3SCIE

Crystal structure of spike protein receptor-binding domain from a predicted sars coronavirus human strain complexed with human receptor ace2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
180
structure length
174
Chain Sequence
CPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRFLRHGKLRPFERDISNVPFSPDGKPCTPPAFNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SARS coronavirus: mechanism of host receptor adaptation and rational prediction of future evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
molecule keywords Angiotensin-converting enzyme 2
total genus 28
structure length 174
sequence length 180
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sciE01
4KR0B 2AJFE 3SCLE 4L3NA 4ZPVR 3SCIE 2GHWA 3BGFA 5DO2A 3D0HE 2GHVC 4ZPTR 4ZPWR 3SCJE 4KQZA 4L72B 4XAKA 3D0IE 4ZS6A 4QZVB 3SCKE 2DD8S 3D0GE
chains in the Genus database with same CATH superfamily
4HYKA 3FQKA 1L3TA 1GMUA 1H3DA 3V2UC 4DV7J 1Q8KA 3CMAS 3GJQB 3R1HA 2LDYA 2E7WA 2NXJA 1B0PA 4QWBA 3EPGA 5LXRA 4AQYJ 4ZDNA 1IWAA 3DLKB 4DOZA 5LT5A 5HMXA 3D1OA 4J9RA 2WVDA 2QLFB 2NXCA 3KHRA 2FY1A 1ZA2B 1GQEA 5ETRA 4L74A 2CIMA 3F0NA 3PW0A 3DDKA 3L9ZA 4USKA 5AXMA 4CO4A 3PKYA 4IRKA 4U96A 3VTIA 5KFMA 4K7QA 3KLGB 4N76A 3M9MB 3UPFA 3C14A 2R8HA 2VH7A 3UDVA 5GAGI 1NJXA 4X4VA 4F4YA 1UWBB 3EGWB 4HTIA 2F3JA 2YNGB 2E1AA 3TJ9A 3RJMB 3N01A 1S1VB 4KRWA 1XNQF 2EK6A 3AT1B 3CD7A 2MKIA 2QMXA 1XMBA 4FF3A 1M5HA 5DG8A 3KMSA 3C6TA 1S0NA 3OV7A 4ZP7A 1IR2A 1VQSA 1XJWB 2QA4G 2OPQA 3KUGA 4DV2J 2VPYB 1D1UA 1WORA 2XSJB 3UI3A 4NLWA 4OJ1A 5GMKa 2W7PA 4UY85 3D1HA 1VJQA 3BF4A 3SQOP 5IC6B 2K1RA 3OFGA 3CWJA 2XGPA 1SL1A 4M63A 2IMWP 5J2QA 2EFGA 4DR2F 4U8VA 1F0XA 3MM7B 3PFOA 3V6HA 2W8KA 4URSA 4TVAB 2FLNA 1VQPS 3BV8A 3DN9A 1R31A 2P9EA 3OR2B 4WJBA 1UCNA 1P1LA 1XNRF 1UKUA 2N7YA 1IXKA 1JKHA 1H7WA 5HQLA 4GVBA 3FMWA 4IG3B 4QYZJ 1E6YA 4Q44A 2AYEA 3KJNB 1WHYA 1Q8IA 1RT4B 3M8QA 1IBLF 3RRGA 1JLFB 2ATCB 3CDBA 2FD2A 5F3ZA 2HFZA 5D6GA 3BSCA 5BR8F 1WOOA 4TY8A 5BXIA 1S0VA 4F8RA 3ONQA 3NS7B 1YJTA 5JJBA 5EWGA 2MLYA 2E7XA 3AD8C 1EZZB 1GEHA 1FFWB 1HQUA 1UL3A 2E1MC 3GONA 5KFSA 4X62J 2UP1A 2UVVA 4TQSA 1JXLA 1BMQB 3JB9k 4PXDA 2JX2A 5CYQA 5FDLB 2WVCA 4OX7A 4EO6A 2B8PA 3NL0A 1SV5A 4NZ6A 1GAOA 4DI6A 2ZH6A 2UU9J 4JUZA 1URRA 2WBRA 2OH2A 3PX6A 5AXLA 2RRNA 4USIA 3BBBA 4ANCA 2J0QD 2BOAA 4K4XA 4O4GA 1VCTA 4AXJA 1NKBA 3M6XA 5EN1A 1GXUA 5KTQA 1ZYQA 1IKYB 4NPOA 4JI3F 3W2WB 1YRUA 1RWUA 1X8DA 1ZAXA 2DR5A 4IO1A 4JI1J 3PJ9A 2G2ZA 2ZNZA 4DR2J 3UE2A 2YKAA 1VLOA 2EFPA 1U1NA 2OJ3A 1RE1B 4QWCA 4I2QA 4OHYA 3NGKA 1S1WA 3H8YA 1XNRJ 1TAUA 2G0IA 5L9NA 2GMLA 3BDPA 3CJ2A 4C6AA 4X64J 2MY8A 1N8RT 1YLXA 2QSWA 4YY3J 4CO5A 1X0PA 1AXQA 1ULRA 2C42A 2AP6A 4PXBA 3QZ8A 4WF9Q 1B64A 2DGXA 2E29A 2AYMA 3B4MA 1R0AB 1YWXA 3FZ2A 1VBZA 1VC5A 2I2YA 2MQLA 3DOMB 4ES1A 1ZZNA 3FFIB 1HNIA 3ZZRA 4EUVA 1M5VC 2CQGA 3LP1B 3TEGA 2B9XA 3NAHA 4K4UA 2AJQA 2C2MB 1ZH5A 1FI4A 1X4AA 4ZITA 1FJGF 5KFDA 2IA6A 3MEEA 4DCOB 4K0KJ 1UPPA 1IN0A 3CJ0A 1NPRA 2HRTA 4TYBA 1VQLS 4IOCQ 3L7PA 4JI7F 1S1UB 1NZ8A 2CPHA 3MCNA 3BGRA 4RW7A 2VFSA 3TO8A 5CABA 1P9QC 2ZD1B 1T9YA 2HHPA 2A6OA 1KRPA 1I1GA 1T9TA 5HANA 2UUBJ 1IBMJ 3GTYX 2Q6CA 3NKYA 1S4FA 4I7FB 2P2CB 2E9RX 2BR0A 3NNAA 3NMAA 2HHHF 4PYAA 3R7NB 1B4SA 4P75A 1PAUB 3V4IA 2G0CA 4NI2B 4RPFA 4AE5A 5DG9A 1RU1A 2IM2A 3MR2A 1JLAA 3I6PA 3QRQA 3UCUP 2EFNA 1Z1ZA 3DNCA 3C15A 1BHNA 2GZOA 5CHCB 5JVHQ 5A6WA 4MIAA 3W5ZA 1S6OA 4ECTA 3H7HB 4X4RA 4DLGA 1MMLA 2JLFA 2FJDB 2KXNB 5DGAA 2YKOA 2JHEA 3QIPB 4EYIB 1IBMF 4EZ6A 3QGPA 4CYUA 3VGSA 2CJYB 4FBUA 2BA9A 1NJYA 1EP4A 5IZHA 3PX0A 4B9LA 1F6TA 1GMWA 1BY9A 4KHPF 3HHKA 4OYAA 4OV6A 3D0IE 3QO9A 1UP1A 4KKOA 1HNVB 3UR3C 4XPCA 4QBUA 3UQSA 5J1EB 2Z4PA 3TUIC 5K8PA 1RT1B 4Y2IA 4YP3A 4C3LA 2ERRA 1HYSA 5CD4H 3HO1A 2B9YA 1U49A 1CJTA 3QFWA 4KGMA 1CULB 1REVA 1SC3B 2CUYA 3D6FB 3S1TA 2ZZMA 4KHPJ 4Q7AA 4USTA 2XULA 5MAOA 3WC2A 4UOFA 1TL7B 4UQGA 4ZVEA 4DFKA 2WAQD 3GV8B 1URNA 2QA4S 1KTQA 5CZVA 1HR0J 2K3KA 2HG4A 2RVJA 2JEJA 3EJMA 2P8IA 1C4AA 1Y4ZB 3GCWP 3ZZOA 4A47A 2OPRA 3CJKB 1V9OA 2V9KA 1G7CB 3N9UC 4ZHRA 4M5KA 2ZEJA 2KT5A 1FJCA 2HVDA 4L72B 4WPAA 5CXTA 3I0RA 8ATCB 2IC3B 5DM6Q 1VQ8S 1YRTA 2R7TA 5M2UA 3W61A 1JLBB 3KHGA 3JSMA 1U47A 1TK8A 3CT9A 3EXCX 1C0TB 1VQ4S 2R3VA 1YK9A 2DNYA 2XZTB 3LP0A 3RBZA 5GADU 3HVTA 4QYZK 1MSWD 1S0OA 4UT4A 1X9MA 4X4NA 2E5GA 2K06A 2HFSA 2JVRA 4DPTA 4UOCA 3ENWA 4DUZJ 3PXGa 2MJNA 1SH3A 1HA1A 3C6UB 1TV6A 1DARA 2BE2A 3F56A 3HFZB 4NRTA 5HI7A 1VK8A 2NS1B 2J9DE 4GC6A 4USUA 3H20A 4DSEA 2GHPA 4CO3A 4RUHA 5A8RB 3VWSA 1T9XA 5C42A 4FBTA 2V8DA 1W2IA 5GAGU 2XS2A 3I82A 5KG2A 4H4KC 2D3ZA 2IJFA 1WTBA 1Y5NB 1QAJA 1CPZA 5EX0A 4WIIA 2H51B 3FZBA 5AXKA 1I94F 4B9UA 2XNQA 3IBWA 2BQRA 3O5TB 3ET6B 3E51A 4OX6A 2FZCB 1XMOF 2B6AA 4TNOA 4X84A 3MPUB 4DL3A 1LK5A 1X7VA 2E5HA 3K7RA 3UD3P 4LFBF 1RKJA 2IBOA 2DB1A 3I0SB 4LVOP 2HMIA 1EB0A 2XM3A 1FDBA 2W9AA 2QRRA 2IJNA 4FPIA 2RQ4A 3KK3A 3T41A 2AV5A 3KTQA 3NGSA 2CWXA 3PRVA 3HSDA 3J80Y 3HFKA 2FC9A 3A8IA 4I2PA 3RB4A 1M5PC 1O8BA 4RUAA 1AW0A 4O3NA 2CXEA 5D0EA 4ZPDA 5KG1A 3VZIA 3SCJE 3TYTA 4KQZA 1YZ6A 5CH7B 2Z0GA 3B4DA 2NZ4A 4K0KF 1RISA 1TK5A 1W7WA 