 4XFCA 1QNYA 4C1WA 4IV3C 2WQZC 1W6NB 2HWC3 4D0QA 3GNEA 2C5DA 1UOJA 2ZGSA 4XHXA 1NCRB 5CFDC 2RMU3 5LATA 2O49A 1POV3 3BS3A 4XZPA 1UD1A 3VDBA 4AE2A 2QE3A 2Z2SB 1B35C 4KWKA 1T6BX 1RXFA 2BFUS 2NYYA 1AXZA 4EWAA 2C26A 5JWPA 1UZZA 5GKAC 2DCZA 2ETEA 3GBGA 3WNOA 4BM8A 4CDXA 3MPPG 1JOPA 4K8RB 2AYHA 3TNPB 2ORZA 1LQCA 2QBXA 5D8AC 3Q8FA 3TN93 5F3GA 1P8JA 5FYBA 3E1F1 3UJQA 4COWA 1WA4A 3CL1A 1DGRA 2K46A 3AKQA 4A4AA 1DHKB 1H8TB 2VUAA 4XABA 2PQSA 4I3GA 1ZA4A 3LA2A 1IPKA 1WH6A 3O0WA 3P3NA 2A75A 3GBWA 4HKLA 2WC2A 2XG3A 3DXTA 2PXVA 5I0UA 5KXDA 2R061 3MICA 5EYYA 2P6HA 1NY72 1IS5A 1ENSA 4CA9A 2ZEWA 4CDUC 2BGOA 4JCKA 3S5QA 2MXDA 1D0HA 5F5QA 1G9BA 4EWEA 1YFUA 5JUVA 4GAZA 1PNRA 3PXPA 4GIQA 4WV8A 1W0NA 3C8XA 1E5IA 3RFRA 1JYWA 4XAAA 5FRAA 2QQKA 4ITCA 4MYEA 1BMV1 4JKKA 1CAVB 5BNQA 2CTVA 3RQ0A 1OD3A 3CJXA 4XPVA 2AXUA 2R30A 1TMF1 2TEPA 4OI2A 4YPJA 4BIFA 4F7ZA 4CEWC 2W1WA 1OUXA 5ERLA 2G9GA 3WHUA 4A7ZA 5FPZA 1CD3G 2A1XA 4G4FA 1OBNA 3P6BA 3FMYA 1C5IA 4O65A 5FZ4A 4B29A 3ETPA 4D3WA 1NLSA 1KFUL 1W6PB 1TVGA 1OVPA 4QXKA 2A71A 1YJLA 2KR2A 4YM0A 5LBFA 3T3YA 3ZR5A 4IGQA 4CU7A 2WQ8A 3U3WA 4MHUA 3C7OA 3QYXA 4UFJA 3S6PA 3I49A 2LYLA 3ETQA 3WW4A 3OYWA 3DXUA 2PXPA 5A3MA 4YM1A 3UFDA 5DRYA 4DXTA 2J42A 4BJ0A 1HRI2 1UCXA 2WNUC 3A4UA 4J6GA 4JZRA 2A3XA 2YPDA 3ASIA 4NO4A 3ZKCA 5IFTA 1RUI1 1UNBA 3WDVA 4XFGA 5BPXA 1JYTA 4LBMA 3IIIA 4Q29A 4S2HA 5JVVA 1OSGA 3WQ7A 2I45A 4LK6A 2V4VA 4XXPA 2YB7A 4WZCA 2ZHNA 3WDUA 1IS6A 3MIBA 4IEPA 1W6QA 3UGHA 4L92A 2ERFA 5FJHA 2WNVA 1ULGA 1KGYA 4LBNA 3KCYA 3VWSA 1RUI2 1W6NA 4I2OA 3WCSA 3O5SA 4A3XA 3WP5A 1RVF2 1GU3A 2AZ5A 2XXZA 1LGNA 2ADEA 2O8QA 5FZ1A 3O1RA 2JDPA 3WF0A 4FTEA 1K5JA 4XMIA 1SCSA 1W8ZA 1UKRA 5CIRA 4DS0A 2PHWA 3POEA 1YQ6A 1CX4A 4LOTA 1BVVA 1FI2A 2YBPA 4CDXB 3QOWA 5FXXA 5LA9A 5LRRA 4LO5B 5CEHA 3NL1A 5T5PA 4LIVA 2AENA 2RDSA 3B3QE 1DGWX 1LR5A 4R9CA 1WUVA 4LUKA 5DDJ1 4CRQA 1TMF3 2EICA 4JVAA 1Q8QA 1UWWA 1YYNA 2DVDA 1XNTA 2QZ3A 1VJ2A 3LEIA 1G8WA 1HRV3 1Q8OA 2OUHA 4Y5SA 5G04L 4MOAA 1PO13 2P3YA 4Y5TA 3FL7A 4I6TA 3MLLA 1UY4A 4P14A 5I8TA 1G9DA 4LUMA 4F8AA 2P3JA 1R083 3AZXA 2QQOA 1ZVVA 1H2LA 4A41A 3C7HA 4YSFA 3TWIA 4BE3A 1MPXA 5A3NA 5L19A 4NHMA 3VZNA 5IVYA 4RL7A 5KC5A 4CDQA 1JYXA 1EUUA 2E7QA 2Q1FA 2RR11 1WETA 1AR91 4NRQA 3GUUA 3JU9A 5FZ9A 5H9SA 1M06G 1D4M2 2YC0A 4L8QA 