3SCIE

Crystal structure of spike protein receptor-binding domain from a predicted sars coronavirus human strain complexed with human receptor ace2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
180
structure length
174
Chain Sequence
CPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRFLRHGKLRPFERDISNVPFSPDGKPCTPPAFNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2
publication title SARS coronavirus: mechanism of host receptor adaptation and rational prediction of future evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 28
structure length 174
sequence length 180
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sciE01
2AJFE 3D0IE 2GHWA 2DD8S 4L72B 3D0HE 2GHVC 4ZPVR 3BGFA 4ZS6A 4KR0B 3SCKE 4KQZA 3SCLE 3SCJE 4L3NA 4XAKA 4ZPWR 4ZPTR 4QZVB 3SCIE 5DO2A 3D0GE
chains in the Genus database with same CATH superfamily
2UXDF 4C0HA 3M2RB 2K8GA 5I42B 3MM5A 4G65A 2YQ3A 2XGPA 3R5DA 2C2DA 2FB0A 1HD0A 3OUYA 3RGIA 4NXNF 2D3O1 4QW8A 4N5SA 2ADCA 3E8OA 2UU9J 5FDLA 3B54A 5C24B 1U2FA 2HRUA 2P8IA 1REGX 1UFWA 3QJLA 3QRRA 1WC3A 2CPZA 1XERA 4IG3B 3CO0P 2OO4A 4HYKA 3L3CA 1SJ1A 2QSFA 4F8RA 4KGXB 4KHPF 2N3OA 2Y8YA 5L9NA 3BB5A 2MZTA 1N32F 5DGAA 1TUWA 1SJQA 4ENOA 4YDDB 4K4VA 3R97A 1U8SA 3KNAA 3AXKA 5H9FK 4YR2A 2BXJA 4FNHA 1BLUA 1DQAA 3JQJA 4NX9A 3HJVA 2WRMA 4QOTA 1XR5A 1Y7PA 2F4FA 5IV3A 5KOXA 2C3YA 3QWUA 2H51B 3B8HA 4CLWA 2Z2YB 4PG4A 2ALZA 4KTQA 4CO2A 2DK2A 4DF8A 4Z37A 1HMVA 1X4AA 1HL6A 1RADB 5GADU 1QLNA 3PRBA 1XMQF 2EG1A 2DH9A 4EGLA 4H4OB 1RT1A 1M5PC 1RAJA 2IIHA 1NAQA 3EZ5A 4X65J 2VFSA 5JVGQ 4F25A 1SJFA 1QAJA 1VIXA 1T02A 2OTJS 1KKHA 3CD5A 3MEEB 2DITA 3HHLA 3FBCA 6FDRA 3TR5A 3R1HA 5DQGA 5ETOA 1GH8A 3O6QA 4X4NA 1SBRA 4MH8A 2VPWB 5F8LA 2PEBA 3Q8RB 2DO0A 4HTIA 2Z2MA 2KZMA 5J1EA 2XHCA 3MCOA 1YGYA 1ZBTA 3O8WA 4ED3A 2LA4A 1GMWD 2A6MA 3M9OB 2E1RA 1UMJA 1QVFR 2GQCA 3NGSA 5E0OA 1VQPS 4J9MA 2R8KA 3LP2A 4YP3A 3IG1A 5K9FA 2CPEA 5KT7A 4H4KC 2VDHA 3BJYA 1Q8BA 5AJ3F 4W92B 4FF4A 4A8KA 1N0VC 2HFNA 3IBFB 4KPCA 3AB2B 1GXTA 4DU8A 4F4WA 1M90T 2B3TB 3GPAA 3OV7A 3BO3A 2IJNA 4CT9A 3MEGA 4ZJLA 2H4WB 3SSSA 1TP7A 1WOSA 2I2YA 4OYAA 2ZD1A 4I6YA 1FJGJ 3DCAA 4HHUA 1FT8A 2L48A 4DQSA 2XCPA 1QUPA 1LXNA 3L7PA 4B3RJ 2FZCB 2MMYA 4DR1J 2YPYA 3GFHA 1T11A 2K7KA 1B0VA 3V5RA 1HBMB 2K1RB 1S6OA 3HVWA 3KJFB 2HHVA 1U0HA 5I4MA 5F8NA 2GW8A 2BQ3A 1LQ9A 2YWEA 2ACYA 3AQOA 3DLGB 3C15B 4HL9A 4Q2LA 4DLGA 2VKZG 1UVIA 4JV0A 4Q7AA 3QGIA 1KN6A 1R3NA 7FD1A 1S6QA 4DOZA 4N77A 2CJAA 2VHGA 1VQ5S 2VODA 1S1VA 3HI9A 4JI4F 3TANA 2NREA 2V6AA 4NMLA 3M1VB 3UD3P 1FKAF 1U1NA 1Q82T 2BVZA 4RKUC 3ZC4A 1HNIB 3NNHA 3RBXA 2BACA 4J37A 4ED5A 4NYOA 2V0NA 3A3PB 2CNKB 2J6UA 3FCWA 2X3GA 1RT6B 1U26A 2FDNA 3PRVA 4M5NA 4DX5A 3AFGA 2KXFA 4B3OB 5KFIA 2ZBIA 1JLAA 3OBIA 1N0UA 3K8WA 5CYMA 3BGFA 3BH6B 4ZPDA 4DV5J 5CA5A 4USMA 2E7VA 4P9SA 4ZCKA 3EPIA 3JQKA 3LO3A 2VQEJ 3O3LA 1N88A 4CWBA 2R7QA 2LFVA 2EG2A 4ZCIA 1NKEA 1S1WA 5CCMA 3GONA 4O0IA 2C28A 3D4JA 3A3NB 2X1GA 4Y2AA 3NGUA 4I7FA 3PW5A 2DPJA 3IRXA 1FE4A 3AJ2A 3F0NA 2WAQD 1P9QC 4Q45A 5A8RB 4USHA 4FF1A 4AFFA 4HDGA 3A8IA 2HEKA 2XS7A 1WC1A 2HNDB 4UUXA 5DJBA 1VC0A 3QJJA 2DGWA 4WK3A 3NOGA 3N6NA 2YKNA 1H7XA 3P6YC 1KQGB 3DOLA 3VQTA 4AXJA 3D6FB 3MZIA 4Y3CA 4USJC 3T41A 4DHVA 2LU2A 1KNZA 3TAMA 4WZQA 3OQ2A 4H4KA 4N56A 1XNRF 3W65A 1S6PA 1LWFB 4JV1A 5IZHA 4XPEA 3FZ2A 4QIVA 4AQYF 1TV6A 1FXRA 3M2RA 3IR6B 4PXEA 4K4WA 2QMWA 1VCTA 3ZZTA 5I42A 1AT1B 3SV4A 1E6YB 5EGYA 3T1HF 2NXNA 3DKDA 3MI7X 4Y2MA 2R4FA 5ETMA 2MY8A 1WDDA 4OYOA 4QQBA 3A4TA 2W4PA 1FJ7A 1MWZA 4HHJA 1X31C 3QJPA 1NK6A 4KGMA 4PG8A 4GMKA 5EX0A 3BYRA 1R0AA 4TLQA 1HNZF 2ZITA 2ZWPA 1FWPA 3UN2A 1J27A 2XY7A 1UEUA 1VI7A 4PPDA 1MWQA 3LANA 4P2FA 3ZXWA 1QJHA 1T3OA 3QBCA 4DV6F 3UQSA 2HVDA 2KG1A 3FK4A 1GT8A 2F7VA 2JRSA 5H1SV 2IRXA 5HVFA 1H6KX 1N5QA 2LXFA 4C8OA 3LP1B 1BWVA 4ETXA 3P8BB 4I2QB 2CJXB 3JTNA 2VL1A 3Q89A 2PO4A 2GJIA 2APOA 4KHRA 1NK8A 2VOOA 2D3OR 4FPIA 4IQMA 3D54A 3MMCA 3VAHA 4LF4J 3K0JA 1AUDA 1IBMF 4EZ6A 4FYWB 4QR1A 5F9LA 4DSIA 2M0GB 4H4OA 4DUYJ 1VRUB 2N7YA 2HKEA 3QMQA 3MURP 3MMAB 4K59A 2CG4A 2DVIA 3CCLS 3V6DA 4C8LA 4LF6F 1N54B 4X64J 3MEEA 1W26A 4HLBA 3SI8A 2ZKTA 4ANDA 4HT5A 3K5LA 3M8QB 1SIWB 4TVAB 1AFJA 2W8LA 1FXLA 2DGUA 4KY3A 2RF2B 2DYAA 4OLPA 2GIRA 1NH7A 1YSJA 1WKKA 4J9KA 4P2MA 1NM2A 5KFCA 3U1NA 1BE4A 1LWEB 4NLUA 2FZKB 3M8WA 4XPCA 1CS4B 3EX7B 2P6SA 2HVEA 2YBVA 3Q23A 1H2TZ 3TX0A 5KT5A 4KR0B 4CNYA 4DCPB 3T19A 5KG6A 4QWEA 4ED1A 2K2PA 3VAIA 2CUYA 1RA7A 2WONB 3CCQS 1IN0A 3TZYA 3FCVA 1FX2A 4ZLNA 3CCZA 2D3UA 2WSFC 3L7OA 3H5UA 2XQCA 2AGOA 2HFOA 1VJWA 4DV7J 2UU9F 3BH7B 4WTOB 1TUVA 1S9GB 4J9LA 4AL7A 2EBGA 5K8PA 5KFSA 5ETQA 2K1RA 2RS2A 2OGUA 5KFZA 3MGJA 3BPSP 1OY9A 1SQFA 1RCOB 2DB1A 3DLGA 3C15A 3GSIA 1TAQA 3MM6B 2KRBA 4J9NA 1U6ZA 5J2PB 2MLYA 4F0MA 1T05A 4PXDA 3BBBA 1J5OA 3BZQA 1E6VB 1PYTA 4L3KA 2EFQA 4WCEQ 4LSLB 1RKJA 7FDRA 2RMLA 4KRWA 2R8GA 1WSRA 4BWMA 1AFIA 3NXZA 2ZBQA 1HBNB 2FPHX 3CIMA 4JI3J 1X9MA 2VBXA 1QD1A 2ZH2A 5AXMA 2AYBA 3CCJS 3QGPA 3U7JA 4ZHRB 1HNIA 2OD6A 3VAKA 1GMUA 2NYIA 3KMQA 3DU6A 4GC6A 1WKJA 1D8YA 1WG1A 2N3LA 2CRLA 1YRXA 2ZBRA 1RT6A 1RTIB 6FD1A 4X65F 3VF0B 