2DHAA 1B0VA 4HT7A 4WE1A 1X4HA 1FWLA 5KG4A 3DGPA 5KFGA 3HT0A 2FJAB 4FYDA 2BMBA 1NZAA 1C1BA 1JJHA 3DFEA 4ZMMA 5M2RA 1S4EA 2KZZA 2QL9B 1MNEA 2KT2A 3ZXWA 5LXYA 3PW7A 2YX4A 2HWTA 1YTYA 3VAHA 1RT7A 1H0HB 4OYZA 4ZLLA 2UUCJ 1TMMA 4F4KA 1UJ6A 5EGYA 3THPA 2DGTA 1T9VA 4OLPA 3BSAA 4NA3A 4DG1B 2C2RA 1VRQC 3ILIA 2C1EB 3RGIA 7FDRA 2FIUA 3D3BJ 3RU0A 4NMLA 4ZPCA 2V2VA 3KLHA 2HS3A 3GIJA 2PMWA 5CA5A 3KK2A 2XG8A 1S9FA 1FRMA 3PM9A 3D54A 4MKYA 3T5KA 1KSPA 3PYFA 3MMAB 2VB6A 2FB0A 2C3PA 2ZDPA 3HZEA 3L7UA 5GADI 1S7HA 1SC4B 1YDLA 2GQ2A 2OO4A 2ZHOA 3IS9A 4HT5A 4KYZA 1RWMB 2WSFC 4HH1A 2QSFA 2VOOA 2DRDA 3DLJA 3PACA 5T7LA 3AB2B 1W26A 2VZ9A 4NZ7A 1VQNS 1H74A 2WVBA 2V5HG 2WONB 2ZWOA 3O6QA 4WP3A 4OI6A 1APSA 4KH0B 4WFYA 2XLJA 4JV5J 3WQPA 2M4MA 4OYIA 5CYMA 1MLAA 1S6QA 2VC0A 3JTNA 4LR8A 3LA0A 5GAHU 1SQFA 3QNWB 2KTQA 3CO9A 5HQ8A 1HBUA 2BZ2A 2PT0A 3DRSA 5KG3A 3C8YA 2ADBA 3MD1A 4PUOA 3AXKA 3EWGA 3SV3A 5A0YB 4DF4A 4Z7YA 1EIYB 3ZTRA 2JZ5A 2FHMA 4MFBB 3I5BA 2W2MP 1NU4A 3LOUA 5BYRA 3QAEA 1F5AA 2HHQA 1LWCA 1WELA 2LQ5A 4F0HA 3J81Y 4OZ0A 3ILLA 4NYPA 3X3UA 4JI7J 3H25A 1RACB 4K4VA 1VIXA 3JSYA 1U26A 1FO1A 1UTAA 3PHTA 3WC0A 4PYDA 4G3IA 2EK1A 2NSCA 2FTRA 3VGVA 3TWZA 4E98A 4K4ZA 1R0BG 3K5LA 4JYAF 1H73A 1Q4RA 4Q5VA 8RUCA 1S1XB 4UY8T 1RJJA 3U7JA 2HRYA 1C1CA 4JI8F 5KT5A 4LF4F 2HHSA 1JJ2R 2HVZA 1RWNB 5IWAJ 5KT2A 1YBTA 2DBBA 1RBAA 1WWHA 3KG0A 3FUYA 2FHJD 1LWEB 1OPZA 1NH8A 3C6TB 1C4CA 2AGOA 3PZPA 2OGUA 4LSZB 3QMQA 3EGVA 2OPQB 3TNVA 2ZC4A 2R7OA 1FRXA 2L3MA 1U1PA 5HROA 4AFFA 2EBEA 2R8GA 4UUWA 1FWPA 2QN6B 2QGFB 1TL5A 3MM9A 1CS4B 4B02A 2AD9A 2R2UA 4G1QA 2C2ZB 3Q23A 4PQUB 1WF1A 2J9DA 1S9EA 2FLPA 3BBFA 2EFVA 2ZBPA 2BW7A 2NCKL 1KQFB 2R8IA 3DYAB 2NREA 1VHFA 4CLFA 3CW2C 2K7KA 1PYTA 1YJ7A 2NSBA 3BZQA 1VRUA 4M94A 3HSJA 3P8BB 3U27A 4K5SA 5IFMA 2V4QA 3VCDA 4OJGA 3MURP 3QATA 4LIRA 3TAMA 2E5IA 3ENVA 3R9LA 1TKTB 1RTZA 1U45A 3K5MA 2HWIA 1GTEA 2BRLA 3VR1A 2LQ8A 1IBKF 2R8JA 4X4PA 2W4CA 4C97A 2JVOA 3DRYA 5HBMB 3FVYA 3CE8A 3GYXB 3IAM9 3PX4A 4TY8B 4DWIA 2KB2A 4MYTA 3WZ0A 4ATNA 2AGPA 3QSIA 1HQUB 3TJAA 2R7XA 2BJ8A 1S6PA 4U95A 4DDFA 1P27B 3RBEA 1HNZJ 1VJWA 5E0OA 1OYDA 3H5YA 1HKAA 2CAJA 3KLFA 2W1BA 2CQ2A 4DV3J 5FDLA 5B0EA 1IBKJ 3CCQS 1AUDA 3JXOA 2WCXA 3R5GA 4QQBA 3MCOA 1QM9A 1RAAB 3K5NA 1HARA 2L48A 3W63A 1N0UA 2EBGA 1ZTWA 3C46A 2OPPB 4OYBA 1IR1A 1S59A 2A18A 3HVWA 3I4PA 2ACMA 4DHVA 1D9FA 2XLKA 4CWBA 3D3CJ 4TLQA 1K0VA 2F65A 3G2XA 2H48B 3MDFA 4I6WA 4A48A 1R6VA 2DNHA 2J0WA 4CNYA 4ETXA 1Q5VA 1X31C 1RTHB 2IRYA 3DM2B 3AOCA 2V69A 3BH7B 1DJ0A 1HQ2A 2EG2A 4NZ0A 3OL8A 1Y0HA 4B9TA 4KIAA 4WK1A 2X51A 2QFJA 1S1WB 4C3MA 4FS1A 4LRAA 2UUAF 3DOLA 1AFJA 1N36J 3ITHB 2ASJA 1AUSL 2J8AA 5D3GB 2DNLA 4NCBA 3NY0A 4N41A 4N8NA 3R5CA 1Q16B 1NPKA 5DLGA 4R0JA 4CI0B 1EETA 1AZSA 1RCOB 1TMJA 2H1YA 3PR4A 4B9NA 1SIZA 4X65J 5DQHA 1XNQJ 2R4FA 3HSGA 3LALA 4J9OA 1VC6A 4KBIA 4UZCA 1HBOB 2FDNA 1RCXB 3ENQA 1S9GA 2LVWA 3KLEA 3T1HJ 3W2VB 3MEEB 3OPKA 4N8OA 1R7IA 2OFGX 3R5BA 3P4UB 1FF2A 1OSDA 3C16B 4RL1A 2KHCA 2V4JA 3GPAA 4K2JA 2C2EA 2CJAA 2OMOA 3J80U 3HP6A 1PC4A 3K2YA 3BGRB 3MCSA 5EUHA 3QRPA 1G2EA 4IQXA 2ZD1A 4X65F 2HBQB 1DURA 1MMDA 5B7WA 3OJSA 4LF9F 5FD1A 4I7FA 3FEYB 1U24A 1BXNA 4PRFA 1S49A 2W8LA 3OD2A 4NA1A 3QGGA 2VHGA 3V4IB 3TRGA 4HHUA 4CLUA 1FJEB 3DHWC 4P2FA 5AT1B 1JLAB 2UUCF 3VAFA 2FGCA 5LJ3Y 5HK4A 3HX9A 5HMZA 2MZTA 2PD1A 1RB0A 4H54A 4FXWA 5IXUA 2RDJA 5C25B 4DF8A 1FNOA 3DLHA 3CNQP 4Q2MA 1YHQS 3QYYA 2ILYA 1FEHA 1XEZA 2P9GA 2Z56B 4WKYA 2XMTA 3UCZP 1T02A 4P73A 4EEYA 1HFEL 1X4FA 2RUGA 2YKMB 1HBMA 2JC1A 3AA8A 2D9PA 3L4BC 3PTWA 3FBFA 4GVLA 1CC8A 2R7WA 4MK9A 3H59A 4DL2A 3EZOA 1WHWA 1X5SA 3LH2S 3NS6A 4V1Ak 2C2KB 1O0PA 3OBIA 4EWTA 2VASA 4QJVA 1Y3JA 3LGNA 3W66A 5A6PA 4JI0J 1HYSB 4ZCIA 4YHHJ 4PG5A 1S12A 3HJFA 1REVB 2QIFA 1HBNA 2VL1A 4OLOA 1SJFA 2OUGA 2RF2A 3LANA 3TX0A 5KFWA 1WD6A 4N47A 2VONA 4B3OA 1WJ9A 5F8NA 5DDPC 3A8JA 1TR0A 4P72A 2IHR1 3W5YA 3G6YA 1KFSA 5JVGQ 4DMZA 2DCUB 2W4PA 5K8NA 4CLWA 3ZNUA 3J7YI 5LMNJ 2HK3A 3DI6B 4YHHF 4P6QA 2W9BA 3BSOA 3RUBL 3Q8SB 5T14A 1AB8A 1WC0A 1JJ4A 2UXDJ 2CPDA 3AODA 3UNYA 3KWMA 1IR0A 2VG7A 3NCQA 2I0XA 4NLVA 4Z37A 4JI5J 5LMUF 2G2YA 2QX0A 1YI2S 4X4QA 2WHOA 2NUHA 3CJQA 3QQCD 3HVTB 4F4WA 3T5JA 3DLBA 4H4MA 2MSSA 1T03A 4DR4J 4UQTA 4GO5X 2W2OP 3JTPA 3DHXA 2BJ9A 3SDEB 3M2RB 3C6UA 4RW8A 2BE2B 4X66F 4J9PA 2XMKA 5HSPA 2DIUA 2DNPA 1NK0A 2Y1JA 4HTJA 3CJ8A 1CSJA 5B0DA 1NM2A 3UN5A 4WP8A 2ZUGA 2V94A 3MM5A 1U1MA 2M8DB 4A8YA 4NCAA 4OYOA 3ZZZA 1RTJA 1TFWA 2PA8D 1FE4A 3W60A 3ISZA 2IAJB 3MEDB 4WYWA 2DNMA 2ZH2A 2B5JA 3WBZA 4I6AA 3GV7B 1TL3B 1CBKA 2B6AB 3O2IA 4LIWA 4DFJA 3DRRB 4ZPAA 1WEZA 2OIHA 1RHJB 3NG8A 1VI7A 1ZAWA 4KSEB 1R43A 1KFDA 5JXSA 2HMIB 4WXWA 4Q8EA 4ZLJA 4ED5A 1OSCA 3PEJA 3C66A 1S76D 1U0SA 3GYGA 2BKOA 2EC0A 1LW0A 2NPIA 2V2KA 3O3LA 1HHTP 9ATCB 3SI8A 4A4JA 4KC5A 1IBLJ 5DDQC 3V81A 3DMJB 3IM8A 1SQEA 2QE5A 3E8OA 3T1AA 1KKHA 2BM0A 2N7CA 2V2QA 1MU2A 4ZIVA 1GMVA 1R8BA 5L1LA 4ES3A 4J9MA 2AJ2A 2AU0A 1W2BR 2DRAA 2HLTA 4NOHA 2HS0A 3T1HF 2X1FA 4ECXA 3A3NB 5D15A 3QFHA 1VIOA 2ZH7A 2AKWB 3QSYB 4F36A 2CQHA 1CJVA 2FJEB 4YMEA 5DGBA 4NL5A 4OHWA 4A8QA 3K8VA 3QT7A 5DRKA 3BPDA 4DU7A 1S1TA 2FZKB 