3SCZA

Combining crystallographic, thermodynamic, and molecular dynamics studies of mycobacterium tuberculosis purine nucleoside phosphorylase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
PDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining crystallographic, thermodynamic, and molecular dynamics studies of Mycobacterium tuberculosis purine nucleoside phosphorylase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 78
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sczA00
1V48A 3U40A 5F7JA 1G2OA 1U1DA 4G89A 1CG6A 1B8NA 3ONVA 5ETJA 1OTYA 3FUCA 3OOEA 5K1ZA 2AI3A 1K9SA 3QPBA 3NM6B 3OZBA 4M3NA 1T8WA 3P0FA 3EUFA 3O4VA 1VMKA 1JDTA 3ODGA 4BMXA 3EEIA 1TCVA 4P54A 1TD1A 3PHCA 3SCZA 1PBNA 4LZWA 5F7ZA 1WTAA 4WKPA 3UAZA 2I8AA 1Z34A 1JPVA 1YRYE 3F8WA 1PW7A 4DANA 4PNPA 2QDKA 1T8YA 3P0EA 4DARA 1A69A 4UC0A 5CXSA 3KVYA 4TXJA 3NM4A 2RJ3A 1PF7E 1SD1A 1LV8A 1NC3A 4OGKA 4YMLA 4F3CA 1V4NA 1JDVA 4ECEA 5CCDA 4F2PA 5F78A 5EFOA 3LA8A 3K8OE 1RSZA 4D98A 1PK7A 1CB0A 1RXSA 4DAOA 4OJTA 4DAEA 1VFNA 4MCHA 5CXQA 1ODLA 1RCTE 5F73A 1V41E 4L5YA 5B7NA 3DJFA 3KVRA 5EPUA 3TL6A 1A9RA 1Z5NA 3OZDA 1LVUA 4DA6A 5IFKA 1TCUA 1PKEA 1U1GA 3FNQA 1RXUA 5F77A 4BN0A 1TGVA 3FOWA 3BL6A 4DA0A 4L5AA 4QATA 1ODKA 4YNBA 5CYFA 1T8SA 1U1EA 3LGSA 4L0MA 1VHWA 2PGAA 4JP5A 1Z39A 3PNSA 1RYZA 5IU6A 3OCCA 3FAZA 4TTIA 1SJ9A 1PR1A 2HWUA 5B7GA 3BSFA 4GMHA 3MMSA 3PNPA 4IP0A 1Y1RA 5B7QA 4TXNA 1B8OA 1YBFA 2HN9A 3ENZA 1A9SA 1ODJA 2HSWA 1K3FA 4MCIA 1ODIA 4I2VA 4M1EA 1PR6A 1PR4A 4TTJA 4K6OA 2ISCA 2HRDA 3E0QA 3UAVA 3K8QA 4QFBA 1I80A 1JYSA 5CCEA 3OZCA 3DDOA 1YQUA 4TXMA 3O6VA 4PR3A 2OC9A 4TTAA 1JDUA 3DP9A 3E9RA 5FAKA 1Q1GA 5DK6A 4NSNA 1V45E 5F7XA 1XE3A 2AC7A 1PK9A 1YQQA 4LDNA 1Y6RA 4TS9A 2A0WA 4R31A 4D8VA 2I4TA 4QEZA 5JPCA 1RXYA 5I3CA 1V3QE 4YO8A 3EUEA 5B7PA 3IEXA 1RR6A 1ULAA 1Z35A 4GLFA 3UAXA 4TXHA 4MARA 4X24A 2GUWA 5KB3A 3NM5A 1Y1QA 2H8GA 4EB8A 4LNAA 1T8RA 2QSUA 2XRFA 2AI2A 3BGSA 4TYMA 1ZOSA 2QTTA 2OXFA 4D9HA 1OV6A 4OY3A 1Z36A 1LX7A 4WKCA 1Y1SA 1JDSA 4TXLA 3KUKA 1U1CA 2QPLA 4QARA 4JWTA 1T0UA 1K27A 4FFSA 1A9PA 4GLJA 3KU4A 3UAYA 4LKRA 4LNHA 2QTGA 1A9TA 1Z37A 3FWPA 1Z5PA 4NY1A 4GKAA 1NW4A 4D8YA 3D1VA 4M7WA 2A8YA 4KN5A 1PR0A 1U1FA 1Y1TA 1TGYA 1RT9A 1M73E 1ECPA 4L5CA 5C80A 3OZEA 2OECA 3MB8A 4QAQA 3NBQA 4BMZA 1QE5A 1ZL2A 4NS1A 1JDZA 3OF3A 4OEHA 3INYA 1RXCA 3UAWA 2B94A 3PHBE 1VHJA 4BMYA 3BJEA 1JE0A 4WKBA 4F3KA 4JOSA 1C3XA 1YR3A 4WKNA 5F76A 3DPSA 4F2WA 4R2WA 3KHSA 1JP7A 1A9OA 2P4SA 4G41A 1SQ6A 2BSXA 3GGSA 1SD2A 1OVGA 1Z33A 5F7OA 3LBAA 3FB1A 4D8XA 4H1TA 3OOHA 2ON6A 2AI1A 1Z38A 1NC1A 4YJKA 2OC4A 3T94A 3EMVA 5CYGA 1PR2A 1JE1A 1OTXA 1Y6QA 1A9QA 3UT6A 2A0YA 4OF4A 4QASA 4DABA 4RJ2A 3KVVA 4R2XA 1OUMA 3IOMA 1RFGE 2IQ5A 1FXUA 3DF9A 4U2KA 1V2HE 3OPVA 4EARA 1Z5OA 4G8JA 4L6IA 4WKOA 2Q7OE 5EUBA 4F1WA 1PWYE 4DA8A 4E1VA 1N3IA 1PR5A 1ULBA 3C74A 2A0XA 1OU4A 4DA7A 4OGLA 3E9ZA 4TS3A 3GB9A
chains in the Genus database with same CATH superfamily
5MGNA 1GFWA 3RSLA 1GRVA 4P6VF 3SX4A 1IHPA 1RXEA 3PE4A 1WETA 2BGNA 3X44A 4OHCA 4G9BA 3DMFA 3DOUA 4Y9RA 2IV3A 3LAWA 4OB8A 1G64A 4J4TA 2GRJA 4QUEA 5ALZA 4BVJA 1NUQA 5BYKA 2D3WA 8ABPA 1FMCA 4A8JA 3G59A 3OJWA 3OZBA 4TRRA 3D6TB 1Q12A 3EODA 3RARA 3T7CA 5KSZA 3P0FA 1XKQA 4F5WA 3EUFA 3WZMA 2JIPA 3O4VA 1G6HA 1YF3A 3HEAA 3OMWA 4HDSB 3NHAA 3RUCA 2FXIA 1S89A 1LDMA 3GJ5A 5HZHA 1CVIA 2XMBA 3HXTA 4W82A 4EFKA 3SLKA 4JB8A 3Q6IA 4N7BA 5EMNA 4EJSB 1YR6A 3PK0A 4L8WB 4NCBA 3MWJA 5EXXA 4C76A 3D59A 1OYOA 4DLWA 3R8XA 1ECFA 5DE3A 3FYCA 3IE0A 4WCFC 1WB6A 1XVUA 2HCRA 3K2BA 4LZWA 3WL5A 4A6PA 4DS3A 3ST7A 3B53X 1GCIA 3L7LA 3WAKA 4M1OA 4DXDA 1R7RA 3L4BC 3KC2A 2FR8C 2XGGA 3EA4A 4S2EA 4A0FA 2XCLA 3M1YA 1IUKA 2P9ZA 3DCYA 1MF7A 2NV0A 2ZEJA 3MWDB 4COOA 1QTNA 2HHAA 3OLZA 2PHZA 8OHMA 3CNLA 2PMEA 5J4VA 2A9KA 1ATIA 2JZCA 2FGJA 3IX7A 3NPAA 3QF4B 4LISA 3T9EA 4WFJA 4FFBA 3RC8A 1PL0A 4AQYB 4ZQBA 1RC1A 2C00A 2I8CA 3OIGA 2IWRA 4TXJA 1C9NA 4EGJA 1T9AA 3R3VA 4XM2A 2X9GA 3VDRA 1ZUNB 2L42A 2VKQA 2IU6A 3CR8A 1KI9A 4YCBA 1PF7E 1VMAA 3O4FA 2IIBA 2HLDA 4RL4A 2EL9A 1J8DA 1ECGA 3F47A 5AD1A 1NC3A 4OGKA 4JSYA 3OT4A 1QGYA 4LJAA 3W6ZA 3R40A 2LV8A 2J9GA 1V3VA 4ZU3A 1UK7A 3KVOA 1VE1A 1AURA 1I4WA 4D6PA 2BC9A 2ATIA 2JLBA 2AW3A 1TAUA 2YINC 3MD0A 1NVDA 5HTKA 4F85A 1RC8A 4XQCA 4LZLA 1LPMA 2QENA 2OGSA 4G8CA 1J5PA 3ZZTA 4CIXA 1Z28A 3GXBA 2D1RA 5CRIA 4OMCA 2VQEB 2ODNA 1D9XA 3NHJA 3UUEA 4DBLE 1N78A 4MS4B 2DQKA 4HWOA 4KJXA 4D3DA 4QHSA 2G3YA 4H3SA 2LCFA 3WGTA 3QTBA 