2JLGA 5HJXA 4J5OA 1Q8KA 1RHKB 4IUFA 4B3OA 3LAMA 1HQ2A 3R5GA 2MSSA 3C14B 2OPRB 4A8OA 1FRJA 1FDDA 1FRKA 4F3OA 4WPAA 1MN7A 3A13A 1M1GA 2XWYA 3CJRA 1RZMA 4UOHA 1B3TA 2BQUA 2KRRA 1NJZA 4B9NA 1WHYA 4N47A 5J2MB 3KK2A 3EZOA 1XR6A 2E5HA 4X4VA 5KG0A 1MSWD 4EZ9A 3IA0A 2HQ3A 4NLDA 1FERA 1HWUA 2DNYA 2R9LA 2CVIA 1HLWA 1RHMB 3S7RA 2MQMA 2NSBA 3TVZA 2Y9HA 3CJ0A 3CCTA 4FPRA 1KOHA 2QC3A 2OJ3A 4KB7A 1B7YB 3UW1A 3X1LB 1FJGF 3QAUA 4WJBA 1S0VA 3UFCX 1LK5A 3IP0A 3PW2A 2GMLA 5GAHU 1FCAA 5HMWA 1WTFA 4B3RF 1HQEB 2VQFJ 4DR1F 3LAKA 4O3QA 4YQWA 3BBCA 1X9WA 3IM8A 5KFBA 2V4JA 1K47A 1KLNA 2ACMA 4QIGA 4QZVB 3PV8A 3SDEB 1VLOA 3PJWA 4URGA 3FKBA 4B9SA 2I5JB 3M8PB 1EP4B 3GIRA 1R7IA 4DCJB 1S49A 1WC4A 2LMIA 1F60B 2BRLA 3TJAA 2UXBJ 4ZN3A 2L9WA 2HBRB 5HJYA 2VG7B 2GO8A 1XBWA 3UWTA 1X4EA 3SEOA 1PAUB 5A2QU 5HMXA 5AT1B 2RUSA 4DQPA 1TVRB 1CJVB 3LP0B 4E2FB 1G4CA 4FYXB 3I5BA 2W2QP 1NBEB 2ERRA 2GFFA 2E9TA 4NLRA 4EYIB 1RT2B 2AKWB 4PEOA 1RBAA 4ZP7A 1FWLA 2PMWA 3TARA 3PHEA 4QYRA 3TA0A 5IS2A 5AE1A 4OX8A 3JXOA 5E41A 3A8JA 2OMOA 1IM6A 3M6UA 2G0CA 4JI1J 1FEHA 1RWPB 3FRZA 2QA1A 3R5AA 1AUSL 2EFPA 4DV5F 3NNAA 3EVMA 4I2QA 1S72S 4WE1B 3L09A 2VQEF 3HZEA 2X1AA 1FX4A 1WSVA 3EYZA 2EFGA 2DNPA 3T3FA 2ROEA 4WWSA 4P2SA 4OYWA 2HBYB 3PG9A 2UXCJ 3N0VA 5L9XA 4UF4A 3KG1A 2WVDA 1YZ7A 1F2GA 3CD7A 1VRUA 4P52A 1TR0A 2J6TA 4KO0B 4ZVGA 3I0SA 4HH1A 3R27A 1URRA 2VPXB 3MMAA 3M2UB 2HFUA 2VBZA 1X5SA 1HARA 4P71A 2F8EX 2QZ8A 3GG0A 4U7UK 3RRHA 5KT6A 3GSDA 4Q2MA 3W2VB 5DZ6A 1WORA 1NHKL 3M8ZA 2V94A 1QY7A 1EETB 1C2PA 3VCDA 2V9WA 3BBFA 2AT1B 2RF2A 4YB1P 2DTJA 2ASDA 3GQCA 2BOPA 3KDNA 1NPKA 4P10A 4DBQA 1YLXA 3G8SA 2MKCA 2CDRB 5A8KA 2W7AA 2RKIB 5KFYA 1LWEA 4H54A 3D0GE 1CS4A 3X3UA 2OD4A 4JOUA 4YS2A 4ZLPA 2DPIA 3R5BA 2M8DB 3ZZOA 1FD2A 1IXKA 3L9ZA 5DDOC 3Q8SB 5B0CA 2DR8A 1S9EA 4O0NA 4N41A 3MPYA 2WONA 2FTRA 3WIUA 2HNZB 2XS5A 2M88A 4EBCA 5EWEA 3K89A 2F4VJ 3PX0A 1GEHA 2QO3A 4DF4A 1U09A 5HP1A 2J9CA 2ASYA 3DN9A 3G82B 4B3SJ 2YPZA 2AJ1A 3ADAC 4QCLA 2JLFA 3AY0A 5LXYA 3JSMA 2OFHX 2OPPB 3W9JA 5F8HA 3JS9A 2E1MC 5C25B 3MM6A 2GVDA 1VRQC 1SKWA 1FK9B 5J2PA 4DS4A 3PRDA 2XYPB 1PJ6A 3A8KA 4ZPCA 2W4CA 3MEDA 4BDPA 3GCXP 4LSLA 4KE5A 1JKHB 3S1TA 4DPOA 2XMTA 2VC0A 2HFVA 1TKXA 3HFKA 1XIQA 1BXNA 3CB4A 1HBNA 3W2WB 1YJVA 2MZJA 4LF4F 4S0MA 3BQ0A 2W7OA 3QIDA 2XMMA 2VB6A 2MQQA 4YDXA 4ZPVR 1V9OA 4DV0J 5I3UA 2YY3A 3HHKA 2KN4A 3VZIA 4UUWA 4DUYF 2EXUA 1Q8IA 4NCGA 1RTIA 5GVQA 3NAIA 1FNMA 3MAAB 1REVB 4X64F 4JI7J 3FC9A 2KU7A 4HACB 3C14A 4Z7YA 3DOKA 2MXYA 2OPRA 3PNIA 4TU9A 2KI2A 2LYVA 2GNKA 2QMXA 4RJVA 3PO5A 4HI2A 4USUA 5LOQA 3CULA 1RT7B 2R7UA 5ETNA 4KGZB 3PFOA 4ZMMA 3CDUA 4ECUA 3CMQA 4DU7A 3TQ1A 3D1HA 3MECB 4C3LA 1LOUA 5E3PA 3BKTA 2BYCA 1EX8A 4OV1A 4ED6A 4U67Q 2I0XA 2MJNA 2PC6A 4F3QA 4RWWA 4EUVA 3OHAA 1NRKA 3MCNA 3M6WA 4M5MA 1HYSA 3TX8A 3HFZB 3SQGB 2IC3B 3QSIA 2QEXS 1MNEA 3DRPB 2OP5A 1OWXA 2M9KA 2HZVA 3DRRB 3GIJA 3LPYA 5KG3A 4RW6B 3RBDA 1X8DA 1Q4RA 4K4UA 2GGPA 2LQBA 3LGMA 4I68A 4DV7F 4ZIVA 1N6QB 4YHHJ 1U48A 3SDEA 2ZM6J 2FVQA 4ECRA 2I5JA 4W90B 1EP4A 3M8PA 3BKFA 4TY8B 2EVZA 2CZ9A 4LBIA 2OEJA 3NBPB 3OFHA 2ZJPQ 1CPZA 1G1XA 2QN6B 3GP9A 2VG7A 1RWMB 4C11A 3T9ZA 1U49A 2ZH4A 1WNEA 3OR1B 2YWHA 4UQTA 5ETRA 4Y0FA 4FYYB 4RZRA 1RWWB 1IR0A 1TVRA 5KG2A 2HPUA 3L95X 3EDQB 3L7UA 3Q2SC 4JI3F 1CQNA 1PG5B 2DNQA 1TUGB 2CQ4A 5GAEU 5CABA 1JWWA 1VK8A 4OQJA 1OMSA 1AZSB 2BX6A 5M2RA 2IM3A 4CQ1A 2D69A 2NZ4A 1FESA 4R8UB 2CQHA 1XWLA 1UW4A 4MIBA 1K0TA 3RRKA 4ZN1A 1VIOA 1OJ4A 2YX4A 4OZ1A 2AX0A 3E01A 1QSLA 4J7CA 2C2EA 2VONA 4OI1A 2ZH8A 2YKOA 4J9UE 1DY3A 1K1SA 2QX0A 3ENQA 5IFMA 1F6TA 1BMQB 4NXMJ 1S9FA 1OSCA 2OAUA 1L3TA 3T6JA 2PD1A 4DR3J 3HSGA 1DQ8A 2U2FA 5LT5A 1FKOA 4DL0C 1IR1A 2KJWA 2KVQE 4Q44A 1AXQA 2QA4G 3HVAA 2BE7D 1VBYA 5KOWA 1NNDA 2HRYA 5L1LA 1IVZA 4DXLA 1N34J 2VASA 3I5AA 4AL5A 4MIWA 1NEEA 1EIYB 3POTB 1ZTWA 2L41A 4KO0A 3V81A 1D9DA 2ASJA 1HI0P 3HT3A 1TQLA 4CLYA 1B64A 4RNMA 4WYWA 1ROFA 3CUNA 5GAGI 1H0HB 2CQPA 1S1UB 5D0GA 1O5JA 3BM7A 3T6BA 2I9SA 4DDFA 2NXUA 3MFHA 2CNOB 3K5NA 1EETA 1LWXA 4FN5A 4EWTA 4ED0A 4ZVSB 2MZ1A 2VQFF 1NB2A 3DOMB 3LTOA 5E33A 1UTAA 2CADA 4F02A 4F04B 4DFKA 3CO9A 2G13A 3NCPA 3UDCA 5JUMA 2DRAA 3NGTA 1UVKA 3KJQB 3PYDA 3M4XA 3KLEB 2EC2A 5KFKA 2BEFA 5K8NA 2DKOB 2AGQA 2UXBF 3LGNA 3IO1A 3CMAS 1B0TA 1M5KC 4A48A 5CHCB 2RAQA 3H40A 1SVDA 4YEAA 2L9DA 4DL3A 2UZAA 1P9YA 2B7BB 2VF3A 4LSZB 2HNZA 1VQSA 2BR0A 1BWEA 1TU0B 1SJ3P 1ZS6A 3W5ZA 1Y3KA 2IYIA 3T1YJ 4MMOA 3Q8UA 3UNGC 3NGDA 2F63A 3G82A 1Y4ZB 2JEFA 3HX9A 4FS1A 2HLTA 1BQNB 2HW3A 2V69A 2B51A 1L5UA 1RQ0A 3IWXA 4USTA 3TRGA 2Z2LA 3G9CA 4ZVRB 2ZNYA 4UY8T 4JI1F 5C25A 2DH8A 4Q8FA 2E9RX 1Q78A 5MAOA 2XG8A 5KFXA 2HYIB 4LF8J 3PJ9A 4QWCA 4XDDA 1PAEX 4DZDA 2HIQA 2WVFA 3SSQA 4M5LA 1XR7A 1JKHA 3N01A 2AW0A 5CCLA 5H9FJ 5HQLA 4OYXA 1FI4A 2XYGB 3BGRA 2O5DA 3W2WA 3TW0A 2A0FB 3DLEB 3W8GA 1PC5A 3TEHB 3D1OA 4KKOB 4PYAA 5DZ7A 2C2MB 2IJRA 1S1TB 2UXCF 4AYBD 5KT2A 1F0XA 4NLVA 4E98A 1UP1A 4MTPA 1QM9A 3SQOP 3RAQA 5JMNA 4DWIA 3Q83A 2BQRA 1Q86T 3OFGA 4DQQA 3MUTP 2W9CB 4ZS6A 2A3JA 2YNGB 3G6VA 2R3VA 1C0TA 4TYBA 1U1LA 1REVA 4U9RA 2B9WA 1FFWB 3VGVA 1YITS 2GS8A 3A1YG 3MR7A 2B43A 1IKYB 4B02A 3DMJB 