3SCIE

Crystal structure of spike protein receptor-binding domain from a predicted sars coronavirus human strain complexed with human receptor ace2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
180
structure length
174
Chain Sequence
b'CPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRFLRHGKLRPFERDISNVPFSPDGKPCTPPAFNCYWPLNDYGFYTTTGIGYQPYRVVVLSFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiotensin-converting enzyme 2
publication title SARS coronavirus: mechanism of host receptor adaptation and rational prediction of future evolution
rcsb
source organism Homo sapiens
molecule tags Hydrolase/viral protein
total genus 28
structure length 174
sequence length 180
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1840 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3sciE01
3D0GE 4ZPVR 4QZVB 3SCLE 4ZPWR 4L3NA 4KQZA 4L72B 2DD8S 3D0IE 2GHWA 3BGFA 4KR0B 4ZS6A 3SCIE 4ZPTR 5DO2A 4XAKA 2GHVC 3SCKE 3D0HE 2AJFE 3SCJE
chains in the Genus database with same CATH superfamily
3DOMB 2MY7A 3CCWA 5CA5A 4NLWA 1OYEA 3WZ0A 3R2DJ 1VK3A 1LXJA 4PG6A 3H42A 3MMAB 4CTAA 5LXRA 2OTJS 4NXNF 4RU9A 1HWKA 4XK8C 3NY0A 2XGQA 4CQ1A 3TP2A 4OZ1A 1D0EA 4ZLPA 4YMEA 1TR0A 1NPKA 1Y3KA 3ZTSA 4JI0J 1AFJA 1B4SA 4E0DA 2CG4A 1HKAA 1NB2A 1S48A 4DV7J 3DMJB 3PZPA 1F3FA 1V5IB 3SMZA 4J90A 5HJXA 1RAGB 1O6XA 4DSFA 1ROFA 1H98A 3JSYA 2UUBF 3TR5A 4KO0A 2ZZMA 4USHA 4TYAA 3UVJA 2BJ1A 3MM6A 1RAFB 4NLXA 2HPUA 3G82A 3W7BA 5C24B 2DXFA 4DR6F 4W4MA 3MMBA 3TAMB 1NHUA 2CQ3A 1S7IA 4I6AA 1D1UA 1U49A 5C42A 1T9XA 5J2MA 3PDNA 1JWWA 1X4BA 1VRTA 4PRFA 2UXBJ 1B70B 3FNNA 4OYPA 1PC4A 3GR0A 4CLLA 1R89A 2ABYA 2MJUA 2NS1B 3OLAA 1GFWB 4IDKA 3SSSA 2B9YA 2V34A 2FLOA 1XR7A 1QVGR 1YG0A 1UTAA 3NP5A 4TQRA 2MKHA 3FRYA 2UVRA 2XEXA 5F0UA 5DG7A 4X64J 3CW2C 3PIPQ 5KFFA 2EK6A 1RQ0A 2CQDA 3CD5A 4R5PB 4IR9A 5ADZA 1FXRA 3O3LA 3I0RA 4KV8A 4ILRA 5KFZA 5KFTA 1M90T 2Q1LA 1VHIA 4CLSA 1RXOB 2CAJA 3M30B 3VGVA 4YDDB 3Q83A 1IBKF 2I5JA 2V67A 2J0SD 4GKJJ 5I3PA 4ID5A 1S9FA 2PO4A 1TK8A 2E5GA 4ED8A 1T05B 2W8KA 1YZ7A 3H90A 2KTQA 1V6HA 2VA3A 3AXKA 4RX6A 1RT3B 2ASYA 3MFHA 1U1LA 4OJ3A 1KLMA 1UWAA 4F0KA 4KFBA 5J2PB 3DC2A 1RT4B 3TO8A 1H3DA 5JJBA 2UXDF 1SKUB 3Q86A 3EUNA 3H5UA 3MAHA 3IRWP 4BDPA 1T9WA 3TOQA 2VB6A 4MIBA 3HHNB 2IDEA 4J37A 1JLCB 4DR2F 2DNKA 1FXDA 4PUOB 1RADB 3QGIA 2HIQA 2ZEJA 3DXBA 1J5EF 1XERA 1IR2A 2WSFC 2WONB 1TKDA 2H1YA 1TMMA 1WKKA 1YRTA 3OR1B 2VQEF 1ZM4A 2AP6A 3QATA 3CCRS 1LNQA 4B3SJ 4W92B 1IKWA 3EPGA 3DRSA 4GO7X 3KJVB 2ZDOA 4CM0A 1CQMA 4PG7A 4DR7F 1Y0HA 1KTQA 3VAMA 1C1BA 4RNFA 4LSNA 2Y1LB 3DLBA 1S59A 1CJUA 2VC1A 1FX2A 4OYOA 1VC5A 4OYAA 1K1SA 1TUWA 2K7KA 2BUNA 1X8DA 2UP1A 2BJ7A 1WOPA 2FJEB 3QT8A 3R8YA 4DCPB 2F4VF 4DPXA 3MUVP 5A8KA 3D66A 4XTTA 4K5SA 2HIYA 3VHQA 3G6YA 2OD4A 4B3MF 2NXEA 1KVJA 4CYUA 4X4VA 3R9LA 5LMUF 2XYGB 3A8IA 5KFBA 1SL2A 2P5VA 4ES1A 3HPOA 1T8EA 1U4BA 2LMIA 3LP1B 4DV5J 2VONA 2QLFB 2HHXA 1HD1A 2MKJA 1JK9B 2QC3A 3SCKE 5C25A 2F9JA 2HNZA 5F9LA 1RHUB 3IS9A 4X4NA 2GJIA 1CJTB 3SFGA 2G2ZA 2XLKA 1C0TB 4YN3B 1T7PA 3T1HF 2G0IA 4IUFA 1FVQA 1S97A 1ZBTA 2OTLS 3O6QA 1ZZFA 1L3TA 2ZOMA 2BM1A 4DL3A 5EWEA 2CPZA 3U1LA 3LW5C 3CJ8A 4DR1F 4CO2A 4M5JA 4ZP9A 3WIUA 3L7PA 3W66A 1FKPA 5CD4H 2I9SA 4CP5A 3AA9A 1Q53A 2BEFA 4OZJA 1YGYA 1M5VC 2X1GA 2V4JB 1JNZB 1TL4A 3SYZA 1LFWA 3I82A 3W1YC 3ET6A 4JOUA 1QY7A 4NYZA 2WK4A 3GJRB 4YB7A 2IHR1 4KAIA 3GSDA 1XMOF 5IM0A 1R6VA 2R2SA 3K2YA 1F2GA 2PE8A 2JC0A 4RBTA 3SDEB 3F56A 2QLWA 2CYYA 1NB7A 5HVHA 4EWTA 2DD8S 4UY8T 1QLNA 1S0OA 2V69A 2JC1A 4L3KA 1RT6A 2YKAA 3EGVA 4N77A 1N56A 4CLKA 1Y10A 1NU4A 2IM2A 5K8OA 2L41A 1RTHA 3DXSX 3V81B 4ECYA 3ZXWA 2PA8D 1HNIA 4UW2A 5JVHQ 1N52B 3NNHA 4NLYA 2ZJQQ 3IWLA 2HHHF 2XMUA 4WZQA 2KO1A 1SL0A 1MWYA 5IWAF 4K4TA 3M8WA 2D69A 1PG5B 3SSQA 1PAEX 3CC2S 5HMWA 2MKYA 4E98A 1CQNA 2YVSA 2J5AA 4NLSA 5ETRA 5H9FJ 2MB0B 2ZH3A 2V8DA 2C3OA 2BA9A 4JV5F 3U7JA 4BWJA 1MG7A 2JFKA 3OD2A 4CLTA 3RW7A 4I69A 2VPXB 3PR5B 2HW3A 2H4WB 4CTAB 5F8MA 3BR8A 3BKTA 3B4MA 3OFFA 1SJ1A 2CQIA 3DLGA 3AJDA 1IBMF 5LSOA 4U95A 2YBVA 3P6YC 5M2UA 4CT8A 4NRUA 1FFSB 3T5HA 2KRRA 1R7IA 1VR6A 1RCOB 1RGVA 2RU9A 3DCAA 4DLEA 2AJ0A 3HMJG 4KO0B 3OL8A 3PYFA 4M63A 5LJ5Y 2NPIA 3UVJB 2BABA 3MM6B 2WB4A 3HSJA 4K4WA 4HH0A 2QMUB 4MIWA 4RR5A 5T7LA 4M5KA 2CPHA 1U1RA 3BBCA 1FTCA 3W5XA 3CNQP 1TAUA 1SI9A 1HWLA 4DX5A 5J2MB 4F0HA 4K5RA 1CS4B 3GFZA 2EKNA 5EUHA 3V6KA 1PCAA 2ASDA 1Y5NB 5AT1B 4X4PA 4IDKB 5KG4A 2HNYA 3C3LA 4DI6A 4X65J 2QG9B 2FIUA 2AV5A 2DO0A 4JB8B 1N33J 1VQNS 2VPZB 2KVIA 4JP8A 4JI8J 4ICLB 5AXLA 3DLHA 2FJAB 6FDRA 3I0RB 4KV8B 3KJNB 3RB3A 3EZOA 4IH7A 1RWMB 1SV5B 2JL9A 3C6TA 4JI7F 1JJ4A 1CULA 3GV8B 2I5JB 2YNIA 4LBIA 1IBCB 4ID5B 1RJJA 2IAJB 3TEGA 3GYNA 3DLKA 4NLUA 1QSYA 4QYRA 2D41A 3MD3A 2E9TA 4FVMA 1VQ9S 3OJSA 1OY6A 4OYBA 2D3O1 1IR0A 4KFBB 4CRJA 1VC6A 3IM8A 8ATCB 1UFLA 1TP7A 3KLFB 1SC4B 2DVIA 3K5MA 2RQMA 3P49B 1N88A 1X4AA 1MMNA 4K59A 4FXDA 5EWGA 3BN4A 2WB1D 4IG0B 1NSKL 1IKXB 4KB7A 1AFIA 1QTNB 2MKCA 3KDOA 1EP4A 1BWEA 4XPCA 2H4YB 2FJXA 3JQKA 4ZPVR 3M8QA 2FY8A 3FGVA 4OZ0A 3RZAA 3DRSB 2FB0A 2JEIA 2DIUA 4PCQA 1M5SA 1NPRA 1C1BB 4LSNB 1LQ9A 2D3OR 2X3DA 3GCXP 3GP9A 1CJUB 