2MEZA 2KD7A 4L2NA 5HCAA 1QJX1 3O1TA 1JN2P 4Y1ZA 1DZRA 1O3RA 3DM5A 4KQ7A 3OUIA 3BI3A 2FDJA 3TFLA 2ICPA 1QJU2 2WZR2 4I3PA 3HNYM 5D2AA 5GLZA 1N1SA 3ACGA 1NW3A 1KS4A 2PHFA 3UT0A 1GZ9A 4B4PA 1RUI3 1GKBA 5FFOC 3BKZA 3PDQA 3LFPA 4HVOA 1NE6A 2IWGB 4KWLA 2JJ6A 1DCSA 2PAEA 3I3QA 3N3HA 1AYN2 1S0EA 4FXKB 4QHOA 1W28A 2G9FA 3WNNA 3AP6A 2VMDA 4UI9L 1ZBA1 1XNCA 1CAWB 2XGXA 1J3PA 1GP4A 3OGVA 4Z07A 2PLV3 3KT7A 3AYEA 3G5GA 3ZXLA 4AEDB 4BPZA 2RJKA 2PTMA 3KVAA 5G05L 4A7YA 1PIV3 1YNAA 2JE9A 3KSCA 2VVDA 1HB3A 5FZ7A 1JUHA 2FHRA 3MYXA 3RYRA 2QQPA 4JDOA 4AEMA 1RB8G 4XUQA 5A7WB 3H9AA 5IT6A 1IQDC 1HXS1 3BPSA 3THDA 1YI7A 5ISLA 1O8PA 1E5RA 4QX0A 4ER0A 3KT4A 2W46A 2XKPA 4AI2A 4URAA 1LCCA 3W21A 4PDWB 3KLSA 1SG3A 4HVQA 3LD8A 4LIUA 3T1MA 1LHWA 1QOTA 1XNKA 3VBRA 5FP9A 3WD5A 2JKBA 3ZXFA 1LOCA 1OLRA 1OLME 3PUHA 2LYKA 5K0UB 5AFBA 5FPBA 1LAJA 1REEA 1VPWA 2DU0A 1XQNA 4Y3OA 2XBO1 4BQYA 3T4HB 4XCBA 2FDGA 3VBOA 4JRAA 3VDAA 3I4IA 2WT2A 3ITQA 3SHRA 3RGBA 4AQ6A 4YW6A 2LM3A 5FY9A 2W9XA 3MIEA 1PMJX 1MS8A 3U10A 3Q8AA 1JS9A 2G9ZA 2D44A 2ZGNA 2DCYA 5EV7A 1O4ZA 2CROA 1QQBA 3UYJA 1J1TA 4HSJA 2PYTA 1G9AA 2ZJCA 3H8UA 3UKTA 3VBHC 1AX2A 2D5HA 1LB2A 2PE5A 4Q2FA 4XDOA 1ASJ3 2WLQA 3VZJA 1PIV1 2UWBA 1WMEA 3LGRA 3OOXA 4CU6A 2NM1A 2VCMA 3B7MA 2VQAA 2QQLA 2DUQA 2BQPA 2XLFA 2CSFA 4TWTA 1N3OA 1FATA 2ZA9A 3KD4A 5FYUA 2EIBA 2VTFA 4AAPA 5FZ3A 2W3JA 4OYUA 3OSDA 4NAOA 1RUF3 5FXZA 4S2DA 1RUJ2 4LO7A 4Q4Y2 3WNLA 3MIHA 3INAA 3UKVA 3CLCA 1PVC1 4UFLA 4Y1XA 1X36A 1QJX2 1VBC1 2QDRA 1AJKA 4Q8LA 5K0UC 2YPJA 3VDDA 4ZS2A 2GMPA 2IC1A 5DUWA 2FCVA 2VZQA 1KJLA 3UETA 5LZ6A 4K40A 2WLPA 3MIGA 4EWDA 1MS4A 5JMCA 4HT1T 3PMEA 4UFIA 1IQAA 2ZABA 2RS33 3E5XA 4XXAA 2PXFA 3PVBB 4HZFA 4AQTA 3KV5A 2ZMLA 3WCRA 3SXWA 4D7TA 4EN9B 4PBPA 2C4XA 2ZHKA 5HI0A 2W91A 4OI4A 4QQPA 3OY8A 3PL0A 2WSVA 4HPKB 5J48A 1N3PA 1YEWA 4R9DA 4DE8A 3TEPA 1US2A 4QPIC 3WF3A 4XIOA 2ORXA 4NHYA 2GZWA 3NVCA 5FWEA 4M0NA 1O3QA 5C33A 3VBFB 5FPXA 2JVLA 5GALA 4AFAA 4HRAA 5FWJA 1AR72 2YU1A 1IPJA 4V1PA 3PHMA 2GRMA 2OXBA 2GSYA 3JB4C 3IDAA 3ZXAC 2RDQA 4NROA 3KB5A 2XR4A 3FBYA 1SBDA 3OBAA 3ZYBA 3WLUA 1O4TA 2P3IA 2MPFA 3SX0A 4XURA 3WVJA 4PU4C 3D82A 2HH9A 1WD3A 3EJKA 4PLMA 1Q3EA 1H0BA 2PUCA 1AR92 2WZR3 3ZYHA 5FLJA 4DXSA 1SMVA 3J8F2 4XFAA 4Z5CA 4YZ2A 3AKTA 4CPBA 3CO2A 1KDMA 5LK5A 4BQ3A 