1RTDB 1KONA 3Q2TC 4XTTA 2C1EB 2DR6A 2DIVA 2GZOA 4OYBA 1RT7A 4BHQA 2IVYA 2MQPA 1R8HA 1SQEA 4QU7A 2RHSB 2EW9A 2IM0A 2MKSA 3EVOA 2NS1B 4CO3A 2CQ1A 4OZ0A 3K8VA 3NRBA 4C8YA 1FRXA 3H4DA 3MECA 3B4MA 2ZH6A 1ULRA 3IS9B 3RR8A 3PFEA 2HHXA 5C5JA 5H9EK 2PA8D 3SIPB 2M70A 3D66A 4NLPA 3ILOA 3QGGA 2ZWOA 2BM0A 1YK9A 3VWSA 2KT2A 1HNWJ 3QNWB 2YQ0A 2OPSB 4UT4A 4DG1A 1G2EA 2XZWA 3S01A 1BQXA 4CLTA 3SQGA 2IC3A 3IBCB 3DRPA 2H5IB 1WACA 2GHWA 1JLEB 1JLGA 1DTTB 2E44A 1RTHB 2F4VF 1T94A 2OKQA 3AH6A 1NPPA 4IG0A 5A8WB 1RBOB 1N6QA 3OVSA 2YWWA 3SCLE 1X4GA 4B3SF 2FVRA 3D1QA 2AHOB 3NGKA 4KH1B 1UPPA 2KT5A 1R8BA 5G4DA 1CJTA 3MM9A 3UCUP 1NK7A 2BJ1A 5BJRA 3EXYA 1T9XA 2EPIA 4LR8A 1ITPA 1HKAA 2E1CA 4OHZA 4KH0B 1KEKA 1J5EJ 4WK1A 4IOBA 2VPZB 3IM9A 1YHQS 2V50A 4L74A 3BO2A 2D7SA 2RUGA 4Y2KA 4DL5A 5L38A 3N9UC 4MKBA 1IKWB 3MAHA 1MN9A 2IBOA 3M05A 2DGSA 5BR8J 3AA9A 4M5JA 3LUYA 3JAMU 1ZM3A 2LXIA 2HHQA 3OTEA 4IRKA 1C1CB 4DR7J 2G2OA 1Y5NB 1URNA 5KFUA 4ETZA 3CJQA 4DV0F 4DSEA 1T9YA 4GKJJ 2CQ3A 2I38A 2LCWA 1YJ7A 1LW2B 5IT0A 1TKTB 1SC3B 4IKAA 1R6VA 3KLIA 3VQSA 4USWA 1RWKB 4JI7F 2DCUB 2DT9A 1C4AA 1W2IA 4V19J 4O23A 2ZJRQ 3D3BJ 4RUAA 1YTYA 1S77D 2IRYA 4LVNP 4C9DA 3CDEA 4FDFA 5HROB 4FKXA 2R7SA 5KFWA 5T7LB 4ED7A 2B5JA 5KFDA 5F41A 4FXVA 2FVSA 1J2VA 2WHOA 3QIPB 1RAEB 2YWKA 2MB0B 2GAHC 3D3CJ 1FFSB 3O5TB 3SCJE 1RYSA 3KHHA 3PDNA 2J7UA 2RH3A 4CNZA 5B7WA 1U1KA 2BE2A 3POTA 4IO1A 3W3SA 2R7WA 4DR5J 3PVXA 3DLBA 3PHTA 1KD1T 4DUZJ 2HQDA 2OI2A 1S1UA 5M2PA 1UVJA 1MWYA 5DG8A 4Y2IA 1MU2B 5LSLA 3VR1A 2J7WA 1HHTP 4LRBA 1N5YB 5IWAJ 1YRUA 2C42A 3CIZA 4C3KA 4R0JA 2IMWP 3FEYB 1T9WA 5DDPC 3P3DA 1R31A 1CSJA 3MPVA 3PIPQ 4YHHF 2XY6A 5BXIA 2ZM6F 5ETTA 4K7QA 1S99A 1P6TA 3WC2A 3IBWA 3ONQA 4GVLA 4F0KA 1RWOB 2IA6A 3KLEA 5EWFA 3EE3A 5FLXU 1N4LA 4ZLJA 4CM2A 4ER8A 1OIAA 2KTQA 1K44A 4FXDA 5J2NA 2G2YA 5U47A 2CPJA 2KVIA 2VC1A 5DGBA 1JJ2R 3D68A 3OL7A 2XSJA 1WHXA 1F9HA 2GX8A 1UAWA 2RQ4A 3Q24A 2GO9A 1FKPB 1B99A 3VGSA 4F50A 4AL6A 1KRPA 3HULA 2DJWA 4C48A 4CI0B 2F9JA 2RDIA 5K5MA 2RRBA 5CD4A 4B9UA 2DXFA 1SC1B 1NSAA 2CA9A 4WFZA 2DNKA 5K8OA 2WCXA 2Q3PA 1VHFA 1R43A 2VKRA 3GJSB 5LMUF 1Y3JA 2X3DA 4WFAQ 1S12A 4U8YA 4E0DA 5AE3A 2HHTA 3NCQA 2EBEA 3FZBA 4XDCA 1P1LA 3M2VB 2YXLA 2HS4A 3BQ2A 2GQQA 3PJXA 1OPZA 2DGTA 5AXNA 4NXMF 3RB0A 3NL0A 2M52A 3ENWA 1K9MT 3ENVA 1NUEA 4NEZA 5KFHA 2AZ1A 3OT9A 3FJ2A 1OS5A 3ETMA 4TLRA 4DR3F 2UUTA 4DPTA 3MCMA 3DLEA 5DDQC 3TI0A 2F40A 4IOCQ 3NLCA 1NK9A 1VBXA 1S0OA 2H4YB 5GMEA 1S1TA 3GCWP 3D9BA 3DM2B 4PQUB 1N34F 4LQ3A 2E29A 1W2BR 1D8ZA 3JQMA 3NCRA 2XGQA 1RHUB 1S1XA 4GO5X 1AROP 3GJQB 1RE1B 2ROPA 2W9CA 4C8MA 3H7HB 3ZFVA 5KFEA 3W9IA 4FBTA 5L1JA 1M5VC 2W1BA 2OPQB 3OPKA 5D3GB 2QLFB 1IKYA 2VFRA 3CCSS 1TK8A 3ZO7A 1G6BA 1TKDA 3D6MB 3KHLA 3TUIC 2VJVA 1O8BA 2XO7A 2FIUA 4ZLLA 2KJVA 3PZPA 4OHVA 3VTIA 4ELUA 4U7UD 4NI2B 1EKRA 2N7CA 2B4OA 1WTBA 2AYGA 4URSA 1NCLA 4BBYA 4ED4A 4M5DA 3UN3A 2P9CA 3IS9A 5HMYA 5D4NA 4IFYB 3C2PA 3FRYA 4ZPBA 3M30B 1VFJA 2KHDA 5D6GA 4MJKA 5EDWA 3D0HE 5ITHA 1M1HA 4FKYA 4N8NA 2RHQB 2XC9A 3I9V9 2JVRA 3HD1A 2LVWA 2R2RA 2OPSA 2CKWA 5IM0B 1SJ4P 1FRMA 2V8PA 1RABB 1RHRB 1R8AA 1QE1B 4DFMA 1JLEA 1TL7B 2DNHA 4O44B 4PG5A 3SFGA 1RTHA 2D74B 1C0UB 3IAS9 2R2UA 2DRDA 5A8WA 3T1YF 1T9VA 1T9UA 3ITHA 4DL6A 2HMIB 3G87A 3T1AA 4ZCLA 4X4TA 5KFFA 2DD8S 3THTA 4EYHB 1HHQA 3FBBA 5D78A 4NASA 5DG7A 4LF8F 2DHGA 5FJ4A 3IWLA 5J2QB 1ZAWA 5KFQA 3OTCA 2ASLA 3MR6A 4FNIA 1XEZA 3V4MA 5CQGA 1JLQB 1WC5A 1ICEB 3NMRA 2DBBA 5KAKA 2CQCA 3AD8C 2QYCA 4USIA 3TEGA 4UTGA 2RQKA 1ZYQA 1CBKA 1OQ3A 3F73A 3BR8A 2G0IA 4M63A 2WK4A 1C1CA 2F3JA 3DI6B 1FO1A 4DFJA 4WKRA 2ZDOA 2XMKA 2XMVA 3CVKA 2XZDB 5G0RA 1PJ5A 3C16A 4C0BA 3ISZA 3H8YA 2KHCA 1LXJA 1Q8LA 2HVIA 3GZ7A 1C1BB 3FFIA 3ET6A 3RRGA 3PY8A 3BV8A 1FRIA 1EKSA 2R7OA 2WW4A 2LXUA 5F8IA 3TP2A 4LF7J 4M5KA 3DC2A 5HROA 4ZP6A 1CULA 5GAEI 5B0DA 4MYTA 5T7LA 1V5IB 5AXKA 2DNZA 1R8CA 3F44A 1BY9A 3UO0A 1F5CA 4QIWD 3CCES 2O3DA 3TWZA 4DX8H 1NU4A 3Q8QB 2AGPA 1DRZA 4L75A 4W4MA 4CO0A 2CQGA 3VZHA 2N82B 5K14B 1NMEB 1HNVB 1P1TA 1K1QA 3CD0A 2OEKA 1CG2A 1HNWF 4OX6A 1HBUB 4RU2A 4RPFA 4OIXA 1VQMS 3TZWA 1ZZNA 1TK5A 2FHJA 2C2OB 4EU0A 1JIHA 3MD1A 2YNFB 5A0YB 2KT3A 2JC1A 1V6HA 2BKNA 3JYTA 2QJ3A 3AD9C 1SIZA 3VAFA 2QL7B 4LIRA 2DGOA 3I96A 4KJIA 5KG7A 3OD2A 3J7AN 3ZNJ1 3V4IB 5DM7Q 2XYHB 2JX2A 2G0JA 1GFWB 2A18A 3KUEA 4LT6A 4YFUA 1VOMA 1V3ZA 1FXDA 4CCHA 3DGVA 3CE8A 2LQ8A 3FQKA 1ZA1B 1PO6A 3RZAA 1JNRB 3HD2A 3LWMA 2NXEA 2B9XA 4YR3A 3NWGA 5I3QA 3IAM9 4B9LA 3MDFA 3G86A 1J5EF 1N8RT 3P5BP 3JAMY 2EFNA 2JOQA 1EQMA 2ILZA 1F3VA 4WFBQ 3GR1A 1FKPA 1MLAA 1DHMA 1RCXB 5E5NA 3ICLA 2OSRA 5BR8F 1S0NA 2HQCA 2W24A 3NKYA 4DZ6A 4WIIA 4DR7F 2V63A 4WFYA 2W4DA 4GKJF 2E5LJ 2VG6B 1VRTB 3UR0A 2FLOA 3AOAA 3AT1B 5CYQB 3H4BA 1S0MA 2E1AA 5KFMA 2NUHA 2XZTB 1VQOS 3T5LA 5B09A 3CC2S 3BN4A 5DS7A 4WF9Q 5HMZA 3M2VA 1UWBB 4NCBA 3QLHB 2W9BA 1NSPA 3V2UC 2BJ7A 1HQUA 4Y6IA 1YWXA 4IR9A 3NS5A 4PUOB 2A2CA 1EARA 4RW4B 3BKUA 1H3DA 1SKRA 3IC1A 5HVHA 1NLKL 1S97A 2YKMB 2UV8G 1ZM4A 3WIVA 3OFFA 2Z58B 4CYUB 1TMJA 3MPUB 2FHOB 3DM2A 3MOZA 1L3SA 5F0WA 2VBYA 3NWRA 4RNOA 3E2EA 1SV5B 1KOOA 3SSRA 3R5JB 4C98A 1DARA 4LRAA 4DR5F 5C7PA 4P73A 