4F92B 1TT7A 2OXCA 3R23A 5F21A 3ZQKA 4NCAA 1BA2A 4LZPA 3SOPA 1S9HA 2DWPA 3DB1A 4BNZA 2EDAA 3S0JA 3TMAA 1BVHA 1K5DA 1T4DA 4U02A 2CVPA 2AJCA 2EJUA 1VJGA 2EZUA 4R7GA 2O3UA 2XCOA 3IILA 2CK3A 1HNWB 1E1DA 2R68A 2UVDA 3KNZA 2GBPA 1YMQA 3O1LA 3QUCA 4PNHA 4L5YA 1VPWA 1TUEA 2R97A 3SYKA 6ADHA 3WISA 2Z2JA 3QM1A 1ZOLA 1TYDE 3G68A 5DP1A 1A9RA 1SXHA 3VHLB 3A9SA 2G25A 5HGJA 1ULSA 2ZJYA 3QELA 1WB5A 1IVNA 4LQLA 5DCYA 3BKXA 1GITA 4XIJA 3UKDA 1ZJ4A 2Z4SA 3IEIA 3F8SA 1WNFA 3FOFC 4CT0A 1KY5A 2ZTVA 1G9SA 4BV8A 2P1DA 2CJFA 3EDRA 5DHPA 1YZKA 3DKVA 2Q6VA 1AVTA 2OKCA 4IXWA 1T91A 4G5GA 2R8PA 1RABA 2FW7A 1DXHA 4CV2A 2VJLA 4X85A 4QD3A 1DAHA 3P9NA 2JLYA 5LYJB 2B5VA 1WCIA 1ABBA 4TT3A 1GG8A 4MK4A 1IQRA 3FZYA 1R8YA 1UDWA 1Z2CA 2WMOB 3H5AA 5JBNA 4IUCS 1ZI8A 1SRRA 2C7BA 2H2IA 3EGDA 3ZDZB 1PUJA 1TLFA 1V5WA 3CEJA 5CVVA 5E38A 1VB5A 3G17A 1ODKA 1YA4A 1YJBA 5CYFA 2OCAA 3E7PA 5LWHA 3ZJVA 3GH3A 4NDAA 3SSNA 2ZUFA 1ZCZA 4ZV4A 3GJ4A 4E30A 1E79D 2J6IA 4EF5A 2FMUA 2NVOA 4XDYA 2NSHA 5AJYA 2Q28A 4YRIA 2DH6A 5KKAA 5U4QA 3GLHA 1O96B 3NEYA 4B8WA 1CK4A 4IR7A 3TOXA 3ZY3A 4M0KA 2BMJA 2ZULA 1WR8A 3DDWA 4HQNA 5GP1A 2QN8A 1EIZA 2ZRGA 2C9ZA 2BFBB 1E5LA 4Q1EA 4AJ4A 2Q62A 1M2VA 4N0DA 1KSHA 3V4OA 4X63A 4BATA 4LHWA 3MLAA 4F4JA 4IQ4A 2WUGA 2APJA 2RH5A 3WHLA 1A27A 4KL8S 1N0UA 2X40A 5AIAA 1O89A 4LJRA 4XSHA 2I91A 4MRNA 3A2KA 4WNYA 1B73A 1X1CA 1KAHA 5CFOA 2JAXA 5ITVA 3NPMA 2Q5IA 3JV7A 4I1VA 2WPDA 3DAHA 3D6UA 5D2CA 5JAMA 2BDUA 2AZDA 1OH5A 2DSNA 4HLUA 1EFCA 3S2ZA 1NF2A 1U3DA 4X6YA 4BNIA 1OPXA 4YQZA 5CXUA 3BGDA 4OUKX 2BL4A 3AKDA 1QE0A 4M0MA 1RLTA 1DEKA 2CUNA 2JLCA 3IDAA 4I19A 4A2PA 3K2EA 1IFXA 2D62A 4UHEA 5ITSA 3EZNA 3IT0A 3O7MA 4I99A 4GXTA 1B93A 4OQPA 4WLUA 4DZRA 5HZKA 3UHPA 3PEWA 1NIPA 3PQ6A 2BN4A 3AY3A 4FHGA 3DKPA 2O5VA 2YL2A 3ER8A 1ZHHA 3I8XA 1SG9A 3CW9A 4PTZA 2BGWA 4CGZA 2C29D 1XZIA 2ZSAA 4UFPA 4MO9A 2BEJA 3KJGA 5FCDA 3TRFA 5C7LO 1DE0A 3IBSA 3SDZA 2YWJA 3A4NA 1YOBA 2CL6X 3TUJC 3TPCA 1UWKA 4K6OA 2ISCA 2HRDA 4WK6A 1W1IA 1N2HA 4CKEB 3KSMA 1E5DA 3CR7A 5A1TA 1UEIA 2QTAA 1IWOA 3OQVA 2YUTA 1SVUA 3NYIA 2A57A 2J3IA 2P78A 2UYGA 3P2YA 2YJTD 3I32A 3JZMA 4B80A 1RI1A 2EF0A 4KW7A 2VDQB 3NKVA 1R0KA 1WKVA 3O6VA 3OF2A 4N3NA 4X5OA 4QBGB 1HQCA 2VK1A 4FWTA 3D8TA 2G71A 3HB5X 5AJWA 1YR1A 4P9NA 5HW0A 3Q8KA 3T8YA 1NW9B 3QLTA 5FO0A 4IYRA 4ZQCB 2HXSA 3HGQA 4IIYA 1CKEA 4JNKA 4PSDA 3EIQA 3JYHA 4W99A 5IRCD 3NGXA 5BORA 5B3JA 1X7YA 3KX2A 4M8KA 1RWKA 2QMOA 1MO5A 3TAXA 1EFUA 2C9BA 1NG9A 4YRQA 4YP9A 1ANKA 1T8PA 3E9QA 3FI9A 3PPIA 4PRZA 5ESXA 2C3PA 1QFJA 2QDXA 4ARZB 4M0FA 4Q02A 3DO5A 3HHEA 2RG7A 3LSYA 5A9SA 3AL2A 2W6PA 2C1ZA 2I54A 5CB4F 2LGJA 5HQ3A 1ZSNA 2JCSA 3IELA 1FMLA 2OP0A 3N7TA 2FLVA 1CQXA 1V4VA 4DIMA 2W37A 3G2NA 1FDTA 5AVSA 4JLBA 4Y2YA 2DQSA 1B7GO 2OD9A 4DBZA 2QT9A 4HB3A 3UAXA 3NBXX 1Y4AE 2P75A 3BORA 2Q0HA 1M75A 3H5RA 4LCBA 1XXHE 4IW3B 1GUZA 4BP3A 3EQ8A 1UDCA 1R12A 4U7PB 1Z0FA 2AYZA 3Q11A 4RK5A 2YWHA 5EJAA 4DJAA 2TSYB 3GCWA 1PUIA 1GKIA 5ESWA 4IGIA 4BUCA 4OHRA 2JGLA 3N0XA 3QMPA 4ZYTA 4XLZA 4P3OA 2QTMA 3EAQA 4G81A 5J43A 4G5OA 4PU0A 5HKAA 1JYFA 2WJHA 3GPDG 4UFNA 1AQIA 1HKHA 1SXJE 1ICEA 5EP4A 4B6EA 4KGZA 1FP4B 2CNLA 4OLAA 2PLNA 2PQMA 3FTNA 4QWWA 3AVWA 4J07A 3JWJA 3NOQA 3EWSA 2C4UA 3FZQA 3ILHA 4QOJA 5G0UA 3JARA 5CX1A 3WIEA 3HMKA 4Q9KA 1GRQA 4WVFA 3H11B 4Y2QA 3SVTA 3C3MA 4DQVA 1KKUA 1XLVA 4RVUA 2I3ZA 2GD0A 2ORIA 3X43A 1E7RA 2RBEA 3ENVA 1MV8A 2W0MA 3KUKA 1D1QA 4D99A 3EK2A 2JD2A 3IHLA 4MLCA 4IV0A 3S8EA 4LC0A 4N3GA 3V00A 2WNIA 3EDCA 3ZGXA 1F2TA 3A9TA 3LYUA 4WADA 2PH7A 3OE1A 2PLAA 2IVZA 3W2EA 3WTCA 2I7DA 1QCDA 2P0EA 1JTFA 4FKBA 2LPMA 3IQDB 1M76A 4RV4A 3UAYA 1S2NA 2JGDB 4DCMA 2C4HA 3MGAA 5LXTA 2IBSA 4NK5A 4V38A 1GGEA 2GJ8A 3JSXA 1W2HA 3K31A 2RBGA 2YVKA 3A10A 3GRAA 3Q3JB 4ZAFA 4EYOA 3IUMA 3KTDA 1ZL0A 3QKSB 5ILGA 2PUAA 1Z6QA 3AEUA 2NSJA 3KKKA 1SA0A 4OOEA 5F33A 4DILA 1H85A 2D6FA 3DDZX 5IHPA 1I7PA 3COJA 1JJIA 2CBGA 3A2MA 3JALA 2VPTA 1ONBA 2XRZA 2C7GA 4LJ7A 2FLKA 1CF9A 2YXLA 2BFWA 5F2NA 4F38A 1UODA 3E9CA 2FSPA 1SIBE 1SM4A 1Y34E 1LF0A 1P19A 2P5YA 3GJRA 4HXEB 4NDNE 4Q47A 4PYNA 3DZHA 2ECPA 4PPYA 5CLLA 5ECDA 2QU7A 4YRPA 4X61A 3HNRA 3H86A 1T4CB 3LLMA 3IHWA 2C3OA 3ZLBA 4E0BA 2I29A 1EA5A 3EH1A 2Z2YA 2ZB7A 1EX7A 3JVDA 4EI2A 3NHUA 4HVLA 4IOLA 1IG0A 2X3YA 4OEHA 4QDUA 4Y0VA 5HE9A 3VVLA 4RZUA 4DMUB 4JL6A 5L4LA 1C8VB 3A6GA 3ZGZA 4OHBA 3JQBA 1R4MB 2BE9A 3KQTA 3NAMA 4E15A 1TADA 4HNUA 5JQWA 1VHJA 4A03A 4EW3A 1JE0A 1V6CA 4NBRA 2NSLA 1XHEA 3L0BA 3T3GA 1QFXA 5HQ3B 3PNQA 5H1YA 1FNBA 