5HBMA 3CJKA 1S10A 4M5MA 1PAUB 3LAKA 2E5IA 3PJ9A 5A6PA 1FCAA 5RUBA 3CDWA 4DUZF 1G3OA 3N0VA 1BWVA 3EE3A 3KJQB 1KS2A 5A8KB 3E01A 4NA2A 3PV8A 1Y3JA 2EI5A 3TAPA 3CPWR 1RU1A 2DIVA 2CQ2A 4CYUB 4ZMMA 4Y28C 1NK9A 1HPZB 3PXGa 1UVNA 2GX8A 3MAAA 4I6YA 4DQPA 1T9TA 2JHEA 1T11A 3CB4A 3IGVA 4MT1A 1L3UA 2WVFA 1Q8IA 3Q2SC 1CBKA 5E3RA 2JEFA 2DTJA 2QA4S 4LF7J 5HQMA 2V2QA 4QQBA 4CO3A 3IS9B 3FBFA 2DR5A 4KIAA 3CCLS 4RNNA 5GAGU 2LU2A 2XCPA 4ZP8A 3LP0A 4JI5F 3MMCA 2RILA 1NO8A 1LXNA 3LGHA 1FNMA 1HWIA 2ZH6A 2EXUA 1VLYA 4Q7AA 4Y34A 4O4GB 4O3SA 1FKPB 1NZ8A 1WWHA 3SFUA 1OY9A 2ZH1A 4I4BA 5KFEA 2EFQA 1DURA 3MR6A 3QO9A 1ZM2A 1EKSA 3VAIA 3ADAC 2LEBA 4A46A 2E1RA 2XS5A 1HLWA 3T6BA 1S6PA 2Q3PA 2B5JB 3NEKA 2PMZD 2FGCA 2DEIA 5HLFA 5DM6Q 1BQNB 3ET6B 4FYYB 2QT7A 4NLOA 4RU2A 1O51A 2DNOA 5IM0B 3R5BA 4X66F 2JLEA 2F8MA 5EX0A 4RW4A 1BMQB 3SZ2A 2Y8WA 3JQMA 1FJGF 1Z4UA 3F0NA 2AHOB 2QLXA 3LQVA 3ZC4A 1HQUA 2C2KB 3E3XA 2DY9A 2Y9HA 3D6MB 1H2UX 1DARA 1RT6B 4WP8A 4OJ1A 2B6AA 1WACA 2C1EB 2XMJA 1DQ9A 2KYXA 3RRHA 1RT2A 4OI0A 5L8RC 1UW4A 2EVZA 5A8RA 2V8PA 4LF8F 4L72B 1HNIB 2HK2A 3UCZP 2JLFA 3IBWA 1VBXA 5DO2A 2UVUA 4LF9J 4ZHRB 3OTOF 1XNRJ 4A8WA 2CQ4A 2UVVA 2A2DA 3PY8A 3D28A 4ILMA 3TEHB 3GFHA 2G0CA 2NYHA 2GZOA 4Z7CA 3HSDA 4NZ0A 1URNA 1RWKB 2FVRA 3N6MA 2VBZA 1JMTA 3IM9A 4WU3A 2XY7A 5D0EA 3VZHA 4EZ6A 4LRCA 2BJ9A 3J7Z5 1WEZA 3H20A 2J9CA 3R6LB 1NK4A 1N5YB 2ALYB 4RW9A 1FEHA 4LFCF 2E29A 3U27A 3W65A 2XMWA 4DPYA 2HRUA 1S79A 3BYPA 3CCMS 1FE4A 4UQGA 3MM7B 2R4FA 3VAFA 2DR6A 1IN0A 3IN5A 4DF4A 3KHLA 1X31C 5DDRC 4JBCA 2V2ZA 3PW7A 5ETMA 4DR3F 4ZIWA 2DXDA 3MI7X 4KKOB 4BWMA 4LBHA 4IRCA 2COLA 4WU2A 3LO3A 3I0SB 4ZVTB 5HVFA 2UUCJ 3G87A 2WW8A 1S1XA 1U1MA 3CCZA 3GCWP 1F2HA 3FC9A 3PM9A 4IKAA 3OVAA 2KHCA 3HSZA 5KOXA 2ZJPQ 3QJJA 3QIPA 1E6YA 3U1NA 5KG5A 4NYPA 2PN6A 3JYTA 3EDQB 2OP5A 2HNYB 3FSIA 1U1PA 1DQ8A 4L74A 1SC6A 4URSA 1NKEA 5GADU 4OHYA 3HKZD 1OWXA 4YR0A 1VMBA 1UPPA 3IR7B 4PXEA 1UETA 3M6UA 5KFUA 1KRPA 2H65B 4NRTA 2NUUG 3TANA 2R8KA 1PJ5A 4J9NA 3R1LA 1PYSB 4ZVEA 1JLEB 4KPCA 3SQGA 3T9ZA 3C6TB 4OX8A 1IXKA 1NPPA 4FZVA 4WJBA 4JI0F 1B0PA 1CULB 3OW2R 2KYZA 4DV7F 2YNIB 3J81j 3ILOA 2LECA 1F9FA 2DNMA 2DHAA 2FVSA 2FHMA 2RAQA 1WHVA 2CWKA 1L3VA 3IMQJ 3MEEA 3RGIA 1SJ4P 2P6TA 3A3OB 3ITHA 4MKYA 4DZDA 1KLNA 2CPDA 1NRKA 1YSJA 3W63A 3C8YA 2IBKA 1FDNA 2XM3A 3PX0A 2QA2A 2FZGB 2ACMA 5DGAA 3GV7B 1G2EA 1GTHA 2G0JA 2ZH9A 2UXBF 2NQPA 1EP4B 4KBIA 2EEYA 1C4CA 3TA0A 2AD9A 3RR7A 1UVMA 1UFKA 4F0MA 4X4QA 2YWKA 5FJ4A 2WAQD 1LW0A 3GIJA 5KT5A 4CLYA 5LMNJ 1WNEA 3IC1A 4DF8A 4B08A 2FHOB 3AOBA 4UUXA 4X64F 2RHQB 5HK4A 3TUZC 4PWDA 2MXYA 5EGYA 3KLGA 1YK9A 5T41A 1FFWB 2ACYA 2ZBPA 5HBMB 3I31A 3BS9A 2MZSA 2ZVIA 4PQUB 3WDOA 1AB8A 5HL7Q 1O8BA 3CT9A 2WCXA 2LQ5A 3KNAA 3CDAA 2CQ1A 4DR4J 3M8YA 3E01B 1Y00A 1H7WA 4GKJF 2HQFA 5G0RA 1HD0A 3CC4S 1S1WA 3Q8VA 1JLQA 5KFAA 3TUJC 2B4UA 2VOPA 4DFJA 5C5JA 2IYGA 1FDAA 4N5SA 3VAGA 1LWEA 2CJ9A 5GAEU 2FD2A 1YBTA 3CIMA 2R7XA 2PGCA 2HLTA 2ZBCA 4DFMA 3IG1A 3N6LA 2LA4A 1IJEB 2YX1A 3MTKA 1ZZNA 9ATCB 2YH1A 4LT6A 4WP3A 3BBFA 2HVHA 3I32A 1HW8A 4WYLA 4LR7A 1R31A 5A8WB 2LA6A 3LP0B 1JJ2R 2ADCA 3UDVA 3QRQA 3K59A 1PYTA 3MMCB 4HACA 4TKTA 2GAHC 3J7ZT 1SH0A 1RKJA 4B3SF 2ZH4A 1S6OA 1XIQA 4TVAB 4KE5A 2DCLA 4LRDA 5E2QA 1G4CA 2KL8A 2L9DA 2ZBRA 2HURA 3LWMA 4WZMA 2OGUA 3QO9B 4WP9A 2AJFE 4KY3A 3H2UB 4Y3CA 2ZH2A 1K1QA 2JZ5A 2FHJD 3Q0AA 3VAKA 2DRBA 2QO3A 4N7TA 2CDQA 1S6PB 2XNQA 5BR8J 3FZBA 3D7SB 3PKMA 5HLFB 3FRZA 1BUXA 4YY3J 4USIA 4NMXA 2KFNA 4RNHA 3KK1A 1WDDA 3A4TA 1RWUA 3DDKA 4LRBA 4IO9Q 2WVDA 4ZLJA 1RBOB 1R3NA 2R2TA 3QT6A 3O2IA 1EJ7L 3MPYA 1UKUA 3K89A 1FXLA 4PG5A 1H6KX 1REVB 3DHXA 4X4TA 2C2RA 4DV5F 3KXDA 3FMWA 3D2WA 2B6AB 2FHJA 1BE4A 3HHLD 2LQJA 2WVBA 2B4VA 1RT2B 2Z2MA 5A8RB 3H4BA 4F3QA 4CLPA 3NWRA 4IG3A 2IBOA 4MH8A 3VGUA 1XNQJ 4K4SA 4CDIA 3MM9A 4USKA 3HI9A 3IFEA 3PO5A 2FUG9 3W5ZA 2V68A 4RBUA 1L5UA 4HHHA 5BXIA 3UN2A 2UV8A 1PSDA 3DOLA 5CYJA 4K50A 1YTYA 3UFCX 4RNMA 4J9UE 3FEYB 2DEJA 4F7VA 3HHLA 2NREA 5KFJA 3NOCA 5EHHA 4X84A 3T6JA 2V50A 2XMTA 1M5PC 3KK3A 2IRXA 4AYBD 4KC5A 4RW9B 1S0NA 1VC0A 3H2LA 2DRDA 4USWA 2B43A 2VV5A 4WFZA 2J0QD 3T1AA 5D78A 1OS5A 2C3YA 4ED3A 2CADA 3Q89A 1XWLA 2C3MA 1EX8A 1ZAVA 2R2RA 3L3CA 3G4SS 2H48B 2V63A 3GG0A 4J9RA 4EI2A 4O3RA 4LR9A 1DY3A 3BYRA 2MPUA 2DH9A 3H98A 2VG6A 1UCNA 5H9EK 1QTMA 5KT6A 1D9FA 4ZPAA 4USUA 2NXJA 2XLIA 3EVOA 3GR1A 1JKHA 2IFXA 3VV2B 5DZ7A 4QYZK 2Y1IA 1VI7A 1U1OA 3A8KA 4EU0A 1ZS6A 1S1XB 1IWAA 1YZ6A 2P9EA 3CC7S 5HAOA 1V9OA 1U1KA 3IBFB 1QUVA 3IGNA 1RE1B 3QIPB 4DX8H 1E6YB 3ZZZA 4OZ5A 2DR9A 1A6LA 2MZJA 3Q22A 4MIAA 2IA6A 2ZZNA 3CJ3A 2F1FA 5AXKA 3WX8A 2O66A 3K5PA 2IIHA 2LDYA 4TN2A 2OEJA 5ETQA 2AU0A 4ZVQB 2VBYA 1RAAB 3MR3A 2HRYA 2J0XA 2OPSA 5GAGI 1P9QC 4CWBA 1FA0A 2YWEA 3D1OA 3BREA 2F7VA 2HEKA 2MLZA 4B9NA 3HP6A 3PRVA 4G65A 2KN4A 5JMNA 1CC7A 2EW9A 2LXUA 1D09B 4HI2A 2A1BA 5KG6A 3N5BA 3PW5A 1ZM9A 3TZWA 2VHGA 2IJFA 5D3GB 3K5OA 3C15A 1Q8LA 2EFVA 2PD1A 2HQIA 5D4PA 3OXFA 2BM0A 3QPIA 2K3KA 4HDGA 2VFSA 3G71S 4UZBA 2K1RA 3D67A 1R8AA 3DRRA 2KXNB 4B9VA 4W90B 3D1HA 4OV1A 4ZVPB 1VQ5S 1N0UA 3AD7C 4EO8A 3ITHB 1P27B 1UEKA 2W2QP 5KFPA 1S1TA 5CZXA 3V6HA 2I2YA 3J7YU 5G4DA 1NZAA 