3FSIA 4DUZF 4A8MP 2OPQA 5ETKA 1LW0B 1X4FA 2PN6A 3P49B 3BYPA 3G96A 4DI6A 1LWCB 1FNOA 5IWAF 4X2BA 2XLJA 1SC4B 2N4DA 4NI2A 3HDSA 3TO8A 5CZVA 1A0OB 1RT5A 5FLXY 3AA8A 2HWIA 2ILYA 5CXTA 2J7KA 4ICLB 1TKZB 2MPUA 4MKVA 4J91A 1JK9B 4AD6A 2G1HA 4X4QA 3QT7A 4IFYA 3M30A 3M8YA 4U96A 3PO4A 4F2SA 2CPFA 4EBEA 1DTQB 1PILA 2G2ZA 1WF2A 3QO9B 4UOGA 2MY7A 4A8WA 3N6MA 5IM0A 2DRBA 4K4SA 2BDPA 4E8UA 4ITSA 3KJVA 1JXLA 3BDEA 2MYFA 5C2GA 3ZZ0A 8ATCB 3I55S 5HAOA 4O44A 4OLOA 4DSKA 3M6VA 3PR5B 2MLZA 4I2PB 4J9QA 4EEYA 4L3NA 3GV8B 1GMWA 3UDLA 2QA4S 2BOAA 4DR6J 1XMOJ 4K0KJ 5MLCV 2Y1IA 4L72B 1F9EB 1BC6A 4M5GA 3UN5A 2ZDPA 4ZA1A 3CW2C 4JUZA 4K5SA 3C6TA 3K58A 5DQIA 2ZFHA 2K3KA 1SKSA 1QSYA 2CAJA 2ZOFA 4R5PB 4QPXA 1DJ0A 1Q5VA 2JVOA 1KHVA 1YJNS 5F3TA 1VC5A 2PEHA 3CJKB 3KNGA 2EI5A 1IQZA 1HBOB 2QFJA 1VR6A 3PM9A 2OFGX 2FHMA 2I8EA 3DI6A 1UA1A 2MGZA 1FVQA 3EXCX 2VBWA 4F4XA 5E2QA 2Y1LB 2EKNA 4PWUA 2XO6A 1S7HA 5LXRA 4C0OC 3H5XA 3CEDA 3DFEA 2PI5A 2AJ2A 2HIYA 2ZBPA 4BC9A 4IYQA 1C1BA 2R7TA 2W2MP 3G8QA 3NS7B 3PW7A 4LMZA 4AXIA 2FVCA 2OMLA 3GWCA 1KFSA 2GMJA 2PIIA 4FS2A 4OYPA 3S8SA 3EDRB 4B9VA 3V6JA 1PC4A 3KK3B 1SH2A 1ZPVA 3PIOQ 2RQCA 2VDIA 2V8VA 4V1Ak 2IAJA 5DO2A 4A47A 4DN9A 1YKWA 3ISND 3K59A 4WU2A 4DSJA 3DLKA 3OSNA 2NPIA 3THPA 2QA2A 3R7SB 4FVMA 3H2VE 1HNVA 4OHXA 1VQ8S 2Q6BA 3DDKA 4AE5A 1L3VA 1HBUA 4GKKJ 2Z0GA 3OTOJ 4MYUA 3KLHB 1N5SA 3GV7B 3I4PA 2CZVC 2Y0SD 3W63A 1TTHB 3QGHA 1YBTA 4G1QB 4ECWA 2DXDA 5EN1A 2R7XA 1T9TA 4X4UA 2D1CA 3V4IA 5C24A 2HSEB 3MM5B 2AD9A 3RB4A 4LJMA 3RG6A 4OYIA 4OX9J 4IG3A 2NYHA 4F4YA 2OTLS 4BCAA 2DGXA 2F1FA 2P2CB 3OUYB 2BKOA 4J9VA 4KT0C 3NOCA 3TOQA 1H73A 4I64A 4OI4A 5HI7A 3J7YI 4O3OA 4KAIA 3EWGA 1F5AA 3OJUA 3WQPA 2ZBCA 2V5HG 4JV5J 5E7OB 4B08A 2ZZTA 2RILA 3G8TA 5IQQA 2FY8A 3ZTSA 2HQGA 5CAAA 1VBZA 3THVA 3C46A 2XB2D 1OQ6A 3W5XA 2ATLA 2IFXA 3BN7A 2DNLA 3IXQA 3KFWX 5EX3A 2VG6A 5SUHA 1VRTA 1RTJB 2KXHA 4ECSA 4Y65A 1U1MA 3MOJB 4CLLA 3WX8A 5IT9U 4CH7A 4OZ3A 4WP8A 3VVTA 1HR0J 1X4DA 5CYJA 3BO4A 1NKCA 3T9NA 3K7RA 2CQDA 3P45B 1UWBA 1FEEA 4OHYA 2HBZB 1XN9A 3D7SB 3PEJA 4RBVA 3QLHA 4LF7F 4LIWA 2DNNA 2Q6CA 2YKPA 1UZHA 2EEYA 2F8MA 1YZ6A 1UA0A 2XLIA 1RT1B 4OI6A 1NSKL 2NXJA 1RAAB 2JC0A 1CLFA 2F65A 3SZ2A 3M6XA 3HPOA 1EB0A 2OLWA 4CYUA 1LV5A 2CXEA 2YWFA 3OXGA 2R7VA 3KLVA 2F5GA 3TUZC 1SV5A 4YB7A 2G1DA 3DHWC 4X4SA 1WI8A 1ZETA 4KC5A 1U6BA 5J1EB 3NP5A 4FYVB 3EZUA 4K4YA 2JNJA 3WBZA 1LW0A 1SB6A 2JHEA 5C2CA 5C42B 1Q0NA 2WOMB 2JDJA 4CDIA 1LWCA 3OL9A 4X4PA 3NMAA 3LP2B 3HSZA 3GIMA 3IG1B 4K2XA 3US5A 2KFNA 3B82A 1NXIA 3GYXB 4U95A 3Q8YA 3QATA 4ZVQB 1V3RA 1N36J 3BR9A 1G3OA 1HBMA 4ZVEA 4DPYA 4ICLA 1TKZA 3MEGB 1Z2LA 1WOPA 3QRQA 2MHEA 2ZD1B 1PGZA 1U2CA 1F1BB 5IXUA 1YBAA 1X5OA 1X5PA 3NEKA 2MQ8A 4LBHA 2J8AA 3QO9A 3TZZA 3Q8VA 2BW2A 4IRCA 2ALYB 3JTOA 2HURA 3EJMA 4RR5A 2UVVA 2FJDB 1WF0A 3M1VA 4F0HA 3D28A 1UZDA 4Z2XA 4IFVB 4I2PA 3IR5B 5A6WA 4KIAA 4K4TA 1AYEA 4JI8J 4WP9A 3TAPA 2HLUA 2E5LF 1RK8A 1S6QB 3OXFA 4OZ5A 2LA6A 2Y1JA 2GV1A 5LMNJ 2QV6A 2EK6A 4B9TA 2DHSA 1DLOB 4LRDA 4DPUA 4M5HA 3MMBB 3EVWA 4GRSA 3B78A 3CCMS 4R5PA 4WKYA 2HGMA 1HWLA 2DO4A 1HWIA 2CQ0A 4OYMA 4DV2J 3FNNA 4OV6A 1Q95G 1P8GA 2AWZA 1PCAA 4Y28C 1EJ7L 3DNCA 2FHJD 5ETSA 5CYMB 4OJ3A 2J0XA 3K17A 4JI2J 5A8RA 3PX4A 2D9OA 4DR2J 1L3UA 1R89A 2HNDA 1F5BA 6AT1B 2QLBB 4DX7A 1S1WB 1F3FA 4RLEA 3BGUA 2IA0A 3LPEA 2PMHA 3TA2A 1Q7LB 3HFVA 4DV3J 1WC6A 3A3OB 1B70B 1DQ9A 3UD5A 1IKXB 3TUPA 3TAQA 2ATCB 2BKPA 2C3OA 2QLXA 3RB6A 1OY8A 4ZP9A 4G1IA 3HVRA 1QAYA 1V5VA 3R2CJ 2JL9A 1LWFA 3BEGB 1FTCA 1LKZA 1U7LA 4QWBA 1Y00A 3OTDA 3UCGA 5H9EJ 2EFVA 1X4BA 2JSXA 4CLKA 4U6PA 3I5CA 3IGVA 3DHXA 4YOEA 1YRTA 4WBFA 3IR7B 1S48A 3C8YA 1UETA 1VYAA 3R6GB 2QT7A 1WJ9A 1E6YA 1I94J 4JV2A 1RAFB 2FC9A 3G6ES 3KLHA 3CXCR 3RU0A 1S6PB 1I51B 3JB9k 4OI3A 2DNOA 4GO7X 4UZCA 2YKAA 2PFFB 3W62A 4G1QA 2WB4A 2R2TA 4ZVOB 5DG9A 4F26A 4NE9C 1SUQB 4YUDA 5D4PA 2AEMA 3H20A 3ULHA 4DR6F 5IV4A 4UOFA 1XMOF 4K0KF 2B7CB 2XSFA 3HHLD 1MG7A 4PWWA 4MK9A 3RBZA 4DR4J 2ZHBA 1OYDA 1JLBB 2ZHAA 1YJUA 3HK2A 3PKYA 1R0AB 3KLGB 2V67A 3LP1A 1KQKA 1Q5YA 4CH0S 3VAJA 4ZVHA 1UPMB 1S5ZA 4QWAA 4WXWA 2QG9B 1BUXA 3G6XA 3NS6A 1ACMB 4PQAA 2M3DA 2MZSA 3DLHA 1RAHB 1NHUA 1O0PA 4RU9A 3G2XA 4QU6A 4ID8A 1VGYA 3AXMA 4P7VA 4QIFA 2V8GA 4G3IA 1RTJA 4DPWA 3ILIA 1RUSA 1IBCB 3H2LA 3EICA 1TFWA 3TNVA 5F8MA 1OSDA 1IM4A 4LRFA 3F41A 3MMCB 3FSXA 1T03B 2HVZA 2NR0A 2DR5A 1XNQJ 2WBRA 2CVEA 4JI0J 4OJHA 3RTVA 1K8AT 3M8QA 4ANCA 3OHBA 4UY85 1GMVA 4RNHA 5KFNA 2CJBA 4MK8A 3IGNA 2JFKA 5ADZA 5GADI 2IM2A 1YQHA 2KKHA 3NY0A 3C19A 3V6DB 4NYZA 2MQOA 2DIUA 4OJGA 5KT3A 3JTPA 3ZZZA 3DDNA 1VQYA 3BREA 2CPYA 4TQSA 5D0HA 4ZJOA 1X7VA 2I6WA 1S76D 3RYLA 2RNEA 4LFCJ 3W64A 1A6LA 2KYZA 4MIAA 1Q79A 2BANB 4GKKF 2WB1D 3ZZPA 3OTOF 2JLEA 2RVJA 1H72C 5DLFA 5C42A 2WOMA 2ZHOA 5J1PA 2RU3A 5D4LA 2PMZD 1NDKA 5KFOA 3GU0A 4FBUA 3N5FA 2ZZNA 3R3TA 4X66J 2L3MA 1S9GA 4WIQA 3JSYA 4OX9F 2QLWA 4CLFA 1VBKA 4I4BA 2DR7A 1Y5IB 1PIEA 3D5MA 3OSPA 1JLCB 3Q8PB 1GTHA 4NA2A 5DLGA 4X84A 2FHKA 3MM8B 3CJ2A 4ZIWA 3HF5A 3Q86A 5LJ5Y 2O67A 2IBKA 1E6VA 1GK8A 3CT9A 3I82A 4TXSA 4J90A 2GJ2A 4JV5F 1SCJB 4B3MJ 2YX7A 2HAFA 2UVUA 4NL5A 4F4ZA 3GE9A 1NDLA 4ILRA 