2ZRMA 3SM3A 1NQXA 1FRVA 1NMYA 4G56A 1M2OA 1NI4B 4BJ1A 1SXJA 4LRSB 1NZJA 3EEYA 1OREA 4D9JA 1GL3A 2AQ8A 3I9V1 1YCDA 4BIIA 3L0IB 3LF1A 4DCVA 4LSMA 1PJ3A 1Z5UA 2H48A 1KI6A 4MLZA 4FYHA 1Q0UA 2IZ1A 4NARA 4NWIA 4TS4A 5FBKA 3DDNA 5CNMA 5A4AA 3NORA 1JHYA 1KBOA 1HMPA 3PLRA 4G25A 1JXQA 1KWGA 2R4UA 3A14A 4KLCA 5DNEA 4O1HA 1QPGA 4ZMBA 2CNWA 5A6SB 4BVFA 1EXNA 1O97D 1RXVA 3ESRA 2VBIA 2LKCA 3KFLA 4L5IA 4D42A 3H5LA 3H4MA 3JAKB 4G41A 5J5CA 1PL7A 1TYCA 2Y4OA 1VLVA 3F6SA 3U4HA 4B75A 4EA9A 1SQ6A 4II7A 1TC1A 4HFMA 4TMXA 1U2DA 2XCUA 4XOIA 3QF7A 2IYQA 3R20A 1QK3A 4HB4A 4KLRA 3WQRA 5LLDA 3MGBA 5AKLA 4ZDJA 5TS3A 4NMHA 4CCWA 4ITVA 1UJ2A 5CX1B 3TVTA 1DIBA 2V1XA 3A25A 4IMIB 4KN6A 2B1RA 5FOUA 1FE8A 1K98A 3EULA 3FB1A 3O93A 3PUYA 4TMZA 4TN1A 3A4YA 5KC8A 4KQMA 5KOJA 1GAJA 3K4PA 2HU7A 4Q3KA 4QELA 2GKSA 3OQIA 3ZUPA 1NDUA 2GM9A 4YCMA 1QFSA 3LKZA 4EF4A 2B4KA 4S1NA 1WUTA 2CD7A 3IIJA 2Q8QA 1QYDA 4N8SA 4XCQA 1Y6QA 4IJQA 4J49A 1Y4SA 3CLRD 1D2RA 1HYBA 1GN9A 3LZ6A 3RF6A 1EHYA 3ZV5A 2A0YA 2EYQA 3A9CA 3K0CC 4BZPA 1TLTA 4L74A 1X2BA 4L3OA 2LDBA 1OLSB 1KEZA 4NFYA 5AUOB 3GNSA 5JAZA 4R1SA 1Z29A 5DX0A 1OC4A 3FNBA 3A11A 1BVUA 1FNSA 2PXCA 4IKEA 3DR3A 4MAAA 3P2KA 1HDEA 2BISA 5EJEA 2DBYA 3MUEA 1XDDA 1U8UA 1LB1B 9GPBA 2GKGA 1TCAA 2FFBA 2V74B 3DTNA 3HCAA 4H6PA 4ZKEA 3WBJA 2JCBA 4GQBA 3OP1A 3CGWA 1FXUA 2A9PA 4JEIA 5REQB 4BQRA 2PZMA 5FI0B 1NOIA 2A1IA 3OQ1A 4UEQA 3WMRA 6GPBA 3IFSA 2FK8A 4K9KA 5CFMA 1MO4A 4DTCA 5IJ9B 1QHXA 4HOYA 1CZHA 4HG2A 1ZWKA 4C3OB 2V6MA 1JZQA 2OR3A 1X9GA 3N2NA 4L4YA 4DXHA 3VPBA 3NH9A 4UBKA 3AR8A 4NI5A 5TPZD 1XMXA 2CHQA 4QYTA 1PTKA 1ULZA 4I6GA 4H6WA 4OHXA 2A6PA 5GJWC 2ZREA 4R71A 1AA6A 3CCFA 3OCZA 4RHXA 3WAJA 3GPBA 1KK1A 3IKVA 3SEAA 1GWNA 3ZVLA 1IJFA 1OD6A 4R6WA 3KPJA 4Z7JA 2RJOA 1Y9AA 3A1CA 1TU0A 1Y5RA 3A70A 4NL4H 3WRWA 3ZEAA 1ZH2A 2C31A 1Q2XA 4NF2A 5CH5A 3WIBA 1O2DA 3CR3C 3NM6B 2QIOA 4Y1GA 2ZIXA 1KZ9A 3V8VA 4PLCA 1ZI6A 4RYDA 3RJTA 1QOZA 1XRJA 1Z8FA 4Q39A 3TNYA 4F46A 5JT1A 4JYZA 2JLSA 3NHFA 4WESB 2L19A 1NJ2A 4MUIA 1UKEA 4Q4JA 2GPWA 1J0DA 3ODPA 3W5IA 1BXKA 3KPUA 3MGGA 4FGSA 1FDRA 1Q1ZA 4MDHA 4MEJA 1U94A 2PJRA 3VKHA 4D45A 1R0LA 1V39A 3IDZA 2EJBA 5EIBC 4FZ5A 2BJHA 3I2KA 3H9EO 2PT6A 5CX4A 2Z5VA 3HZHA 2XDYA 3HO6A 4TQUS 3V7NA 1U28C 2WD7B 3AONB 4IHKA 4OV6B 2AS0A 4XGQA 2ZTHA 5JE8A 3SHQA 1NBWB 4I4NA 3BUSA 2I7VA 4CIAA 2QVYX 2FPIA 1G5HA 5HUQA 5KWVA 5KVVA 2CXQA 4GE3A 3L6UA 4ZHQB 1BU8A 4C0SA 4QUAA 4DQDA 3H1FA 1TAHA 1KXJA 4LXGA 2AR7A 2NACA 2NUTB 1XRSB 2FN4A 4ZKDA 5IKEA 1PN3A 3C7TA 1QS0A 3HVKA 4BO0A 2CNBA 1PSDA 4KR3A 4AXBA 3V2UA 4N6NA 5JWRA 4ER6A 2FR1A 1UAAA 4DJDC 4YQEA 2BEWA 2VRNA 2N9UA 3K05A 4FHFA 4NEHB 5CCXA 5CT6A 1Q3KA 2CUZA 3T5TA 1THMA 3BERA 4ZO4A 3QNUA 2Q3CA 1QO0D 3DVAA 1NU6A 3HSYA 3L5OA 7REQA 4V1CI 3KXDA 4GLOA 4JKIA 1GOTA 1Y7PA 4ND1A 4CKXA 5K8TA 2RH8A 2VK4A 1YJCA 3KALA 1W96A 1KYTA 2BI7A 3M1IA 3OPYA 2Y0BA 1CZNA 1FU4A 5E7QA 1Z4OA 1FOEB 1H4TA 1UXOA 5ALLA 1G20B 1QDEA 3BRQA 3BDIA 3ANLA 4Q1DA 2OM6A 4GUAA 4DLRA 4YAGA 4MI3A 5G41A 1RHQA 3AF4A 3K0FA 2E5FA 1Z6YA 3SYMA 3FPFA 2DHRA 1TKRA 2J3JA 3QJYA 1UKCA 4AZ0A 4DTIA 2VYVA 3BMCA 4TV9A 3YASA 1X2EA 3IP5A 1DQPA 4M6WB 5MF6A 5BO5A 2GPJA 1D9ZA 1YQDA 1E0DA 4DWVA 3W05A 3LUKA 3DV0B 4RIFA 2YXBA 3IIMA 4JT9A 2VSFA 4P0QB 1I3MA 3U3DA 1J23A 1XZMA 1VA4A 3BEOA 2K6GA 1L5MA 4H7HA 1Y0BA 1T10A 1PFKA 2BR3A 5CD1A 4ZVRA 2NPFA 1Q2UA 3KEOA 2GH1A 1T1SA 4JYAB 2Z6VA 4LXQA 3IDFA 3DM5A 1ADJA 1KYXA 4DKXA 5A71A 2LIPA 1EMDA 3FBGA 3I37X 4YAKA 4E5KA 3KT0A 2W2XA 1KQPA 4ND5A 1USIA 3HPQA 4MRSA 4P4TA 1L7PA 2WWRA 1XXHB 2Q7DA 3TOCA 2JJ8A 1FMFA 1A7AA 5KU7A 2VK8A 1Y7IA 4H4DA 1ONNA 2QMUA 1QBGA 1ZVQA 1E3IA 1YT5A 1TF2A 4IX1A 3S29A 4B83A 4ZCTA 3V8EA 1GPKA 4A6EA 2YFYA 4UXHA 5IAJA 1U1GA 3ZDRA 4X9XA 4P58A 4DYHA 2V7TA 4TKMA 5KC9A 4UPDA 1M1UA 4X8LA 4Y9DA 1IOWA 4BN0A 1QP0A 2HWKA 1PFUA 1VZ3A 2CVOA 4OJNA 4KLZA 3LUFA 1OILA 4AXXA 2W6NA 2BFCA 3NV7A 3HHPA 4FE4A 2NSYA 2DYKA 2GXAA 5LB4A 3WYAA 3I01A 3II6X 4LMPA 2ESRA 3E9MA 4L5AA 2XT6A 1FC0A 4ZU1X 3A3PA 2VBGA 3HY6A 1R6XA 5G2OA 4CM3A 1WW8A 2X4LA 3NVMB 4L15A 1YOVB 5AHWA 3Q7TA 1DRVA 1NA5A 4YNBA 3GP3A 3GDHA 4EECA 3ZCPA 3W5HA 5FI5A 3GR6A 1YCFA 2PNJA 3RVJA 2AEFA 1QGUA 1EP3B 1WQ3A 5HCUA 3SM9A 1N8TA 3QXCA 1LJ8A 1Q57A 3OZAA 4KYUA 4U5XA 5CVEA 5G3YA 3ZI7A 4P82A 3RFCA 2RB5A 3X1DA 5GONB 4EGSA 2H16A 4E12A 4UBNA 4WDQA 3GMIA 3W90A 2DU8A 4K5QA 1DKPA 1Z7GA 4MUXA 4QYMA 4X97A 2CLKB 3AR5A 4WNAA 4D3YA 3T4UA 3TFOA 5IAEA 4FB5A 2QXUA 3MHTA 1YVPA 2VQ3A 3BTVA 3QA9A 5C37A 4NHOA 1MTZA 1T2CA 3EQ6A 1KO1A 