1W8UA 4MHRA 4DINB 4YG6A 5LRSA 3IZOA 4AOCA 4EE2A 3S8QA 2QDNA 3V0AA 5EWSA 3NJVA 3MFCA 4NVPA 5FZOB 1UF2C 4JTNA 3S5AA 2WINB 4MX3A 5FY4A 1W06A 5CFDB 4KBBA 3TRSB 2D43A 2GMEA 2P6CA 2V72A 3HNMA 3MO4A 4MXWB 3NDBB 1UIJA 2XUMA 1ULDA 3O1OA 3ATGA 3UNPA 4Z2WA 3ZX7A 3QH7A 3T2TA 5JZGC 2GRLA 2IVGA 3BYWA 3FFZA 3SLIA 1S2EA 3L2YA 5HBAA 3R0RA 1UOGA 1V9U2 5FPVA 4QKNA 1SLCA 4NDWA 2JIGA 4BIOA 4PLNA 4YRDA 2XBO2 3QQ6A 4XILA 4I0BA 4NIDA 4TLGA 3B00A 4IEYA 3AMQA 2VZOA 1VB4A 4Z8BA 1F5JA 2BUKA 2CDOA 2WO7A 5CADA 3BIWE 4NWVA 4ATFA 5FDBA 1OC1A 4Y20B 1LOBA 3AZZA 1YUDA 3DECA 2W0XA 1L1MA 1U0AA 3T0DA 2WA4A 1H4HA 1ODMA 3LCPA 3HBZA 5L9RA 5L73A 1UMIA 4Q4X1 1YQCA 1O59A 4ER5A 1PGL1 3AL6A 1O3SA 1ZRRA 4BQ2A 2IXJA 4FOVA 3PVEA 4FBFA 2JG9A 1W6PA 5JDBA 4IE6A 4AYUA 2ZX1A 5J36A 1JHNA 4AI3A 2CDPA 3ZPOA 4MO3M 2Z79A 1W05A 4NIIA 4ZKTB 3GBFA 4M0HA 3BODA 1UPIA 3ILFA 2ODRD 3FZ3A 3GZTB 4BQWA 2WFF2 4OUSA 5DAVA 5L7OA 4LKDA 1CJPA 3B94A 3ALQA 1QXRA 4NWWA 2WT1A 1UZWA 2VCAA 1RUOA 3MBWA 4EN0A 1C8NA 2KEIA 2YHJA 4YFZA 3ORJA 2OA2A 3CQOA 4AVBA 3T1LA 2ID4A 2VNOA 3VD9A 4E4SA 2GN7A 4TTGA 3V64A 1K12A 3UK9A 1AYM1 4LE3A 1ZS4A 5KR7A 2BJCA 4PHZA 1RUH1 5LASA 5A7WA 3CMGA 2ZGRA 4JGZA 1K5MA 2VH9A 1EY2A 1JBCA 3VBHB 1VBA3 3NJZA 3ZSLA 3QOPA 1Y9MA 1W6QB 2PUDA 1I9RA 4XTPA 4JX0A 3USUA 4JCYA 2LALA 1Q43A 1UW8A 1I6XA 2XVLA 4GWIA 1O91A 1JFSA 2Q8OA 4M4PA 5JOXA 1ENQA 1NERA 1RUC1 4I09A 3AXDA 4LA2A 5FO9B 4I6UA 1H2KA 1OH3A 1MS9A 1UY3A 3QBQA 1NE4A 5C70A 3VBUB 2R63A 5I0RA 4EKIA 2EVXA 4IV1B 1EAH1 1CAUA 2J22A 2PLV1 3JD72 4UT5A 5JXHA 3ZPXA 1LU2A 4Z5HA 4BMBA 2DYCA 3OB8A 3AP4A 2CAUA 3VHNA 1KJRA 1POQA 1VIWB 1MZ6A 2VVEA 4FP2A 4Q1RA 3NNLA 5JXGA 4DY3A 5F39A 4LHLA 5BY5A 3T4VA 5CNAA 2EF8A 2W1UA 5DT2A 1W2NA 1RUH2 3HVDA 1UZVA 2VXJA 2E63A 3WNXA 1L7RA 3Q8BA 3NKGA 4HOOA 5FO7B 1H1MA 1H8TC 4BLJA 3ZFGA 2HWD3 1PRVA 5EPAA 1OKOA 4A6OA 4UF0B 3F95A 4FP3A 4E2SA 4IXLA 1CZVA 3QH6A 4ASMB 5HXMA 1B35B 2EWTA 1JYCA 2R063 2AWIA 5DTQA 1FNYA 1QDOA 1LGCA 3QCWA 2OIIA 4OI1A 3WF2A 1ZRIA 1DLCA 2JDUA 3FHQA 4M3CB 4ZU7A 3PTRB 1ND2A 3NNGA 3IT8A 4LLFA 5FIXA 1JYVA 1Y9QA 5HCHA 3OQNA 2BGPA 3BB6A 4QHBA 3AKRA 5JXJA 1ULEA 2CSGA 2OQ7A 1AL21 4PQQA 1UZ0A 1AR61 4GHJA 3DKQA 3M1HA 3MFAA 1JU3A 2D6NA 3WXPA 3NROA 4W6WA 1RPEL 4HONA 4RHV3 1HQNA 3K77A 1ZYBA 4LQRA 4EZIA 3HN3A 1XSQA 4AVAA 1JZ7A 4HFSA 1UOBA 