3EMTA 4YB1P 2EKNA 5KFXA 1XMQJ 1E6VB 2M70A 1IVZA 1S7IA 2ZH8A 4A46A 2HVEA 1GMWD 1RAGB 3LPYA 4KFBB 3BREA 1XIQA 3OR1B 4DSKA 1SUQB 2WTFA 2UUAJ 1A0OB 2YPYA 3HHLA 4K2XA 3IRXB 4Y3CA 3W64A 4C98A 1D9DA 4CQ1A 4KO0A 2RQKA 2HQ3A 1N33F 3A8KA 1NNDA 3RB3A 5KG7A 3K17A 1RWPB 2F9DA 4DG1A 1IM4A 3IR5B 4OYMA 1KOHA 1WNEA 1P9YA 1IKVA 3PFEA 3MFIA 4ETZA 1CQNA 3KLHB 2EC2A 2YQ3A 3FEXB 1WI8A 3EICA 4CNZA 3HHDA 3NRBA 2EFOA 4B3MJ 2Z2LA 3UN3A 3SYZA 3I5CA 4JV1A 3IS9B 4K59A 2YQ0A 3Q83A 2ZZTA 3OLAA 2GAHC 2CJXB 2LEBA 1KEKA 1HWKA 1UVNA 4M5DA 4LT6A 1X4EA 4USWA 2YKQA 3D0GE 3D28A 1K1SA 3JS9A 5HJYA 2GCFA 3NWRA 1DRZA 1IWGA 2V6AA 1NPPA 1RUSA 4J9LA 2HAFA 2Z57B 3FKBA 4ZKAA 4DR1F 4PAAA 2CRLA 3M8PA 3CCJS 1S6QB 1WG1A 2KYZA 2DR9A 2YNFA 1RAJA 2HHHJ 2Y0SD 3VV2B 4JB8B 3WIUA 2L41A 4DV5F 3CC7S 2LEPA 5E3AA 2I5JB 4C7QA 3DRSB 3EPIA 2OLWA 2Y1IA 4BC9A 5L1JA 2IRUA 3A13A 4QR1A 1LW2B 3GLJA 4ICLA 2KFNA 2A6MA 5I42B 2B7BB 1RT2B 4MFBA 3UVJA 3TARA 2VF3A 2A1BA 2V67A 3HJVA 4ZCLA 4C2MA 1G4CA 1L3KA 4KB7A 4LF2A 4KJIA 2JEFA 1RT6B 2DIVA 4NLXA 1LWCB 2VC1A 4LRCA 1FFSB 1U2RA 3OXGA 3BGLA 3JAMY 2WW4A 2MHNA 3BYPA 3GIIA 2MJUA 4LF5J 3R8YA 4ED3A 3RBXA 2FVRA 4O44B 4YN3B 3MWBA 1Q95G 3GR1A 1UWAA 4LF9J 2QMWA 3M9OB 1U0HB 1NK9A 4DR6J 2DCLA 2K3IA 2RMLA 2E1CA 1EAYC 3NNCA 1FKPA 2H65B 1IQTA 3QPIA 1WKKA 3AOAA 4NLUA 1G6BA 2HQFA 4LSLB 4CT9A 3DLGA 4AL5A 1BWEA 2N4CA 1JLEB 2Y9HA 2D3UA 1F3FA 4TYAA 3CCSS 1SC1B 2PI4A 3A3PB 2ZZNA 1EQ0A 2PFDA 2B9WA 2GS8A 3FBEA 4NCGA 1LWEA 4C11B 5KFCA 4OQJA 3SEOA 2HGNA 5ETNA 2ZBQA 2J7WA 2CPEA 3AFGA 3ZO7A 3DOKB 4F04B 1YIJS 2VA3A 2R7RA 2CQ1A 1UVKA 3D6TB 4O4RA 1CJUB 2HQIA 1KDNA 4OJHA 1S79A 4A8KA 1DLOA 2HNDB 3KJQB 2YNIA 2F40A 2RRBA 2ZKUA 5KFFA 1RQ0A 3ZZYA 3P5BP 4G1QB 1QVFR 3G8SA 1R3NA 2XTJP 1NUEA 1RHRB 4K5RA 2QLBB 3CMQA 3G8QA 3LP2A 4OI0A 2VUGA 3RAQA 3RAMA 4ZVUB 2CNNB 4PWUA 1VRUB 2G9OA 3HVRA 3W62A 4HLBA 3BO3A 1RXOB 3MR7A 4LSNB 3TAMB 2J7UA 1PJ6A 3OLBA 4I64A 1KQGB 1TKTA 4WU2A 1HMVB 2F63A 4MK7A 1FNXH 1N32F 5KFVA 4LF8J 3SCKE 2C3OA 3MOZA 1J27A 4FXDA 4JI4F 1JK9B 2GV1A 4ILRA 1ELOA 4QIWD 5HBMA 4C8OA 4JI6J 1TFYA 2AWZA 2FGOA 4ENOA 1UEKA 4RZRA 2DNRA 3OJUA 3L95X 5E5NA 5ETOA 3ELHA 5DZ6A 5L1IA 4LFBJ 4DV2F 1ZA1B 5B0AA 2EPIA 3KNGA 5IM0B 3K57A 1R6YA 4NWBA 1XN9A 2V68A 2VU5A 5KFRA 1JXVA 3OSPA 2VQEJ 3EGZA 5AJ3F 5G0RA 5I4MA 1LEOA 2BQUA 1UJ5A 4MT1A 1LXJA 4ECRA 3G9CA 4PABA 2ZOGA 2OPPA 3DXSX 5D4PA 1QSSA 3ZTSA 1TKXB 2H5IB 1PBAA 4A8SA 1UVMA 2FQQB 2A0FB 3LGMA 4A8WA 4O3PA 2HWHA 3POTB 4AT1B 5F8GA 2UXBF 3MPYA 5ETTA 3PIPQ 3R6LB 3CJ4A 2DHSA 2MDAA 3GJRB 2R7VA 1YJ9S 1HWUA 3V4MA 5IQ6A 4AD6A 4A8OA 5DM7Q 4LQ3A 5FLXY 3N28A 1RA7A 2WOMA 3FSXA 3PG9A 4DUYF 1RWXB 1SVDA 3SCIE 1F2HA 4NLRA 3MM6B 1RAOA 1Q82T 1SKWA 5LJ5Y 4ZK7M 2VD3A 3FCVA 3DU6A 3PY8A 3ULHA 3IGVA 1MWYA 1N6QA 5KFNA 2LCWA 3NOCA 3PW2A 3FDSA 1L5UA 3QT6A 4J7CA 4LR9A 3CPWR 1KLNA 4HR2A 2OPSB 3NCPA 4HHHA 1RTDB 2DK2A 3AD9C 3L09A 4C48A 3PRBA 4IFYA 3WIVA 4X4TA 1YZ7A 3GR0A 1PG5B 1XBWA 1Y9OA 2VPWB 4WFZA 2UUWA 2B51A 3EE3A 3SFUA 1Q1KA 4MKBA 5KFHA 2MTLA 3EM1A 3MEKA 3M2VA 4CRJA 7AT1B 5F8LA 1F2GA 3QBCA 1MW7A 1KR4A 1LOUA 3HXMA 3BDEA 2CJBA 2J7KA 2IM1A 2W01A 1S9GB 4Y28C 3KLEB 3TUPA 2BDPA 1CJKA 1QTNB 3FRYA 2ZH1A 3BR8A 2RUSA 1FDAA 3CSKA 5HAOA 4U67Q 2V4JB 4NLYA 2MLZA 4DPUA 1LWFA 2D69A 3DLEB 3MTJA 4KAIA 4RUCA 2MXYA 3KHLA 3FCHA 2IJRA 3OUYB 2G4BA 1NK8A 1SJ1A 3K0JA 1WOSA 4FVMA 4UOHA 5E3PA 4ZVFA 1XR7A 2MGZA 2EEYA 4J91A 2O1PA 4DV1J 3R6GB 1Q5YA 1FDNA 1ZPVA 1SBRA 1M5SA 2M2BA 2O66A 4X64F 3EVMA 3I56S 3HI9A 1UW9A 3RW6A 4F26A 2C2NA 2ZM6F 5GAEU 1RAHB 3PW5A 1Q7LB 2NPFA 2VJVA 3R5JB 1C0UA 1RHUB 1WACA 3SV4A 3V6JA 4DU8A 3IGNA 4NLGA 3MMBB 4P74A 1N5VA 1K47A 3MM8A 2HVHA 1SKUB 2VG6B 3MHYA 1NMEB 1QE1B 3KLIA 4RW6A 4AL7A 2DGWA 2YKNA 4I56A 4P52A 3T9ZA 1CC7A 3BEGB 4LFAF 1RAFB 4MIBA 3D7SB 3O44A 4LRBA 3T6BA 2ZM6J 4ZJQA 1S10A 3RZAA 2DGOA 5F9NA 4DV6J 2PFFB 3GV5B 3GIRA 2DGVA 4NYZA 3TQEA 2KG0A 4C0OC 2ZHBA 4IG0A 4OMFG 4RUBA 3RYLA 4DSFA 1FX2A 2XMVA 1RKIA 4F0KA 5DG7A 1VDHA 2OTJS 4ZVTB 1U8SA 1OYEA 1RT3A 2KJWA 3W8GA 4Z2XA 4R5PA 4NXNJ 4UTGA 1TKZA 1UVLA 4KPCA 3EZUA 2KXFA 2B4VA 5M2PA 5GAHI 1N34F 3AB4B 2EFQA 4CTAB 2DH7A 1J5OB 4KV8B 2AYBA 1TL4A 2AIRB 1EKSA 4LF4J 4UZBA 2AGQA 3M6UA 2DY9A 4IFVA 5A8WB 4MTPA 2MHEA 4XDDA 3UDEA 2DO0A 2YWWA 2W9BB 4DN0A 2LP4A 1Q0NA 4MMOA 2CQ3A 4KGKA 4USVA 5K14A 4FS2A 1L3UA 5F8IA 1DQAA 3KXDA 2OD4A 5JMNA 4DCJB 2YBVA 3W3SA 5E3QA 2E7VA 3HF5A 2ALYB 3CCTA 4DV1F 2HZCA 2L9DA 2HKEA 3TX8A 3FSIA 2LXFA 2KU7A 4DSIA 5DQIA 2XYGB 2MKCA 2RB7A 2H5EA 1XR6A 4DL7A 1HD0A 1ICEB 3MMCB 4B9MA 1JLCB 3DRPB 3M2RA 3J81U 1ZZFA 4RW8B 4L76A 1TL1A 4P2XA 3IN5A 5J2MA 3P49B 2HHUA 2QA1A 2XMMA 1YJRA 4IOBA 4QOTA 2GGPA 4ID5B 5KT4A 5B0CA 3OFFA 3M8SA 1DTQB 3MM5B 4RBVA 2FVQA 1QLNA 3OTCA 3D68A 2AJFE 4O3QA 2A2DA 2MZJA 3M30A 3JQJA 1BQMB 4PPZA 3J7Z5 1A7GE 3SXLA 2IAJA 3MEDA 2B3TB 3Q8PB 1WUUA 5GMDA 1WKLA 1JNRB 3VZHA 4ALZA 3RAXA 3DRRA 5KFPA 4U7UD 4X4UA 4PG4A 4DUYJ 1PCAA 1AT1B 2PE8A 2HPUA 1FESA 1UETA 5KFIA 7FD1A 3HMJG 5C5JA 2XO7A 2VJUA 4JP8A 1OY9A 3KMQA 3IWXA 3MXHP 1P1TA 2W7AA 3H5UA 1QUPA 5HVHA 1RYRA 2PGCA 1UAWA 2AJ0A 2LXIA 1IQZA 4Q43A 3LAKA 4LUBA 1M5KC 3V6KA 5FJ4A 2CQBA 3DXBA 2ZE2B 5J1NA 4F0MA 1VRTA 1SB6A 