4ZO6A 1GYQA 1S01A 2J0UB 1GAWA 3ZW8A 5F1YA 3UXMA 2W6JA 3EF0A 2Q1XA 4GOLD 3U56A 4NFSA 3JR3A 4JSTA 4W5HA 1OBHA 2MCFA 2BOVA 2PLWA 1N5KA 3M3HA 3CUEF 4GKVA 3ZCXA 3OBIA 4COKA 3TF5A 2Z5GA 4F1JA 4L7QA 3S1AA 4DMRA 2WHYA 3GGGA 4C2BA 1PFVA 1ORHA 3CZMA 5ALDA 3OQOA 2PVCA 4B6FA 4MRVA 3BD8A 3ANNA 5C0OE 1TUBB 1JQEA 1N2ZA 1Q74A 2QXTA 3DEIA 1PWEA 3PA8A 4EB3A 1SUWA 3CFYA 2PGNA 3I5XA 1V1JA 2IITA 1M2NA 4L5BA 4H7KA 4FOLA 1BWSA 2EU8A 1EUCA 1QTIA 1VHDA 4H7EA 1H6DA 2YOFA 3GUYA 3STTA 4BQIA 2NXEA 1QCCA 3V4LA 2J0VA 3NMUF 1PR4A 3FGZA 3ZG6A 1KY3A 3KDSE 5FF9A 4GECA 1JFVA 2JPDA 3E0QA 2EERA 1SCUB 1DKMA 1A72A 3WSVA 4ERNA 1OT5A 2WTXA 2H0AA 1KRXA 2WU4A 4OUDA 4A2CA 3GLGE 3LBYA 3V6LA 3TBFA 2ZIFA 2R6GA 5M3BA 1Q0HA 2I2FA 2WOOA 2JANA 4EH1A 2V5VA 4OHYA 1X1SA 4IIXA 3OKPA 5JTUA 3SBDA 1NVWQ 1LLCA 3GH1A 3O8OB 4HS4A 1Y6JA 3O5AA 1K6JA 4RLHA 1TAGA 1R5OA 4UNPA 2HR1A 4ZEOA 3O8NA 4JDUA 4W7IA 4JXKA 2VA9A 4UM5A 1J33A 2FPGA 3GZNA 4PLZA 4YRAA 2ALJA 1U0GA 2UAGA 3D0OA 3NOVA 5ES3A 3WGKA 5JCJD 3ETNA 4QJIA 3GLQA 4J6EA 4LE1A 4PC1A 4B3MB 2OK8A 4V0LA 1HDYA 1BCSB 4RCVA 1M0TA 1HC7A 1BQEA 5F3RA 4UM9D 3I5UA 5FIUA 3GPCA 4E1AA 1GSHA 3PT5A 2VHVA 5K0CA 1CR1A 2ZYRA 1EFAA 2E4YA 3BB3A 4HADA 1T9ZA 4GRAA 2BSAA 4Q9DA 4TTRA 4EJFA 4YTEA 1XZAA 3OCUA 3C3DA 1GO2A 3OFJA 4GPBA 2EWMA 3HB0A 3EDQA 2IOQA 3P2EA 1RXYA 1MORA 2OHFA 4K6FA 4TN5A 1TQ4A 3N39C 4U7WA 5K4GA 3VKVA 2C0CA 3AEKB 1PG0A 4YJ2F 2I4IA 2XUIA 2YRWA 1BQ4A 4K9QA 1ATZA 4E13A 5HYVA 5AW6A 5JQGF 4CVNA 2E6UX 4PV7A 3KDPA 2ZYTX 4PPNA 3WAGA 2XH8A 3HDTA 1GZUA 1RR6A 2BVNA 3EY9A 4JUDX 4D96A 1VYHA 3E6AA 3Q9LA 2UZ1A 5FLYA 3OZGA 4DCCA 1XO1A 3BXHA 4JYMA 1ARZA 1TJ4A 2DEUA 1XMJA 3MTJA 3GJ3A 4X8HA 4BNMA 2GUWA 5KNLA 1AGYA 1IBRA 4Q9JA 3T4XA 4UHKA 1TEVA 3N75A 1T36A 2GS9A 2YQ4A 3NM5A 3Q6MA 5JZSA 3RGGA 4EA7A 4UVIA 3GQBA 4M0EA 2O54A 1DAIA 4GX1A 3RK0A 1YNOA 2HPZA 5IAKA 2P2SA 3HRIA 4LXTA 5EIXA 2FDXA 1CHNA 1B8VA 2O2YA 3TIGA 1IXKA 2JBWA 4GIBA 1ZIPA 4FTWA 1N6KA 1X1AA 2O6LA 2QAGC 2W22A 4LYJA 4NTZA 3DYVA 3AV3A 3OESA 1VKRA 3GEGA 1E20A 1M66A 4J0FA 5A3SA 3GIDA 1ZJYA 1COWD 3GRVA 4TKUA 4DJ5X 3DAGA 2F8MA 5JEDA 3UPUA 1Z4MA 3MT0A 4Q19A 4RD2A 4DR1B 2XXAA 1Z8DA 2IYZA 2RE8A 4A9AA 3K30A 1SVIA 3ADKA 2CDAA 3L8ZA 3RHFA 5AVWA 2XTMA 1G8FA 1L4BA 5C9ZA 3JPYA 3F3KA 2A5FA 4AMBA 4WN9A 1NNSA 1L5KA 3ZHCA 2XZPA 1CQPA 4BO2A 5GVSA 2IH2A 1RAGA 3AF5A 4LI0A 1TNDA 1L4GA 4JJKA 1MT3A 4GWLA 3W06A 2I3DA 2JAUA 2YHUA 3VKUA 1MRNA 3D7MA 4B0PA 3LTNC 3EGEA 5I5EA 1RIFA 1SQFA 2RKWA 4NP6A 4PZDA 2PAFA 2BIFA 2H4JA 2ZRNA 3SF0A 3OBBA 3SZLA 4EY6A 1TAQA 5IT5A 3F5QA 5LYJA 2X8JA 3EWNA 2O3SA 3T3EA 1C81A 1YACA 2BKUA 2VJNA 3PX2A 5E2BA 5LQRA 4AF7A 1FP7A 1SCUA 2XWPA 3D6HA 3JW8A 1K8ZB 1P5FA 3WGZA 5GINE 1JAZA 4GW3A 4XVRA 1JEDA 2NV2B 4B45A 1THTA 1UPFA 1D07A 2N47A 3T99A 3RS2A 2W6CX 4XI9A 2WA1A 1R0ZA 3EA5A 2B21A 4KOAA 5TC4A 3RYTC 3WB1A 3C1AA 3S5JA 1Z7BA 1OQAA 3NIWA 1F20A 4UM8B 1E3SA 3FKQA 2AJTA 2W11A 4FDUA 2CMFA 4JLAA 4PTLA 1P74A 1XQXA 4KPFC 3UTCA 4CTKA 2IH4A 4NU6A 2JGFA 1T35A 4MO2A 5SYAA 1ECPA 1N3BA 1ZPDA 2RGCA 4DUGA 3HU2A 2CK3D 2BUAA 4E07A 1X1TA 4QAQA 1P7WA 2WHQA 3PUKA 3D8UA 3BEDA 4MOWA 4JOQA 3O7WA 1ZL2A 4NJEB 4O2BA 1O5IA 1QHYA 4XEUA 3RLFA 4CL2A 2VLIA 3PRHA 1QTQA 2GN2A 3KKOA 4OXRA 3FBTA 4YCNA 5EN4A 4QOIA 4JI0B 2JEZA 3DGEC 3G5MA 3PNMA 1M34A 1U7OA 4KPYA 5C1BA 3CLHA 4RMGA 3MINA 3O83A 5A5EA 1B76A 2Y71A 1UFOA 2YHBA 3RSGA 4BUZA 5DI3B 1USUA 2CV0A 4D3ZA 1C7IA 4EKEA 5FQNA 5IKPA 1GCUA 2BMEA 2Y1CA 3PPYA 3N9IA 2ZVDA 4FGKA 4HS9A 5D01A 1QP4A 4Q9NA 1Z9BA 2P7HA 4JI8B 1JKIA 4IM7A 1H2WA 2F3PA 2ZRJA 2GRUA 2GXUA 1JEEA 2WFMA 3ZS9A 1VIVA 4QNRA 5JHHB 1Q0LA 3Q2OA 4NEGA 1UPAA 1KMHA 1NKTA 1L4HA 1QX3A 4CEHB 2HW8A 3FPAA 5F4ZA 5IBCA 2I2WA 3U4MA 4FOTA 3E2PA 3Q3HA 2FF7A 4AURA 4V02A 2ZU6A 4WZ6A 4OI1A 1QYCA 3FKSA 1YH3A 4D5GA 1K8QA 2IYNA 1WXQA 2VF7A 4YAFA 1PWZA 4TM7A 3WYDA 1NPDA 4DFDA 3A1SA 1DOAA 1QORA 2ZBDA 3E1SA 1J6UA 3EZYA 1W5AA 2Y66A 2C03A 3W2GA 4O8CA 1RLOA 2P9JA 4KV7A 2DE0X 4R84A 3I9MA 3JYOA 1SVNA 3RQIA 4TKUB 2OYRA 4AWXA 4ETMA 1NR7A 3HXLA 2VS1A 1KO7A 2NO7A 5TARA 1LBSA 2PQ6A 4I7EA 4KYVA 2G82A 3B9QA 3N53A 4ZYLA 4LV8B 2JRLA 3BA6A 3BK1A 1JIUA 4ZIRA 5CDGA 1LK7A 1V95A 2GFQA 3E18A 1B15A 2F8LA 4IZ6A 3NC0C 4OYHA 4B4DA 1OBVA 3GG9A 4D8XA 5J23A 1ZD8A 1TK9A 2AOWA 4FFRA 4HWTA 4JHXA 1YL7A 3VSAA 1T2AA 1UAGA 2DY0A 1K3TA 1Q1NA 1ADGA 1WRBA 2JAOA 2JRCA 1OKKA 2X8LA 3CF4A 3JQBC 3W6OA 1LDEA 3MWFA 4E5SA 1C9DB 1M74A 5CEFA 4FQ7A 1YGPA 2HU8A 1GDDA 1V11B 2GBLA 1Z4IA 1CZUA 1SC9A 3AERB 3AZPA 2WUVA 1R5BA 2OG1A 4YDSA 4FU0A 5DZSA 