3NV1A 4Q0QA 3THPA 4K3UA 2JIJA 1JHJA 2Q8DA 2XPJA 2VU9A 2WNVB 3W20A 1CGPA 1RUC3 5FY7A 3M8LA 4DIQA 2JB8A 1YXWA 5KHJA 3MEPA 1AR83 4LEJA 1U5YA 2VOTA 3K3OA 3KVBA 5KHKA 1AX0A 2IUWA 2AW6A 4FAHA 5CKNA 1FYUA 4NMIA 3DYOA 4WM7B 3LPFA 1XPWA 2D3RA 4QPWA 1CONA 3ST7A 1QU0A 2R6QA 1VLNA 3OTFA 4YW1A 5BNOA 5E16A 4AGRA 2BVBA 1GZWB 2JXAA 2P4EA 3JBG1 1AYM3 3LSEA 2IV1A 3MF9A 4L99A 2WO2A 4HK9A 4N53C 4WM8A 1RIOA 3VBSB 4ATEA 5DG1A 1IC8A 4AI8A 4BISA 4X4CA 1NA1A 2C6SA 2GC0A 4X6QB 1Y7BA 2XMLA 5FZ8A 4AEKA 1PRUA 3DGTA 3WEZA 4Q0SA 4Q2JA 1EPWA 3AKPA 4TZDA 1AHSA 4P02B 5FXWA 4BDVB 5ABJA 3N7JA 3EUSA 3OWQA 2AEYA 5BV6A 2LROA 2OVUA 3ELNA 4CP0A 1NLQA 2VOVA 3BCWA 3FYMA 1TNFA 2FCUA 1ZZBA 2GNMA 2W39A 1ND2B 2PMWB 1PM4A 1GYKA 4JGYB 2VUCA 2VR4A 1VE0A 1RUE2 5FBJA 3QD6A 2GALA 3WDWA 4DXZA 1TNRA 2ET1A 3KGLA 4UW3A 2D6PA 3T2QA 3VD4A 4FPGA 2C24A 3GGLA 1BZWA 1MZFA 4MGSA 3JD73 2XXQA 2VQ0A 4MADA 2FD8A 1DG6A 3SR4A 4JKMA 5FZOA 2B7YA 4GMP0 2X09A 1NZCA 1H6YA 2FBEA 4QB6A 4Q0PA 2DU1A 4PU3C 1ODNA 2LUWA 4B1MA 1DW9A 5C8CB 5TSWA 2LCVA 2HWE1 4C90A 3POYA 4QKFA 1IPSA 1SCRA 4A2UA 3V0BB 3PTYA 1LECA 4LBQD 1LEMA 3OEBA 3TYJA 3DN7A 3LIGA 4QAWA 1WW6A 3AB0A 3HBKA 4WVLA 4O8BA 1WMXA 1ALYA 2R062 4BMEA 2J1EA 2Y60A 2WNOA 4PDWC 3RDIA 1WLCA 3RZJA 4GB31 3OBTA 4QX3A 5L7OB 2VZUA 3POSA 4M3CE 4A42A 2IXKA 4AG4A 5CFCC 3FBMA 4XOGA 1J59A 3ZFEA 3LA3A 4KWJA 1CESA 5LA0A 1EYBA 4OBMA 4X4FA 3RZMA 1R69A 3I2FA 4OLLA 4Q4V1 5J09A 1X9PA 2X10A 1V9U1 3K4AA 4QU1A 5SV8A 3MW4A 1D0GA 3WT3A 4J1WA 1EV11 4BHPA 4I02A 4YVSB 4TXWA 4DEVA 1UKGA 2X5IB 1VALA 1MEC2 4XFBA 2IZWA 3AZYA 3JQXA 4EV0A 3UKNA 4GJYA 5JIAA 1FV2A 5FKBA 4W50A 1ZPQA 2ZX3A 1AR93 1S0IA 2A6XA 3WQ1A 2VMHA 1R1A1 3FJSA 2XJPA 1S0BA 2JG8B 1GOFA 4M00A 4LXLA 3WW1A 4DUVA 1C8M2 4HANA 4D7YA 2ZX2A 3UWPA 4XFFA 2WN2A 5FOJB 1BVP1 2LYRA 1QJU1 2VG9A 1LOGA 2VPVA 4IV1A 5F3IA 2MHFA 4RR3C 1JTZX 1URXA 3RI9A 3SQOA 3ZDVA 1G7YA 3PE5A 3UESA 3PNAA 3N4MA 1QNWA 2B42B 2XJQA 4A44A 1F5FA 3HJRA 1S2KA 4FPEA 5F7UA 2D98A 2OQ6A 2VW2A 5IATA 4YGCA 2BGCA 4A6SA 5JAXA 1J83A 2E51A 2ZKNA 2VEOA 3H7JA 3NAPB 3ACIA 3Q8CA 3F52A 2RG4A 4LKEA 2DTWA 4LBOA 4NPLA 2B8MA 3AFKA 4Z92B 2BZDA 3ZSJA 4XZUG 5A1FA 4FO9A 3F6WA 2D6LX 3CJIC 2PLV2 5IVVA 4TYSA 4YGEA 4DEQA 5K9YA 3O1UA 5A1LA 4ZS3A 3WQBA 5C5UA 4GB33 1ZRCA 1CIYA 1PERL 1VRH1 3MEJA 4P08A 4QXCA 3VHOA 