2RB7A 1S0MA 3CULA 1CLFA 2DNZA 1DHMA 1VISA 3OFEA 3ILJA 4DHVA 1FJCA 4I2PA 2HHQA 1A0OB 2OPPA 3BB5A 4XIUA 4J9MA 2HWIA 1YI2S 2OUGA 1M0SA 2WOMA 2CPEA 2OI2A 3UCGA 1ZA1B 4Z37A 1MMLA 2DT9A 4RWXA 3E2EA 4X65F 1S9GA 1U09A 2G1HA 3AJ2A 1P9YA 1K0TA 1KKHA 1W25A 3ZZYA 4M95A 1N33F 2YX4A 5HP1A 2BX6A 4WTYA 4JI8F 3MFIA 3HLUA 5K14A 3HVAA 3DGVA 1N5VA 4HH1A 2DGWA 3BR9A 5KFWA 1GMWA 1UJ6A 2UU9J 3GJQB 2IJRA 3QQCD 3D68A 4KGKA 2XZDB 2WW4A 3M9OB 2BMBA 1HBOB 1S1WB 2RS8A 3R2CJ 2B56A 1JLQB 4WIQA 2CQGA 1TUGB 2BJ8A 2XMKA 1FEEA 1VJQA 1XQIA 2W25A 4QIVA 1LV5A 4E8UA 1N36J 4ZVOB 3B82A 3QNWB 4OI6A 1EQMA 1QJHA 2C22A 3GTYX 5D0RA 2HVZA 1SB6A 2GO8A 4K4ZA 1LWEB 3A12A 1N5QA 1FF2A 4DN9A 4C8MA 4CNYA 5F0WA 4LMZA 3C14B 3IG1B 2K7JA 4XDCA 2E7XA 3UCUP 2NSBA 2HZCA 4A4JA 1Q86T 4LREA 4CZCA 1RP5A 4OHXA 1E6VA 3PW0A 4FYWB 2J9DA 4AXIA 1FKOB 2F63A 3AHPA 3AXMA 3MF5A 1TTHB 3ZZUA 4ZN3A 5DDOC 1RYSA 4HACB 3LA0A 1IKYA 2VASA 1NXIA 3FFIA 1KHWA 4DPOA 1KDNA 5B7WA 1QSSA 3C19A 3B54A 2HZAA 3JSRA 3ISNC 1S49A 3ZZRA 3DOMA 3ISZA 5HROA 2BW2A 3EZ5A 1AW0A 1S57A 5U47A 4DU7A 5DG8A 2ATCB 3EWGA 4LBPA 3I5CA 5E3QA 2ZVSA 4N76A 1NMEB 2V8VA 5J1EA 1GNKA 4Y2MA 1VQKS 4FBTA 1JLFA 1RHQB 1HBMB 3SV4A 4PYDA 4DV4J 1KWMA 2FTRA 3KK1B 2WZ1A 1UJ4A 3BQ2A 4N41A 3B4DA 1AUSL 2G13A 1WDTA 4R0JA 2AJ1A 1B0VA 5A0YA 5LSLA 4ZVSB 4NZ7A 2J9DE 2AIRB 1TKZA 3DDNA 3PW4A 3P3DA 1U48A 2PC6A 5DDQC 1HA1A 4DL7A 4CH1A 4MKBA 3CJQA 1JLBA 2W2NP 4G3IA 1FX4A 1S9EA 4F2SA 3MPVA 3M8SA 2QJ3A 4JYAJ 2NXUA 4DS5A 1C1CA 3OT9A 1EARA 2RH3A 2A10A 4LF7F 4F26A 2W9BA 3MEKA 1P1LA 1RAEB 2FPHX 3J7A1 2D74B 4C0HA 4IG3B 5CYQA 1FRKA 3RRGA 2M5YA 4FDFA 3HJFA 3NCQA 5D0HA 5MAOA 3V5RA 4NA3A 2D3UA 3DOLB 2GW8A 4KR0B 4CT9A 2PDAA 2O67A 2XULA 3M2VA 4DX6A 1DAXA 4C3LA 5KFVA 1WF1A 4OI4A 3H2VE 2W2MP 4QU6A 3N01A 3TI0A 2R7OA 3EX7B 4PG8A 1I94J 1Y5IB 1GT8A 3KK3B 3KLHA 2OKQA 4J9KA 3SCJE 3HVRA 1VYAA 1OO0B 3T5LA 3KFWX 3AT1B 4ETZA 1SPBP 2XWYA 1X5TA 2UVWA 3US5A 4DQIA 1U2FA 1FKAF 1RAIB 1N54B 3PX4A 4KHRA 3R97A 5AE2A 2VG5A 2VG6B 3KLVA 2JVRA 5HQLA 2HAIA 1URRA 4Z2XA 4FF4A 1XMQJ 2IYIA 3GJSB 3ELHA 2EC0A 4EUVA 3AD8C 1YRXA 4QW9A 1JKHB 2F4FA 5DM7Q 4ZPTR 3GFYA 2L9WA 4P52A 1RHRB 3IAM9 1C4AA 1HNVA 4LF9F 1JLCA 3HT0A 4X4OA 1XNRF 4URQU 2J7WA 2HFZA 3MECA 5GAEI 2WONA 1TL7A 3NCPA 5KOWA 3UD5A 2NXCA 2KHDA 3H59A 3KJVA 4P6QA 3J7AN 3T19A 2FC9A 4ID8A 3OFHA 1RZMA 4ZS6A 1X5SA 4V19X 5K8MA 4XO0A 1X7VA 3DI6A 3A8JA 5F3TA 2OPSB 3AA8A 3M6XA 1GAOA 2K8GA 5KFOA 1TK0A 5E33A 5GAHU 4DX7A 3TAQA 3M8RA 5KG7A 3OTEA 3SQOP 1FRJA 1YBUA 4DU8A 2BE9B 1TVRB 4RWWA 3C15B 4O0IA 1QSLA 2APOA 4ZK7M 3OSNA 4U96A 2ZE2A 3PR4A 3Q8YA 4CH7A 4YR2A 2Z57B 1ITPA 3ZNUA 2KJWA 2VA2A 2K1RB 5KFMA 2CG8A 2J6UA 4P75A 1FWKA 1U6BA 2FGOA 3EVWA 1JLGA 3MR5A 3PX6A 4FN5A 2R42A 1MWZA 2DNLA 2Q6CA 4KYZA 1N34J 3MM5A 1KR4A 1WUUA 2UUCF 4NXNJ 4TLQA 1VDHA 4OL8A 4F4KA 2BKPA 4DUTA 2X1FA 1C0TA 4I2PB 2QIFA 4C6AA 4P2XA 2RDDA 4LQ3A 1NK5A 2GV1A 1IBLJ 2VG7A 4O4RA 3POTA 2WOMB 3VAHA 2HNDB 5BYQA 4J91A 3CO0P 5LJ3Y 2KI2A 4AL7A 1I6JA 4NZ6A 3THTA 1S9GB 2LXFA 3ZO7A 2CFXA 2MHNA 3TX8A 1U45A 2NCKL 1H73A 4OZLA 3CD0A 5HP1B 2CPJA 2QYCA 2ZBQA 3IXQA 2W4CA 3K5LA 4DL5A 2QN6B 4DXLA 5K14B 3TVKA 3DRXA 3AB2B 4L75A 2YNFA 4GMKA 3OSPA 3AOAA 4P2MA 5C2CA 3B8HA 2RSQA 4BS2A 4N47A 2XHWA 5IT9Y 2YKPA 3TUPA 4NLGA 3MR7A 3SDEA 1NKCA 4U9RA 3AB4B 1Q82T 2OHDA 2UUAJ 1YHQS 1V3RA 2HVDA 3HHDA 2JLGA 2HZVA 4DV1J 2YWWA 1Q79A 3PFOA 2MEWA 1CPZA 1R43A 2R8IA 1WC4A 1GMUA 4NMLA 1F3VA 3MPWA 2C2MB 2HBYB 2F40A 4EGLA 1RT1B 2DHXA 1KNZA 1HFEL 4DPTA 2QSFA 3I4HX 4NI2A 4K7QA 1PO6A 2CJKA 3ENVA 4QBUA 1LW2B 1E6VB 3KLIA 2QTWA 2RUGA 4ED4A 3OL6A 2ASJA 5KG1A 1CVJA 1VCTA 3FZ2A 3M1VB 4M5LA 1RAHB 1IKYB 1B0TA 1KOOA 4B9TA 2KT2A 3FSYA 2O3DA 5LMNF 2ROGA 4IOAQ 1RTIA 2GHWA 4TU9A 4B17A 3CMQA 1RB0A 5LL6d 2ZZTA 1HYSA 1DQAA 5HROB 3H0PA 4YB6A 4ZP7A 5KT4A 5J1EB 4DL2A 1N5TA 1WG4A 1Q1KA 2H5JB 2UXDJ 1JLFB 1TFWA 2HBQB 3DRPB 3D6FB 4DR4F 4U7UK 4ECTA 1NK0A 4UOCA 2L48A 1NSQA 4QOTA 3NXZA 1NDKA 4TU7A 4M5DA 3HHKA 2RQ4A 4DPUA 1S1UA 2O1PA 4DJBA 4E2FB 5SZTA 5A0YB 5IT0A 1BXNA 2W9CA 2MKIA 1TKZB 4C8YA 5DZ6A 3LAMA 1T03A 3D3CJ 5B0AA 4WXOA 2Z2YB 1UP1A 3NS5A 3M9NB 3P45B 1JLBB 3M4XA 1O5JA 4O44B 2AQ4A 1S9EB 1U0SA 3UD3P 1C1CB 3SIPB 2KDOA 3LANA 2W9BB 1PIEA 4QU7A 4LSLA 3OR2A 1SJRA 1YJWS 4FBUA 3DDIA 4U6PA 2C3UA 4K8RA 3RUBL 4WFNQ 1SJFA 5CYQB 3OL9A 4L73A 1B3TA 4UY85 4QWEA 4ECUA 2V94A 3DN9A 4HYKA 2HHVA 1CS4A 3FVYA 3QSIA 1NJIT 2V0NA 2HFNA 4UQTA 4YQWA 3ETMA 3Q2TC 4XDDA 1F0XA 4U7UD 3M2VB 2HGLA 3CJ4A 4EEYA 2GVZA 2X51A 3AJ1A 3S8SA 2Z4PA 2C2DA 3PYEA 3W2VA 3TQEA 2OMOA 3AQOA 1GXLA 2B7BB 1YJUA 4FPRA 5BR8F 2HQ3A 4ZVUB 4LRAA 5DJBA 1T3OA 4ALZA 3BN7A 4ICLA 3X3UA 2UXCJ 3KLHB 1CSJA 2M3DA 4RUCA 2LEAA 3FBBA 4YY3F 1OSDA 2ZHOA 5L46A 3CCQS 1SV5A 4FYVB 3T1HJ 1D9AA 2MQ8A 4DG1A 3R5JB 4DCOB 2N7CA 3ENWA 1HI8A 2H3EB 3G6ES 2IAJA 4Q2LA 4X62J 5D4NA 2A6OA 1ICEB 4A8FA 3BEGB 4QW8A 2D7SA 4P74A 3RBZA 5D0GA 1KP6A 4DBQA 2VG5B 1IR1A 2X1BA 1WEYA 1Q81T 3LGMA 4IO1A 1OYDA 1OMSA 5DDPC 2DPIA 1HNZF 3A3NB 4ECVA 2GIFA 2VPWB 3BGUA 3KLFA 2G2OA 3HFKA 3OHAA 2JFDA 5CH7B 4GKKJ 4O3OA 1VRUA 1U1NA 3P5BP 2F3JA 5K5MA 2R7VA 1XNQF 1HNVB 2B9XA 2P8IA 3HFZB 4FNIA 3KMQA 1RT7A 4IG0A 4KGXB 1IKXA 1DZ5A 2Y0BB 4WK3A 