1FTCA 1KHVA 2PC6A 2PIIA 4M5NA 3TW0A 2DITA 2KN4A 1MU2B 3DU5A 4RWXA 3H4BA 3KLGA 1DTTB 1VOMA 4Q0BB 3BO4A 5K20B 2CQDA 4ZPVR 2PEHA 5IV4A 1NKCA 4K4WA 1HW9A 5F9LA 3QJJA 4TU7A 4QWDA 3EYZA 5IQQA 5FLXU 5ETQA 4UF4A 2RS2A 1X4BA 2FYXA 2GVZA 4FKYA 3SIPB 1WKJA 5E7OB 2UVRA 2EW9A 1RLDA 3ZFVA 5IT4A 4BLGA 4ILLA 1S1TB 2OAUA 3SFGA 5J2PB 4F3OA 1M0SA 1Z2LA 1TVRB 4GMKA 4USHA 4C0HA 3G82B 1FKAF 3NAIA 4KFBA 1U6ZA 2HBYB 1FKOB 2I38A 4Y2KA 4DX7A 1SUQA 5KT6A 5IC4B 4FVCA 4U7UK 2N3LA 4QZVB 3TA1A 2Y8WA 3SQGA 5KFQA 4A8MP 3WHIA 2BE7D 4BCAA 4W98A 2RSQA 3K5OA 1QSYA 3VAKA 1IM6A 5EX3A 2HHTA 4I4BA 2ZJPQ 5ADZA 1JKHB 5BYQA 1T0TV 4DR5J 2V9WA 2G0JA 1CVJA 4GVBB 2VPZB 3BO2A 5THWA 3MPVA 3I9ZA 2XSFA 1NXIA 1NO8A 2Z2ZA 5DO2A 5LSLA 5DDOC 4CLZA 4YR0A 2ASLA 2M0GB 4MJKA 1JLFA 4OFZA 3AJ1A 1FWKA 3UO0A 4C0BA 3M2UB 3VAIA 4E2FB 3LGHA 1NSQA 4X62F 2GW8A 2XLIA 1NK7A 4XPEA 2RKIA 4M5DB 3M8WA 2ZOFA 4DV6F 4OYWA 2BANA 2R9LA 4DL5A 1NJWA 4A8FA 3M05A 1TKDA 4Y2AA 5CCMA 3VGUA 4RNOA 2IPOB 2MZSA 3QLHA 3UD5A 1ZM4A 1WG4A 2XWXA 1N5SA 4L75A 2YWHA 2ABYA 1EX8A 1YJUA 1WF2A 5K8MA 3UW1A 4KR0B 3HT3A 1I3OB 2B4OA 3VHQA 3EUNA 3MPWA 1BGXT 2RQCA 2MKKA 1JLGA 3T9NA 3T1YJ 3MOJB 2B8QA 3ILOA 1LW2A 3DCAA 4ICLB 2MQMA 1I5OB 1RT2A 3UVJB 2F7VA 1ZM9A 2Q1LA 1RLCL 1KTVA 4HDGA 2HURA 3WX4A 3QWUA 1VISA 1D0EA 4F7VA 3QGHA 2AYGA 3C19A 4DSLA 2OHDA 4ECQA 5KAKA 2DNKA 4XAKA 1QDUB 3M6VA 2CWKA 3KK1B 2M5YA 1HWJA 1TUWA 3ZNJ1 2DEJA 4F67A 2MQOA 2VBWA 5J1PA 3A4TA 1X9WA 3H42A 3VQTA 4IRCA 1RWVB 2DD8S 4KGXB 1KLMB 3K89A 4IH6A 3PR5B 4E0DA 2OKQA 1RTIA 3H5SA 3ICLA 4NA2A 3UNGC 2ZH5A 1YITS 2YWKA 2G1HA 3Q24A 1U4BA 1HPZB 3MD3A 3N6LA 2CJ9A 2BEFA 4LSLA 4OIXA 2FC8A 3HPOA 3DLGB 1RGVA 3HKWA 2KO1A 4ID8A 1JLEA 1UPMB 2O5DA 2VKRA 5D78A 1RAEB 2QL5B 4HEA9 3FFIA 1NSPA 1HNIB 2Y1LB 3DC2A 3VVTA 4IDKA 3OL6A 3BN7A 2JNJA 4MH8A 4CM0A 3IA0A 5A2QU 3HSZA 3LTOA 1GT8A 2LYVA 2YX7A 3H98A 4QW9A 2R7QA 2CJKA 4O3RA 3NWGA 4M5JA 3AHPA 3DOKA 1M1KT 2IVFB 1H98A 1RP5A 2ZC3A 2VFRA 2HS4A 3FSYA 4EZ9A 4PWDB 3R3TA 3ETMA 5KT7A 3QAUA 1DLOB 2HNDA 1QD1A 3AJ2A 2YNIB 4M5GA 2GVDB 5KG0A 1RAIB 4DV0F 3LO3A 4DFMA 1VQKS 3D9BA 3K8WA 4F2RA 1UFWA 1AFIA 4WTYA 3OVAA 2UVWA 2DNQA 2RU9A 4KHRA 3D6HB 2FUG9 3LP2B 4DX8H 4R8UB 4CLYA 1DY3A 1SKRA 5G4DA 3ZZ0A 1G1XA 2R2SA 4P10A 1N5QA 1CLFA 2V2ZA 4DZ6A 4LSNA 3N6NA 2O01C 3OTBA 4LREA 2WSCC 2LECA 4ELVA 5DJBA 1Y3KA 2MQNA 3KG1A 4HH0A 4HI1A 2N4DA 1MN9A 3FNNA 3QIPA 4ITSA 4QR2A 4WIQA 2F9JA 3KFWX 5HL7Q 2RHSB 2KVIA 3Q8UA 3OTOF 1D8ZA 2DT9A 5C7PA 1IKXB 2N82B 3ADAC 1HWLA 3G71S 1SQGA 1EP4B 1FT8A 4JI6F 3RB0A 4OX9J 2FY8A 5I3UB 2HNZB 2CZVC 2C2OB 4FYWB 2W9CB 5AE2A 2GIQA 4G1IA 1H72C 2YX1A 3N6MA 2ZHAA 3EDRB 2D3OR 3R2CJ 2N3OA 2Z8QA 3QO9B 4PXCA 4Q45A 2NYIA 4PPDA 3ZTQA 2GJFA 4DR1J 2DTJA 3CC4S 3DLKA 2EKYA 1R8CA 4U7CA 4YY3F 2IM0A 4M5MA 1UW4A 2JEGA 1CJTB 3GFZA 4WYLA 4DS5A 1U6BA 1WG5A 3CEDA 1LFWA 1FHTA 2E44A 1F9HA 2RH3A 4IYQA 2E9TA 2ROPA 5E41A 1A9NB 2JLGA 1F1BB 1VS3A 4GRSA 2JDJA 4ZIWA 3CO0P 3QT5A 3ZZUA 5IV3A 4KGVB 3BR9A 1WSVA 2HNYB 1KD1T 4L73A 4Y34A 1Q86T 3G4SS 2XC9A 1S1VA 2AW0A 3OXLA 4QIGA 4ELTA 4Y6IA 1TUVA 4USJC 3ZZTA 3I0RB 4ZN1A 2RE1A 5DLFA 2IC3A 2FLLA 2HRUA 1FXLA 4YB6A 2I9SA 3MM6A 4BS2A 1JLBA 3JSMB 5C24B 4DR6F 4C9DA 1H2UX 1I51B 2XSJA 3GSDA 1NSKL 5FIIA 6FD1A 1FEEA 2APOA 2KRRA 2QV6A 4DQQA 1RTDA 1FXDA 2K1RB 2IMOA 2YWGA 1CEZA 4W90B 1FD2A 3AY0A 2EXUA 4DQRA 2HFOA 1N48A 3MM7A 2CNKB 2YH1A 1U48A 3MAHA 4G65A 2BQ3A 1U2CA 4AYBD 4TU9A 1L3SA 2F8HA 4X4OA 1DZ5A 4PEOA 1S5ZA 4ZLNA 4XIUA 1OMSA 4QWAA 1QAIA 3KYLA 4F02A 3CCRS 4KHMA 1C2PA 1PAEX 4FNHA 3S7RA 1VC0A 4NX9A 1UA0A 4RW4A 4FN5A 4ZA1A 1K1QA 2X7IA 1B3TA 1VFJA 3MAAA 1F5CA 2M8HA 3IO1A 4NLTA 2RILA 3UDCA 4DZDA 4F3QA 4RNHA 3GIKA 3WDOA 4M8LA 2KI2A 5HO4A 2MGZB 3KOAA 4WU3A 3MUTP 2KYXA 1ZTTA 4JI2F 1NK4A 1NDLA 1NJIT 4Y2CA 4TY9A 4L3KA 4WXOA 4B17A 3JAMU 2QT7A 5E2QA 4PKDB 2HAIA 4DV4F 4LRDA 3T5LA 2F1FA 4A8XA 2WVEA 1C0UB 3BPSP 3R5AA 1XC9A 3G87A 5BYSA 3FBBA 1A6LA 4OV1A 3HHLD 3MMBA 4V19X 2L08A 3H4DA 5A2QY 2F4VF 2H4WB 2CKWA 1QE1A 1N0VC 1X4DA 3KLIB 1KBRA 1QAYA 2KJVA 2J6TA 1P6TA 1J5EF 3GB0A 3W2WA 2B0GA 3BM7A 5KFOA 2M3DA 2P5VA 4JI5F 2BW2A 4RNNA 1WC5A 3C2PA 1ZPWX 2XQCA 5H9EJ 3P96A 4DX6A 2OD6A 1SC6A 3VQSA 4EI2A 2JOQA 4NMXA 5D8HB 4IG0B 4JV0A 3EDQB 3TOQA 5J2NA 3H0PA 5IWAF 4I2QB 4DR7J 1U25A 2HGMA 3BQ1A 3FJ2A 2HFVA 1KQSR 1TKZB 2CZ4A 1QUVA 2U2FA 2KFZA 4FDFA 1U6FA 4CM2A 2ZJQQ 3AAWB 4ZS6A 5K5MA 2XO6A 3RRHA 1R0AA 3MF5A 4IFVB 5A8WA 2QA2A 5ETKA 3BH6B 4U6PA 4QW8A 4ZJOA 4LF8F 3AA9A 4U9RA 3TVKA 3IWNC 1F9EB 1IJFB 1WTFA 1XERA 1DFDA 3LP1A 1R8PA 3RRKA 3CJRA 4LQ9A 1DBDA 4P2SA 1K8AT 3PCOB 2ZNYA 4WK3A 2J6SA 2J0SD 5LL6d 3MECA 3PRDA 5KFJA 5KFBA 1OQ6A 1VLYA 2AEMA 5T7LB 2HYIB 1SCJB 2MYFA 4OZNA 4WBFA 3M1VA 4CH7A 4RWWA 3HCXA 1X4CA 1S1UA 1V5VA 2BJ3A 2CQ4A 2EWHA 2WONA 2XS5A 2HK2A 5J2MB 1R8HA 1TL1B 3PO4A 5CYMB 3BBCA 2GGPB 3BYRA 4ID5A 2BABA 3B54A 3P45B 4OI4A 3TI0A 1DTQA 2A3JA 2CADA 3AXMA 1FCAA 3CCZA 4NI2A 3ZC4A 1BQNB 2W2PP 3H40A 3M30B 2XGQA 3MZIA 3BSNA 5KT3A 3RW7A 1EQMA 4YOEA 3W1YC 2HFNA 2NYHA 1W25A 3CB4A 1PIEA 3TR5A 3CULA 4OZ2A 1HNZF 3VGTA 4K50A 1V6HA 5D0RA 1FRHA 1SH2A 2VBXA 4IO9Q 4KTQA 2QTWA 3N79A 2FLOA 5KG6A 4CYUB 3TZYA 3H5XA 1BC6A 5C2CA 3JQMA 