4ILLA 2J9EA 5LL6d 5IT9Y 3GFYA 2QSWA 3KXDA 4IFVA 4G1PA 4ALZA 3J7ZT 4ZHRA 1T05B 1J5OB 2GIFA 1SQGA 5DRKA 1IWAA 3W7BA 2DY1A 2CZ4A 1FWKA 3MMJA 1IR2A 4RUCA 4JI5J 2VD3A 1DFDA 9RUBA 2CWXA 4XK8C 2FGCA 1RYRA 4C2MA 1T3NA 1HR0F 1ZAVA 4PG6A 1TAUA 4GVBB 2HBQB 1DLOA 2EC0A 3GIKA 1OY6A 3DYAB 3MMBA 2YX1A 2POKA 4LSNB 3TJ8A 1ZH5A 1X5TA 1W25A 2KZZA 2QE5A 5KG5A 4TU8A 2ZH1A 4P6QA 1I6JA 2GC8A 4CRJA 4NLGA 1PKUA 4QYZK 5J2MA 1T7PA 5HVGA 5D8HB 5HBMB 2EWHA 4NRUA 5F3ZA 4K8RA 2A10A 1D9FA 3V6KA 1NZ8A 4A8YA 4DN0A 4O3RA 4A4JA 3KTQA 3PEHA 4RW9B 1QVGR 1VQ7S 4LF5J 4LFBJ 2XMAA 4NA3A 3MR2A 4P72A 2XLKA 3OLAA 3AJDA 1HA1A 3BGLA 3HVTB 3KK2B 1TL1B 4CO4A 4ELVA 4AT1B 3BSNA 3RAXA 3L4BC 3RB3A 1HI1A 1WC0A 5DQHA 2UVRA 3FSYA 4TN2A 4BS2A 3HHDA 1HQEA 1IKXA 1IWGA 2UVWA 1X0PA 3H98A 2P9EA 2E5GA 2J9DE 4N76A 1N36F 4IR1A 2VPYB 1RT4B 2Q66A 2FYXA 2W01A 3BSCA 4R25A 4F4KA 1XTZA 1JLFB 1WF1A 4V19X 1VQKS 4CH1A 2W9AA 4KHMA 2V2KA 3R1LA 2FJEB 2Y0BB 4DLEA 5AE2A 2ZH9A 4ES2A 2SXLA 2XY5A 1UVMA 1NH8A 3VAGA 2O1PA 4HH0A 4QBUA 1CEZA 2RDDA 2V4JB 2ZVSA 3G6YA 3CCVS 1H38A 2AZ3A 1VJQA 2E1PA 5B0GA 1X0FA 1DBDA 4FZVA 4MT1A 2YNHB 1WHVA 2GCFA 4NZ0A 4MKYA 1K0VA 1CJVA 1Y5LB 3LP0A 5RUBA 2XI2A 1M5SA 1RGVA 2E5JA 2EFOA 1VQ6S 3R9LA 3W5YA 1U6FA 4LQ9A 4P7TA 3QRPA 4JI8F 4NA1A 1RT2A 1SUQA 4DQIA 1MMDA 5KT4A 1RXOB 3DRYA 1AW0A 1DAXA 2BA9A 3FGVA 2X1BA 1VISA 2AYMA 5LMNF 2V8HA 2AV5A 5E3RA 1XQIA 4C8KA 5LMUJ 2W25A 2UUWA 4D3HA 5EUHA 1Y9OA 3N5BA 2AJ4A 4KGVB 2AU0A 2ZUGA 1JLBA 4J9OA 2V4RA 3VAMA 4DL2A 1BQMB 2NUUG 4DV4J 4IDKB 3EGNA 2DH7A 3BS9A 1U0SA 3D6TB 3KLGA 1SJRA 4OZLA 4OL8A 1VC6A 2WSCC 2IVFB 4WE1A 4DV2F 1CJUB 3BSAA 4WP3A 3HM9A 1T0TV 4ZP8A 3B6BA 3DXSX 4AUKA 1G7CB 1B0PA 3GJRB 1RWUA 2WZ1A 3U1MA 1QAXA 2E5IA 1TFYA 2Y1RI 1T8EA 4M8LA 4DV1J 2DR9A 2PI4A 4JI2F 2CPIA 5FIIA 1W7WA 3GYNA 4O3PA 1HI8A 5GAGU 5HATA 4FYDA 4DR2F 1NK5A 1UWAA 1Y10A 2GQ2A 4PABA 5KFRA 2PFDA 4MAKA 3M2UA 2ZUAA 1T03A 3J80U 2ZVIA 4NWBA 3JSBA 4QJVA 3W2VA 4O3NA 4XIUA 3ETOA 3QT5A 1KC8T 4DV3F 5HLFB 1VMBA 2AX1A 5ETVA 4ECXA 1OO0B 4ES1A 4UW2A 4EO8A 3OVBA 3I0SB 2CPHA 3V6HA 2EKYA 2E7XA 2B9YA 3AB4B 3LH2S 5IQ6A 2VH7A 1Z4UA 2H48B 2MHNA 3M8SA 2KO1A 1WG4A 3I4HX 2W2NP 2RKIA 1AB8A 2V2QA 1ZA2B 3KKFA 2R8HA 3DGPB 3FBFA 3TVYA 4PWDB 1M1KT 1A9NB 4PCQA 1MMLA 2F9DA 3HHNB 2ZH3A 2MZQA 2BANA 1OPIA 2M4MA 1XMBA 1ZOTA 8AT1B 4M95A 1I94F 3M8RA 1ZAXA 4TQRA 3RUBL 5LSOA 2R8IA 2XMWA 4EBDA 1RHQB 2BE9B 5A8KB 2K7JA 2P5VA 1SC6A 4WYLA 2Q79A 2FJXA 3HSJA 5ETLA 1X4CA 2KDOA 4PXBA 2B8QA 1DZ5A 5K20B 5F8GA 4DCOB 1DURA 2ZOGA 1VDHA 1D0EA 1NKBA 1S9EB 4TY9A 3KWMA 1GXLA 2QIFA 4BLGA 1CQMA 4OI0A 5CZXA 3D0IE 4C7QA 2OPPA 3KHGA 1FDNA 1Q7YT 4DR4F 3P4UB 1JLCA 2AP6A 3CWJA 2FJVA 4RW8B 1FK9A 2LEPA 3MM8A 3OW2R 1L3KA 3W60A 1H2VZ 3G4SS 5HP1B 2MJUA 4UOCA 1RISA 4ZKAA 4LVOP 4JYAJ 2NLWA 4F2RA 5J1NA 3IN5A 3GB0A 3JSMB 2GJFA 4RNNA 1MROB 2VFTA 3N6LA 3VGTA 4NZ7A 2GVDB 3A12A 2XEXA 2B4PA 4QW9A 4DJBA 4NCAA 2XULA 3LGHA 5M2UA 3VGUA 4RWXA 1NZAA 3MEDB 1QTNB 4IO9Q 2XMUA 2FLPA 3GJTB 5T14A 1TKXB 4CO1A 1SXLA 1YBUA 4GVBA 4IOAQ 3CSKA 4FVCA 3DYAA 3CJSA 1R8PA 3MAAA 3NG8A 2V4QA 3W61A 2K06A 4LSNA 1PBAA 3O44A 4HACA 1XNQF 2NCKL 2QYGA 4JI0F 1HWJA 5I3UB 1YI2S 1JX4A 3ZNUA 1JXEA 3CPWR 3IFEA 1ZM2A 1I1GA 1Q81T 3MM7B 1HHSA 1MMNA 3GMGA 4URQU 2RRNA 4JP8A 2J5AA 2Z2ZA 4NCGB 4LF2A 2LU1A 4QR0A 2WVEA 3P96A 1FNXH 2A6OA 1IBLJ 2XM3A 2CQ2A 2O66A 2FC8A 2GHVC 2VV5A 5HBMA 4KYZA 3PX6A 2AJQA 2NQPA 1I5OB 4M5IA 3DOKB 1TL4A 4RW9A 3D67A 1ELOA 1FVSA 3I9ZA 2BZ2A 5THWA 4ECQA 3HLUA 3AOBA 4LFCF 2M2BA 1CC8A 2L08A 2VICA 4Q43A 5DDRC 3PACA 3HVTA 1HPZB 1TL1A 5DM6Q 3I87A 4PG7A 4W98A 2ZE2B 1WELA 3DRRA 2LECA 2D3ZA 3ZZYA 4RW6A 4HT7A 3UE2A 1D09B 2DEIA 3NAHA 4LFAJ 4X66F 1T95A 2RQMA 2J0QD 1HW8A 4MFBB 1GXUA 1RT4A 1HYSB 4FP9A 3CJTA 2ZZMA 2GAGC 2Z30B 2H9ZA 2HRTA 3CCRS 1JLFA 2M5YA 5D4OA 1VQNS 2PT0A 2IJFA 3SXLA 4ZVFA 3R5CA 1LEOA 2QLJB 4TY8A 4L76A 4C3MA 4LF1A 3BQ1A 3H42A 1U4BA 2AEJA 2OHDA 3NBPA 2GGPB 4ZJQA 2XS2A 3H2UB 1I3OB 4ECVA 3W66A 2RB7A 2DXEA 4Y2CA 3UDVA 2MKYA 2ABYA 2Z8QA 5GAHI 3OR1A 4HI1A 2JEIA 4B3MF 2YNHA 2BMBA 3P5TL 4WTYA 4K50A 3MTKA 4ZPAA 1RLDA 1NO8A 2WVCA 1RAGB 4F3MA 4KQZA 3M9MB 2C3PA 3KK1B 2J6SA 1NSQA 5KG4A 1NB7A 2Z57B 4TNOA 3OL8A 4C11B 2DGVA 2AYEA 1U8WA 5FD1A 1U2RA 1FA0A 4JI5F 1AZSA 3H90A 4LR7A 3MUVP 1UEVA 4R8UA 1SKUB 2BUNA 3PXGa 1WDTA 1RB0A 1RTZA 1SH0A 1BQMA 2BJ8A 4IDKA 5DETA 3MWBA 4C6AA 3CC7S 1N5TA 5JJBA 2G9OA 5HK4A 3MPWA 4DMZA 1CJUA 4CIOA 4CO5A 1FTRA 5D0RA 5KFGA 2DHHA 4WFNQ 2DGQA 3U1LA 5T41A 3E01B 3OL6A 1B4SA 4ID5B 1QAIA 4WXOA 4Q0BB 4J9SA 5KG1A 1N5VA 1UKUA 3UI3A 3GFZA 2KFZA 4LF5F 4LFBF 1BHNA 2CQBA 4ZCMA 3LWLA 1IKVB 1IUJA 1UJ5A 4O4RA 5F0UA 2XCAA 1RP5A 3TQEA 1FKOB 2E9ZA 1KS2A 2CJQA 5K8MA 3GG1A 2NZCA 3T5HA 1NHVA 4I56A 5KFVA 1XC9A 2CJKA 2V9KA 2IMOA 5HLFA 1TL3B 3OFEA 2ZNZA 4EFAC 2LLZA 2DNGA 2W2PP 4ECYA 4IH7A 5BYRA 1CJKB 3DOMA 1RWNB 2FVPA 4WU3A 3V81B 2CPXA 2COLA 3CC4S 1RKIA 3OJSA 3EMTA 3UDEA 4TKTA 2XHWA 1H7WA 2GA7A 5LSRA 1PYSB 3SFUA 1UW9A 4HEA9 2KB2A 3SV3A 3K5PA 3DGPA 2C3MA 4XO0A 1HD1A 2VUGA 2CIMA 4PWDA 4CT8A 1KVKA 4P2XA 3H5YA 4Q8EA 2LDYA 1GTEA 2V2ZA 1QTMA 5KFPA 4LF9J 2CJ9A 2J0SD 2XI3A 4RUBA 1JMTA 1R6YA 5CD4H 2FJBB 4RBTA 1UCNA 2B6AB 