3MECB 1DTTA 2QX0A 2MZRA 4K2XA 2HFVA 1VIOA 2KZMA 3JXOA 1TL7B 1S77D 3W9JA 1OQ6A 1SKWA 1WG5A 3D0GE 1YDLA 3DI6B 1U0HA 2R7SA 3DM2B 1UVKA 4I2QA 3NL0A 3M05A 4FXVA 1S4FA 2E5LJ 2MQNA 5E7OB 4CNZA 2ZWOA 4L76A 2PA3A 2VFRA 3QZ8A 1UEVA 1TU0B 1D9DA 2YWFA 1F5AA 3FCVA 4J9SA 4B9SA 4DV2J 2BACA 3QSYB 2YX7A 1IKVA 4X4UA 1TQLA 1T0TV 2ZE2B 1KOHA 2GQQA 1KQFB 3DFEA 5KG0A 3VWSA 1IM4A 3SV3A 2J0WA 4NLRA 1JLGB 3ZTQA 5KFQA 5HMYA 1HWJA 1ZETA 2V2VA 2GHPA 3VCDA 1HPZA 1GH8A 3T3FA 2HWHA 3ZNJ1 5E3PA 2MGZB 5J2NA 4X4RA 2L9NA 4L3NA 3ISND 1G7CB 3MM5B 3H25A 1R8CA 2J76E 2AWZA 5AXNA 2Y3YA 4ERDA 2W24A 5EX3A 5JUMA 3FUYA 4Y2CA 3HHEA 2RKIA 4ZKAA 2V8GA 3FK4A 1ZTWA 2HFUA 4O3QA 2Q66A 1FD2A 2E5HA 2VG7B 2GGPB 4RUAA 4F4AA 3POTB 4UOFA 1SQEA 5KG3A 3QRPA 3NGSA 3KWMA 2BKOA 4BC9A 1KQKA 2MSTA 2DHSA 1VQPS 2CJQA 3H5YA 4O4GA 4X4SA 1ACMB 3FBEA 1H38A 5CD4A 2LYVA 2HFSA 4D3GA 1UEUA 3CJ0A 5H9EJ 2A18A 1HHQA 3MWBA 3R7SB 7FD1A 3KUGA 5IC4B 1CJKA 4TY8B 2B5JA 5F9NA 2XG8A 4QYZJ 4PXDA 3BSCA 1BQNA 2U2FA 3NRBA 2JSXA 2YNFB 3KDNA 4Q43A 3W8GA 5DQHA 5L1IA 2FLLA 2EK1A 2AZ1A 4GO5X 3M8ZA 4KT0C 1SKRA 4Q8FA 4C7QA 4AL6A 4JV1A 1FRLA 2GIQA 4B9MA 3GFXA 4DR5J 2OO4A 1UW9A 2NYIA 5DQGA 3KG1A 1R0BG 2R3VA 1FNXH 2MJNA 2GA7A 3NS7B 5IQQA 5K8NA 1Q78A 2ZUAA 5IQ6A 2DCUB 4ZJQA 2A3JA 1F9EB 2HK3A 4AE5A 4ZCIA 5L1JA 3PACA 4ZVFA 1HIYA 1UZDA 1VQ8S 4ANEA 4NI2B 4MK7A 2XYHB 3NNAA 1XK8A 3KLIB 4ECRA 1FESA 1XBWA 2BANA 2O01C 3BDPA 4ZHRA 3BF4A 4JI7J 5IT9U 1FHTA 3JAMU 3BJYA 3RG6A 4ANCA 4JUZA 4YEAA 3M2RB 1VJWA 1ZH5A 4M1KA 4TXSA 4GRSA 1RTIB 4CLFA 1X4HA 5GVQA 5F41A 3OBIA 4NLVA 1HYSB 3KYLA 5HI7A 4EO6A 3TX0A 2HVIA 2JX2A 1QE1B 4N8OA 4QWDA 4OZ2A 1VRQC 3TVZA 4C0BA 4BHQA 2A0FB 5KFDA 2DISA 5MLCV 3SI8A 1N5YA 4YP3A 3H8YA 4HVZA 2UU9F 2Z30B 1EQ0A 1FT8A 4M5DB 2BE2A 3EGWB 3OLBA 1S1UB 3NBPA 4CIOA 3BSAA 2J6SA 5B0GA 4MAKA 2PEHA 2KB2A 2CDRB 4BC7A 5A2QY 2W9CB 3WC2A 3NMRA 3MM7A 4J9QA 1N36F 4NCAA 4CH0S 5CCMA 4FS1A 5GAHI 2I38A 1T03B 2VUGA 1FNOA 1NJZA 5H1SV 3IAS9 3W60A 2ZOFA 4A8QA 2CJXB 1HNXJ 2R7UA 5L39A 3THPA 2FJWA 3RYLA 3IP0A 1Q7LB 4KKOA 4B3OB 2MZQA 1FWLA 4LSLB 3I0SA 3THVA 3OR2B 3UN3A 2G4BA 4U8YA 1QVFR 2YQ3A 4C3MA 2YTCA 1M5OC 1ZAXA 1N8RT 2ZKTA 3BBBA 4I64A 1MMDA 2JRSA 2BQ3A 4RLEA 1C0UA 2POKA 3NS6A 3HD2A 1R8PA 5SUHA 2MKKA 2JJ4D 3VR1A 4RW8A 1UVIA 1T94A 1J5OA 2W2PP 1NNDA 5GMKa 2BJEA 3MCSA 4ECZA 2XWXA 3R6GB 2GVZB 1UJ5A 4F50A 4R25A 3W2VB 2CZVC 3R7BB 2RS2A 3QFHA 3ZZPA 3QGPA 3GWCA 1UFWA 2HGMA 4FNHA 5B0CA 5ETNA 2XSJA 2CXEA 3BQ1A 3HT3A 4DV4F 3LP2A 2CPYA 2FDNA 1JLEA 2GJFA 1OQ3A 2C42A 4IH6A 4DDFA 2KKHA 1REGX 3PCOB 2H5EA 3GE9A 4DG1B 3NLCA 4DV3J 2Y1RI 4H4OA 2E9ZA 4YB1P 4HL9A 3OFGA 2WVCA 4DUYJ 1EHWA 1C2PA 3RAMA 4ZLLA 3LF0A 8RUCA 2XI3A 3N5FA 2VBWA 3OTCA 2RF2A 4RW6B 4LF2A 3CDBA 2IA0A 3MEGB 3UDLA 3W2WA 4RBVA 2PSZA 2CWXA 4KHPJ 3AODA 3KK2A 2EFNA 4K4UA 4Y2IA 1VRUB 3D54A 4IFYA 4PZVA 4WCEQ 2QMXA 1SC3B 4DLGA 2X1AA 5ETVA 4X66J 4I1TA 1RT7B 2MQMA 2LQ9A 1RBLA 3NAIA 4DQRA 4NLDA 1DTTB 2VQFJ 4I67A 1PKUA 4OX9J 2DY1A 3FKBA 3MZIA 2W7AA 2XB2D 1N5SA 3PVXA 2XGPA 2M8DB 1R8BA 2AKWB 4JV0A 2R2UA 5FD1A 1KHVA 1RK8A 1X9MA 4K4XA 1U0HB 3NCRA 1S7HA 2AYGA 4I2QB 1JX4A 1G1XA 1PC5A 4CCHA 2R8HA 3MAQA 2DNRA 2IM1A 4PQUA 2D9OA 1WORA 1GXTA 4C8LA 3GU0A 1HBUA 3L4BC 1FRMA 5KFLA 3LOUA 5FDLB 4Y6IA 1IKVB 1OPZA 3ILLA 1JJHA 2C28A 2DR8A 2HVEA 4H4KA 1CJVB 2N3OA 4Y0FA 3OUYA 4O3NA 2VZ9A 3EXYA 3OXGA 3S1TA 1K9MT 4K0KJ 1HQEA 2MTLA 3IRXA 4RUHA 3RB4A 2I6WA 1F5CA 2DBBA 2LDIA 2UV8G 4H4MA 1XMQF 1G6BA 2EG1A 2MDAA 2VFTA 3NGDA 3RRKA 5J2NB 4Y00A 4KGMA 3G96A 1H2TZ 3EJMA 4HHJA 2NLWA 3VVTA 1RBAA 5E0OA 1Q5VA 2R7QA 2E9RX 3QGGA 2RKIB 4LFCJ 1B99A 2XY5A 1TELA 4Y2AA 2RQCA 4UOHA 1FD8A 5A8WA 1VLOA 1YJVA 5K8PA 4H54A 2QL7B 1R8HA 1YLXA 2C2ZB 3U1MA 2RE1A 3VZIA 1TKTB 4ER8A 1TZ0A 1BGXT 2JVOA 3DHWC 3MPUB 1CJKB 3W5YA 3V6JA 1L3SA 1IWGA 2W01A 4C8OA 4RL1A 3T41A 3QWUA 2NZCA 1Q8KA 1X0FA 2R7TA 1Q8BA 5D8HB 4FP9A 3F41A 3L7OA 2HBRB 2DGTA 2LP4A 1RA6A 3CMES 5J2QA 3HVTB 3NWGA 2PFFB 4WFAQ 3A13A 2YKMA 3BZQA 2R9LA 2VPYB 4QIWD 4M5NA 2NZ4A 5F3ZA 1U2CA 4YHHJ 4P73A 3KG0A 3DOKA 1REVA 4TLRA 3RJMB 3TJ8A 2ZOGA 3E51A 3LPEA 4TQSA 1N34F 4ZCMA 4Q44A 1UZHA 1I1GA 2RJZA 2DYAA 2GO9A 1U8WA 1MSWD 4ES2A 1WKJA 5KFSA 2LEPA 4HDHA 2KM8C 1KFSA 2AGPA 4PWUA 5L9XA 3H7HB 2BANB 1IBLF 1WC0A 3KUHA 4WPAA 1RI7A 2HS0A 2E44A 1Q95G 2VL1A 2ROPA 1NH7A 2X7IA 3P4UB 4OQJA 4DSJA 4EBCA 1SL1A 3UNYA 5L9NA 1B64A 2VFVA 2FJVA 4YFUA 3K5NA 1X9SA 2HQCA 3QGHA 2FJBB 3Q8SB 2JNJA 1X4EA 1S99A 1NAQA 1SJ3P 1RTDB 2VKRA 5IV3A 1HARA 2OSQA 4KGVB 2AJ2A 5T14A 3S7RA 1RWPB 2IVFB 2EPIA 2ZWPA 3CCJS 1NJXA 2BE2B 4EK2A 3NBPB 2B4PA 2UUAF 1NSPA 2BR0A 4Y65A 4ZIVA 4MMOA 4DV1F 1EETB 4F3MA 4TYBA 4KH1B 3C46A 4EYHB 4J9OA 1BC6A 4KPYA 2W1BA 1Q4RA 4ED7A 4PXBA 3VF0B 3ZFVA 1XJWB 2RVJA 4ECSA 2VFUA 1AZSA 1X9WA 5HATA 3DLEB 1UMJA 3G86A 2IM3A 1YQHA 4WTOB 2DGXA 4LJMA 2A2CA 2V4RA 4NWBA 3EGNA 2M8HA 5KFYA 1Y4ZB 2KJVA 1FRXA 1FDBA 4QR2A 2IPOB 3M6WA 3V4IB 5KFNA 2M0GB 4KSEB 4BLGA 2HWTA 2PI4A 1C0UB 1NCLA 4ZCKA 5C2GA 5A2QU 3IR6B 4RW8B 1MNEA 1J5OB 3HF5A 4R8UB 3BGOP 2R7RA 3IR5B 3T1YJ 3RU0A 3C66A 1VQ6S 1TL5A 2ZFHA 1GEHA 4ZVHA 4RW7A 4OI3A 2BXJA 2IVMA 4EBEA 1YX2A 4A47A 3NMAA 1AYEA 3K8VA 2KG0A 4UF4A 3CDEA 2BW7A 1MU2A 2XSJB 