4ECYA 4NLPA 3D0HE 1RZMA 2M7SA 2LLZA 5B0BA 1LV5A 1SJ3P 2BXJA 3UD4P 1XMOJ 1BD6A 1TTHB 2NLWA 3ETOA 4RX6A 3CCES 2DJWA 2QL7B 2W25A 1EHWA 4KKOB 1HNVA 2LQ9A 4UUXA 5SUHA 5LMUJ 1HNWJ 2ZE2A 4DCPB 2RHQB 2CA9A 2DH8A 2V8GA 3OW2R 2DRBA 3NGUA 3A3OB 1S1XA 3TA0A 4P71A 1FXRA 1T9WA 1B70B 1WI6A 1DTTA 2MKJA 2YH0A 4BBYA 4Q0BA 1S57A 2CDQA 3KDNA 2YVSA 3PYEA 4LF6J 1B0TA 1C1CB 1EJ7L 1OQ3A 1EARA 2GFFA 4W4MA 4HKQA 1PKUA 3FC9A 3QT8A 2HIYA 1TL7A 2W24A 3OTDA 2D41A 4FXVA 4I1TA 5HMYA 4ECWA 3HDSA 2MPUA 2A2CA 3OTOJ 4ZVSB 3MR6A 4J9SA 4DV7F 1VQ7S 3MI7X 5ETSA 3KDOA 5J2PA 3ILJA 2BJ1A 1B99A 2YWEA 1DHMA 4QU6A 2GIFA 2OPRB 4OX9F 3CJKA 2AHOB 2OMLA 2HEKA 3QGIA 3VAMA 2CJQA 2GA7A 5HROB 1WC1A 3QRRA 1U09A 3I4HX 2BVZA 1CS4A 2YWFA 3PW4A 1Y7PA 2FVSA 2WK4A 3G6ES 3SQGB 2VODA 3PNIA 2CQCA 1NKEA 5L1KA 3LP0B 1QAXA 2D9OA 1HQEA 1X5TA 1VQ6S 2VOPA 3DYAA 2YY3A 4N5SA 5F8JA 1K0TA 2RNEA 1LKZA 3MEGA 4WZMA 3EVOA 2COLA 4OZ1A 3TVZA 1XK8A 4FKXA 4B3RF 4YQWA 1U1RA 2RAQA 1FD8A 4OZ3A 4PQAA 4M5LA 4ZVGA 3PJWA 2HQCA 3LW5C 2GQCA 2LQBA 2V8HA 1TP7A 3MPDA 5C42B 1M1GA 2V34A 1REGX 2YKPA 4UOGA 4TU8A 3M2UA 4CH1A 1VYAA 5I3PA 2VV5A 2RKIB 2HBZB 4DV3F 3T1YF 2JFDA 2XCPA 3P6YC 4U8YA 3QLHB 3GQCA 1NB7A 2GJ2A 1T3OA 2DVIA 4LFCF 2IYGA 2J9CA 4ZVHA 2BYCA 4RJVA 1FNMA 5HJXA 3W65A 3KLFB 2ZH9A 3OXFA 1SPBP 2F8EX 2JJ4D 1TUGB 5AE1A 1T9UA 4DLEA 4AXIA 3T3FA 4I0WA 4DPWA 3IRWP 3IP0A 2H54B 3GYNA 1QJHA 2HW3A 4RBTA 1RBOB 1LWXA 1WOPA 2QC3A 3PYGA 1KS2A 3U1MA 4I2PB 4LVNP 3JQKA 4M95A 5K9FA 2CPIA 5CAAA 2DR6A 5LM7E 3J7ZT 4RNMA 4X66J 4IR1A 3THVA 1X5OA 5ITHA 5F8HA 4HI2A 5U47A 4O3OA 4JI0F 2B4UA 3BJYA 4BDPA 3NP5A 1VK3A 5L8RC 1SL2A 2ZUAA 3IBCB 3KK1A 1T7PA 4WE1B 2V8VA 1RTHA 2XWYA 4CLPA 1O51A 2ZKTA 3J7AN 3DGPB 3MUMP 4YS2A 3B6BA 5L39A 5EWFA 5HATA 4ANEA 1OY6A 4CP5A 4P7TA 1C1BB 1D3WA 2QYCA 3O1LA 1N5TA 3HHNB 3OL9A 2YTCA 3OFEA 2VIHA 2R7UA 2C3YA 4LBPA 1PGZA 1HPZA 2AZ3A 2KM8C 1MWZA 2JSXA 5CZXA 1JMTA 2DISA 2W2QP 3D6MB 3GFHA 2B4PA 4HDHA 1RT7B 4BWJA 3SCLE 4IOAQ 1BQXA 1UEUA 2ZOMA 1UVIA 3G6XA 2FJWA 2UXDF 3LPEA 4D3HA 2F8MA 4LF6F 5ETLA 4IDKB 4CLLA 1LXNA 2XB2D 5LOQA 3JSBA 1K73T 2KDOA 3BGFA 3B78A 1YQHA 3GCXP 1R0CB 3R27A 3GILA 1HBOA 4JI8J 3AD7C 4LFCJ 1VMBA 5D77A 1XTZA 3W2VA 1J5EJ 4ZPTR 2M88A 4XK8C 3CCMS 1GXLA 2Y3YA 1UJ4A 4CDIA 4EBEA 2R8KA 4ECSA 1NAQA 3Q89A 4LRFA 4DV0J 1T8EA 2OP5A 4QU7A 3NGDA 1T05B 1Q79A 2D74B 1UEVA 2ZBRA 4WP9A 1BWVA 2PN6A 2XBPA 5IOLA 1DQ8A 4H4OA 3W5XA 5LSRA 3CDEA 3KJFB 2KRBA 3BQ0A 3IBFB 4QR0A 3OL7A 4J37A 4DSJA 1PILA 1RT5A 3O8WA 4QPTA 5B0FA 2B56A 2XZWA 4R8UA 5A8KB 1OO0B 2CG8A 2NXNA 4B08A 1X0FA 1NB2A 3L7OA 4WWSA 5AJ3J 5KFAA 4CLKA 2NQPA 4Q2LA 1X60A 5IT9U 1UVJA 1NHVA 5C25A 2MLXA 4J9UE 4X4SA 2C3UA 2LA6A 3CJTA 3VAJA 1HBUB 1OS5A 2IRXA 3BKUA 3DDIA 4K4YA 4B3SJ 3HZGA 3OVBA 4JV5F 2UXBJ 2QEXS 1MMNA 1HI1A 2RJZA 4PUOB 2LDIA 1IKXA 1QSLA 3PJXA 5A0YA 3FRZA 3JTOA 2YKMA 1RWOB 2DPJA 3N0VA 1IKWA 3W9JA 2P6SA 2HNZA 2QO3A 2W9CA 5I3UA 1F60B 3ZTOA 2R2RA 5H1SV 1HI0P 4DFPA 2CQ0A 3CF5Q 3PV8A 2ZVSA 4LMZA 3QJPA 1BE4A 4CIOA 4G1PA 2OEKA 4LR7A 1N88A 2DKOB 3LQVA 2J8SA 2HLUA 1NHKL 2RQMA 2W4DA 2BX6A 4YDDB 1SI9A 2LU2A 4WFBQ 1FK9A 3WX8A 1WDTA 4F4ZA 1JB0C 2FVCA 2Q3PA 2IYIA 3M6WA 4RW9B 2LKZA 5F0WA 5I3QA 4GC7A 2BKPA 3ISNC 4B3RJ 5D0HA 1NJZA 3DGVA 1HD1A 3S6EA 3OHAA 1SJ4P 5KOXA 3IFEA 2DHGA 1VQ9S 1FVSA 2PDAA 2XHCA 3IR7B 3UDLA 3V5RA 1JLQB 2BACA 2MZRA 3CIZA 2MQQA 1PO6A 1ZETA 2XZDB 2HNYA 4BHQA 4DEZA 3PEHA 4ZPWR 1Z4UA 3KJVB 3I87A 3JYTA 3IAS9 1FRKA 1MROB 2O67A 2VFVA 3HKZD 1N32J 4ZP9A 1NEEA 4DPYA 1OPIA 2VG7B 5C24A 3M4XA 5CQGA 3TAQA 1S48A 1N52B 3M32A 4EK2A 4DJBA 4L3NA 1TU0B 2M52A 4F3MA 3CJ3A 3MM9B 1UFLA 3CUNA 4HVZA 3TUZC 5KFUA 2XY6A 4NXMF 1U1LA 2CYYA 2Q66A 4PQUA 1S9EB 4PXEA 4NLOA 4TQRA 4IR9A 2WB4A 2PI5A 4C3KA 3QIDA 5MLCV 3HLUA 2VDIA 5F8MA 3BKTA 1RTJB 3MFHA 4ED1A 4E8UA 3G8TA 3UN2A 4Y0FA 4GKKJ 3R2DJ 2B5JB 5D4LA 1TL3A 1SXLA 2I1RA 4RW4B 4QCLA 3IG1B 1OJ4A 2J9EA 2ROEA 2Z30B 3NCRA 1GX6A 1UZDA 2IA0A 3AQOA 1FTRA 3MCMA 2D1CA 3MAAB 3R7BB 4PG7A 5HN0A 5HLFB 3VVUA 4DV5J 5GAEI 1ITPA 4DV4J 4TXSA 2BUNA 2J5AA 3I5AA 1JXEA 5HQMA 3LWMA 4ED8A 5E33A 2XMJA 3FMBA 2CPFA 2L9NA 2GMHA 2DPIA 2F4VJ 3OTEA 4CLSA 1Q8LA 3E01B 1Q8BA 4ZN3A 2FHJA 6AT1B 2LA4A 1S6PB 3DMJA 4RO0A 3V81B 4I67A 4OL8A 1D09B 1KVIA 5DQGA 5F41A 1TZ0A 5LSOA 3IWLA 4DPXA 2EVZA 3CXCR 2ZBIA 2YNHA 1KVKA 2C2DA 1VR6A 1SKSA 5KG5A 1YJWS 3UR0A 2K2PA 2HIQA 3I9V9 2PMZD 2XHWA 4ED4A 3W9IA 2GIRA 2DO4A 4AL6A 3RR7A 4HL9A 1YVFA 1NHUA 3QZ7A 1V3ZA 2YXLA 1NLKL 4IQMA 1RA6A 4RNFA 1YGYA 4KY3A 1WC6A 2Z2MA 4J9QA 2OTLS 3Q8QB 4B9SA 1JQGA 5F3TA 2R2TA 4R0EA 1SJQA 4K4SA 1Q78A 1RABB 4EBDA 2XYPB 3DM2A 1VBKA 4FYVB 4ANDA 5HVGA 5J2NB 1V3SA 4LBIA 3OR1A 2W7OA 4O0NA 4RU2A 3DOLB 4OI2A 3ITHA 5ETVA 1JJCB 4KO0B 2HBRB 2DNNA 5DS7A 4DN9A 5D3GA 3AOBA 3OHBA 1N5YA 2FZGB 1FFGB 5KFTA 4J9NA 3CDWA 2KVQE 4HACB 1HHQA 4Y65A 1M5OC 3CMES 1N36F 1M1HA 4B3MF 4OZJA 2E9ZA 4IH7A 2CPYA 1EETB 1FDDA 1AZSB 2CFXA 4XDCA 2HGLA 2QJ3A 1TELA 2DEIA 4ZVPB 3BQ2A 4DQPA 2E5LF 1WDDA 2R7SA 2KM8B 5L38A 4ED6A 1AA1B 2NXUA 3MECB 4RKUC 1HHSA 4NLQA 4PG6A 4CZCA 4OYXA 2GO9A 3C16A 3NOGA 4B3TF 4GKJJ 3M1VB 3MTKA 2UU9F 2BRKA 4I69A 3OFHA 4ED7A 3F73A 5EWEA 1Q53A 1YG0A 1N4LA 2RDDA 2ASDA 9RUBA 