4EN6B 4JDMA 1X33A 4IE4A 4XQWA 3VK0A 3GCWA 3HOBA 4AL9A 4E8CA 4FFIA 1TZOA 3SC7X 3RRDA 5CVRA 1DQ6A 2BEOA 1ADRA 3ZN6B 1QDCA 5AC92 4UWDA 1OKQA 2W47A 2VM9A 4AFMA 2QNKA 1GFF2 4LKFA 3LFIA 3FHAA 4ZY9A 2RHPA 1UOFA 2EIDA 4FFHA 3VDDC 4ASKA 4K1ZA 4ZZ5A 4LULA 5BNPC 1SLAA 3JZVA 3AK0A 2A73B 3ROUA 2J7UA 2HWB3 5HPOA 2NLRA 3MI8A 4MGYE 5A7SA 3ILNA 3ON7A 2CHHA 2WSUA 1O3TA 1WD4A 1ASJ2 1IS3A 3KXAA 1JH9A 1OFSA 3C7FA 3ZFGB 1ZZ7A 4BZ4A 2EAKA 1IZ3A 2E33A 4AVCA 5AFEA 1K3IA 2XXPA 1L7LA 4ZPIA 5FY1A 2VD7A 4Y4YA 4YYOA 3DEMA 1JXNA 1JZ8A 2VNRA 2EXKA 3T09A 3WOGA 3OQMA 2ZMKA 1HN1A 4HETA 3IN9A 1PK6C 3CU7A 4QQ2A 3BTAA 2LTNA 1XNDA 4EK9A 3P3PA 5DAPA 1IOAA 2W08A 2W5FA 1DFQA 1HV1A 4IERA 2WWSA 3E97A 1FPN3 1ND2C 3GZAA 3ZYFA 3RWNA 3ECQA 4CP9B 4Z5DA 2C1FA 1NY71 3R09A 1HLCA 4PJYA 5FUPA 3FLTA 2K9ZA 5KHHA 3K2OA 1WCQA 1NA1B 4IUGA 4W6XA 3KQ4B 4N7IA 4LHSA 1OXCA 5BNNC 2DURA 3VBSA 2VBBA 3SMHA 3VGIA 2JE8A 2WKKA 1B0NA 3JXSA 1RHI2 5JIUA 3HD8B 4QGNA 3J7LA 1VB2A 3K46A 2HYXA 1YLLA 1SLIA 1W8FA 4AI0A 1OQDA 2NQYA 4RS5C 4DRRA 1J3RA 1E3OC 4BQ1A 4X8PA 2ARBA 3POFA 3PJQA 3HQUA 5FPAA 1JU4A 2BWAA 2HCSA 3C2UA 3PUAA 5E8AA 1DQ2A 5GZFA 3VKNA 2JICA 1MEC3 1Q8SA 3AVRA 4O7XA 2FDKA 4XBQA 5BNNA 3SCFA 3LWCA 1MS5A 2ZX4A 3E6DA 3GDBA 2XWBB 4YM3A 1R1A2 2ZGKA 2XLGA 4BH9A 4CCOA 4KGGA 4A45A 4CCKA 1S2BA 1OOPC 1WBFA 2GC1A 1EAH2 4G9SB 5FZFA 4GZ9A 2H0BA 4D6RA 3CLPA 4MLOA 3U0ZA 3BTXA 4K21A 3NAPA 2HWD1 1PK6A 2E31A 4OB4A 5FLHA 5FYYA 1DBNA 3RWKX 4BOWA 4CU9A 1H9WA 2R071 1K42A 2O0OA 1BDHA 1VBE2 3VD3A 2RM22 3BTZA 2WZR1 3M7AA 1Y9GA 2BBVA 1KRIA 1W6MA 5APAA 3X29B 2EIGA 3DF0A 3IDEA 5C8CA 4C8DA 4FOQA 1GQGA 1Q5OA 1ZRFA 3D1NI 1NQDA 1GOHA 1LCLA 4FXGB 4RFT0 3E5UA 4O9EA 1MVQA 3M4FA 3EQEA 3W5MA 4YVSC 1QJX3 3O0XA 4WM8B 5GAGi 4Z1VA 2PXLA 3I2HA 1W9FA 3KV9A 2QQNA 3THTA 4EYUA 1TMF2 3AXEA 3H5TA 3I59B 4NR1A 5FZCA 4PIXA 4KGQA 2OT7A 1VAVA 1RJ7A 3H7YA 1X2LA 1DZQA 4FN3A 1I3HA 3N36A 3N9QA 1ZBE3 1CQ9A 2ARAA 3R05A 2CY6A 2GC2A 1N47A 4ER7A 3B9IA 4HL0A 2HWE2 4ONUA 4Q4V3 5E88A 3NAPC 3PVOA 1F35A 4XVHA 1DQ1A 2VW1A 4ZONA 2HWE3 3K75B 1UXCA 2HWB2 3RYKA 4EJRA 4QPIA 2UY9A 1BEV3 2WABA 3D6EA 1COV1 1CZSA 2DTYA 3BOPA 1KITA 1OOPA 1XYOA 3UJOA 5CISA 4OCTA 2R1DA 3B5LB 3GZUC 4OHVA 5KWRA 1U5IA 4DUXA 5JUWA 1CAUB 5IW0A 3WF1A 5T5JA 1DULA 3OMTA 2EXIA 3R4UA 5ACA2 3T0BA 4O61A 1PGW2 3IAPA 