4LFAJ 1VIXA 3LP2B 3M7VA 5KFHA 4G1IA 1I3OB 1XTZA 5D3GA 4ZPDA 1NJYA 3NG8A 1Q5YA 5DRKA 4EFAC 2OIHA 1W2IA 1AUDA 2DNPA 1RLDA 4H4OB 3O8WA 4S0MA 2RDJA 2YY3A 3BGFA 3G6XA 2FZKB 2G1DA 1NH8A 2RUSA 4OYZA 2ZH7A 2CA9A 1WSVA 4G1QA 2RF2B 3Q8RB 2W4PA 3ICLA 4RZRA 3TA1A 3HK2A 2HQDA 3W2WB 1A7GE 4F25A 2HHUA 2QA4G 3KK2B 5AJ3J 3KJFB 1V3SA 2ATLA 4IFYB 1VQYA 1HHTP 5KAKA 2YKNA 2KZZA 2W4DA 1WI6A 5AXMA 3TYTA 1GQEA 2F5GA 3VGSA 2Z2ZA 2CQPA 4I6WA 2GNKA 2ADBA 4MYUA 2BVZA 1VGYA 1HHSA 2HBZB 2BDPA 2CKWA 1RA7A 1F1BB 4ECWA 2BYCA 3I9ZA 2B0GA 5IOLA 2VODA 4MTPA 4IYQA 1RT5A 3A1YG 1HL6A 3CMAS 4CLZA 1VOMA 4PKDB 2OPRA 1SVDA 2UXCF 2L08A 1JXVA 5LOQA 1BHNA 1TL3B 4BCAA 1HBUB 1H2VZ 2XSFA 3AFGA 5DG9A 3J81Y 3V6DA 4LUBA 3CCTA 1K0VA 3CWJA 2ALZA 4F04B 3OUYB 2DGVA 5F8GA 2ZH5A 1HBOA 5HN0A 2QV6A 5BYSA 4X62F 1HQEB 4OHZA 3IRXB 3PHTA 3MMJA 2DHGA 4FXWA 1HNWJ 1JJCB 4Q5VA 2XBPA 2DXEA 1FJ7A 2KVQE 4U8VA 1Z1ZA 2CIMA 3UR0A 1BD6A 4M5IA 1SIWB 4H4MB 5CCLA 1NKBA 3AY0A 4AUKA 1WHYA 4HHUA 3C14A 1JIHA 4WWSA 1Y5LB 3L7UA 3EYZA 4GKKF 5KFGA 3CJRA 2KFZA 1W26A 3QJLA 2CPXA 3MDFA 3K58A 3HDSA 3WHIA 4A8KA 1FKOA 3PFEA 1YJ7A 2WBRA 2RQKA 4QWCA 1KONA 4B3RJ 1OSCA 7FDRA 5L1LA 3E8OA 2YPYA 2MKSA 3ZZTA 3JSMA 4NA1A 2J7KA 3H5XA 1B7FA 1RYRA 4JI6J 1WF0A 2E5LF 3SCLE 4FKXA 3HFVA 2XO7A 4DV0J 2GFFA 3T5KA 1VQLS 3H5SA 3IBCB 2GMHA 3F44A 1HBMA 4DV2F 3CUNA 3GIKA 2NSCA 1TL1B 5E5NA 2QLJB 2LLZA 2JH3A 4NCGB 4D3HA 2M4MA 5J2QB 1FRIA 2HMIB 2FC8A 2YKMB 3I87A 1IVZA 5HVGA 4PEOA 5ETKA 3CF5Q 1KTVA 2CRLA 5KT7A 3MURP 3MEDA 1VQOS 3PO4A 3RW6A 3DOKB 1XR5A 4U67Q 2RRNA 2QL9B 1S4EA 2O5DA 5HMXA 1YWXA 4A8MP 4OIXA 3ZZOA 1P6TA 4WIIA 1UVJA 3CCUS 3Q8PB 1D8YA 3ILIA 4EZ9A 1SIZA 2CNNB 3C2PA 4F2RA 3TARA 2FZCB 4DEZA 2N3LA 2J9EA 2JDJA 1T95A 4ED1A 3I96A 1HBNA 1YITS 1QAIA 2LQBA 3G6VA 1UA0A 1HR0J 4FS2A 2WSEC 2G2YA 4JI4J 4PAAA 1Q16B 2C2OB 4OYWA 3OVBA 4Q8EA 4QIGA 1LK7A 4P72A 4P7TA 4NEZA 3ETOA 2VICA 3D1QA 2D1CA 2XZTB 2DNGA 1R0AA 2IDLA 1K8AT 2MY8A 3OVSA 9RUBA 4QWAA 1YJNS 2HHTA 1UAWA 3G82B 4EYIB 2W2OP 2AJQA 4LF5J 3MMBB 5D77A 3HZEA 1KC8T 3GMGA 4GC7A 2F9DA 3O44A 2V9KA 2WVEA 5C42B 2BZ2A 3BGRA 3QFWA 4DCJB 3UD4P 2ZITA 1S72S 2CUYA 1VRTB 4Q0BA 4J9PA 2ZBIA 3NNCA 2ZJRQ 4LF6J 3ENAA 2UUTA 5LXYA 4FF1A 3UQSA 4DR5F 3BSOA 1QAJA 1APSA 1FTRA 3CVKA 3HHLC 2E5JA 1SKSA 4OYMA 4X2BA 3GONA 4DN0A 4A8SA 2OFHX 1T3NA 3HXMA 4ZPBA 2P9GA 4I7FA 1AZSB 2NXNA 2RNEA 3GLJA 3QRRA 4QCLA 3RBEA 1V5VA 2AYBA 1NDPA 4OX6A 3DU6A 1P1TA 4CO1A 2EWHA 4JI3J 3FSXA 3RBXA 4WF9Q 2MYFA 4OJHA 4NLPA 2SXLA 4NXMJ 2J8SA 1PBUA 1WELA 4ZITA 2VJUA 2BKNA 2X3GA 2J8AA 4WYWA 2DK2A 2NPFA 2OH2A 1CG2A 2EFPA 1DTQA 4U7CA 3GYXB 2F8HA 3QJPA 4RW7B 2OAUA 6FD1A 4QPTA 3Q8UA 4OYXA 4WK1A 4WFYA 1KLMB 4OI2A 2AT1B 5EDWA 1VQSA 3KLEA 4DQSA 3OV7A 1MU2B 5A6WA 4F4WA 4WBFA 3UN5A 4AQYJ 1TVRA 1VQ4S 3BH6B 5CQGA 2WRMA 2WSCC 3OHBA 1M1HA 5LT5A 5ITHA 2HS4A 2MHEA 2AGQA 3RBDA 3H4DA 1IKWB 4ZCLA 3FCHA 4N8NA 3NGRA 2GMLA 4DFKA 1R27B 1SUQA 2FVCA 5IC6B 1PBAA 1WTFA 4G1QB 3WBZA 1HNXF 3U02A 1N32J 1FWPA 4QZVB 2B51A 3M9MB 2YWHA 3WIVA 2DB1A 1LKZA 4ELUA 3AOCA 2V2KA 4FF2A 2RT3A 4KRWA 2YKNB 1GMWD 4M5GA 3EVMA 3TQ1A 2YXLA 1Z2LA 4Z7YA 1IQTA 2HNDA 1AXQA 2MQOA 4GC6A 1R6YA 3UDCA 4LSZB 2P6SA 4ZLNA 4KHMA 1ULRA 4ZPWR 1RWVB 3TWZA 3VAJA 1M1GA 3HVWA 1RT5B 2W7PA 2HAFA 2IRYA 5DLGA 5KT3A 5ETSA 4TU8A 1TFYA 1BQMA 2HKEA 2EG2A 4URGA 2OPRB 4LRFA 5C25B 1XC9A 4QR0A 2FYXA 2HNZB 1RWOB 2RRBA 3DKDA 1RAOA 5CZVA 3ENQA 3L95X 3GYGA 2PI5A 3V6DB 4K4VA 1LOUA 1VQMS 4DV3F 2RDIA 3LUYA 2KU7A 3HZGA 4LQ9A 4ED0A 2CNLB 1S1VA 2QGFB 4DUYF 4B9UA 1NK8A 4G1PA 5B0DA 1JXEA 1VFJA 2GIRA 2IMOA 1I5OB 3QWPA 1GMVA 1CC8A 2WTFA 4B3TJ 5IS2A 2HFOA 2G9OA 1WC6A 5JXSA 2DNHA 3Q8QB 1K73T 4KHPF 4UUWA 1RT1A 3KMSA 5HQ8A 3CD7A 2MQLA 2Z56B 2E1PA 4ED6A 1LW2A 3TJAA 1RLCL 1WHXA 3AD9C 3H40A 4OX7A 4O0NA 4DSIA 3J81U 4V19J 2VQFF 3W8PA 2FJDB 2CPIA 3CD6S 1LWCA 4OX9F 1RKIA 3UPFA 3IWXA 3M1VA 2BJDA 3AQPA 5KFRA 5J1PA 3VTIA 2XS2A 3F73A 3FDSA 5BYRA 3JSMB 3RB0A 4TNOA 2DGUA 3PG9A 5L1KA 1NK7A 1RWWB 3PRDA 2PEBA 3GZ7A 4EMDA 1PILA 4IFVA 5DLFA 4P71A 5DQIA 3D0IE 3ULHA 5DGBA 2V6AA 1MROA 1DJ0A 2HS3A 1JXLA 4PXCA 4OHVA 2ZC3A 3HSGA 2R8JA 1X4FA 1UA1A 1WG1A 1A9NB 4OFZA 2HG4A 5JVGQ 2I0XA 1RTHB 3N79A 5FIIA 2OPQA 2DGQA 3DRPA 2BRKA 3KHHA 5HSPA 2JEJA 4HLBA 4DL0C 2KT5A 5GADI 3BPDA 2IJNA 4A48A 3N6NA 4NE9C 1RTJA 4K0KF 1SH3A 3KHGA 3TUIC 4NLTA 3PEHA 4K4YA 2CJAA 3MEDB 5KFXA 2HGNA 2YKOA 1TAQA 4F3OA 1U8SA 1N6QA 2DNQA 1NSAA 4ZDNA 4P10A 4OZ3A 4O44A 5CHCB 5KG2A 4JI1J 4LF4J 5KFIA 3MR2A 4WFBQ 5LM7E 1CEZA 1ZPVA 3UDEA 2IY5B 4F4ZA 2XMMA 3DLGB 4USJC 4CO0A 1HBNB 5K9FA 5I3QA 4CO4A 1FRHA 3VVUA 5HANA 2ERRA 1QUPA 4C48A 1U2RA 2ZM6J 3C6UA 3MUMP 2DR7A 1SQFA 3W3SA 4NX9A 1GTEA 1F5BA 3UI3A 4UOGA 2N4CA 1O0PA 1YJ9S 1WC3A 5ETTA 1R0AB 3A3PB 2DH8A 2QE5A 2M70A 1YJTA 2V9WA 2K06A 2DJWA 5T7LB 1RWXB 2FLNA 4LVOP 3J80Y 3B6BA 3D9BA 2XY6A 2DNNA 3BGRB 2K3IA 4CLUA 1TMJA 1AROP 4ILLA 1M1KT 3QLHA 4Q0BB 2CVEA 1RUSA 4ED2A 2J7UA 4NCBA 2KH9A 1VBYA 1KVKA 2AEMA 7AT1B 1VBKA 4F36A 4RJVA 4NLQA 4YHHF 3DNCA 2IMWP 1KD1T 3K57A 2LXIA 3SCIE 1WTBA 4I7FB 3SBMA 4LF1A 5K20B 3JTNA 5C7PA 2XQCA 2BQUA 2Z2LA 1N4LA 3FBCA 1S6QA 3HULA 1VQ7S 1ZA2B 1HMVA 2ZKUA 2MZ1A 3JQJA 2VBXA 1KEKA 1FFGB 2RHSB 2KG1A 2AJ4A 