4DS4A 2I5JA 1BQNA 1KNZA 2QFIA 2VG5B 2YPZA 3G86A 3U1LA 3KHHA 3M8ZA 3N4WA 4G6VB 2MKSA 3K59A 1VQOS 2HSEB 4EYHB 5I42A 2FHOB 4N7TA 4EFAC 1OWXA 1N34J 2ZFHA 4ELUA 1Y11A 1HL6A 3HD1A 2Y0BB 3K5PA 5RUBA 1YKWA 2FPHX 5DETA 1D9AA 3NGTA 3QWPA 4N77A 3H2VE 1ROFA 4NRUA 4TN2A 2OI2A 4FNIA 1HBMB 2M9KA 4MIWA 3SBMA 2XY5A 4JI1F 2KG1A 2XYHB 1M90T 2JFKA 1WEYA 3DDNA 2HQDA 4H4KA 1XR5A 1EKRA 1G3OA 2UUTA 3AJDA 2G1DA 4M5IA 4BC7A 5EHHA 1KC8T 8AT1B 4NXMJ 2CZ9A 4AQYF 2LXUA 2UVUA 4CO1A 1S72S 4C8LA 3MAQA 2MSTA 3NBPA 2H5JB 2Q6BA 3FK4A 1NDCA 1ZOTA 5B09A 4LF1A 3GG1A 1LFPA 3TA2A 4DL4A 1K44A 3MR3A 1FJGJ 2WB1D 2Q43A 4MKAA 1HBNB 3TZZA 3GIMA 3CD0A 2HVIA 3TANA 2GO8A 1V3RA 1VHIA 3D67A 2H9ZA 4QYRA 5KFYA 2RF2B 4B3SF 2GNKA 1YJVA 2R42A 1YBUA 4Z7CA 2UXCJ 4B3OB 4C11A 3V6DB 2B9EA 1GTHA 2AX0A 4YFUA 3FCWA 2RT3A 1R27B 1PYSB 3DI6A 3J7A1 3QJLA 2VPXB 3RG6A 2KH9A 5CYJA 2PA3A 3PVXA 5H9EK 3A12A 1WEXA 5ETMA 3CD6S 3KNAA 3NXZA 4IH5A 2FVPA 2DXDA 2GHWA 2ZVIA 1VBYA 1O6XA 1PC5A 2W2NP 2X1GA 2ZH4A 2XNRA 2HZAA 4JBCA 4QIVA 1HQEB 2ZWPA 4H4MB 4MKVA 1T03B 1VBXA 1KOOA 4LJMA 2IDEA 4TKTA 3MEGB 1YJNS 1XWLA 2IVYA 3SDEA 3SMZA 3GMGA 3ZTPA 1Y5LB 4HHJA 2VA2A 3BB5A 2EI5A 2ZJRQ 4O3SA 1RHQB 2DR7A 4DR4F 2E1RA 2XI3A 2Y1RI 5K8OA 5HP1B 1UA1A 2MZQA 2XMWA 1U2FA 2RRAA 4F2SA 5D4NA 4O0IA 5H9FK 4OZ5A 2KL8A 2DGQA 2DH9A 2VBZA 1JWWA 3GFXA 3TP2A 4LF5F 2HHXA 4ER8A 2RD5C 1GNKA 3VF0B 3GSIA 3W7BA 2BJ7A 2VKZG 2AMCB 1XQIA 5H9FJ 3KKFA 2BBEA 4NYOA 2D3O1 4PG8A 2CG4A 4KT0C 1PBUA 3CDAA 3EXYA 4YEAA 5IM0A 3TQ1A 1T11A 2JEIA 2X3GA 1LW0B 3FBCA 1YBAA 3N5FA 2VICA 3A8EA 2H4YB 3IR6B 3NLCA 5D4OA 3D1QA 5G0RB 4ECVA 2D7SA 4YR2A 3ISND 1KQKA 4LFAJ 4WKRA 5T41A 3Q2SC 5E3CA 4V19J 4NE9C 1NDKA 4NLDA 3R97A 1WHVA 3C14B 2QLJB 4URGA 1UWBA 3BN4A 3RBDA 2YNGA 4ED2A 2AEFA 4DR3J 4C4WA 4OZLA 3CDUA 4TLRA 1NH7A 1CJVB 1GFWB 1UZHA 2JC0A 4DUTA 4EMDA 1U1KA 1UFKA 1SH0A 2CDRB 3TZXA 5CD4A 3CCVS 4JOUA 1JX4A 2FJXA 3OVSA 4WCEQ 4FF2A 1VQ5S 3PKMA 4EGLA 1E6VA 3GWCA 2KFYA 3RR8A 2JLEA 2LMIA 1DAXA 4ZVQB 1HNWF 1YX2A 2IIHA 2J76E 2P6TA 2BJDA 2CPXA 4MAKA 2VQFJ 1CQMA 4F25A 4DL6A 4I68A 2PO4A 1HLWA 1KONA 2WVFA 3HFVA 4LBHA 3K58A 5LMNF 4C8KA 3E2EA 3EVWA 3HHLB 4CLTA 2MMYA 3IRXA 4DPOA 1KVJA 2DXEA 1WF0A 5J2QB 1VQYA 1GH8A 4PZVA 3IM9A 5D0GA 3Q2TC 1FVQA 1RHMB 2DYAA 2GMJA 2CQIA 4J5OA 3LWLA 2XMAA 1U1OA 3OR2A 2A10A 4WZQA 1IKVB 4CO2A 2MQPA 1NBEB 1I94J 1TAQA 1WC4A 3DRXA 4XTTA 4IG3A 1E6YB 5B0GA 1YSJA 2U1AA 2Z58B 3F44A 4OI3A 1SL0A 3C3LA 4W92B 1FE0A 4LF7F 1RT4A 4N56A 2OELA 3M8QB 1LWFB 2ASYA 3DLEA 1B7YB 2DGSA 1BUXA 4M1KA 4OI1A 3TZWA 3G96A 1T05A 3X1LB 3TUJC 3M8RA 2Q79A 4H4OB 3OQ2A 3KG4A 1T3NA 4OHZA 5A76A 4J9KA 5C2GA 1RT5B 3J81j 5A8KA 1LNQA 3PYDA 2C28A 4KE5A 3U02A 3NMRA 1GXTA 2HZVA 3FGVA 1ZS6A 2UV8A 2AEJA 3M8PB 4C8ZA 4OYPA 1X4GA 2YNFB 4ZP8A 4DR3F 4RLEA 1RHKB 5CYQB 4WFXA 3SSRA 2WBMA 1S77D 3Q8VA 2OEJA 1JNZB 5BR8J 3M8YA 1SV5B 3GZ7A 4C8YA 2CNOB 1YRXA 2ADCA 2FJVA 1H2TZ 2DHXA 1ZBTA 3S01A 2LU1A 2P9CA 2VG6A 1IKWB 2GQQA 3AH6A 4FYYB 4O4GB 4PWWA 3W9HA 1PSDA 1HR0F 2YKNB 2XY7A 3R5DA 1IKYA 1ZM3A 3GE9A 3TEHB 2GHVC 2MKHA 1RT6A 4RR5A 4CH0S 1HNXJ 4J9VA 3UWTA 1S97A 1WHXA 2JL9A 1GK8A 2GX8A 4EBCA 3PDNA 3D4JA 2RIJA 5AE3A 5L46A 1RADB 4O44A 2V8PA 3Q8RB 1DQ9A 2KT3A 3SZ2A 1FK9B 3IMQJ 2CVEA 1U0HA 1FERA 4RW9A 2OFHX 1RT3B 1GX5A 1NK5A 4WTOB 2J0XA 2V50A 1HNXF 1FKPB 2VFTA 3G6VA 1RDRA 4OJ3A 1K9MT 2Y8YA 2VQEF 1J5OA 1I6JA 4KV8A 4ED0A 4RBUA 4X2BA 1JLQA 4ZPBA 2BV3A 3M9NB 1S6UA 5ETPA 3HHEA 3JYTB 2ILZA 3DOMA 3KJVA 2UZAA 1MROA 2AT1B 2X1AA 2MQ8A 2AF6A 1KWMA 2OSRA 3ENAA 4NCGB 4ZCKA 5K14B 2ALZA 1ZM2A 2G13A 1X9SA 2HHWA 4WFNQ 1SIWB 1NSAA 3GP9A 3P5TL 5IS2A 1VGYA 2DY1A 1QVGR 4IKAA 4C8NA 3NEKA 2CPZA 3M32B 4O23A 1O5JA 1CJUA 2ZITA 1FRJA 5DDRC 3EGNA 3LUYA 3US5A 3MMCA 3L3CA 3DRPA 3H2UB 4RW7B 5DZ7A 4GKKF 3ZZPA 1S99A 1Q81T 2MY7A 3HM9A 2UUBF 3MGJA 1TK0A 4FPRA 1KN6A 4QPXA 3LF0A 4AUKA 4ERDA 2BE9B 1IUJA 3I55S 3GU0A 2KHDA 1U1QA 3C15B 3TVYA 3CIMA 4B9VA 3I96A 2QG9B 3NS5A 4FP9A 3CGIA 4KGZB 1SJRA 1XMQF 2DNZA 2UV8G 2V4RA 5F0UA 3IG1A 2RDIA 1HMVA 3BGUA 3IXQA 4UW2A 2F4FA 3SSQA 4C8MA 4CO0A 4PR6A 4URQU 5HLFA 3LAMA 1FRLA 1T94A 1AROP 5JUMA 1N56A 4YR3A 4KH1B 2HFUA 2BKNA 2IM3A 2HQGA 4ZVRB 2E1PA 1PYOB 4DQSA 4NASA 3IC1A 2VFUA 1X5PA 1N33J 3E01A 3Q8YA 5GVQA 4IRDA 1H6KX 4NXNF 4Q8FA 1HWIA 3H90A 2ROGA 5HMWA 5J1EA 1VRTB 1MWQA 2MKYA 2GAGC 3B8HA 4L6V3 5KFZA 3TAPA 4JYAJ 1NCLA 1RT1A 1Z2ZA 2AJ4A 2IDLA 2WRMA 3I31A 5BJRA 5GMEA 3NNHA 1S0MA 2YNHB 4J90A 3HK2A 4JI3J 2F5GA 2JWNA 2PMHA 3BKFA 3CD5A 2NR0A 1CULA 2AZ1A 2H3EB 3KUEA 4Y00A 4CT8A 3CJSA 4ZVOB 4QWEA 2UXCF 2ZH3A 1TKXA 2GVZB 2K8GA 2OEMA 5KOWA 4RU9A 4ZOSA 2V63A 2YQ1A 1KHWA 3POTA 1WC3A 2G2OA 5E3RA 3TJ8A 4QIFA 4F4XA 3PO5A 3W8PA 2KZMA 3CC2S 1LK7A 1P8GA 2O3DA 4ZP6A 2RU3A 2BOPA 4FF1A 1IBCB 4ZHRB 1TVRA 4F50A 2XS7A 1Y10A 3DKDA 3CCWA 3G82A 5CCLA 2CPJA 2WOMB 1FKOA 3T19A 4P7VA 2XCAA 1V5IB 3OSNA 1H7XA 4GO7X 2LQJA 3BS9A 4NEYA 2MZ1A 4IUFA 1C0TA 4PCQA 4YDXA 1N6QB 3D66A 2BM1A 3JSRA 1N5YB 5B08A 2OPSA 2B7CB 2WSEC 4EO8A 4HACA 2WZ1A 3CJ5A 3NGRA 1MN7A 4IFYB 1F9FA 3H2LA 1PJ5A 1TV6B 2JH3A 1U7LA 4B3TJ 1R8AA 2E5JA 5A8RA 2QZ8A 3M2VB 4OX8A 3Q22A 2QMUB 3GG0A 3Q86A 3CCLS 1NK6A 4DX5A 4ILMA 2E5LJ 3R1LA 2L9WA 