1XQ6A 2FZEA 4BNWA 4C08A 1A3CA 4CBVA 1X7YB 4QSHA 2QN6A 3LD9A 4BEVA 1D2EA 1UIMA 1XXLA 5EZ6B 1QR6A 1J8QA 2RHHA 3B78A 4LRUA 4REOA 4L6CA 1BGXT 4U8GA 4L0CA 1HQDA 4EDFA 1BE8A 3I01M 2QKYA 2GMWA 5DO9A 3EPPA 1VLZA 5EI5A 3TSYA 4YJGB 4QXMA 1KDRA 3RUPA 3W2TA 2RHLA 1NQVA 2AG1A 3AI7A 4KXVA 3SBOA 1RKVA 1NMEA 3I42A 4WOBA 6PFKA 2XE8A 4H1UA 2XBLA 3NVAA 1CR0A 3HUTA 1NURA 2IQ5A 2XE7A 1B1CA 3HYLA 3NFRA 2DUWA 2FF5A 4GP6A 4DUPA 4L3VA 1KEEA 1OXUA 2BHNA 2Z08A 4NBSA 2HSJA 5EIAA 4UUQA 1GPJA 3QIVA 3MYYA 1P1BA 4QDTA 4UTVA 4G24A 1KS9A 1C50A 3RTCA 1P8AA 1UKYA 1KZYC 1BH2A 2LZ0A 1LDYA 5EKDA 3M6VA 5F1PA 2RFLA 1UCFA 2VAMA 1CUCA 3SJCA 5LQKA 4HATA 4GM1A 4AYTA 2ZDHA 3EZ2A 3L8CA 1HLGA 3P0RA 1DJNA 4PN3A 2W83A 4PC3A 1CJSA 3WK8A 4DA7A 1C7FA 1QLJA 1M1NA 5DI3A 4UOEA 4MMZB 1KJZA 1M1ZA 4LOAA 5E7MA 1G19A 2O1WA 2V4UA 4GPIB 3ZCQA 4BAGA 5L3QB 1BMDA 1E61A 4CMBA 3FOZA 4ZDWA 2GGSA 5JZBA 1YQEA 2XRMA 1X8LA 3FUCA 1N3LA 1WW3A 2IHVA 2M9MA 4WY8A 5IKMA 2O8DB 1T3TA 2DLNA 2VPWA 5CFPA 2PL9A 1R9GA 2W6JD 5LCXA 1JLLA 3TW8B 2A92A 4MJXA 5BSFA 3KYDB 5DDIP 5CM8B 5T8KC 4B2PA 4MPTA 2X0KA 1EFKA 1HFWA 3QFSA 4CIWA 5I4IA 4PO8A 2O7RA 2H4XA 4B6QA 4OYLA 3C24A 2CHVA 4HNRA 3CY6A 3MCAA 1R16A 1R37A 4E03A 5JC1A 3ESBA 3HA7A 2AMLA 2QQGA 1VG8A 1I24A 2VQSA 2PKEA 1JVNA 1YDEA 5GVRA 3SCZA 3PFHA 3TD9A 3A4IA 1SU6A 2C95A 5H68A 3OPQA 1P2FA 4MPRA 4CKEA 1UZUA 1FFBA 3C6QA 5DYTA 2DQZA 3O0TA 3GT0A 3IPRA 4U0KA 5DBHX 1VL8A 3ESDA 3V55A 1KI8A 1X7WB 1C8LA 3ADDA 1QQTA 4OA8A 3CQ9A 1U65A 1XZKA 3B3GA 2R96A 4D8TA 5HKKD 4PFKA 5L6MB 4I5GA 4FJ2A 3VNRA 1E7SA 2BJVA 3Q87B 4EG8A 5AKXA 4ZEVA 2VCEA 2FK7A 1M6VA 1D4ZA 3OLQA 3MTDA 4FKZA 1HOXA 5CHYA 5C51B 1PEKE 2HA0A 4UHHA 1I2MA 1YNSA 4RZXA 3ZJ4A 1QG4A 3I72A 1Y81A 4FI3C 4HDMB 4D92A 2WFLB 3QVVA 1II9A 4ZI3A 1UH5A 3D0KA 4ZRDA 3CN7A 1OYWA 2FFJA 5B1IA 1MCZA 4D9EA 2EFCB 1KAQA 1V16A 1BFKA 5FWYB 2CVQA 1ZMXA 4E46A 5HXAA 3EWAA 1HK7A 4LYHA 1NQUA 4JSRA 2ZJ5A 4J1SA 1PEAA 3AHEA 4MWTA 2JIDA 3LUPA 3URMA 4JC5A 2PUFA 1CF4A 5AM5A 4GPZA 3JD4A 3Q7RA 5J2TA 3OQBA 1QKJA 2QX6A 4CKZA 3P94A 4JH0A 4U7FA 4F2PA 1Z8NA 4HZGA 2ZKIA 4IZOA 4B3IA 2ANBA 3A7EA 2BYTA 2W98A 1GQRA 4UREA 4GL2A 4JUIA 5AOVA 5ALUA 2WIJA 5E9QA 3IOBA 3EDMA 3VZCA 4C04A 2WSIA 3K0KA 5IP5A 1QRSA 1D2AA 1SCBA 1TPYA 2VJPA 1CB0A 4C05A 2G9UA 2O7SA 5BOSA 1C0LA 1PD0A 4EG4A 4CL3A 4WOKA 5CVDA 1XPOA 5A6SA 4W4TA 1Q22A 3KQQA 4CYMA 3CLTC 3ZZMA 1ZNXA 4J76A 5IANA 1AKQA 1TECE 1Y5NA 4GOOD 2P1ZA 2YYAA 3VO9A 3B1KA 4PHTA 1BKYA 2ZRHA 3S1SA 4CQLA 4MKGA 1DMRA 1ORDA 1N7IA 3AFNA 4KWIA 5EHGA 3KAPA 4LRWA 2D4HA 1K06A 2ZPTX 1CETA 3H7AA 2IH5A 4LVOA 3KJNA 3LDFA 3QVSA 3OM1A 4LXYA 4HQRA 5EPUA 1AZSC 2CLLB 2CKDA 5J58A 4YCSA 5E1OA 3GLTA 4C0JA 2OYSA 1WQ1R 3LIIA 2VPQA 1NLFA 1YS1X 2A3NA 2EC5A 1T29A 4L3WA 3ZXXA 3VM6A 4ZICA 2JGKA 1CY1A 4JLDA 1QR2A 4S04A 1GM5A 2CLEB 2YJZA 3R5HA 2NNLD 3X2SA 3CF2A 2XW6A 4K40A 2WSSA 3FNQA 3QW4B 1K7CA 3NJRA 1L8XA 1NVXQ 1RXUA 2VZ0A 1W0KD 1FEZA 5F77A 3IQEA 4MEBA 3NQ41 4X6LA 1UBUS 3D7NA 1H2AS 2C5EA 2XD4A 1JVBA 1F4PA 3ETEA 2YV4A 3PHHA 4OK3A 2DBZA 4WSOA 2WWVD 2WKPA 4YUYA 4G09A 5AVRA 5AI4A 3O3MB 3K35A 4DA0A 3I6BA 1PEDA 4FUTA 3Q2IA 4Y1FA 1NFQA 3QSYA 2QJOA 3X1JA 4YDQA 2N0SA 1EK0A 4GR5A 3BFXA 3D6AA 1DLIA 3H84A 5E6SA 4OP2A 1U1EA 2AXNA 3OTQA 1RRGA 1NRIA 5JYDA 2O2IA 3T3PB 4P32A 2Y92A 4ZYUA 1GTSA 2ZUEA 2IGTA 3OQHA 2GK7A 4E5UA 2VIIA 4YT8A 5I7HA 2R5WA 3HG7A 3SF8B 4E21A 3FYUA 1QIDA 3OOJA 1GRRA 1FRZA 4ZOQI 4MCAA 3DV9A 4WGFA 1YC2A 4BB0A 3M0EA 2OGWA 2J59A 4DNPA 3QXGA 5FFMA 1VJDA 2HJRA 2C04A 2HIMA 2QOEA 3HR4A 4QU0A 3COZA 1W36C 5C35A 2N1BA 4G0PA 4LUCA 5C52B 3SC2B 4ZYVA 2C57A 3C7KA 1IL0A 1V5FA 1YB6A 2E48A 4JLWA 4N03A 5ESDA 2L17A 3UMBA 1RJ9A 1BS9A 3IT2A 4HKTA 2AFHB 4DNFA 1LSSA 1SJ9A 3Q3CA 2JLVA 1XZDA 5DEOA 3GXOA 4L4XA 4UUAA 2IU0A 4YJKA 4ZO9A 2VHWA 3UWMA 3OFVA 4NMWA 3D3WA 2IEZA 5DHRA 2C20A 1MG5A 1NQWA 2G6BA 3BSFA 2QUKA 7GPBA 5FFNA 2NO4A 4LS3A 3NWEA 5A4IS 4NMLA 3WLOA 3WS7A 5H8WA 1G41A 4OH1A 4Q4AA 5B7QA 3KL4A 1AGNA 1B8OA 1P73A 2OB2A 4N7JA 4P3KA 3E5MA 3KLMX 3SKXA 3WHPA 3B38A 2QVBA 2ZRKA 1DZ3A 1KVUA 1NX9A 2O9JA 4UOQA 5F5NA 5IH3A 3STVA 2CXTA 1E7YA 2FUEA 4WOPA 5TXGA 2R47A 2BGMA 1Z4PX 2D2XA 1ODIA 2WAYA 3MD9A 3ISVA 1HYQA 2HCJB 3L7BA 1R0CA 4M1EA 4WE3A 3T0FA 5A04A 2GYYA 3A6HA 2VJQA 4D3SA 5K8IA 1CZRA 4MV0A 4WJLA 1E9CA 1LPBB 1VDMA 3LO5A 3SIWA 3ORRA 4FHZA 4CU2A 2RGUA 1DINA 3FCCA 3HJNA 3JWPA 5DPMA 3ZWMA 4TKVA 3F5DA 3P19A 2O5EA 2ZRPA 4LSZA 5BWCA 4OSOA 2W6QA 1YQUA 4RH3A 4HMQA 1NZDA 4B5KA 3ZBUA 1T9HA 4UM9B 4LFAB 5EJFA 4KQWA 4BLQA 4JQZA 2Z1NA 