3T5JA 3D5MA 4UT4A 3K17A 1RISA 4IOCQ 1KVIA 1SCJB 2YNGA 4WE1A 2DKOB 3BKFA 2GCFA 2EC2A 3DLKB 4AL5A 1DTQB 4JI2J 1EKRA 2OLWA 4WFXA 2I8EA 2FQQB 3HD1A 3S6EA 3EGZA 2AEFA 1HI1A 1RHKB 3KOAA 2ZC4A 2L3MA 4J9LA 1D8ZA 3QIDA 2ZNYA 3DM2A 1T9YA 4IQMA 4OHWA 3KTQA 4KH0B 2V4QA 3KLEB 1X5PA 3QMQA 4DV6J 5D4OA 1NUEA 1ZOTA 2GHVC 3SXLA 4ZJLA 1N48A 5D4LA 1P8GA 2GMJA 4C98A 2ILYA 2IVYA 3BPSP 4Y2KA 3QZ7A 3KKFA 2HSEB 3M8QB 4GVBA 2RMLA 3UWTA 1KQSR 2ZH8A 3WQPA 3L9ZA 3UW1A 1GX5A 1SUQB 4LFBJ 5IXUA 2F8EX 1SXLA 4KTQA 2PMWA 2MGZA 5D6GA 1XN9A 4RUBA 1U47A 2OMLA 3CJKB 3M32A 2MMYA 3NOGA 3BDEA 2CJBA 4ANDA 2ZUGA 3CJTA 4DSEA 1U25A 2CPFA 3PYGA 1TKXA 1X4CA 3ZZ0A 3DRYA 4MKAA 1IM6A 2GGPA 2Q43A 4F67A 3I56S 4A8YA 1WEXA 1RSCA 4CLWA 3T1YF 3NGTA 3TZZA 3DYAA 3VQSA 2VIHA 1QD1A 4DL6A 3R5AA 5M2RA 2UUBJ 2VJVA 3FMBA 1GK8A 4HI1A 3RTVA 3MAAB 4ZVGA 1S76D 4HT7A 1HW9A 1BQMB 2ILZA 2LKZA 3CJSA 4TY8A 1OPIA 3G9CA 2AX1A 2XCAA 1IUJA 2FVQA 4AT1B 2QFJA 4LFAF 1VS3A 4DR6J 4DFPA 4I56A 2JOQA 2PT0A 1RACB 3BGLA 2DGSA 3MHYA 4DSLA 4Q45A 3BSNA 4ETXA 3JAMY 2N7YA 2LFVA 2CZ9A 1S1VB 3NGUA 4DWIA 1ZPWX 2AYMA 5KFCA 2BBEA 4RNOA 4ELVA 2MQPA 3CO9A 2JWNA 5D15A 2OD6A 4IQXA 2YWGA 4PQAA 4ZVRB 3D4JA 2MSSA 3TRGA 5CXTA 4DMZA 3DLJA 2C2EA 1OIAA 3K8WA 3EICA 5KT2A 1RWNB 3P5TL 3QAEA 5AJ3F 1WF2A 3MOZA 3W62A 3BQ0A 2N4DA 1GXUA 4QR1A 1HWUA 3W61A 4IH5A 2QYGA 1YJRA 3ZTOA 4IRDA 1KFDA 1X4DA 3BM7A 4RW4B 2KM8B 5THWA 1NJWA 1R0CB 2W8LA 4L6V3 1LWCB 4HTJA 1Y7PA 1IBKJ 4C8ZA 2GAGC 2CQCA 2VOOA 2LQ8A 2XMVA 4PG4A 3M2RA 3CCSS 1SQGA 1WOOA 1NHKL 2B3TB 2HRTA 1S5ZA 2P2CB 1HQUB 4HT5A 2UZAA 1WKLA 2RD5C 5E3AA 3CSKA 2V5HG 4IFVB 1WI8A 2B9WA 1MWQA 2AMCB 2GS8A 2W7OA 2OJ3A 1QE1A 1MROB 2E7WA 3BO3A 1AT1B 1HNZJ 6AT1B 3R7NB 4NASA 3GIIA 5FLXY 2OPQB 3WX4A 4MYTA 4A8OA 3OJUA 2B8QA 5CABA 4DR2J 1NK6A 4OLPA 1RTJB 2YNHA 4FF3A 2BRLA 3FEXB 1J5EJ 2N82B 3G8QA 4M8LA 2AGOA 3TZXA 1Q7YT 2KT3A 3CCES 1HNWF 2VQEJ 3EZUA 2FLPA 1N6QB 2E66A 3CEDA 3SEOA 1FK9A 4DR7J 4ZJOA 2EKYA 4DS4A 3I55S 1VHFA 1YKWA 1X60A 4CO5A 2KFYA 3CE8A 3AH6A 4B3OA 2HHPA 2ZHAA 2YQ0A 2QA1A 2OEMA 2PMHA 1RCXB 4WXWA 4AFFA 3KNGA 4USTA 2R7WA 2Y1JA 2CJYB 1F9HA 2FY1A 1H74A 3R27A 2F4VJ 4B3RF 1SC1B 3QT7A 4C11A 1BY9A 2CNKB 4OMFG 3C6UB 2ROEA 3PNIA 4NOHA 2VF3A 4IR1A 4ED5A 1NEEA 3J7YI 3IWNC 4B3MJ 1FE0A 2B9EA 2YKQA 5LMUJ 2DGOA 3C16A 4KQZA 4JI6F 4ZP6A 1DLOA 1MW7A 2XC9A 2XO6A 2YQ1A 3PIOQ 3MM8A 4DV0F 3CTRA 3I6PA 4ES3A 2ZD1A 3DGPA 1UL3A 3BV8A 3M8PA 4EBDA 3EXCX 2OEKA 1V3ZA 4UZCA 3QYYA 1H0HB 3TVYA 2QFIA 1DBDA 2ASLA 3QLHB 2GVDA 2NUHA 3BKUA 5EN1A 1HI0P 3R5CA 2CQBA 1TV6A 3VQTA 1PJ7A 3JYTB 1X4GA 4OZNA 1PYOB 3HCXA 2EBEA 2IM0A 2XTJP 4DR1J 1KN6A 1W7WA 5CYMA 3JTOA 1UWBA 3PJXA 5I3UA 3KG4A 4F02A 4RW6A 1IQZA 3M6VA 4LR8A 3HO1A 5AE3A 2CVIA 3MEGA 3I4PA 1S6QB 2P9CA 1LFPA 4CI0B 3N9UC 1HMVB 3J80U 2BE7D 1U7LA 3SQGB 5F8NA 1B7YB 1K47A 1XMOJ 2J6TA 5F8IA 1HR0F 5ETLA 1T02A 4JI4F 2YNGB 3UR3C 1SJQA 4WE1B 5DS7A 2Z8QA 1T9UA 3EM1A 2H5IB 4BBYA 2UUWA 2XMAA 2FVPA 1DRZA 2E7VA 4HR2A 3CJ5A 4OJGA 5HO4A 2XHCA 4J7CA 3O5TB 2QZ8A 1RHJB 3MEEB 4PPDA 8AT1B 4C9DA 5H9FK 4YUDA 5L38A 3P96A 5IFMA 3PJWA 4IOBA 5I42A 4LF5F 4QIEA 1QAYA 1RAJA 1SBRA 3Q24A 3MCOA 4R0EA 3R5GA 1SH2A 3MGJA 1XR6A 4DQQA 3GB0A 4FYXB 3Q23A 4GVLA 3MPDA 5FDLA 4ECXA 4LF6F 2B4OA 2BOAA 2YH0A 3FJ2A 1LWFA 1CJVA 2HHHJ 1FI4A 1U1QA 4MFBA 4ZN1A 4QWBA 2YPZA 4GVBB 1FERA 5IWAJ 1LW0B 2C2NA 2H54B 4I68A 3FQKA 3TJ9A 1XMBA 3MOJB 4AXJA 3QT5A 2HHWA 3TNVA 1JNRB 1ZAWA 4TY9A 4PWDB 3CDUA 3KLGB 1S6UA 2M7SA 3RB6A 2OSRA 1FVSA 1FO1A 4JV5J 4JI3F 3PW2A 2Y0SD 5ETPA 3M32B 4NXMF 3EPIA 5B08A 4LIWA 2Y8YA 1QM9A 2GC8A 4NEYA 1TKXB 1WJ9A 1IBMJ 4PR6A 2E1MC 1X0PA 4MJKA 1VBZA 5G0RB 3UE2A 4DSKA 2ZDPA 5ETOA 2XI2A 2VC0A 3MUTP 2K2PA 4ZA1A 4I0WA 3DLLQ 1QAXA 2F65A 3DYAB 2M52A 4RKUC 1U6ZA 2ZHBA 1RHMB 4XAKA 3G8SA 1TKTA 3AAWB 1JLAA 1W2BR 3LTOA 1WD6A 2Z0GA 2DH7A 1VK8A 3RR8A 2R8GA 1KSPA 2MLXA 3W9IA 3L09A 2XS7A 3RAQA 2QLBB 1ZYQA 1RU2A 4UTGA 4AQYF 4ZOSA 2XZWA 3IO1A 3OXLA 5GMDA 3GV5B 4OLOA 5I4MA 2M9KA 3FCWA 3HVTA 2VD3A 1TUVA 3I9V9 3R1HA 3M2UA 1YVFA 1S0VA 4PPZA 4AD6A 3PRBA 2IC3A 1LEOA 2V8HA 1PJ6A 3OPKA 4HEA9 4C97A 1YIJS 1N32F 1EAYC 3EMTA 3GJTB 3D0HE 1YBAA 3VGTA 3G2XA 2EBGA 2GQ2A 4USVA 1WSRA 3MMAA 4G6VB 4LVNP 4DL4A 5B09A 4ECQA 2OFGX 4P7VA 2DHHA 3GSIA 3TZYA 4P2SA 1JQGA 1FJEB 1L3KA 2EFGA 2BJ3A 3NAHA 3CGIA 2BV3A 3OL7A 3W64A 3BO4A 3DMJA 1OY8A 5J1NA 4NL5A 5HJYA 2QSWA 4IRKA 4PABA 3TW0A 4YB5A 2HQGA 3JB9k 4J9VA 1JB0C 1MLAA 3GQCA 1OJ4A 4A8XA 3GIRA 5IV4A 4NYOA 3GILA 3HX9A 1RTDA 2JEGA 1M5KC 3MD1A 5C24A 1LWXA 4FYDA 1N0VC 2Q79A 1H7XA 3TAMA 4B02A 1U6FA 5F8HA 2DNYA 3I5AA 1TK5A 3UNGC 2H9ZA 3K0JA 3ONQA 2B7CB 1IJFB 3MM9B 5B0BA 4MKVA 1BQXA 2VDIA 2GJ2A 1Z2ZA 2YNHB 5DETA 3R5DA 4C4WA 3GG1A 4F4XA 1RABB 2U1AA 4P2FA 3D6HB 2XYPB 2B8PA 1WC1A 1EETA 3MCMA 5A76A 2M88A 2QMWA 4B3TF 4B9LA 4ELTA 2NR0A 1LK5A 5KFKA 2Z58B 2D3ZA 1FK9B 3HHLB 3DLEA 3LALA 5B0FA 2AEJA 2CZ4A 4QPXA 1Y9OA 4OYIA 1NM2A 2Q6BA 4W98A 4R5PA 5BJRA 2QL5B 2LVWA 2KXFA 2DITA 5FLXU 4HKQA 1NBEB 5CAAA 2EFOA 4DUZJ 3MCNA 3PYDA 1Q0NA 2WBMA 3V4IA 3RAXA 4WKRA 1D3WA 2VU5A 3M30A 5F8LA 1ELOA 3R3TA 1XEZA 4YS2A 4C11B 2AZ3A 2VH7A 1X5OA 5E3CA 1KQGB 2VDHA 4YDXA 4ENOA 4R8UA 1T05A 2CQHA 3P8BB 3V2UC 4PYAA 