4I6YA 4P9SA 1CJKB 1FA0A 5KFLA 2NUUG 5SZTA 2EG1A 3ET6A 2WW8A 4KPYA 3GJTB 2BANB 2ZDOA 3MMJA 1FJ7A 4GKJF 1IJEB 2DNGA 3EZ5A 3D5MA 4YB7A 2FJBB 2XEXA 1MG7A 2POKA 3PHEA 1AYEA 1NDPA 1U8WA 1FX4A 2B43A 3OUYA 2I6WA 2NXEA 1PJ7A 5KFKA 3I0SA 3THTA 2J6UA 1QY7A 2V0NA 4DQIA 5L9XA 1F5BA 2MB0B 1VQMS 1QTMA 3F41A 2AX1A 3SSSA 4ZCMA 3KK3B 1OY8A 2LFVA 1RI7A 1JLGB 2VG5A 3FEZA 4D3GA 1RBLA 3RB6A 2AQ4A 3B82A 3AQPA 2IY5B 2DXFA 1OIAA 4FZVA 2ZBCA 1Y5IB 1RSCA 1RYSA 2QLWA 3HULA 1T95A 3MUVP 3N5BA 1HIYA 2CVIA 2X3DA 1N54B 1H2VZ 4EU0A 1HI8A 2QLXA 4ES2A 3R7SB 4NEZA 1J2VA 1Y00A 2DHHA 3MM8B 3U1NA 2RS8A 5KFEA 1HW8A 4OHVA 2CNLB 3VALA 1LQ9A 1R89A 1WSRA 4RW6B 4BWMA 2ATLA 2DGUA 2I8EA 3GJSB 2XI2A 3S8SA 5IT9Y 1KLMA 1NRKA 2PEBA 1KP6A 1B7FA 3EX7B 2Z2YB 3NBPB 4XO0A 1RTIB 2KXHA 5IT0A 4ECUA 4P2MA 1U02A 2VBYA 3HD2A 4ZJLA 3FQLA 4R25A 2CQPA 3E3XA 3T6JA 2ACYA 4R5PB 3PIOQ 3VAGA 1ZAVA 2QYGA 1UMJA 4MK8A 2VQFF 4F4AA 5EDWA 2MEWA 4JI4J 3RTVA 3A1YG 1H38A 4CTAA 2DR8A 4JI2J 2GC8A 3BGOP 3V6DA 1BLUA 3DLLQ 2HHVA 2KKHA 2BJEA 2OSQA 1RU2A 2IFXA 3CCUS 1L3VA 1RK8A 3KK2B 4PWDA 4FYXB 5HVFA 2C22A 4FF4A 4QIEA 2LEAA 3MMAA 2E66A 4YB5A 4DUZF 3MR5A 2GVDA 3OT9A 4OHXA 3KUHA 3KLVA 2SXLA 3I32A 2GJIA 4JV2A 3D2WA 2VDHA 2XMUA 1CG2A 1ACMB 1JIHA 3CVKA 4NLSA 4S0MA 1FRIA 4Y2MA 4USMA 4DBQA 2JRSA 5AXNA 1F3VA 1TQLA 2IBKA 4LF7J 1RWWB 2AJ1A 3UCGA 4WFAQ 1JLCA 3Q0AA 3HVAA 1RWKB 4K4TA 3GFYA 1D8YA 4M5HA 4DL0C 4ZLPA 1Q7YT 4CCHA 3P3DA 2PSZA 4MYUA 4ECZA 2NZCA 5HP1A 4DR7F 2DNOA 2IVMA 4DXLA 2FHKA 3CTRA 2K7JA 2X1BA 1BQMA 3HHLC 3M7VA 4K8RA 4YUDA 3J7YU 4DR5F 3UFCX 2C3MA 6FDRA 3T5HA
chains in the Genus database with same CATH topology
4HYKA 3FQKA 1L3TA 1H3DA 3V2UC 3CMAS 3R1HA 2LDYA 2E7WA 1B0PA 4QWBA 3EPGA 5LXRA 4ZDNA 3DLKB 4DOZA 5LT5A 5HMXA 3D1OA 4J9RA 3KHRA 2FY1A 1GQEA 3PW0A 2CIMA 3DDKA 5AXMA 4CO4A 3PKYA 4IRKA 3VTIA 5KFMA 3KLGB 4N76A 3M9MB 3UPFA 1NJXA 2R8HA 2VH7A 5GAGI 4X4VA 4F4YA 1UWBB 3EGWB 4HTIA 2F3JA 2YNGB 2E1AA 3N01A 1S1VB 4KRWA 1XNQF 2EK6A 3CD7A 2MKIA 2QMXA 1XMBA 4FF3A 1M5HA 5DG8A 3KMSA 3C6TA 1S0NA 3OV7A 4ZP7A 1VQSA 2QA4G 2OPQA 2VPYB 1D1UA 3UI3A 2XSJB 4NLWA 4OJ1A 5GMKa 2W7PA 4UY85 3D1HA 3BF4A 2K1RA 3OFGA 3CWJA 2XGPA 1SL1A 4M63A 5J2QA 2EFGA 4DR2F 1F0XA 3MM7B 3PFOA 3V6HA 2W8KA 4URSA 2FLNA 1VQPS 3DN9A 1R31A 2P9EA 3OR2B 4WJBA 1XNRF 1P1LA 1UKUA 2N7YA 1IXKA 1JKHA 1H7WA 3FMWA 4IG3B 4QYZJ 1E6YA 4Q44A 2AYEA 1WHYA 1Q8IA 1RT4B 3M8QA 1IBLF 1JLFB 3CDBA 2FD2A 5F3ZA 2HFZA 5D6GA 3BSCA 5BR8F 4TY8A 1S0VA 4F8RA 3ONQA 5JJBA 1YJTA 5EWGA 4YB5A 2E7XA 1JWWA 1UL3A 1HQUA 2E1MC 5KFSA 2UP1A 2UVVA 4TQSA 1JXLA 3JB9k 4PXDA 2JX2A 5CYQA 5FDLB 4OX7A 4EO6A 3NL0A 1SV5A 4NZ6A 1GAOA 2ZH6A 4JUZA 1URRA 2WBRA 2OH2A 3PX6A 5AXLA 2RRNA 4USIA 2J0QD 4K4XA 4O4GA 4AXJA 1NKBA 3M6XA 5EN1A 1GXUA 5KTQA 1ZYQA 1IKYB 4NPOA 4JI3F 3W2WB 1YRUA 1RWUA 1X8DA 1ZAXA 2DR5A 4IO1A 2ZNZA 3UE2A 2YKAA 2EFPA 1U1NA 2OJ3A 4QWCA 4I2QA 4OHYA 3NGKA 1S1WA 3H8YA 1TAUA 5L9NA 2GMLA 3BDPA 3CJ2A 2MY8A 1N8RT 2QSWA 4CO5A 1X0PA 1AXQA 1ULRA 2C42A 2AP6A 4PXBA 3QZ8A 4WF9Q 1B64A 2DGXA 2E29A 2AYMA 3B4MA 1R0AB 1YWXA 3FZ2A 1VBZA 1VC5A 2I2YA 2MQLA 4ES1A 1ZZNA 3FFIB 1HNIA 3ZZRA 4EUVA 2CQGA 3LP1B 2B9XA 3NAHA 4K4UA 2AJQA 1ZH5A 1X4AA 1FJGF 5KFDA 2IA6A 3MEEA 1IN0A 3CJ0A 4TYBA 1VQLS 4IOCQ 3L7PA 4JI7F 1S1UB 2CPHA 3TO8A 3BGRA 4RW7A 2VFSA 1P9QC 2ZD1B 2HHPA 1KRPA 1I1GA 4I7FB 2Q6CA 3NKYA 1S4FA 2E9RX 3NNAA 3NMAA 2BR0A 2HHHF 3V4IA 2G0CA 5DG9A 4AE5A 2IM2A 3MR2A 1JLAA 3I6PA 3UCUP 2EFNA 1Z1ZA 3DNCA 5CHCB 5JVHQ 5A6WA 4MIAA 1S6OA 4ECTA 4DLGA 4X4RA 1MMLA 2JLFA 2FJDB 2KXNB 5DGAA 2YKOA 2JHEA 3QIPB 4EYIB 1IBMF 4EZ6A 3QGPA 4FBUA 2BA9A 1EP4A 5IZHA 3PX0A 4B9LA 4KHPF 1BY9A 3HHKA 3D0IE 3QO9A 1UP1A 4KKOA 1HNVB 3UR3C 4XPCA 4QBUA 3UQSA 5J1EB 2Z4PA 3TUIC 5K8PA 1RT1B 4Y2IA 4YP3A 4C3LA 2ERRA 1HYSA 5CD4H 3HO1A 2B9YA 1U49A 4KGMA 3S1TA 1REVA 2ZZMA 4Q7AA 2XULA 5MAOA 3WC2A 4UQGA 4ZVEA 4DFKA 2WAQD 3GV8B 1URNA 2QA4S 1KTQA 5CZVA 2K3KA 2HG4A 2RVJA 2JEJA 1C4AA 1Y4ZB 3ZZOA 4A47A 2OPRA 3CJKB 1V9OA 2V9KA 1G7CB 3N9UC 4ZHRA 2KT5A 1FJCA 4L72B 5CXTA 3I0RA 2IC3B 5DM6Q 1VQ8S 1YRTA 2R7TA 5M2UA 1JLBB 3KHGA 3JSMA 1U47A 1TK8A 3CT9A 3EXCX 1C0TB 1VQ4S 2DNYA 3LP0A 5GADU 3HVTA 1MSWD 1S0OA 1X9MA 4X4NA 2E5GA 2JVRA 4UOCA 3ENWA 3PXGa 2MJNA 1SH3A 1HA1A 3C6UB 1TV6A 1DARA 2BE2A 3F56A 4NRTA 5HI7A 2LECA 1VK8A 2NS1B 2J9DE 4GC6A 4DSEA 3H20A 2NREA 2GHPA 4CO3A 4RUHA 5A8RB 3VWSA 5C42A 4FBTA 2XS2A 2V8DA 1W2IA 5GAGU 3I82A 5KG2A 4H4KC 2D3ZA 2IJFA 1WTBA 1Y5NB 1QAJA 1CPZA 5EX0A 4WIIA 3FZBA 5AXKA 1I94F 4B9UA 2XNQA 3IBWA 2BQRA 3O5TB 3E51A 4OX6A 1XMOF 2B6AA 4TNOA 4X84A 4DL3A 1LK5A 1X7VA 2E5HA 3K7RA 4LFBF 1RKJA 2IBOA 2DB1A 3I0SB 4LVOP 2HMIA 1FDBA 2W9AA 2QRRA 2IJNA 2RQ4A 3KK3A 2AV5A 3KTQA 3J80Y 3HFKA 2FC9A 4I2PA 3RB4A 1M5PC 1O8BA 4RUAA 1AW0A 4O3NA 4ZPDA 3VZIA 5KG1A 3SCJE 3TYTA 4KQZA 5CH7B 2Z0GA 3B4DA 2NZ4A 4K0KF 1RISA 1TK5A 4WE1A 2DHAA 1B0VA 4HT7A 1X4HA 5KG4A 3DGPA 5KFGA 2FJAB 4FYDA 1NZAA 1JJHA 1C1BA 3DFEA 4ZMMA 5M2RA 2KZZA 1MNEA 2KT2A 5LXYA 3PW7A 2YX4A 2HWTA 1YTYA 3VAHA 1RT7A 1H0HB 4F4KA 1UJ6A 5EGYA 3THPA 2DGTA 4OLPA 3BSAA 4NA3A 4DG1B 2C2RA 7FDRA 2FIUA 3RU0A 3KLHA 4NMLA 4ZPCA 3GIJA 3RW6A 2HS3A 5CA5A 1S9FA 3KK2A 2XG8A 1FRMA 3PM9A 