1JFLA 3LPDA 3OWXA 1GUDA 4YRNA 2C2MA 2FSVA 4CKCA 1ESMA 2XOXA 4DBLC 3AJ8A 2AVNA 2Z43A 3DP9A 3GUZA 3A37A 4PCAA 2CDCA 5HFJA 3N6VA 1ISMA 1G98A 1N6PA 2PWAA 3C98A 3JQEA 5DGTA 3CVYA 2PTGA 3VJRA 4JUFA 1Q1GA 3A0UA 1BIFA 2QN2A 1I3CA 4X64B 2HSGA 2AG8A 3EOBI 4M83A 1U8EA 1YFKA 1E63A 3V7WA 1GA6A 2Z9CA 4GOXA 5JISA 2NG1A 3DZ8A 1TEZA 1P7ZA 4N8EA 3O8RA 1TD9A 4MGIR 3FFXA 1M6YA 3DXYA 4KYIB 2P6PA 2ZBRA 5CVTA 1E4EA 4J75A 5ENVA 3IV6A 5TV2A 2GEUA 1AGXA 3QNMA 2Q3LA 4M54A 4N0QA 2ZZKA 4ZVQA 4HEA1 4P5DA 4XJXA 3UAOA 4PPGA 3AKZA 1RMTA 1TF5A 1V3TA 2GEJA 2R00A 2C5HA 1IZ7A 5KTMA 1XVTA 1HE8B 2YIMA 2OUIA 1EXMA 2H31A 3H2IA 1UQTA 3UGQA 4EZIA 3LNCA 3F4BA 1U2GA 2QQ0A 2QSYA 4BQQA 1Y42X 3MERA 3BXOA 3E35A 1A4IA 1K86A 1XMIA 1WVIA 1HE5A 2RGWA 4CGYA 3GF4A 4MARA 1U3GA 3ZE0B 1KYIA 1YL6A 4OP1A 4D3XA 3UBTA 5TF4A 1EFTA 1E3WA 1I36A 1H0RA 4MP6A 4ECAA 3BB1A 2QJRA 3D8RA 4B7UA 1I4OA 3PGJA 2XAUA 4BU1A 4F4HA 1GGFA 1RJ9B 2X42A 1NLYA 1IZZA 3LYAA 4OHVA 1KJJA 2IGBA 4XD7A 5TGTA 4C5BA 4E51A 1GPNA 1UBRS 4DMLA 5HHTA 1FTQA 3MRSA 3GC6A 1PBTA 4KDFA 3UUFA 1IBSA 2IA5A 2DT5A 1KAEA 4NESA 4Q37A 1DRWA 2E37A 2G6TA 3J7AC 1QLWA 2O2XA 3PFKA 4R40A 3SSOA 3I58A 5AFSA 5AJTA 1TTHA 4P7FA 3H87A 4YONB 3ZZNA 5CM9C 3L8MA 5JZOA 4OJMX 1G6OA 2JVIA 4RTJA 1XXHA 2FFHA 5ALYA 1K4MA 1LA2A 4A1OA 4CRWB 4OVKA 2V7UA 4X60A 4LGVA 3NX4A 2NUAB 2ZYUX 1MIHA 4C2AA 2HNBA 1JQJC 4IWXA 1K75A 3GYGA 4Q4AB 4UM7A 4Y1RB 2VF2A 2H85A 2VI5A 4QARA 1TJNA 3THWA 3RT7A 2G5CA 3AHIA 2ZS8A 3EGVA 5TEVA 5UKDA 1I7QB 4HWRA 4LVNA 3MBKA 3NP7A 1QYVA 2OM2A 1U63A 2VA8A 2XA1A 3KU4A 4J94A 2V6GA 1GDHA 2OQ2A 4IDDA 4JLMA 1XMOB 3TAHA 1E2DA 3HJTA 3L7MA 1QQAA 2ZPUA 3U7HB 2C2HA 5U4XA 4MUGA 3EZ9A 4DWWA 5JC8A 4UDNA 1F0KA 1YMVA 3FWPA 1V96A 1DXYA 3E5HA 1KEKA 2FJPA 4XWWA 2NQ2C 2Q2VA 5H16A 4MA0A 2Q6TA 5LP6C 4JYCA 4MS1B 3BD9A 3R5XA 3L4EA 1MEOA 2EW2A 2HF2A 1RWQA 4KBGA 3UZUA 1XCBA 3OT1A 4BX3A 4DLYA 2CMKA 1SH7A 2SECE 3DL4A 3LHKA 1XL1A 1AM4D 4CKCB 3S8YA 3GEBA 4AO8A 3E61A 4M2LA 2P9EA 1ORRA 2QNRA 3USES 1ODCA 1HDCA 1JPJA 3GEPA 1UKZA 3I6IA 1LS1A 3R0VA 2H29A 4D0NA 1Z0SA 1M7HA 2Y3IA 3AC0A 4EFDA 1TA0A 4WNAB 1IULA 3FIUA 3QU7A 4JBHA 5FV7A 5AUNB 3CZCA 4WLEA 2QP4A 4R7TA 3I9NA 1SIOA 5ADHA 2WUEA 2NAFA 1S0UA 1C2TA 1F2UA 4F0JA 3JTMA 2WAAA 1K0FA 2PJDA 2XUHA 2FNAA 4RGYA 5KTRA 3LLVA 3DCJA 2Q3DA 4R9UC 1FFAA 5BY2A 1K5GA 2I8LA 4LF8B 2NPOA 3U3JA 1UBKS 3I4LA 3QVTA 4LAFA 3SEQA 1U0SY 2IZ5A 2VNHA 1ZN8A 1FSSA 3L0SA 3ISJA 3UN1A 4TV8A 3D2CA 1QQ6A 4XDHA 5KVSA 4YMTA 4U6NA 2VRBA 1HYGA 5FUWA 4CTNA 3RKSA 3K9WA 3ELDA 3BH0A 4M6WA 4WKNA 5FOVA 1R3DA 3R9WA 1A2BA 1GKKA 2HQRA 4A16A 4KE9A 1W34A 2Q0QA 4HDSA 3UV3A 1L8LA 1S4MA 2N42A 3I64A 3PUXA 4PYKA 4R8KA 1F8XA 3ETLA 3M70A 4NAUA 1BS1A 2E0IA 3WDKA 5C1IA 2BMVA 3C3EA 3KR0A 3N70A 3UVEA 4BEWA 3KTFA 4EPVA 3P9CA 3B6KA 1PT6A 5K51A 5JH7A 4KFCA 3L02A 2NZ2A 1KS2A 4F2GA 2CXPA 5BQOA 1CUIA 1YDHA 2WM3A 3ZKWA 3DZBA 5JADA 4M37A 1JQLB 4RHYA 1WLSA 5TJ9A 4CPDA 5EQJB 3G2OA 1GYRA 3RUDA 3OA2A 4PANA 4BJ5A 4UBOA 1F0NA 1EM8A 1KKLA 1LBTA 5EXSA 1UZMA 2CDRA 1Z38A 2VKTA 2QW0X 3LOQA 4Q7LA 4TQAA 3NBAA 3RKUA 3U7IA 4JCOA 4BL5A 2F1OA 3I5MA 3R24A 2VPPA 2XMRA 4ZVLA 3V4VB 4BVLA 5ARCA 2XWQA 1DU4A 2XYVA 4GE0A 3I61A 1D5CA 2YNMA 3MWKA 2HJGA 3ZGVA 4EAAA 5JRJA 4C0WA 2XGOA 3CPHA 3O82A 4PLTA 4R0NA 2HRRA 4ZPJA 4OF4A 2BFCB 1ONSA 1TTQB 4JCCA 1F9EA 3LKBA 2W8ZA 3F7MA 5FD8A 3NRBA 2BRUA 5P8WA 3OUTA 3DDUA 3CLKA 1GNRA 3EVGA 4CU5A 3QMVA 3SIXA 2C8JA 1YOVA 2GXSA 3FDFA 3HN6A 3WKEA 4JP2A 2HJ9A 4GEKA 4Q1VA 3AQIA 4YQFA 1CHDA 4J4BA 1X92A 2WF7A 2ZE7A 3OT1B 3Q9NA 4KBFA 2AK3A 3O4HA 4ALKA 1JG3A 1WHTA 2CL0X 2WILA 4MRMB 4LXIA 1FBTA 2UZ1B 3VJLA 1OLOA 4O6VA 1AKVA 3R8CA 4DCTA 1OZ0A 3W8EA 1CUFA 2JJQA 1MH1A 2NUBA 1N8KA 1UBHS 4M0UA 3KTAB 3GQVA 5A5DA 2CT8A 2J7PD 1G38A 2HEIA 3JQ9A 5DN6A 3K6RA 2IY9A 3D8SA 4J3FA 4Q3NA 4ZVUA 4F4FA 1V0JA 1KY2A 2AJBA 4E1VA 1PR5A 4UFOA 1EFDN 1XRPA 3NTRA 3ZYZA 4HDKB 2CCJA 2XRYA 2IY8A 3BMQA 1M6HA 5JMWA 4E5PA 1H3EA 5C5CA 3IXLA 4Q1CA 3AY6A 3KQMA 1WO8A 5JH7F 2VYFA 4X3CA 1JFTA 4LBVA 1C0PA 5L6LB 1OAAA 1PDVA 3KS9A 1GPWB 3V97A 3OLXA 1WCYA 4U2DA 2NAPA 2OAP1 2ZJ7A 1LK5A 1G2OA 1U1DA 2VWQA 5IVDA 3FZEA 4E6EA 1OT3A 1OHHA 1R3UA 2PD4A 4TV8B 4V0MA 4R5HA 2A7QA 4FC6A 4WLOA 2AI3A 3EAGA 4HFRA 5K3CA 1NYRA 3IMEA 3IR5A 2ZB2A 1KPIA 3KQUA 4WN9B 5HP4A 2M1XA 3ZLUA 3PWTA 2QY6A 3QX9A 4HFNA 2HMYB 2MSWA 4QODA 5DHTA 2XUQA 3SJAA 1YIOA 3NTQA 3OEED 3ORSA 1XLTA 3QHQA 4JLNA 4JY7A 3ETDA 4K26A 3LOUA 3GGOA 3PF9A 3IP3A 4R81A 3DE0X 3DDHA 1GPYA 4TWAA 1L3IA 4K9NA 4HXGA 4ZOBA 1A7UA 1OR8A 3FWNA 