2CDQA 1RWXB 3FCHA 1AA1B 5B0AA 2ZEJA 3DLJA 5LM7E 4ELTA 2BJEA 1FF2A 3MXHP 1RDRA 4L73A 4NYPA 3HT0A 1GAOA 2B56A 1BQNA 1Z2ZA 2IDEA 4Z7CA 4ZVPB 1EHWA 4C97A 2AEFA 3AHPA 1XJWB 4RW8A 3MAQA 4EI2A 4DV4F 2YNIB 4K5RA 2D41A 4ZVTB 1H98A 1KQFB 2YH0A 3MUMP 2BJ3A 2BBEA 3WX4A 4RL1A 3LOUA 2RD5C 3OR2B 1X4HA 2V34A 3AAWB 4ILMA 1KTVA 2VIHA 1VQLS 4ZOSA 1MROA 3N4WA 3KMSA 3UR3C 2ZJQQ 2AF6A 4KKOA 3GILA 1UJ4A 2BV3A 1N52B 1HNXJ 4DV1F 1U1RA 3HZGA 3R7BB 2OUGA 3J80Y 4ECZA 4X62J 3KG4A 2OH2A 2HK3A 1FJEB 2CG8A 1SI9A 1FRHA 5D0EA 3KUGA 2YNGA 3BGRB 2RU9A 3ILLA 2C2KB 1QDUB 2E66A 3BF4A 3HSDA 1JJCB 1C4CA 2BABA 3UVJB 2FZGB 3DMJA 1RTDA 2VFVA 4I1TA 2D9PA 1U1PA 3MM7A 1EZZB 3CDBA 5L8RC 2G4BA 2HVHA 2IDLA 1FDAA 1YDLA 3EGWB 4O4GB 2ZOMA 3PW0A 1C0TB 4J9PA 4YMEA 4Y00A 4K4XA 4B17A 5D15A 1U1QA 4DL7A 2X51A 3KYLA 3M32B 3AD7C 1D9AA 3R6LB 2YH1A 1H2UX 4LBPA 1NJXA 1U25A 3CJ4A 1ZPWX 3PYEA 1U24A 4LREA 4NLSA 1HPZA 1ZTTA 5JVHQ 2MDAA 3MR3A 2ZE2A 1DTTA 3RAMA 4KSEB 1TZ0A 2R8JA 4NLQA 3RBEA 1UVLA 1V3SA 4MFBA 3AQPA 4P75A 4FXWA 2HHHJ 2FY1A 3NNCA 2BRKA 5B08A 5L39A 4DG1B 4BC7A 1KVIA 2B0GA 3QT6A 3BSOA 2VU5A 4HVZA 2BJDA 2RJZA 5GMKa 1WOOA 1PJ7A 2VG5B 1JLGB 2MKIA 2MQLA 3QZ7A 2XMJA 4DUTA 2BW7A 4G6VB 4CZCA 4IG0B 2C2NA 3J81U 3QT8A 2DHXA 3EGZA 3GR0A 2J9DA 4YB6A 4JB8B 4H4MB 4ED8A 4ES3A 4JYAF 1FFGB 5ETPA 2RE1A 1IKWA 1Q53A 3GLJA 1CJTB 2RRAA 3MM9B 1WEYA 5L46A 3ZTOA 3KK1A 3QQCD 2B4UA 3CJ3A 2AIRB 1TL5A 3CMES 2KFYA 3N79A 2UUCJ 3HXMA 5HL7Q 3HJFA 2KYXA 3CD6S 1QSSA 2ZC4A 3TZXA 3W8PA 3FEZA 2UUAJ 3I32A 2QTWA 1LW2A 1TKTA 4CM0A 2K3IA 2HAIA 3QPIA 3KUHA 3OVAA 2AQ4A 4JI6J 1RLCL 4OZ2A 4MK7A 1NJIT 2I1RA 3IRWP 4GC7A 2HHPA 1UVNA 4I69A 2VFUA 2B9EA 2KXNB 1RT3B 4YY3J 1B7FA 4LRCA 2Z4PA 3TUJC 4PR6A 1IBLF 1WUUA 3KLIB 2X1FA 4OJ1A 2R7RA 1WEZA 1X60A 3MTJA 4ID5A 4PXCA 3OXLA 4Q0BA 3K5MA 2M8HA 3SCKE 3QIPA 3DDIA 3RW6A 2UP1A 5HO4A 2HGNA 3M7VA 4PYDA 2DNRA 1NJYA 2LKZA 1IKVA 4Y34A 3A8EA 4ZITA 3I31A 5AXLA 2VA3A 4PZVA 2B5JB 2LEAA 2GMHA 2IYGA 1SL1A 3CF5Q 1XK8A 1YJ9S 2FLLA 4OZJA 1FDBA 1MU2A 1IBKJ 2ZH7A 3KDOA 3DXBA 3LW5C 1TL3A 1N5YA 1S79A 2X7IA 4LFAF 2BE2B 1S4EA 4CLUA 1CJKA 1Q1KA 4NLWA 3VALA 2H3EB 2LDIA 3B4DA 1O51A 2MSTA 2C22A 2XTJP 3GFXA 2ZC3A 3CDAA 4CLZA 2QGFB 4K4ZA 4NOHA 4N7TA 3WZ0A 3RW7A 2PSZA 2YTCA 4KV8B 2C2RA 5KFLA 2VA2A 1KWMA 5B0BA 3HHEA 1M5OC 4WFXA 4NRTA 4ZK7M 4C4WA 4X4RA 1NDPA 3ZZRA 3S6EA 1YJRA 1JXVA 3EGVA 3IMQJ 1WKLA 4C8NA 4A46A 2B6AA 1GQEA 1RJJA 4PKDB 3U02A 5E3CA 5A2QY 1YX2A 4ANEA 2CJYB 2FJAB 3VV2B 4KBIA 1WHWA 2FD2A 5J2NB 3TA1A 2VOPA 2HQIA 2XSJB 2HZCA 4YB5A 3I56S 5D77A 3KJNB 2Q1LA 4DFPA 3QWPA 4OZNA 1N33J 3GIIA 4LUBA 8RUCA 4RX6A 2XNRA 1GX6A 2DNMA 4WZMA 2YNIA 3FBEA 2B8PA 4RBUA 1RSCA 3LA0A 4NMXA 3OR2A 2IVMA 3HCXA 1FJCA 3DRXA 2C3UA 4FF2A 1VLYA 2UUBJ 1N56A 3MD3A 4RW7B 2Z56B 3HO1A 2R2SA 3J81j 3FMBA 4D3GA 1S6UA 5A76A 3HKZD 2QRRA 2KH9A 4B3TJ 3MF5A 4PQUA 1KQSR 3TVKA 1Y11A 2CWKA 2JJ4D 1U47A 4ZPWR 2VZ9A 4F7VA 4F4AA 2N4CA 3VVUA 1R27B 3FDSA 5D3GA 1Y0HA 3NGRA 3UVJA 2GVZB 3WDOA 4DX6A 3AJ1A 3E3XA 3WHIA 2RIJA 4OHWA 1S1XB 2H5EA 3O1LA 5L1IA 2H54B 3SYZA 1F9FA 2JFDA 2GHPA 1S10A 5HQMA 3HMJG 4O4GA 3EM1A 2HS0A 5B0EA 2HGLA 1HFEL 4CTAB 4I6AA 2NSCA 4ECTA 3KHRA 3M32A 2YKQA 1UFKA 2P6TA 2Y8WA 3M9NB 5KTQA 2W2OP 2FLNA 3LALA 2HFZA 4M1KA 1F2HA 4NLTA 4A8QA 4LF9F 4R0EA 1YVFA 4M5DB 1JQGA 1RBLA 3HKWA 2P9GA 1QE1A 2CQIA 2DY9A 1TL7A 3OLBA 2XNQA 5BYQA 3RJMB 4M94A 2ADBA 3EUNA 1C0UA 2UXDJ 2LQ5A 1YIJS 2F8HA 1S57A 3ISNC 3JSRA 1BD6A 4HR2A 2HMIA 2H1YA 2OIHA 4USKA 2CFXA 2AJ0A 4P74A 2VG5A 2FJWA 4LR9A 1KR4A 3CGIA 1UJ6A 1KP6A 2UV8A 4ZPTR 1VS3A 4NXNJ 2JH3A 5J2QA 2OEMA 2M7SA 3FQLA 3C6UB 3ITHB 4H4MA 2U1AA 2JEGA 4OYZA 1S7IA 1JLQA 2MLXA 2KM8B 1ZZFA 1JJ4A 3UPFA 1KBRA 2PDAA 4ERDA 3FEXB 3MEKA 5IOLA 4KHPJ 3T5KA 3UCZP 4DEZA 3PW4A 1HNXF 1IJFB 3KG0A 1N32J 3ZZUA 4X62F 3MFIA 1KVJA 1EQ0A 4KFBB 5GMDA 3QZ8A 1SL2A 1RAOA 3I0RB 1YJTA 3DLLQ 3R2DJ 2RDJA 2HK2A 1VQ4S 4IQXA 1UFLA 2HNYB 2HG4A 3CCWA 2J8SA 1KFDA 4CP5A 4O3SA 1XMQJ 5G0RB 1EAYC 3KLFB 1RT3A 2WSEC 3DRSB 1HWKA 1KTQA 3H59A 3C16B 3PYFA 3PR4A 1KLMB 4NEYA 5IC4B 3FFIB 3ET6B 3QFHA 3ILJA 4QYZJ 3LF0A 1SH3A 3T5JA 3EPGA 2O01C 4HHHA 3ZTPA 3I6PA 4HKQA 2WW8A 5K14A 1CULB 3SBMA 2HFSA 1D1UA 4YR0A 3CJ8A 3ENAA 2QL5B 4NPOA 4DSLA 2XBPA 2LQ9A 1VK3A 5LJ3Y 2AJFE 3CCUS 1S59A 2YNFA 5A0YA 1S4FA 2IRUA 1RI7A 5A6PA 2AMCB 2HS3A 5AJ3J 4PRFA 4F36A 1RHJB 4DQRA 2E7WA 4YN3B 3C66A 4OMFG 2HHHF 2CNLB 2PGCA 1LFPA 3J81Y 5B0FA 2WBMA 2V68A 2YWGA 1M0SA 3J7YU 2IY5B 4A8SA 4USVA 3Q0AA 3FMWA 3H5SA 1SPBP 3JYTB 1R0BG 4NZ6A 3CJ5A 1WI6A 2RSQA 2MEWA 4KV8A 4Q5VA 2V2VA 3PKMA 5FDLB 2GIQA 4FF3A 1MW7A 1P27B 4DL4A 2ROGA 4DS5A 1JNZB 1X9SA 2XWXA 2RS8A 3QYYA 4EO6A 3R7NB 4EK2A 1KHWA 2ZH5A 2KM8C 4F67A 2BM1A 1Q16B 3QSYB 4B9MA 2WVBA 1NPRA 4CLSA 5IC6B 1JB0C 2UUCF 4OFZA 4IH6A 1LNQA 2CPDA 3H25A 3QAEA 1K73T 3D6HB 2UUAF 5CYQA 1NJWA 3PTWA 5F9NA 1RACB 1U02A 2NPFA 4JI4J 4I67A 4JI6F 4QWDA 3DU5A 2HWHA 2DISA 2Q43A 1TK0A 1IQTA 1VHIA 5KFAA 1WEXA 4XAKA 1RU2A 3J7A1 1HMVB 3WC0A 3PYGA 2IM1A 1UL3A 4A8FA 2BJ9A 4UQGA 2W8KA 4PPZA 4YY3F 3ZTRA 4PUOA 1FHTA 1FRLA 4TU7A 3CNQP 3UD4P 7AT1B 4PAAA 1CVJA 4RW7A 4DPXA 4RW4A 1LFWA 2DHAA 3GYGA 1PYOB 4K2JA 1RA6A 4QR2A 2YKMA 1H74A 