3D54A 4MKYA 3T5KA 3MMAB 2VB6A 2FB0A 2ZDPA 2C3PA 3HZEA 5GADI 1KSPA 1S7HA 2GQ2A 2OO4A 2ZHOA 3IS9A 4HT5A 2WSFC 4HH1A 2QSFA 2VOOA 3DLJA 3PACA 5T7LA 3AB2B 2VZ9A 4NZ7A 1VQNS 3O6QA 2V5HG 2WONB 4OI6A 1APSA 4WFYA 2XLJA 2M4MA 5CYMA 1S6QA 3JTNA 2VC0A 5GAHU 2KTQA 3CO9A 5HQ8A 1HBUA 2BZ2A 2PT0A 3DRSA 5KG3A 3C8YA 2ADBA 3MD1A 4PUOA 3SV3A 5A0YB 4DF4A 2FHMA 2JZ5A 4MFBB 3I5BA 1NU4A 3LOUA 5BYRA 3QAEA 1F5AA 2HHQA 1LWCA 1WELA 2LQ5A 3J81Y 4OZ0A 4NYPA 3X3UA 3H25A 4K4VA 1VIXA 3JSYA 1U26A 1FO1A 3WC0A 4G3IA 2EK1A 2NSCA 2FTRA 4K4ZA 4E98A 3K5LA 4JYAF 1Q4RA 4Q5VA 1S1XB 4UY8T 1RJJA 3U7JA 2HRYA 1C1CA 4JI8F 5KT5A 4LF4F 2HHSA 1JJ2R 2HVZA 5KT2A 2DBBA 1WWHA 3KG0A 2FHJD 1LWEB 1OPZA 1NH8A 3C6TB 1C4CA 2AGOA 3PZPA 3QMQA 2OPQB 3TNVA 2ZC4A 2R7OA 1FRXA 2L3MA 1U1PA 5HROA 4AFFA 2EBEA 2R8GA 4UUWA 1TL5A 3MM9A 4B02A 2AD9A 2R2UA 4G1QA 3Q23A 4PQUB 1WF1A 2J9DA 1S9EA 2FLPA 2EFVA 1KQFB 2R8IA 3DYAB 1VHFA 2K7KA 2NSBA 3BZQA 1VRUA 4M94A 3U27A 5IFMA 4K5SA 2V4QA 3VCDA 4OJGA 3MURP 3TAMA 4LIRA 2E5IA 3ENVA 1TKTB 1U45A 3K5MA 2HWIA 1GTEA 2BRLA 3VR1A 2R8JA 1IBKF 4X4PA 2W4CA 4C97A 2JVOA 3DRYA 5HBMB 3FVYA 3CE8A 3GYXB 3IAM9 3PX4A 4TY8B 4DWIA 2KB2A 4MYTA 3WZ0A 4ATNA 2AGPA 1HQUB 2R7XA 1S6PA 4DDFA 1P27B 3RBEA 1VJWA 5E0OA 3H5YA 3KLFA 1AUDA 2CQ2A 5FDLA 5B0EA 3CCQS 2WCXA 4QQBA 1QM9A 3K5NA 1HARA 2L48A 1ZTWA 1N0UA 2EBGA 3C46A 2OPPB 2A18A 3HVWA 3I4PA 4DHVA 1D9FA 2XLKA 1K0VA 4TLQA 3MDFA 4I6WA 4A48A 2DNHA 4CNYA 2J0WA 4ETXA 1RTHB 2IRYA 3DM2B 4NZ0A 3OL8A 4B9TA 1DJ0A 2EG2A 1Y0HA 4KIAA 4WK1A 2X51A 2QFJA 1S1WB 4C3MA 4FS1A 2UUAF 3DOLA 3ITHB 2ASJA 2J8AA 5D3GB 2DNLA 4NCBA 4N41A 4N8NA 3R5CA 1Q16B 5DLGA 4R0JA 4CI0B 1EETA 4B9NA 1SIZA 5DQHA 2R4FA 3LALA 4J9OA 1VC6A 4KBIA 1HBOB 2FDNA 3ENQA 1S9GA 2LVWA 3KLEA 3W2VB 3MEEB 3OPKA 4N8OA 1R7IA 2OFGX 3R5BA 1FF2A 1OSDA 2KHCA 2V4JA 2C2EA 2CJAA 2OMOA 3HP6A 1PC4A 3K2YA 3BGRB 3MCSA 5EUHA 1G2EA 4IQXA 2ZD1A 4X65F 3OJSA 1DURA 1MMDA 5B7WA 4LF9F 5FD1A 4I7FA 3FEYB 1U24A 4PRFA 1S49A 2W8LA 4NA1A 3QGGA 3V4IB 3TRGA 1FJEB 3DHWC 1JLAB 2UUCF 3VAFA 2FGCA 5LJ3Y 3RRGA 3HX9A 5HMZA 2MZTA 2PD1A 4H54A 5IXUA 4FXWA 2RDJA 4DF8A 5C25B 3DLHA 1FNOA 4Q2MA 1YHQS 3QYYA 2ILYA 1FEHA 1XEZA 2P9GA 4WKYA 2XMTA 1T02A 4EEYA 2DPIA 1HFEL 1X4FA 2RUGA 2YKMB 1HBMA 2JC1A 3AA8A 2D9PA 1CC8A 2R7WA 4MK9A 3H59A 4DL2A 1WHWA 1X5SA 3LH2S 3NS6A 1O0PA 3OBIA 4EWTA 2VASA 4QJVA 1Y3JA 3LGNA 5A6PA 1HYSB 4ZCIA 4PG5A 3HJFA 1REVB 2QIFA 1HBNA 2VL1A 4OLOA 1SJFA 2RF2A 3LANA 5KFWA 2VONA 1WD6A 4N47A 4B3OA 5F8NA 5DDPC 1TR0A 1KFSA 2IHR1 3G6YA 5JVGQ 4DMZA 2DCUB 2W4PA 5K8NA 3J7YI 3DI6B 4YHHF 4P6QA 2W9BA 3BSOA 3Q8SB 5T14A 1JJ4A 2CPDA 3KWMA 1IR0A 2VG7A 3NCQA 2I0XA 4NLVA 4Z37A 5LMUF 1YI2S 4X4QA 2WHOA 2NUHA 3HVTB 4F4WA 3T5JA 3DLBA 4H4MA 2MSSA 1T03A 4UQTA 4GO5X 3JTPA 4J9PA 3DHXA 3SDEB 1K73T 3M2RB 3C6UA 4RW8A 2BE2B 4X66F 1M5VC 2XMKA 2DIUA 2DNPA 1NK0A 2Y1JA 4HTJA 1CSJA 5B0DA 2ZUGA 2V94A 3MM5A 1U1MA 2M8DB 4A8YA 4NCAA 3ZZZA 1RTJA 1TFWA 2PA8D 1FE4A 3ISZA 2IAJB 3MEDB 4WYWA 2DNMA 2ZH2A 2B5JA 3WBZA 4I6AA 3GV7B 1TL3B 3O2IA 2B6AB 4LIWA 4DFJA 3DRRB 4ZPAA 1WEZA 2OIHA 3NG8A 1VI7A 1ZAWA 4KSEB 1R43A 1KFDA 5JXSA 2HMIB 4WXWA 4Q8EA 4ED5A 1OSCA 3PEJA 3C66A 1S76D 2EC0A 1LW0A 2NPIA 2V2KA 3O3LA 1HHTP 3SI8A 4A4JA 4KC5A 5DDQC 3V81A 3DMJB 1SQEA 2QE5A 3E8OA 3T1AA 2BM0A 2N7CA 1MU2A 1R8BA 5L1LA 4ES3A 4J9MA 2AU0A 1W2BR 2DRAA 2HLTA 4NOHA 2HS0A 3T1HF 2X1FA 4ECXA 2ZH7A 1VIOA 3T5HA 2CQHA 2FJEB 4YMEA 5DGBA 4NL5A 4OHWA 4A8QA 3K8VA 5DRKA 1S1TA 4YB1P 5KFXA 1E6VB 2M70A 2ZH8A 4A46A 3LPYA 4KFBB 3BREA 3OR1B 4DSKA 1SUQB 2WTFA 3HHLA 4K2XA 4Y3CA 3IRXB 4C98A 1D9DA 4CQ1A 4KO0A 2RQKA 2HQ3A 1N33F 1NNDA 3RB3A 5KG7A 2F9DA 4DG1A 1IM4A 3IR5B 1KOHA 1WNEA 1IKVA 3PFEA 3MFIA 4ETZA 1CQNA 3KLHB 2YQ3A 3FEXB 1WI8A 4CNZA 3HHDA 3NRBA 2EFOA 2Z2LA 3SYZA 3I5CA 4JV1A 3IS9B 4K59A 3OLAA 1UVNA 2LEBA 1KEKA 1HWKA 4M5DA 4LT6A 1X4EA 2YKQA 3D0GE 3D28A 1K1SA 2GCFA 1DRZA 4J9LA 4DR1F 4ZKAA 2CRLA 3M8PA 3CCJS 1S6QB 1WG1A 2KYZA 2DR9A 2YNFA 1RAJA 3CC7S 2Y0SD 2L41A 4DV5F 2LEPA 5E3AA 2I5JB 4C7QA 3DRSB 3EPIA 2OLWA 2Y1IA 4BC9A 5L1JA 2IRUA 4QR1A 1LW2B 4ICLA 2KFNA 5I42B 2B7BB 1RT2B 4MFBA 2A1BA 4ZCLA 4C2MA 1L3KA 4KB7A 4KJIA 2JEFA 1RT6B 2DIVA 4NLXA 1LWCB 2VC1A 3TARA 1U2RA 3OXGA 3BGLA 3JAMY 2MHNA 3GIIA 2MJUA 4ED3A 2FVRA 4O44B 3MWBA 3GR1A 2QMWA 3M9OB 1NK9A 2DCLA 2K3IA 2RMLA 2E1CA 3NNCA 1FKPA 1IQTA 3QPIA 4NLUA 1G6BA 4LSLB 4CT9A 3DLGA 4AL5A 1BWEA 2N4CA 1JLEB 2D3UA 4TYAA 3CCSS 2PI4A 2ZZNA 2B9WA 4NCGA 4C11B 5KFCA 1LWEA 4OQJA 3SEOA 2HGNA 1YIJS 2J7WA 2CPEA 3DOKB 2VA3A 2R7RA 2CQ1A 1UVKA 4O4RA 4A8KA 3UD3P 2HQIA 4OJHA 1S79A 1DLOA 2HNDB 2YNIA 2F40A 2RRBA 2ZKUA 5KFFA 1RQ0A 3ZZYA 4G1QB 1QVFR 3G8SA 1R3NA 4K5RA 3G8QA 3LP2A 4OI0A 2VUGA 3RAQA 3RAMA 4PWUA 1VRUB 2G9OA 3HVRA 4HLBA 3BO3A 4LSNB 3TAMB 2J7UA 3OLBA 4I64A 1KQGB 1TKTA 4WU2A 1HMVB 1FNXH 4MK7A 1N32F 5KFVA 3SCKE 2C3OA 3MOZA 4JI4F 1JK9B 2GV1A 4ILRA 1ELOA 4QIWD 5HBMA 4C8OA 1TFYA 2AWZA 2FGOA 4RZRA 2DNRA 3OJUA 3L95X 5E5NA 5L1IA 4DV2F 5B0AA 2EPIA 3KNGA 5IM0B 3K57A 1R6YA 4NWBA 1XN9A 3OSPA 5KFRA 3EGZA 5AJ3F 5G0RA 5I4MA 2BQUA 1UJ5A 1LXJA 4ECRA 3G9CA 1QSSA 2ZOGA 2OPPA 3DXSX 5D4PA 1TKXB 1UVMA 4A8SA 3LGMA 4A8WA 4O3PA 2HWHA 3POTB 5F8GA 2UXBF 3MPYA