2BOPA 5HMZA 3C16B 1UVLA 1DLOB 1RT3A 1U26A 3NGKA 1AA1B 3MM8B 3JSBA 3CIZA 5J2PA 4ATNA 3A8EA 1RT4A 3ZTPA 2ZD1B 4O23A 3DGPB 4QJVA 2W9AA 2LU1A 5B0EA 3M8PB 2MLYA 1KBRA 2BQRA 4FKYA 2RU3A 4PUOA 1F60B 2GVDB 1FDDA 1WHWA 3TA2A 1TV6B 4JI5J 3OTBA 1NDLA 2QEXS 4KGZB 3MTJA 3GPAA 5M2PA 5E41A 3OR1A 4KJIA 1GX6A 4CM2A 2GQCA 3LH2S 2DRAA 5LSRA 5AE1A 2HYIB 5CYMB 2I1RA 1UWBB 3X1LB 3I5BA 3MXHP 5I3UB 1T9VA 3BO2A 1K44A 4JYAF 4JI1F 3CCVS 4LF4F 5IT4A 2XNRA 1J2VA 1F6TA 3FEZA 3FQLA 5IZHA 4DOZA 4N56A 1UPMB 2QRRA 4C0OC 2RIJA 2PFDA 4MK8A 2C3PA 3ZTRA 2IRUA 3PEJA 3EDRB 1U02A 3KHRA 2RRAA 1I51B 2AF6A 1EZZB 4PWWA 3CXCR 2ZM6F 4P9SA 1FJGJ 2LCWA 2AYEA 1HQ2A 4YOEA 4V1Ak 2VKZG 1QDUB 3DRRB 4F4YA 3IA0A 4O3PA 2ZNZA 4OV6A 1J27A 3LP1A 4ZPCA 3T9NA 5I42B 1S1TB 3K7RA 1I94F 4RO0A 3KUEA 4Q2MA 3LWLA 4WKYA 2CNOB 4J5OA 1CJTA 1TL3A 1MN9A 3PHEA 1BLUA 1Y11A 4LF8J 4QIFA 2OPPB 4USMA 2CQ0A 1S12A 3HM9A 4OI1A 3LPYA 4MK9A 3OTOJ 1LWFB 3JTPA 1ZTTA 3N28A 4FPIA 1EB0A 4MFBB 3PKYA 3D3BJ 3QAUA 3OQ2A 4LIRA 3W9HA 3NKYA 3OTDA 4XPEA 3VALA 1MN7A 1PGZA 1ZM3A 1WC5A 3WC0A 2V4JA 2XLJA 4M94A 1NDCA 2PIIA 3O1LA 4C8NA 3S01A 4C3KA 4FVCA 4YR3A 2AX0A 4H4KC 1H72C 3D6TB 4F8RA 4DPWA 3PTWA 2HLUA 4JI2F 3B78A 3JS9A 1YRUA 1RTZA 5F8JA 3HJVA 2MZTA 2E1AA 5EWFA 3SSRA 1U24A 3QBCA 1JLAB 4HTIA 4C8KA 2D9PA 2KRBA 3DU5A 4DR3J 2A6MA 3CJ2A 4DV6F 2M2BA 3V4MA 2MQQA 1M5HA 3N4WA 3GIMA 3BH7B 2H51B 3V81A 4DZ6A 1TL1A 4C2MA 3G8TA 1RDRA 4ITSA 1NLKL 3LGNA 2E1CA 2FHKA 4NCGA 1EIYB 2DPJA 2WHOA 2KXHA 4M5HA 2HMIA 1WOSA 5GMEA 3UO0A 2DO4A 4K2JA 2AW0A 3M2UB 2HHSA 4RPFA 3FFIB 5KTQA 1NHVA 2OELA 2IC3B 4LFBF 1DFDA 4NPOA 3HKWA 4JV2A
chains in the Genus database with same CATH topology
1X4FA 2MY7A 1UA1A 3CCWA 1WG1A 1A9NB 4OFZA 2O01C 3BDPA 4ZHRA 3MPYA 3BF4A 1UKUA 2HG4A 4NLWA 5CA5A 5JVGQ 2I0XA 1RTHB 3N79A 5FIIA 1FXLA 2OPQA 2DGQA 1FHTA 3DRPA 2BRKA 3KHHA 3WZ0A 4PG5A 1H6KX 1VK3A 2JEJA 1REVB 3DHXA 4HLBA 1LXJA 3BJYA 4PG6A 4DL0C 4X4TA 2C2RA 2KT5A 4DV5F 3FMWA 3D2WA 5GADI 3MMAB 4CTAA 4JUZA 4YEAA 2IJNA 3M2RB 1VJWA 2B6AB 2FHJA 5LXRA 1ZH5A 4M1KA 2OTJS 4TXSA 4NXNF 3HHLD 4A48A 3N6NA 1RTJA 1RTIB 4RU9A 1HWKA 1X4HA 4XK8C 2LQJA 4K0KF 2XGQA 4CQ1A 5GVQA 2B4VA 1RT2B 1SH3A 4OZ1A 3TP2A 3KHGA 5F41A 1D0EA 2Z2MA 3OBIA 3TUIC 4ZLPA 4NLVA 4YMEA 5A8RB 1HYSB 3KYLA 4NLTA 1TR0A 5HI7A 4EO6A 3PEHA 4K4YA 3H4BA 2CJAA 4F3QA 1Y3KA 2HVIA 3MEDB 2JX2A 1QE1B 4N8OA 1AFJA 5KFXA 2HGNA 2YKOA 4E0DA 4IG3A 1TAQA 2CG4A 4F3OA 4QWDA 1S48A 1U8SA 2IBOA 3DMJB 1N6QA 2DNQA 4MH8A 3PZPA 4C0BA 3TVZA 4ZDNA 4K4SA 3SMZA 4BHQA 3MM9A 5KFDA 4O44A 2DISA 5CHCB 5MLCV 3HI9A 3IFEA 3SI8A 5KG2A 3PO5A 4DSFA 2FUG9 1N5YA 4YP3A 1ROFA 1H98A 3H8YA 3JSYA 4HVZA 2UU9F 2UUBF 3TR5A 4RBUA 5KFIA 1L5UA 4KO0A 3MR2A 2UV8A 1FT8A 2ZZMA 1PSDA 4USHA 4WFBQ 4M5DB 3DOLA 4TYAA 5CYJA 4K50A 2BE2A 3MM6A 3EGWB 3OLBA 1ZPVA 3UFCX 4RNMA 1YTYA 4NLXA 1CEZA 1S1UB 2HPUA 3NBPA 4CIOA 3BSAA 2J6SA 5B0GA 3FEYB 4F4ZA 4MAKA 3W7BA 2XMMA 2PEHA 2KB2A 3DLGB 4BC7A 5A2QY 2W9CB 3WC2A 5C24B 3NMRA 3MM7A 4J9QA 4USJC 1N36F 4NCAA 4DR6F 4CH0S 3MMBA 5CCMA 4FS1A 3TAMB 4CO0A 1HBNB 2I38A 5GAHI 1NHUA 3HHLA 5K9FA 5I3QA 2CQ3A 4CO4A 2NREA 1T03B 4I6AA 1FRHA 2VUGA 5KFJA 1FNOA 2ERRA 1NJZA 1D1UA 1QUPA 5EHHA 5H1SV 1U49A 5C42A 1U2RA 3C6UA 3MUMP 2DR7A 3IAS9 4X84A 3W3SA 5J2MA 4NX9A 2ZOFA 3T6JA 3PDNA 2XMTA 4A8QA 1M5PC 1GTEA 1JWWA 1F5BA 3KK3A 2IRXA 1X4BA 1VRTA 4AYBD 3UI3A 2R7UA 5L39A 4PRFA 4KC5A 3THPA 2FJWA 4RW9B 2N4CA 3FNNA 3RYLA 1S0NA 1VC0A 3H2LA 1O0PA 1YJ9S 1PC4A 3GR0A 1Q7LB 1R89A 4KKOA 1R0AB 4B3OB 2ABYA 2B43A 2DH8A 2MZQA 2VV5A 2MJUA 4WFZA 2QE5A 2J0QD 2NS1B 3T1AA 3OLAA 4LSLB 4IDKA 3SSSA 3I0SA 2M70A 3THVA 3OR2B 1YJTA 2B9YA 2V9WA 5D78A 1OS5A 2G4BA 1QVFR 2C3YA 2FLOA 2YQ3A 1XR7A 4C3MA 1QVGR 4ED3A 1YG0A 2YTCA 1M5OC 3NP5A 1ZAXA 1XWLA 1N8RT 2DJWA 2ZKTA 5T7LB 2C3MA 4TQRA 2MKHA 1ZAVA 3FRYA 2R2RA 2FLNA 3L3CA 2UVRA 4LVOP 2XEXA 5F0UA 5DG7A 3G4SS 4I64A 1MMDA 2JRSA 2BQ3A 3J80Y 3GG0A 4J9RA 4RLEA 1C0UA 3PIPQ 2POKA 5KFFA 4O3RA 3NS6A 2XY6A 1R8PA 2DNNA 3BGRB 2K3IA 5SUHA 2EK6A 1RQ0A 2CQDA 2MKKA 2MPUA 2JJ4D 2DH9A 3CD5A 3H98A 3VR1A 2VG6A 4RW8A 4R5PB 1UVIA 1AROP 4IR9A 1T94A 4ILLA 5ADZA 1FXRA 1QTMA 5KT6A 1M1KT 3QLHA 1J5OA 1D9FA 4Q0BB 2CVEA 4ZPAA 1NNDA 5GMKa 3O3LA 2XLIA 2BJEA 3MCSA 3I0RA 4KV8A 4ILRA 5KFZA 4ECZA 4ED2A 2J7UA 2XWXA 3GR1A 4NCBA 5KFTA 2KH9A 1M90T 1JKHA 2Q1LA 2IFXA 1VBYA 1UJ5A 4F50A 4R25A 3W2VB 2CZVC 3M30B 4YDDB 2Y1IA 1VI7A 1U1OA 2RS2A 4EU0A 4NLQA 3ZZPA 3QGPA 4YHHF 1IBKF 3DNCA 2IMWP 1S1XB 3GWCA 1KD1T 2I5JA 2J0SD 1UFWA 5I3PA 4ID5A 2HGMA 2P9EA 3K57A 3CC7S 2LXIA 3SCIE 4FNHA 1WTBA 4I7FB 1V9OA 1U1KA 5B0CA 2PO4A 1S9FA 1TK8A 2E5GA 2XSJA 3BQ1A 3JTNA 3HT3A 4ED8A 4DV4F 1T05B 1QUVA 3LP2A 2CPYA 3IGNA 2W8KA 2KTQA 2FDNA 1V6HA 2BQUA 3QIPB 1JLEA 4DX8H 1E6YB 3ZZZA 1OQ3A 2VA3A 2Z2LA 2C42A 4OZ5A 2DR9A 1A6LA 2MZJA 3Q22A 1N4LA 4IH6A 4DDFA 2KKHA 4RX6A 4MIAA 1S6QA 1RT3B 2ASYA 3MFHA 2IA6A 2ZZNA 1VQ7S 3CJ3A 2F1FA 1HMVA 2ZKUA 1U1LA 2MZ1A 2H5EA 4OJ3A 2VBXA 3GE9A 4DG1B 1KLMA 3NLCA 5AXKA 1KEKA 2Y1RI 4H4OA 4KFBA 5J2PB 2E9ZA 4YB1P 2O66A 3DC2A 3K5PA 4HL9A 2KG1A 1RT4B 2AJ4A 3TO8A 2LDYA 4TN2A 1H3DA 5JJBA 3T5JA 3D5MA 2AU0A 3OFGA 1RISA 2VBYA 4IOCQ 3MR3A 2UXDF 1KVIA 2HRYA 3EUNA 3H5UA 2J0XA 2OPSA 