2FGOA 2FQQB 3GTYX 1U45A 2OSQA 1WD6A 3HHLB 2W9BB 1TELA 3E51A 1HQUB 4A8XA 2HZAA 1APSA 3J7Z5 2HHSA 3RR7A 2V8DA 3O2IA 2GVZA 1FE0A 1KSPA 2KL8A 2Y3YA 1IBKF 4KPYA 5E3AA 4QIEA 2NXCA 3Q22A 2JEJA 4JBCA 3CDWA 4ZDNA 1GNKA 1YJWS 2J0WA 5IT4A 3OTBA 4OX7A 3W1YC 4ATNA 2WTFA 2RT3A 5JXSA 3PCOB 4CTAA 4IH5A 1JJHA 3FUYA 3AODA 2LP4A 4RNFA 1DTQA 1NDCA 3D2WA 4RO0A 3MHYA 3K5OA 3TJ9A 1RT5B 2YVSA 1FD8A 2LQJA 1WG5A 5HQ8A 3FVYA 1U1OA 4BWJA 2MTLA 5KFJA 1NK4A 2JWNA 1M5HA 1XNRJ 4UZBA 3SCIE 1U0HB 2EK1A 2ZKUA 4OI2A 3BPDA 3ELHA 2DEJA 3W9HA 4NLXA 4HDHA 4AQYJ 2KG0A 1NK0A 3ZTQA 3GV5B 1PSDA 2HQFA 5HSPA 2CYYA 3KOAA 4EMDA 4TYAA 2LEBA 4NLYA 1OYEA 3T1HJ 3KJVB 5SZTA 1D3WA 4ED2A 1N33F 1S1VB 2B4VA 3IWNC 1BGXT 3K2YA 1CC7A 3MCSA 4ZVUB 3LQVA 2A1BA 1VQ9S 2IPOB 1RU1A 5EHHA 2HHUA 1HNZJ 3C6UA 1UEKA 4DSFA 2QMUB 4X4OA 2C2ZB 2UUBF 3MPDA 1R0CB 4I0WA 3G71S 3C3LA 4IRDA 3CJKA 5KFTA 1QUVA 2H65B 1RAIB 2H5JB 1HBOA 9ATCB 4DV6J 3C6TB 1HW9A 2MKKA 1N48A 5I3PA 5E3QA 3K57A 5HN0A 1JLAB 4B3TF 2YQ1A 2R42A 1KDNA 2QL9B 4KFBA 3HHLC 5EWGA 2IHR1 5BYSA 3I0RA 2MKHA 4NLOA 3F56A 4HTJA 2HHWA 2HNYA 2DCLA 1A7GE 1IBMJ 1GX5A 4I7FB 2MGZB 3IRXB 4N8OA 1O6XA 3KLFA 4U7CA 3DRSA 3KK3A 1PBUA 1HIYA 2W7PA 1KLMA 1Z1ZA 4CLPA 3U27A 1IJEB 2JZ5A 2L9NA 3MR5A 5L1KA 3TYTA 3SMZA 3BGOP 2A2DA 2CNNB 5F8JA 4LF6J 2QFIA 2VJUA 3UNYA 1RWVB 1TMMA 3HP6A 3H0PA 1ZM9A 3R8YA 4KGKA 4J9RA 4U8VA 2YKNB 4C8ZA 3N28A 1YG0A 4I6WA 3DOLB 5CH7B 3AOCA 1LK7A 2IAJB 5HANA 2MZRA 2J76E 3CTRA 3TAMB 4RUHA 2HWTA 2PE8A 4MKAA 3DLKB 2MQNA 3QFWA 3VHQA 3BDPA 2PA3A 2MKJA 4QPTA 1WWHA 2FUG9 2OELA 1SL0A 4L6V3 1TV6B
chains in the Genus database with same CATH topology
4CIOA 3KLHB 1N5SA 4CO5A 2UXDF 2VONA 4OI1A 3GV7B 2ZH8A 4C0HA 2YKOA 3M2RB 1FTRA 2K8GA 5KFGA 1K1SA 3I4PA 2CZVC 2Y0SD 4WFNQ 5I42B 3MM5A 3ENQA 5IFMA 2DGQA 2YQ3A 3QGHA 3U1LA 1S9FA 2XGPA 5T41A 3R5DA 3E01B 4G1QB 3OL6A 2C2DA 1OSCA 2FB0A 2OAUA 1HD0A 4ECWA 4ID5B 1L3TA 5EN1A 1QAIA 4WXOA 2R7XA 4Q0BB 4J9SA 5KG1A 3T6JA 3OUYA 2PD1A 4X4UA 2D1CA 1N5VA 1DQ8A 1UKUA 2U2FA 5C24A 3V4IA 3UI3A 3GFZA 3MM5B 2KFZA 5LT5A 1FKOA 4LF5F 2AD9A 4DL0C 3RB4A 4NXNF 4LFBF 4LJMA 2KJWA 4Q44A 1AXQA 4QW8A 4N5SA 2ADCA 2QA4G 3HVAA 4IG3A 4F4YA 2OTLS 3E8OA 2CQBA 4BCAA 1VBYA 4ZCMA 3LWLA 2DGXA 5KOWA 1IKVB 1IUJA 2F1FA 1NNDA 2HRYA 1UJ5A 4O4RA 5FDLA 5L1LA 3OUYB 5F0UA 2XCAA 1RP5A 4KT0C 5C24B 1U2FA 2HRUA 1FKOB 3TOQA 2E9ZA 2VASA 3I5AA 4AL5A 1KS2A 4MIWA 2CJQA 4I64A 1NEEA 1UFWA 4OI4A 3QJLA 5HI7A 2CPZA 5K8MA 3GG1A 1XERA 3POTB 3J7YI 4O3OA 1ZTWA 4KAIA 4IG3B 1NHVA 3T5HA 2L41A 4KO0A 2OO4A 4I56A 3V81A 1F5AA 2ASJA 1D9DA 3OJUA 5KFVA 1HI0P 3HT3A 1TQLA 1XC9A 1B64A 4RNMA 2CJKA 4WYWA 1ROFA 2V9KA 2ZBCA 4HYKA 3L3CA 3CUNA 2V5HG 2IMOA 5HLFA 1TL3B 3OFEA 5E7OB 5GAGI 4B08A 1SJ1A 2QSFA 2ZNZA 4EFAC 4F8RA 2LLZA 2DNGA 4KHPF 4ECYA 2N3OA 2RILA 4IH7A 1H0HB 2CQPA 5BYRA 3G8TA 5L9NA 1S1UB 3BB5A 1O5JA 3DOMA 2MZTA 5IQQA 2FVPA 3BM7A 4WU3A 3V81B 2CPXA 1N32F 3T6BA 5DGAA 2COLA 1SJQA 4YDDB 3CC4S 1RKIA 2I9SA 4DDFA 4K4VA 2NXUA 3MFHA 3OJSA 1U8SA 3K5NA 3KNAA 1EETA 4TKTA 4FN5A 2XHWA 1VBZA 4EWTA 4YR2A 4ED0A 1H7WA 2BXJA 3THVA 2MZ1A 2GA7A 2VQFF 4FNHA 5LSRA 1BLUA 1DQAA 4NX9A 3C46A 2WRMA 4QOTA 1XR5A 2XB2D 1Y7PA 1OQ6A 3SFUA 2ATLA 2IFXA 5E33A 4HEA9 3BN7A 2KB2A 5KOXA 4F02A 2DNLA 3IXQA 3KFWX 5EX3A 2VG6A 2C3YA 1VRTA 3QWUA 3K5PA 5SUHA 3B8HA 1RTJB 2KXHA 3SV3A 4ECSA 4DFKA 4Y65A 3DGPA 1U1MA 2C3MA 4XO0A 3CO9A 4PG4A 2ALZA 4KTQA 3MOJB 2G13A 1HD1A 3NCPA 4CO2A 2DK2A 4DF8A 2VUGA 2CIMA 4PWDA 3UDCA 5JUMA 4CT8A 4Z37A 1HMVA 4CH7A 3H5YA 2DRAA 4Q8EA 2LDYA 1X4AA 1GTEA 1QTMA 1UVKA 5KFPA 1HL6A 1X4DA 5CYJA 3BO4A 2CJ9A 1NKCA 2XI3A 2J0SD 3T9NA 3M4XA 5GADU 1QLNA 3PRBA 3KLEB 1JMTA 1XMQF 1R6YA 5KFKA 5K8NA 2EG1A 2DH9A 2AGQA 3K7RA 2UXBF 2CQDA 3LGNA 4EGLA 3IO1A 1UWBA 4H4OB 5CD4H 2FJBB 1FEEA 4RBTA 4OHYA 3CMAS 1B0TA 1XN9A 1M5KC 3PEJA 1RT1A 4RBVA 4A48A 2B6AB 2CDQA 3QLHA 5CHCB 3FCHA 1M5PC 1RAJA 4LF7F 4LIWA 2DNNA 2Q6CA 2YKPA 3H40A 5B0AA 1NAQA 2F8MA 3EZ5A 3DLJA 4YEAA 2L9DA 2VFSA 5JVGQ 4F25A 4DL3A 1UA0A 1SJFA 2UZAA 1QAJA 1VIXA 1T02A 2OTJS 3CD5A 4ELTA 2BJEA 2B7BB 2XLIA 1FF2A 3MEEB 1RT1B 2DITA 3HHLA 4OI6A 3MXHP 6FDRA 2HNZA 3TR5A 1RDRA 3R1HA 2JC0A 5DQGA 1VQSA 4NYPA 1CLFA 1GH8A 3O6QA 2BR0A 1BWEA 3SZ2A 1GAOA 4X4NA 2B56A 1SBRA 1BQNA 3M6XA 1Z2ZA 1SJ3P 4MH8A 3HPOA 2VPWB 1Y3KA 2OLWA 1LV5A 2IYIA 5F8LA 3Q8RB 2DO0A 4C97A 2YWFA 4MMOA 4HTIA 3OXGA 3UNGC 2Z2MA 3AHPA 3NGDA 2R7VA 2KZMA 1Y4ZB 5J1EA 2JEFA 3HX9A 3KLVA 1YGYA 4FS1A 2HLTA 3TUZC 1ZBTA 4RW8A 1BQNB 3MAQA 4DV4F 2HW3A 3O8WA 2YNIB 1SV5A 4K5RA 2LA4A 2D41A 3M9OB 1H98A 2E1RA 1UMJA 4ED3A 1QVFR 1KQFB 4YB7A 2B51A 2GQCA 2YH0A 2G1DA 5E0OA 1L5UA 1RQ0A 3DHWC 3IWXA 3TRGA 2Z2LA 4X4SA 3MUMP 4J9MA 2BBEA 3WX4A 1WI8A 3LP2A 1ZETA 2R8KA 3G9CA 4KC5A 4YP3A 3LOUA 2RD5C 3IG1A 5K9FA 2CPEA 2ZNYA 3OR2B 5KT7A 4UY8T 1X4HA 4H4KC 4JI1F 1U6BA 5J1EB 5C25A 3AAWB 3NP5A 1JXLA 3BJYA 1Q8BA 2DH8A 5AJ3F 4Q8FA 4W92B 1KTVA 4ILMA 3EZUA 4FF4A 4K4YA 4A8KA 1N0VC 3WBZA 2E9RX 2HFNA 1LW0A 1Q78A 1SB6A 2JHEA 5MAOA 2XG8A 5KFXA 2HYIB 5C42B 2WOMB 2JDJA 3AB2B 4QWCA 1LWCA 4ZOSA 1VQLS 4X4PA 3OL9A 3LP2B 3NMAA 1GXTA 4XDDA 3GIMA 3IG1B 1MROA 4F4WA 3N4WA 1M90T 2B3TB 4K2XA 2HIQA 3US5A 2KFNA 3KMSA 3B82A 