2GDJA 3EVDA 3MT9A 1NQ5A 3G1WA 4BY9E 4RDXA 4EKNB 2QV0A 3DOJA 3MXTA 2R6JA 3GOQA 1HFEL 3TUZC 2MIIA 4BTEA 2JCYA 5JH7B 1PG2A 3K4HA 4MV1A 1MGOA 2W71A 5K99A 1E9EA 4GR4A 3E82A 5A2GA 1XVIA 1BHO1 4XA8A 3R7SA 2R1TA 3E3NA 3G8YA 2DUUA 4RZSA 1Z2EA 4LNUA 1ZK0A 4X93A 4A10A 1X74A 2CXRA 2OV1A 4LHVA 1G4AE 2YHSA 1IEVA 4OG2A 2G4LA 3F8WA 1T3SA 3OIFA 5BQ5A 3HXQA 2X1MA 4MHTA 4F96A 3R3SA 4UARA 2IOFK 3M81A 3ZQ6A 4CM6A 1ML3A 4WY5A 1FPQA 3QBEA 2HHCA 2R00C 5AKYA 1IPEA 1QHNA 3VR4A 3AT1A 4B85A 1EWQA 3BG5A 1ZDMA 1XEXB 4Y67A 5GZ6A 4TQ9A 1K7XB 4G1BA 3GN2A 2YWEA 2X8WA 1YDGA 3RSHA 3VTKA 4YRKA 1Q14A 3SS7X 4JX9A 3OC0A 2Q4TA 3PNKA 1DRJA 1VMEA 4LY6A 4N5DA 4U3JB 1QIIA 4KNYA 3I76A 3CBGA 5JVDF 2R84A 3EZFA 1R9JA 1Y9ZA 1NG1A 3RRJA 3ICPA 1SOVA 2DPHA 3NLLA 3G2HA 2ZJFA 3A3OA 1LV8A 3IA2A 1HWYA 3MW8A 4RENA 1MB2A 4U7TB 1EKXA 4LXHA 5TGDA 4ASUD 5HIAA 1I01A 3HL4A 1U2EA 3IQIX 3AEQA 1CRLA 1JDVA 3GP5A 5L45A 1NUUA 1ZWLA 2J0QA 2Q9AA 1K2VN 1XZFA 2YRFA 3CIOA 3MJSA 5LQSA 1VCNA 6YASA 1PVDA 5JDIA 1EINA 2FDCA 3V5NA 4B3DA 1O97C 3FAKA 5K4AA 4AMUA 4B40A 4DB4A 1E32A 4MGZR 4UUPA 1C7RA 4OJKA 4YAEA 3P7MA 3FNGA 3L6CA 3EHEA 1DHRA 3T9BA 4CT5A 1WHSB 1OBFO 3VYSB 2DFLA 3H1EA 3VV3A 1PFYA 4TYPA 5I3ZA 3VR0A 2FPUA 1RXSA 3WBFA 1RC0A 2VDPB 3HKCA 3O84A 1S8OA 3GMDA 4Y6LA 3KFVA 4HLCA 4IIUA 1MEEA 1ODSA 1DAMA 3KXPA 1XQ9A 4MEAA 2IKQA 2OV8A 1YCHA 4G1MB 3DVSX 4KE6A 1UOEA 1EVLA 2FRXA 1PGNA 1UXKA 2CVHA 2FG6C 2XUPA 2ZIZA 4FHCA 4OQFA 5ALPA 4GICA 3GRFA 5CXQA 1IONA 3T9FA 4BYMA 2F8SA 1ODLA 4L50A 4MYCA 4TL9A 4YJFA 4RXMA 2YHAA 3OWOA 4WXRA 1OIXA 2Y9MB 1ZYUA 1JQ5A 1KJQA 2R5NA 1X1BA 1BRTA 3BE8A 1F6BA 3VC1A 4LJYA 1QX4A 5K6RA 5T6BA 5DW3A 2R7NA 3P9KA 3T1TA 3PRJA 4DR6B 4YCJA 4BFLA 5KS2A 1SU4A 3K9HA 4GC5A 3HXKA 1BX3A 2EKBA 3WK6A 2P11A 1A4RA 2R44A 2MSCB 4HR7A 4LHXA 3DBHA 2CFCA 3NBMA 1YU6A 1QMPA 3CG0A 4CG2A 4YJ2A 2PBRA 2W8BA 1YVEI 3SS9X 3IC5A 1VL1A 1OXXK 2R6ZA 3TLMA 2I1QA 3ABRB 4JI5B 4YFYA 3FDZB 1OF1A 3IVRA 1KAMA 1WXIA 4NCXA 1E2HA 1NMXA 3L0YA 2EKPA 2JJMA 4MITA 1K9VF 3LQRA 3PI7A 3ZZ1A 3UV7A 2FVXA 2UYCA 1LD3A 3EPRA 1XNRB 2C4WA 2O2HA 3KSZO 2IC5A 4HDOB 1QCZA 2Z3ZA 1PJBA 3TR0A 5JJKA 3QX7A 2OFPA 4UVEA 3VOTA 2R8OA 4W5WA 1XROA 1XHFA 4QEDA 3FDIA 5IT0A 4AMGA 4HX9A 2QRUA 3QF4A 1CR4A 1Z39A 4TVBA 1YR7A 2CWDA 3LXXA 2E18A 1RYZA 4KAAA 3JVUA 4TTPA 3TRKA 3ONNA 4MVCA 3S68A 4DM7A 2GBLC 4ENQA 3QPWA 2MR5A 2E4UA 4D43A 1ZD1A 2ZCVA 3VR5D 1JWBB 3Q7QA 1LI4A 1J21A 2O3JA 5L95A 4JV5B 3W3AH 5LN1A 3R0QA 1W8IA 4BGEA 4ZYZA 4Z3OA 2QUHA 1CEEA 4CM9A 3FOCA 1GPMA 1CVLA 1SUIA 4FQ5A 4TYQA 2H5JA 1E9RA 2CZGA 2W2LD 3WLKX 4ESOA 3AR4A 2IXDA 2J1LA 1RBQA 4D56A 4JJFA 4G5HA 3W79A 2UVPB 2QTHA 2ZJ6A 3HU1A 3M6XA 3TEMA 2VK2A 5FORA 2BZ1A 1Y1RA 3BE5A 1UBLS 3BOSA 2AFHE 1E2IA 1G5IA 8ATCA 3W9YA 3V8BA 3VO2A 4M60A 3ENZA 3RRNA 4F2HA 4RWEA 1F2TB 3AU8A 3ETGA 3RFVA 1N75A 4W8OA 1FVXA 4MIOA 4RHCA 4IWYA 3WADA 3UKOA 1QP8A 5CDUA 2N46A 2QMZA 3C0KA 1PR6A 4PSUA 4O5AA 1CLEA 4BB6A 4DPLA 2PKYX 2RHMA 3I83A 2G09A 1TW2A 2FSIA 4QGAA 4Q9HA 4C3ZA 1E1YA 3IPYA 3HLYA 3KYBA 2NT4A 3C8ZA 4DLLA 4F7DA 4XGIA 1FCJA 3LVRE 2X2OA 4LZZA 4UUBA 2KBFA 2B69A 1D7AA 3BM5A 4IZIA 4Q3OA 5BMVF 5K0FA 4FIDA 1KNXA 4L02A 3N8KA 2BY4A 5FTLA 4H18A 5F9FA 3EAFA 3UPDA 4PR3A 2SBTA 1I5RA 3FN4A 3P9QA 3QLEA 3VJKA 13PKA 1VSBA 3VSCA 2XTNA 3ZNPA 3VNQA 4W1PA 1SR8A 3D7SA 4DT1A 721PA 5DM0A 3AGQA 3ONFA 2V7PA 5CB0A 1Y5MA 1A9XA 1JH9A 4BDTA 3CG4A 3R9XA 4QHTA 1I30A 2DFTA 2FZWA 1XZBA 3OY2A 2OCXA 1BOOA 4YLEA 2VXOA 2Y1LA 3K9FC 4C0HA 4LDNA 3OIVA 2GEKA 4TS9A 2W2OA 4I6EA 1RU3A 1Q83A 2WYWA 3GCGA 4R31A 1QCYA 4GYWA 5HF6A 3TJMA 3RS9A 2UYHA 1C5KA 3K32A 2B37A 1K7SN 1NM5C 4LWQA 4YO8A 4Y6QA 2ZE5A 3D6NB 1BMQA 2ZE6A 3C5VA 4QULA 1O0CA 3SBEA 2CB9A 3N86A 3AFOA 1SXJB 3IEXA 2IEBA 4TWZA 4RQTA 3VO1A 1E6UA 4J9UE 2P62A 2QN7A 3RUIA 2ZU0C 4B9EA 1BCRA 3K5WA 3DXFA 4IICA 1EB9A 4DLTA 3WNCA 1TDJA 4JASB 4BPBA 4AN4A 2PUGA 3QZUA 3QVKA 2ODEA 4O33A 4EY7A 5KNDH 1DKOA 2C61A 5I47A 1YBHA 3T12A 1L7NA 4MV5A 2WQ6A 5T4EA 2ZSFA 2IEYA 2XVXA 3ADCA 4ZCSA 3KQOA 3INTA 1CUYA 2IKSA 2OZEA 3KYCA 1NW8A 2NTJA 4Z49A 3FYUC 1QQBA 1KI1A 1OWNA 3DFFA 4UMDA 1UINA 5AVJA 1IBKB 1XZPA 1YZLA 4X7BA 1WXHA 3TMKA 4P34A 3HYSA 2O4UX 3BF8A 1HH4A 2GCEA 1W46A 3U09A 5DSZA 1SUAA 2QN3A 3OQIB 1CY2A 1PQWA 1CNEA 5TDHA 5G40A 3F7NA 1BD4A 4NX2A 1W94A 1P9OA 1XCPA 4L0QA 4ZGGA 2B8EA 3HJAA 1LRKA 4FT2A 1NUPA 4G23A 2D8MA 2ZVJA 3KTOA 3SHFA 1E3QA 4JBNA 4AZ3A 2IXFA 3TX2A 2HJVA 3EXEA 2WWGA 2V9CA 3ORFA 3NB0A 3RT9A 1K0UA 4RD1A 5AKGA 4YV2A 3LBFA 1U4NA 3TPFA 1MAHA 5A02A 1OZAA 5LD2B 2XJ9A 