3WX5A 1RITA 2JB4A 2OZ6A 5F3EA 4C1XA 3E6CC 1BHGA 2IXCA 2F17A 5LW9A 4AFCA 3OPWA 3G7DA 2AR6A 2DV9A 1POUA 2FCTA 2QQUA 2Y26A 2H6CA 4A3ZA 4B8EA 3H0OA 4CUCA 5KXBA 2JG8C 4CP9A 1QEXA 1O4XA 3G0TA 3ZOIA 1BXHA 1LMB3 3GM8A 3U78A 2AUYA 1QQAA 3HT1A 4E4DX 1FPN2 2W52A 4B4RA 3R1FA 3FE5A 4LMFA 4ORFA 3T2OA 4CDXC 1QH6A 1F4AA 5FP4A 3V56A 2PXKA 2EXHA 2P2KA 2BVVA 4K9SA 3ZXDA 1AXYA 1SHWB 5L36A
chains in the Genus database with same CATH topology
4MCTA 1WBLA 1UL9A 4PF5A 2Z5WA 4CDWC 3IPVB 5KBFA 4DQAA 2R041 1A6CA 1YI9A 3KM5A 4MVTA 5FQ0A 1WIZA 1NLRA 2QJVA 1MEC1 3AX4A 1CJGA 2DVFA 2D6MA 2L8NA 1OA3A 1POV0 4H7MA 1RUF1 1N1TA 1XU1A 2ZGUA 2R072 4YM2A 1FMD1 1GV9A 5D8AB 1OQEA 2WS92 5BXXA 4E4ZA 4KU7A 3M70A 3MF6A 4U36A 4AQSA 5AC93 5C4WA 4IVZA 5DZGA 4O9GA 2C0ZA 1XYNA 1OHFA 4ZU5A 4LO4B 3WDYA 3VDDB 1R091 5JOZA 1IGOA 1BEV1 3LOBA 2JD4A 5C9AB 4JAAA 1SDWA 3AMMA 5HCFA 5IK7A 3D0JA 1SFNA 4AHWA 5A33A 1VRH2 4CEWB 1WCKA 4YZ5A 2A7AA 2LYQA 2XB6C 3ZMNA 3CECA 4XE9A 4DRVA 4E2QA 1NCQC 4U2AA 2PHRA 4D69A 3J9SA 1CPMA 1VRH3 2OZJA 4QM8A 4INDA 1RZRD 3TRBA 1WW4A 1ZNPA 3MLKA 3MLFA 2VXRA 2ZAAA 1CAXB 3BALA 3TB0A 1UU4A 1YRZA 3HMYA 4N43B 4Q27A 4YZ3A 3EO6A 4QQHA 2R32A 1G6NA 2XKOA 3IPVA 3RZZA 5E89A 5K0UA 5B2GB 4XJUA 4YG7B 3GHNA 1WW7A 1R081 1L3JA 2OR1L 1QF3A 2YGMA 4LBKA 3SITA 1D4M1 4NPRA 4JDNA 4HKWA 3M3EA 1NEQA 4XIKA 1GLHA 1ZBA3 1GICA 4RD7A 4AVTA 1X7NA 4META 2PFWA 1BEV2 4JRLA 1PVXA 2XIUA 1OD5A 4BCUA 2DFCA 2WJSA 3VN4A 3WHTA 3MLJA 5I8YA 3SISA 4R9AA 3FMGA 4P9JA 4FQ4A 5CFDA 4QT6A 4AEJA 4GH4C 1AR73 1SQ4A 2AUWA 1YO8A 2WS91 3APBA 2F6BA 1BYHA 1SQ8A 2SLIA 3H1YA 1YWKA 4KG0A 3M3IA 4WM8C 4P9YA 3VBOB 1YSEA 1BCXA 4WVVA 3RYPA 1UN1A 3SNMA 4FT8A 4YGBA 1ZUGA 1SEFA 5JOYA 4XTMA 4HBNA 3FHIB 1GBGA 2D6KA 3NW4A 1TQ5A 3AP9A 4PDWA 3OYWB 3CNAA 3ZFEC 5C4WC 4DOUA 3IWZA 5FBZA 2NPIA 4QPGC 2DUPA 3B02A 1YIFA 4UW5A 1COV2 1PIV2 2ZGTA 2L49A 1LHUA 2BFUL 4R4ZA 5GJ6A 3HN1A 1UX6A 5JLVA 1CAWA 4N90A 5T3NA 1BDIA 2EA7A 5JSRA 5DUUA 3RMYA 5KHGA 4GH4A 4LBJA 3VBUA 3ZYPA 3WR0A 1MACA 1SLLA 2MQKA 3B9CA 4RGGA 4QU2A 2BWCA 3OF1A 3VKFC 2QKDA 4RQPB 3TBDA 4CDWA 3ZIXA 2ZZQA 3WW2A 2B46X 2Z69A 4OHXA 2PUEA 4QX5A 2WL1A 1UIKA 1CJDA 3MPBA 3AP7A 4CTEA 3WG4A 4PLOA 5GZDA 2FQPA 2DCJA 4PCRA 2GH8A 1RC6A 1QY4A 4JGZB 3UV9A 4P9IA 1VBA1 4AHXA 2FZ1A 4Y5Z0 1O5LA 1GR3A 1SBEA 4QGLA 2RM23 