3SSQA 3OV7A 3BO3A 1XR7A 1JKHA 3UR3C 2ZJQQ 2AF6A 2IJNA 3N01A 4KKOA 2AW0A 4CT9A 5CCLA 3MEGA 5H9FJ 3GILA 1UJ4A 3GYXB 3SSSA 1TP7A 2I2YA 2BV3A 1N52B 2ZD1A 4I6YA 4DV1F 1U1RA 3HZGA 1V3RA 3DCAA 3BGRA 2O5DA 3W2WA 3BR9A 3TW0A 3J80Y 4ECZA 3DLEB 1FT8A 1G3OA 3KG4A 2OH2A 1PC5A 2L48A 1FJEB 1HBMA 4DQSA 3D1OA 4ZVEA 4KKOB 2XCPA 4ICLA 1TKZA 1QUPA 3MEGB 1LXNA 1Z2LA 3L7PA 2MMYA 2MHEA 2ZD1B 1S1TB 1FRHA 1SI9A 2YNGA 2UXCF 1PGZA 4AYBD 3BGRB 3GFHA 1F0XA 5KT2A 2K7KA 2RU9A 1B0VA 3V5RA 4NLVA 4E98A 5IXUA 1UP1A 4MTPA 1YBAA 1QM9A 1X5OA 1HBMB 2E66A 3RAQA 3BF4A 2K1RB 1X5PA 1S6OA 3HVWA 4DWIA 2BQRA 2J8AA 1Q86T 1C4CA 3OFGA 4DQQA 3QO9A 2HHVA 2BABA 3MUTP 5I4MA 2BW2A 2W9CB 2GW8A 4ZS6A 2BQ3A 2A3JA 2YNGB 5F8NA 1LQ9A 2YWEA 4IRCA 3G6VA 1SL2A 3DMJA 1RTDA 2ACYA 3JTOA 2VFVA 3AQOA 1C0TA 4I1TA 3DLGB 4TYBA 2D9PA 1U1LA 1REVA 4U9RA 4HL9A 3MM7A 4Q2LA 4DLGA 2VKZG 1U1PA 1UVIA 2B9WA 1YITS 3A1YG 2B43A 3CDBA 4JV0A 4Q7AA 1IKYB 3QGIA 5L8RC 2UVVA 2G4BA 1KN6A 2HVHA 4B02A 2FJDB 1FDAA 1WF0A 3M1VA 1R3NA 7FD1A 1S6QA 3EGWB 3DMJB 4DOZA 1RTDB 3D28A 1KONA 4O4GB 3Q2TC 4N77A 2ZOMA 3PW0A 1C0TB 4DSKA 2DIVA 4Z2XA 4IFVB 2CJAA 4J9PA 4YMEA 4I2PA 3IR5B 1VQ5S 5A6WA 4Y00A 1RT7A 4KIAA 4BHQA 4K4XA 4K4TA 4B17A 2IVYA 1S1VA 2MQPA 2VODA 1U1QA 3HI9A 4JI4F 4DL7A 3TANA 3TAPA 2HLUA 2X51A 2NREA 3KYLA 1R8HA 3M32B 2E5LF 4NMLA 1SQEA 4QU7A 2EW9A 1RK8A 2IM0A 2MKSA 3M1VB 1D9AA 3UD3P 1S6QB 1FKAF 1U1NA 2YH1A 3OXFA 4OZ5A 1Q82T 2NS1B 4CO3A 2LA6A 2CQ1A 2BVZA 3K8VA 4OZ0A 2Y1JA 2GV1A 3NRBA 4C8YA 1H2UX 4RKUC 3ZC4A 1FRXA 3H4DA 2QV6A 3B4MA 3MECA 2EK6A 2ZH6A 1NJXA 1U25A 1ULRA 3IS9B 4B9TA 1HNIB 3RR8A 2DHSA 3NNHA 3PFEA 2HHXA 5C5JA 3CJ4A 1ZPWX 2PA8D 2BACA 2M70A 4J37A 1U24A 4ED5A 4NYOA 4NLPA 2V0NA 1DLOB 4NLSA 1HPZA 3QGGA 1ZTTA 3MMBB 2J6UA 5JVHQ 2BM0A 3B78A 2MDAA 3MR3A 3CCMS 3VWSA 2ZE2A 4R5PA 2KT2A 2X3GA 1RT6B 4WKYA 1U26A 1DTTA 2FDNA 2HGMA 3RAMA 1HWLA 2DO4A 1HWIA 2OPSB 4KSEB 4DG1A 1TZ0A 1G2EA 2XZWA 3S01A 2CQ0A 1BQXA 2R8JA 3SQGA 2IC3A 4NLQA 3RBEA 1UVLA 2KXFA 3DRPA 4B3OB 1V3SA 5KFIA 2ZBIA 4MFBA 1WACA 1JLAA 2GHWA 3OBIA 1N0UA 3AQPA 1JLEB 4FXWA 3NNCA 2FY1A 3K8WA 5CYMA 1JLGA 3BGFA 3FNNA 1DTTB 2E44A 2BRKA 4ZPDA 5B08A 5L39A 5CA5A 1RTHB 4DG1B 2F4VF 1T94A 1P8GA 4BC7A 1KVIA 2B0GA 2OKQA 3AH6A 4IG0A 3BSOA 2AWZA 4HVZA 4Y28C 2BJDA 2RJZA 5GMKa 4ZCKA 5A8WB 3EPIA 3DNCA 3LO3A 3OVSA 1N6QA 3O3LA 2FHJD 3SCLE 2VG5B 1N88A 5CYMB 1JLGB 1X4GA 2R7QA 4OJ3A 2J0XA 2MQLA 2MKIA 2EG2A 4ZCIA 3QZ7A 4B3SF 2XMJA 1S1WA 1NKEA 2FVRA 3D1QA 5CCMA 5A8RA 3NGKA 4O0IA 4G6VB 4CZCA 3PX4A 2D9OA 2C28A 1L3UA 2KT5A 4IG0B 1R8BA 2X1GA 4Y2AA 5G4DA 3MM9A 4I7FA 2DHXA 3PW5A 2DPJA 3UCUP 3IRXA 1FE4A 3EGZA 3AJ2A 1R89A 2WAQD 2HNDA 1P9QC 2J9DA 3GR0A 1F5BA 4YB6A 4Q45A 1NK7A 1S1WB 4H4MB 5BJRA 4ED8A 4ES3A 4JYAF 5A8RB 3EXYA 4USHA 4FF1A 4AFFA 4RLEA 2RE1A 3BGUA 2EPIA 2IA0A 4HDGA 1IKWA 1Q53A 2RRAA 2PMHA 3MM9B 3TA2A 2E1CA 1Q7LB 4OHZA 1WEYA 1KEKA 2XS7A 4WK1A 4IOBA 2VPZB 2HNDB 4UUXA 5DJBA 1YHQS 3KK1A 1VC0A 3BO2A 2D7SA 2RUGA 4Y2KA 2B4UA 3QJJA 1DQ9A 1IKXB 2DGWA 3CJ3A 3TAQA 4DL5A 1TL5A 3CMES 5L38A 2KFYA 3N9UC 4MKBA 3N79A 1IKWB 2C3OA 3MAHA 3HXMA 4WK3A 5HL7Q 2QLXA 3HJFA 2IBOA 2KYXA 3M05A 2DGSA 2YKNA 3N6NA 1H7XA 3RB6A 3P6YC 3CD6S 1QSSA 2ZC4A 4ZP9A 1KQGB 4G1IA 3AA9A 3FEZA 3HVRA 3LUYA 1QAYA 1ZM3A 3I32A 3DOLA 2LXIA 3VQTA 4AXJA 2HHQA 2JL9A 1LWFA 3OTEA 3BEGB 4IRKA 1FTCA 1LKZA 1LW2A 1TKTA 2K3IA 3MZIA 4Y3CA 1U7LA 1C1CB 2HAIA 4USJC 1Y5NB 3QPIA 3OVAA 1URNA 5KFUA 4ETZA 4QWBA 4DV0F 4DHVA 2LU2A 4DSEA 1Y00A 3OTDA 2AQ4A 1KNZA 3UCGA 5H9EJ 3TAMA 2CQ3A 2EFVA 1X4BA 2JSXA 4MK7A 4WZQA 2I38A 3OQ2A 4U6PA 4H4KA 4N56A 2LCWA 3I5CA 3IGVA 1XNRF 3DHXA 4YOEA 1S6PA 1YRTA 3IR7B 1LWFB 1S48A 1UETA 3C8YA 1NJIT 2I1RA 4JV1A 1LW2B 5IT0A 1TKTB 5IZHA 3IRWP 4IKAA 2QT7A 4GC7A 3KLIA 2HHPA 4XPEA 1E6YA 3FZ2A 3VQSA 1UVNA 4I69A 4JV2A 2VFUA 4QIVA 2FC9A 2KXNB 3G6ES 1RT3B 1TV6A 4AQYF 4JI7F 2DCUB 3KLHA 1B7FA 3CXCR 3RU0A 1FXRA 1S6PB 2DT9A 3IR6B 3M2RA 1C4AA 1W2IA 4V19J 4PXEA 4K4WA 2QMWA 3JB9k 2Z4PA 4O23A 2ZJRQ 3TUJC 1YTYA 4RUAA 4OI3A 4PR6A 1S77D 1IBLF 3ZZTA 5I42A 2DNOA 4GO7X 2IRYA 3KLIB 2YKAA 4LVNP 2X1FA 2PFFB 4OJ1A 3SV4A 1E6YB 5EGYA 2R7RA 4C9DA 1WEZA 3CDEA 4G1QA 2WB4A 3T1HF 5HROB 3MTJA 2R2TA 5DG9A 4F26A 4ID5A 3MI7X 4Y2MA 4PXCA 3OXLA 2R4FA 4Q0BA 3K5MA 2R7SA 2MY8A 2M8HA 3SCKE 3QIPA 5KFWA 4QQBA 5T7LB 1SUQB 4YUDA 5D4PA 3RW6A 3H20A 2W4PA 3ULHA 4DR6F 4ED7A 1FJ7A 1MWZA 4HHJA 2UP1A 5HO4A 2B5JA 1XMOF 4K0KF 3QJPA 2HGNA 2B7CB 2XSFA 5KFDA 5F41A 3HHLD 2DNRA 1NK6A 4FXVA 1NJYA 4KGMA 2FVSA 4PG8A 1J2VA 4GMKA 2LKZA 1IKVA 5EX0A 4Y34A 3A8EA 2WHOA 3QIPB 4TLQA 1R0AA 2YWKA 1HNZF 2ZITA 4MK9A 3I31A 5AXLA 2VA3A 2MB0B 2ZHBA 3O5TB 3SCJE 1JLBB 1RYSA 3KHHA 2B5JB 2J7UA 2RH3A 3PDNA 4CNZA 5B7WA 2ZHAA 2XY7A 1UEUA 1VI7A 1YJUA 2BE2A 2LEAA 1U1KA 3POTA 4PPDA 2GMHA 2IYGA 4IO1A 3HK2A 3PKYA 3W3SA 3LANA 1SL1A 3CF5Q 1XK8A 1YJ9S 1R0AB 1QJHA 2R7WA 4OZJA 1FDBA 1MU2A 2FLLA 3KLGB 1T3OA 2ZH7A 3PVXA 3LW5C 3DXBA 3UQSA 4DV6F 3DLBA 1TL3A 3LP1A 1N5YA 1KQKA 1S79A 2KG1A 1KD1T 4CH0S 3VAJA 4ZVHA 4LFAF 1GT8A 4QWAA 2BE2B 2F7VA 2JRSA 1S1UA 4WXWA 5M2PA 5H1SV 1UVJA 1MWYA 1Q1KA 4NLWA 3NS6A 3G6XA 4PQAA 2IRXA 2M3DA 2MZSA 1H6KX 3VALA 3DLHA 5DG8A 2LDIA 1NHUA