2YNGA 5GAGI 1C2PA 4WE1A 3MAHA 1P9QC 3IRWP 1FA0A 3RAMA 2YWEA 4BDPA 3D1OA 3LF0A 3TOQA 2VB6A 3O2IA 3BREA 4MIBA 2F7VA 2GCFA 3HHNB 2XI3A 3N5FA 2VBWA 3DLKB 4J37A 3HP6A 1DTQB 1JLCB 4B9NA 4AL5A 3OTCA 4DR2F 2DNKA 1FXDA 2RF2A 4PUOB 2OLWA 4RW6B 2KN4A 3QGIA 4WFXA 2HIQA 3CDBA 1CC7A 2I8EA 2EW9A 3DXBA 3S6EA 1XERA 1J5EF 3EGZA 2IA0A 2LXUA 4HI2A 2A1BA 1HI1A 2WSFC 5KG6A 3N5BA 3PW5A 1ZM9A 2WONB 2IJFA 3MEGB 5D3GB 3UDLA 1TKDA 3KOAA 3W2WA 4RBVA 2ZC4A 3K5OA 1Q8LA 2PSZA 1YRTA 2L3MA 2EFVA 2PD1A 2HQIA 3OR1B 2VQEF 5D4PA 3KK2A 1ZM4A 2AP6A 3CCRS 3OXFA 4W92B 2EFNA 4J9LA 1D8ZA 4K4UA 3QIDA 2ZNYA 2BM0A 3DM2A 3QPIA 4IQMA 4Y2IA 1IKWA 3EPGA 3DRSA 4GO7X 1VRUB 4OHWA 3D54A 3KJVB 4IFYA 2K3KA 4WCEQ 4HDGA 2VFSA 2ZDOA 3KTQA 3G71S 2QMXA 2V4QA 4DLGA 2X1AA 3KLEB 2K1RA 1CQMA 4PG7A 4DR7F 4I1TA 1RT7B 2MQMA 1X5PA 2LQ9A 1Y0HA 3QMQA 1KTQA 1R8AA 3NAIA 4DQRA 3DRRA 2KXNB 5D4OA 3VAMA 4B9VA 1C1BA 4NLDA 4RNFA 1DTTB 4LSNA 1ZOTA 4I67A 2GHVC 3SXLA 3D1HA 4W90B 3DLBA 3MZIA 4OV1A 1N48A 2W7AA 5D4LA 2XB2D 1P8GA 2VC1A 2GMJA 4C98A 1VQ5S 1N0UA 2ILYA 1N5SA 2IVYA 1VC5A 4EO8A 3PVXA 2XGPA 2M8DB 1K1SA 4Y2KA 1R8BA 3ITHB 2K7KA 2BUNA 1P27B 5KFPA 4JV0A 3QZ7A 1S1TA 3KKFA 5CZXA 2R2UA 3V6HA 2I2YA 5FD1A 1X8DA 2UP1A 1KHVA 2FJEB 1RK8A 3J7YU 5G4DA 1NZAA 2RB7A 3M8QB 1X9MA 1S0MA 2F4VF 3MUVP 4K4XA 2RMLA 5A8KA 3NCRA 3UWTA 1S7HA 2ZH8A 1KQSR 4K5SA 3G6YA 2AYGA 3CULA 4I2QB 3UW1A 1JX4A 1GX5A 1G1XA 1PC5A 1CLFA 2DNZA 4CCHA 1DHMA 3OFEA 2R8HA 1SUQB 5IXUA 3MAQA 4DHVA 1FJCA 4I2PA 2HHQA 2OD4A 2DNRA 2IM1A 2OPPA 4PQUA 2F8EX 2D9OA 4B3MF 1SXLA 1KVJA 1GXTA 3BB5A 4XIUA 4J9MA 4X4VA 4C8LA 4KTQA 2MGZA 5LMUF 5D6GA 2HWIA 5KFBA 1HBUA 1YI2S 1M0SA 1XN9A 2WOMA 1SL2A 2CPEA 1FRMA 2P5VA 5KFLA 4ES1A 3HPOA 3LOUA 1U47A 1T8EA 1U4BA 2OMLA 2LMIA 5FDLB 4Y6IA 3UCGA 1IKVB 3LP1B 1OPZA 3CJKB 3M32A 2MMYA 1JJHA 3BDEA 2C28A 4Z37A 1MMLA 2DT9A 4RWXA 2VONA 2CJBA 2DR8A 2HHXA 3E2EA 2ZUGA 1HD1A 2MKJA 4X65F 4DSEA 4H4KA 1JK9B 1S9GA 1U25A 2N3OA 1U09A 4Y0FA 3AJ2A 3OUYA 4O3NA 2VZ9A 1K0TA 3EXYA 3OXGA 2CPFA 3S1TA 1K9MT 1W25A 1HQEA 3SCKE 5C25A 3ZZYA 2F9JA 3IRXA 4RUHA 4M95A 2HNZA 1TKXA 5F9LA 1N33F 2YX4A 5HP1A 1X4CA 3IS9A 3ZZ0A 4X4NA 3DRYA 2GJIA 4MKAA 4WTYA 2GGPA 3SFGA 3RB4A 2Q43A 4JI8F 4F67A 3I56S 2XLKA 4A8YA 1C0TB 3MFIA 1F5CA 2DBBA 1WEXA 1T7PA 2LDIA 3T1HF 4IUFA 1FVQA 3HLUA 5K14A 1S97A 1ZBTA 2OTLS 3T1YF 2UV8G 4H4MA 1XMQF 3O6QA 1G6BA 1ZZFA 2MDAA 2EG1A 2ZOMA 2BM1A 3HVAA 2VFTA 4DL3A 1L3TA 3DYAA 3NGDA 3VQSA 1N5VA 3RRKA 5J2NB 4Y00A 4KGMA 4HH1A 5EWEA 4DL6A 2CPZA 2DGWA 3BR9A 5KFWA 3G96A 3R5AA 3U1LA 5M2RA 1UJ6A 1H2TZ 3FMBA 3LW5C 4HHJA 4HI1A 3RTVA 4ZVGA 2NLWA 1S76D 4KGKA 4DR1F 4HT7A 4CO2A 1HW9A 4ZP9A 3L7PA 3M9OB 1BQMB 5E0OA 1FKPA 2R7QA 2ILZA 2LKZA 5CD4H 3QGGA 2RKIB 4TY8A 2E9RX 1HBOB 1OPIA 1S1WB 2AX1A 2I9SA 2RS8A 3G9CA 2B56A 2XCAA 1JLQB 1IUJA 2CQGA 2XMKA 2FVQA 1FEEA 2XY5A 2W25A 4QIVA 4E8UA 2QFJA 1VS3A 4Y2AA 2RQCA 1LV5A 4LFAF 4DFPA 3B82A 4I56A 2JOQA 3AA9A 4OI6A 1FD8A 1Q53A 1QJHA 4OZJA 1YGYA 2C22A 1M5VC 2X1GA 5A8WA 2PT0A 2HVZA 1SB6A 1JNZB 2V4JB 1YJVA 2GO8A 5K8PA 1TL4A 2DGSA 3BGLA 4K4ZA 3SYZA 4H54A 3MHYA 1LFWA 4DSLA 1LWEB 3I82A 4Q45A 4JOUA 3BSNA 1R8HA 1QY7A 1N5QA 4NYZA 1FF2A 4DN9A 4ETXA 2WK4A 3U1MA 4C8MA 3JAMY 2N7YA 4YB7A 2IHR1 5F0WA 4KAIA 4CNYA 4LMZA 3GSDA 3IG1B 1XMOF 5IM0A 2RE1A 2R2SA 3K2YA 1F2GA 2K7JA 4XDCA 2E7XA 2PE8A 3VZIA 3UCUP 1S1VB 1TKTB 2NSBA 4DWIA 1ZPWX 2JC0A 2HZCA 4A4JA 2AYMA 1TZ0A 5KFCA 2BBEA 1BGXT 4RNOA 2MQPA 4ELVA 2JVOA 3DHWC 1Q86T 4RBTA 4CZCA 1RP5A 3SDEB 4OHXA 3CO9A 2JWNA 3V6JA 1L3SA 2OD6A 1E6VA 3PW0A 4IQXA 4C8OA 2J9DA 3F56A 4AXIA 2QLWA 2YWGA 1FKOB 4PQAA 3QWUA 2MSSA 3AHPA 2CYYA 3MF5A 3TRGA 1NB7A 4DMZA 5CXTA 1X0FA 3DLJA 1Q8BA 2R7TA 5D8HB 3ZZUA 4FP9A 2C2EA 1OIAA 3K8WA 5DDOC 5KT2A 1RYSA 3P5TL 4EWTA 3F41A 3L7OA 3QAEA 2DD8S 2DGTA 5AJ3F 4UY8T 1WF2A 3MOZA 1IKYA 1S0OA 1QLNA 2JC1A 2VASA 3BQ0A 3FFIA 1RA6A 1RT6A 1KHWA 4DPOA 2N4DA 1GXUA 5B7WA 4QR1A 3CMES 5J2QA 1HWUA 2YKAA 3HVTB 3NWGA 1QSSA 2PFFB 4WFAQ 4IH5A 4N77A 1YJRA 1N56A 2YKMA 3JSRA 3ISNC 1S49A 3BZQA 1NU4A 2R9LA 1KFDA 1X4DA 4IRDA 3BM7A 4RW4B 3ZZRA 3DOMA 2VPYB 2KM8B 5THWA 2IM2A 1NJWA 3ISZA 5K8OA 5HROA 2BW2A 3EZ5A 4QIWD 1AW0A 2L41A 2W8LA 4L6V3 5U47A 2NZ4A 1LWCB 5F3ZA 1RTHA 4HTJA 5DG8A 1Y7PA 3DXSX 3I5CA 3V81B 5E3QA 2ZVSA 4ECYA 4C8ZA 2PA8D 4N76A 1HNIA 2V8VA 3KG0A 3DOKA 1REVA 4TLRA 2CQCA 5J1EA 4UW2A 2VOOA 5JVHQ 1GNKA 2ZOGA 2XMVA 1N52B 3E51A 3NNHA 4Y2MA 1VQKS 4PG4A 3M2RA 4NLYA 4TQSA 3CCSS 4FBTA 1JLFA 2ZJQQ 1HBMB 2B3TB 3SV4A 3IWLA 1N34F 4ZCMA 2HHHF 2FTRA 1HQUB 2XMUA 4HT5A 4Q44A 4WZQA 2UZAA 3KK1B 1UJ4A 2KO1A 1SL0A 2RD5C 5E3AA 1I1GA 3BQ2A 3CSKA 4N41A 2V5HG 4IFVB 1MWYA 5IWAF 1WI8A 2RJZA 3B4DA 2B9WA 4K4TA 2G13A 2GO9A 2W7OA 1MSWD 4ES2A 2OJ3A 1QE1A 4R0JA 1MROB 2AJ1A 1B0VA 5A0YA 2E7WA 5KFSA 3BO3A 2LEPA 3SSQA 4HDHA 2KM8C 3CC2S 5HMWA 5LSLA 4E98A 1KFSA 1CQNA 2AGPA 2YVSA 4PWUA 4NZ7A 5L9XA 2J5AA 2J9DE 4NLSA 2BANB 1TKZA 1IBLF 5H9FJ 2MB0B 2ZH3A 2V8DA 3DDNA 3GIIA 5FLXY 3PW4A 3P3DA 1U48A 2C3OA 2BA9A 2PC6A 5DDQC 1RI7A 2HS0A 1HA1A 2E44A 3U7JA 4JV5F 2OPQB 2VL1A 4BWJA 4CH1A 4DL7A 2JFKA 2ROPA 3WX4A 4MYTA 1NH7A 4OQJA 3RW7A 4A8OA 4I69A 2VPXB 4DSJA 3OJUA 4EBCA 3PR5B 4MKBA 1SL1A 2HW3A 1JLBA 4CTAB 4G3IA