2B5AA 4GXLA 4FPLA 2HWD2 4M3CF 5F6KA 1NYWA 4OFGA 3ENRA 1ENXA 5CBLA 4YG1A 4D94A 4IEOA 1BBT1 1RMU1 2ZGLA 4CDUB 3L2HA 2Y0IA 4IETA 1FV3A 4F3JA 2HJIA 4X8NA 4YG0A 2H8RA 1D2SA 3L9JT 4URTA 2XJ3A 2OPKA 3WV6A 4X4BA 4Q4V2 3ES1A 2E7TA 3EHKA 4JC1A 1AL23 1S0DA 5A32B 1K5MC 2D7FA 4C91A 3LAGA 4AFBA 2WS93 2X8KA 5DUVA 4E9KA 2VULA 1MZEA 2KPJA 4CEYA 4LT5A 3R6SA 1VP6A 4WVWA 1J58A 4Y26A 4UW6A 2WNVC 4XEZA 1YFWA 1VBD1 4LNVA 3ZHMA 4XHBA 2LYPA 4YZ4A 3OP9A 4MCXA 1IS4A 3HIFA 3USSA 4HN0A 3AJZA 1V6MA 2WA3A 2HWC1 4FPFA 3VV1A 1GNHA 1OPMA 3CF6E 3CJIB 4YG3A 1QMJA 2HKXA 2A6YA 3OY8B 2OFYA 1RUE1 4S2GA 3NO8A 3KZ3A 4XQ4A 3DL3A 3JB8A 1AYN1 2GNBA 4X6RB 4B7EA 4Q4Y3 1Q56A 3G6JB 3VL9A 2YYOA 2I74A 4YVWB 3D0SA 2WT0A 1APNA 1KS5A 1MZ5A 2YV8A 4M01A 2NZ9A 1H8TA 4UBGA 5ABJB 3DPRC 4XW3A 1W39A 4IEZA 2RS51 1K5MB 3N7MA 1G9FA 4YW2A 2RMU1 1RUG3 4QMAA 1DQ5A 3ZN4A 3JBG2 2K2SA 3M3QA 1C5HA 3AYCA 5T52A 2D5VA 1AL22 1VBB1 1MS1A 1QKQA 3O12A 4AVVA 4XETA 1SLBA 4MXWA 2IXLA 1HV0A 1RUD2 1WGPA 4MGIE 1LGBA 4N43C 2K0GA 4RS5B 3ZYRA 1TME1 1BK1A 1DWKA 4XJ8A 3ZXKA 2PELA 5IUQA 1T6GC 1A8MA 3HQXA 1LHOA 4YNIA 5KC6A 4I0AA 3SCHA 4B7KA 3KCCA 2GH2A 2O8OA 3V0BA 5IK4A 1S1AA 3JXCL 5A3LA 1DQ0A 4Z82A 5J37A 3JCIA 4N7UA 2YXSA 1YIPA 2AREA 3MGUA 2PHLA 4X4GA 3ZFFA 3NWKA 5SV5A 2AXVA 5JSOA 4AEDC 1WLTA 1WLWA 4N9HA 1PM7A 5KXEA 2JG9B 3FX3A 1Y3TA 4LR4A 2X53S 2IUOA 1LU1A 2VW0A 1RUJ3 4FPHA 4OHZA 4GMP1 1NXMA 2GNDA 3FC0A 3USUB 4MZUA 1AXKA 3B7HA 1LOEA 1CR7A 2H6BA 3OGGA 1PGL2 1FOD3 4XJZA 1RUG1 4Q4X2 1MQTA 5ACA1 1GSLA 3L1PA 2XL9A 2BW8A 3CJIA 2DVAA 4KNCA 4AWDA 3ZN5A 3IM0A 4NOTA 5FO8B 4QQOA 2JG9C 4I01A 2Y38A 4QPGB 1WCSA 2ZX0A 3J26N 2YY1A 4YW5A 1QP0A 4SBVA 1VBB3 2G4IA 3VZMA 1AX1A 2YUEA 4Q4Y1 4R4XA 2RR13 3WP4A 1GZWA 3ZXJA 4EROA 2KEKA 5BNOB 2JX9A 2D6OX 5JZGB 2IFWA 2ET7A 3ZO0B 1HW5A 3NV4A 5FLIA 4YLZA 3JUUA 2PHDA 4ZXKA 1LJ7A 4MH0E 5GLVA 4ES9A 3FYAA 3O9XA 3VLBB 4IA8A 4NHKA 5EFUA 4YG4A 1HRV1 4H7LA 3F51A 3OGJA 3MIDA 3DPRB 2ENRA 3O14A 3H1MA 3GYDA 1HQWA 1M4WA 1DIWA 2HEWF 2NN8A 3KCXA 1XWRA 1ZAYA 1S0JA 1NCRA 3NV2A 4MV2A 4Y22A 1I1EA 4RHV1 3ZN6A 5EJ3A 4F8DA 2WFPA 1A8DA 4MGKE 4Y22B 3C3VA 1QQP1 4OZXA 3TOJA 2XLAA 4LO8A 2ATFA 2JCGA 3AMPA 4XJAA 2CWMA 1R1ZA 3GALA 5FTTC 3S0MA 1PO23 1TME2 2OW4A 4FQZA 2RS13 1Y43B 4GQMA 2VOWA 2P37A 4FCAA 1TEIA 4ZU4A 3OPZA 3MDPA 4YVWC 4YM3A 2HYKA 1ZM1A 2I07B 2XJVA 3AYAA 4XF4A 4COYA 1J1LA 3WG2A 3ZPYA 1LEDA 2TBVA 1A3KA 1NCQB 4LLOA 5LK7B 3M3CA 4FAGA 3RSJA 3RS6A 3H1WA 3BOWA 4XFIA 1VBE3 2RS12 4LBLA 1S7EA 2UURA 3TAYA 1NCQA 4AHZA 1Z78A 4Y1YA 2A6CA 4HKOA 2CWSA 4XF9A 4XBLA 4OVEA 5HCBA 2RMU2 4AW7A 1KD7A 3OD0A 2BTVC 1QXPA 2WNUB 3VBFA 2HWF3 2E53A 4Q26A 4QM9A 4YVWA 4RSUA 3B69A 4IEXA 5T55A 5C4WB 2GU9A 1AUYA 3HR9A 5GLTA 3WP6A 4YVSA 4JCXA 1UU5A 1RGSA 1U5XA 4B3NA 2P3KA 2IXIA 1ASJ1 1QH7A 3LSDA 4FVVA 5C8CC 1KFXL 2VNGA 5BUVA 2RS31 4ISRA 1AU7A 1V6IA 1XE7A 4PBOA 4XJWA 1FMD2 3KS7A 2EALA 1AL0G 4PIZA 5FCCA 2CGOA 3SH4A 3OBRA 1V6OA 5LEKA 3VBOC 4YARA 4IQPA 4OUMA 5DUXA 1TME3 1EFAA 3I2DA 4FOWA 5I91A 4FTSA 4H14A 1RZRA 1KDKA 2XHKA 1OCTC 4GKYA 2WNEA 1SACA 3I7DA 3WZ1A 3AYDA 1DYKA 4M3CA 1HXS2 1JUIA 3IIAA 4MXVA 1OI6A 2JG8A 5JR7B 4XBNA 3EXUA 4GKXA 4Q4W1 3VBRC 2A3WA 3ZFFB 1X82A 4BWOA 1XRUA 5FQ0B 5T54A 3A0KA 1F2NA 3FLRA 4Y1VA 4P9GA 1LODA 3V65A 4Y20A 4IL7A 1ZBA2 4LBQA 2WNUA 4X4IA 3EBRA 4HLTA 1QHDA 2TUNA 2Q1MA 3N7LA 1F9KA 2FJRA 3ZMOA 2OUJA 1DU3D 1RHI3 4R9BA 4FOYA 3A0NA 3BU7A 1TE1B 2VGDA 2ZGOA 1D4M3 1V6NA 5I8SA 4JTOA 4WM7C 4P9WA 3HZIB 4HMZA 3Q9OA 1ND3B 1W6MB 1ZBE2 4WZFA 1UTXA 2MEV2 2ZTNA 2B45X 5CB7A 5DZFA 5J3UA 1ZZ9A 2PUGA 1VBC2 3N35A 2RR12 1BQPA 5T50A 3ZDSA 2ZOEB 1HRI3 3WUCA 3AMHA 1VR3A 2V09A 3WG3A 1LOAA 1QJY2 1MS0A 4OULA 3MIFA 3U4XA 4AGVA 2W68A 2LYJA 2BNOA 3W9AA 2VY0A 2IXHA 1W6OB 2GC3A 2HINA 4AGGA 2R16A 5I93A 1MS3A 1QP4A 4A7KA 3H50A 1DLLA 3MW3A 1DGWA 3D5OA 1QGLA 5DDJ2 1AYM2 3E6BA 1QP7A 3S7IA 5A7LA 2ZAHA 1BJQA 4Y1UA 4EN8B 1JYIA 2ZPXA 1XE8A 3BD1A 2E6VA 4W6YA 3TNQA 3R4SA 5J96B 1AZDA 4L11A 2IVBA 2O38A 4ISQA 4N53A 3D4KA 4RQPA 3ZYJB 3GF6A 1RUG2 2XJUA 3KT1A 2DFBA 4OI0A 2WFF1 5BNOC 3K51A 2X29A 1H2NA 2CNAA 4K20A 1DF0A 1GQHA 3AFGA 2ZS6B 4AQ2A 4DY5A 2JENA 2R0HA 5D8AA 3DKWA 1RUNA 1C57A 1JOJA 4LO6B 3ZYGA 2PHUA 4XMAA 4JGZC 4YFWA 2YROA 2RM21 1FOD1 2GZUA 3VUOA 3I8TA 1WMDA 3B93A 2DUOA 2R49A 4FPJA 1B35A 3SH5A 2ZBJA 1VAKA 1PK6B 5F6LB 1R093 4HVRA 4IV1C 1H4GA 3UL2A 1V70A 1H30A 2XVGA 1UMZA 1VBC3 2VECA 1BKZA 2YGLA 3DPRA 2BNNA 2XJTA 1DQ4A 3JQWA 4R8HA 4S2FA 1SFYA 4Q8KA 1GZCA 1LRHA 4FPKA 2UWCA 3LA7A 1N1YA 1C8M3 2ZACA 4OHWA 4IV3A 4JQRA 3AKSA 4YGDA 1V00A 5F1RA 2Q1ZB 2ICTA 5T5LA 4WVZA 4LHNA 5K8SA 1RUH3 2QCSB 3I59A 3R4DB 3PMSA 1CAXA 2XI8A 3RG0A 4OHYA