4RD6A 2WINI 1USKA 1SZPA 2Q5EA 4OXQA 4MDFA 1AH2A 3AOEA 1WEKA 1I51A 1RAHA 2P9HA 5JZ9A 1Z5PA 4OLFA 1XTRA 4C43A 5DXJA 5CTJA 4R1QA 2PUWA 1NJ1A 4AECA 1GV1A 4DNXA 5BN3A 4H1VA 1V47A 4BJHB 3MTIA 4CF5A 3LZCA 4EY8A 5AM3A 2H1OA 1XTIA 3LUDA 2EZ9A 5L7TA 4MGEA 1BVYF 3IQZA 2FKAA 2DFPA 4G0QA 2HJHA 5KHOC 1KY4A 1Z2AA 2B3DA 1OFTA 3VR6A 4TMVA 1IN5A 5IH7A 3HY4A 1Q0QA 4YT4A 1JEYA 1H4VB 4PZYA 1ADYA 3G2MA 3KDAA 3JSAA 3KLBA 4IIJA 3R9XB 4PLPA 2RHWA 5JS6A 1EH5A 3VPDA 2OXRA 4FYIA 3LW8A 3WLJA 3PVZA 4YEDA 4HPJB 4B09A 1MP0A 3C3BA 4BYGA 4UEKA 2OA0A 1G3RA 3T52A 2EGGA 5JY6A 2IUFA 4JBYA 1C9EA 4W6ZA 3R6TA 4DJEC 4CMIA 5JXGA 4WK2B 4Z9FA 3C87A 2WVHA 4JZKA 2PUEA 1JAIA 5I48A 4D79A 4R51A 2DHQA 4JOSA 4RZHA 2BBTA 4AG5A 4D57A 3TSAA 4QBHA 3BJRA 1CS0A 1FVFA 3RWOA 3PUHA 5CH3A 1CY7A 1CVRA 1K8YB 1MC5A 2IUYA 4I3HA 2IS6A 4MV8A 1GNTA 1QRAA 1IXZA 4H35A 3MCUA 4C3UA 3T3HA 3IHTA 1YS6A 1VM6A 3DMPA 4WESA 2FRDC 2ZBUA 4Q4JB 4ZHSA 4FS8A 1QIFA 1FX1A 1GQ2A 1H0HA 3HP4A 3RVOA 4QNNA 2R8BA 5TT0A 4LRYA 3ULKA 2QK4A 3FZNA 4OFXA 2IHBA 1ORVA 3A1FA 3KR2A 4FGLA 4L08A 4R2WA 1JP7A 1TO6A 2HMUA 1GPAA 3S7TA 3VGJA 2HT1A 1OB5A 3AIKA 1OX6A 3F67A 3S2EA 3A06A 1W581 3KYCB 1USVA 1O4WA 2WM2A 4Q7MB 4DSNA 2CE2X 2G80A 2PWBA 3FTQA 5CNJA 3RTAA 4K28A 2P90A 3FMPB 3VI4B 2JI6A 4IVPA 4RESA 1Q16A 3SXUA 3P1JA 2QR5A 1NDHA 1QFYA 1V6AA 3R3XA 2XLBA 1GEGA 4D9CA 1O6FA 2Y1DA 2ZWIA 4L16A 2O8EA 1C3EA 2A2ZA 4BKUA 2XCTB 3ONDA 3UGTA 1NHGA 1Z5ZA 1XZLA 3KAQA 4R8VA 5JATA 3OJEA 1ZK4A 2QEQA 2A59A 4WASA 1ZGAA 3RVRA 1JUDA 1CWUA 1NMQA 1Y8RA 1YS9A 2KYRA 3PLNA 4AZ3B 3DAFA 4NZ9A 1A9QA 2GSDA 2WAXA 1R0YA 3GFOA 3B5JA 5ERYA 3O4JA 3NH6A 1LJLA 3FFTA 4AJNA 2JW5A 1N25A 2ZBPA 3AR3A 2ZITA 4RVNA 3T0GA 4MV3A 3TD2A 3GJZA 4C6SA 4DWJA 1U7ZA 3IPCA 5B57C 4PLFA 2AOXA 3BJZA 1RD4A 3QITA 1TZBA 1YRHA 2VPZA 5F9MA 3ZY5A 3T38A 3H1TA 4DC9A 3CZ9A 2NYVA 1P1JA 1WA5A 3ILXA 3SFVA 1FLVA 3QY9A 3IV7A 2BFDB 2QP9X 4KACA 1JJFA 2JZNA 3KKMA 3TSZA 1EXVA 1QHFA 4HDAA 4RH1A 3W1VA 4MDEA 3GZ4A 5M5BA 1RJGA 3PUVA 4EJ2A 1NP6A 1QZXA 3Q1KA 5BW8A 4Q9AA 3KKNA 4JP1A 1ZD2P 1WOMA 4ID3A 5ICGA 5KTNA 4JWKA 2CNDA 2ADOA 3L6RA 1KFCB 1WXEA 3DOCA 3JVIA 4Z0HO 3T4EA 3R0ZA 5BSGA 1YWGO 1UC4B 4QGGA 3LA6A 4F4IA 1OFUX 1UEXC 3MUNA 1TXGA 1O9BA 1VA5A 4QDJA 4AKTA 1WSWA 2R6CA 3LF2A 3TCKA 3L18A 3HXPA 5EJ5A 3DNMA 2FMFA 1V1MA 1H9CA 5ALHA 2ZYDA 1E94E 4GMGA 4G5SA 3SDSA 1AK9A 3TZHA 3KB6A 4EYQA 1RPTA 3EG9B 5K6AA 3E9ZA 4TS3A 4CMIB 2PN1A 5JXJA 1JT2A 2FZVA 4UNSA 3I1JA 3GFGA 1JR3D 3C8MA 3ONWA 3SHTA 3GP8A 2OXEA 1BDBA 1U0NA 2FFRA 2WWTA 3D7KA 3I04A 3RABA 3TJZA 4EMUA 5ERGB 4A3SA 1IAQA 3O1IC 1E1QA 4B3XA 2HCFA 4R9SA 1F1JA 4R68A 1ZRNA 2OO5A 1G66A 3G82C 5K2OA 3BRWD 5IEBA 1KI4A 1CRPA 1J4AA 2LXNA 3L06A 4ACAA 2E1PA 2OGTA 2V6FA 2ZAMA 3RRZA 3ZHVA 3TAUA 4D80A 4DCPA 1JDTA 3Q3IA 1KTIA 3L84A 4JT2A 5J59A 1WY7A 2XTAA 5ITWA 1AS2A 3VNSA 1GPBA 3BF7A 3ZW9A 1KETA 1NJGA 1TO1E 4RVGA 3WL3A 5EZ5A 3E03A 2I3BA 5BSEA 4BKOA 4IDQA 4RY2A 4BZWA 1K63A 3SY8A 5CGQB 1YZYA 2LKDA 1U3WA 2PQ0A 5AJVB 4ZQHA 2IE0A 5ICSA 4D82A 2BZGA 3P97A 4RKRA 4Z2YA 5KJ6A 2BLNA 5KNDA 1ENPA 4QJ4A 3GPLA 5CNIA 4EYEA 5EKXA 4EY3A 1EGVB 1PJLA 2W6ZA 4HUJA 4XWTA 1BVRA 3F1KA 4NZMA 4P38A 4EF6A 4AJHA 4E14A 4EYKA 3DE7X 3SQOA 1LY1A 4ER3A 3M8KA 2OAGA 1SBYA 3BSYA 4WA8A 4I9GA 4J9VA 4MR9B 1W2GA 3GROA 5FTWA 2MMCA 4MULA 3CXUA 1R9MA 4R2HA 5AW2A 3KVNA 2ZB8A 1GTJ1 5ER6A 1XYYA 5B4VA 4AVYA 4H7JA 1LPAB 4GEGA 5J4LA 1U3TA 4MR7A 3ZU2A 4MSUA 1RM4A 3WFIA 3OOSA 1SU8A 3N2GA 3TX6A 1RXWA 3ZE7A 1N2CA 5AKHA 2QRJA 4LKOA 2J0UA 1ZJJA 4AS1A 2QNIA 3A36A 1O54A 2R62A 3OQPA 5DBIA 5KUTA 4YGXB 2H52A 5G1OA 2ZJ0A 1HNXB 2YYYA 4OIMA 1TQ2A 1I3NA 3MT7A 1V5EA 3EDYA 5KWIA 1AMOA 1II8B 2IP2A 3L8YA 3ZWAA 1W6UA 3ZC3A 4B1FA 5EJ4A 3DR5A 2WU1A 3LIPA 2OXIA 3CUUA 1B6GA 1EUDB 4JN6B 1AKMA 1VZ2A 3CH5A 3UJ7A 3K3PA 3CLSC 3LWZA 5EE9A 2AZMA 2H9YA 3ADPA 2H3HA 3EYAA 4Q12A 4EI8A 1EESA 4BKPA 4GNKA 2BBSA 4AW9A 4PZPA 4BO1A 4JLVA 1EUCB 2YTZA 3F5SA 3ELWA 4OQYA 3IP8A 4PZLA 2GN9A 5AHKA 3WIDA 1CIVA 5IWAB 1N33B 3AF1A 4BO9A 1IM2A 2GASA 4HVTA 5HS6A 3U6BA 3LT0A 2ILTA 4AP5A 3LM8A 4IKPA 4H6VA 3VR6H 3GBVA 4Y7CA 2ZANA 3LY7A 4WBNB 2E5WA 2PNFA 5KQPA 1Y3DE 5CBPA 3TUIC 1IJBA 5HOEA 1XMPA 1UMCA 1ZNQO 2I2AA 4NBVA 4CF6A 5KQSA 2OSVA 2WYHA 1AQNA 1VG9B 2QHXA 1PP4A 1R5NA 1TCCA 3QEOA 5DU2A 2CDNA 3RYIA 5KVCA 2VHEA 4BV2A 4YMHA 3MMPA 2TMKA 3BCUA 5DLYA 2D8AA 2Y67A 2YN4A 4IJVA 2P6NA 2ZI3A 1QYRA 4GOKA 4F9FA 3I53A 4FX2A 1X8XA 5LA6A 4GNRA 1CJBA 1X38A 3LQQA 3MEQA 1TT5B 2BGTA 3AF6A 1T0PA 1Q3HA 3EHDA 5TMBA 3JWGA 3X1YA 4MVYA 4ZMRA 2VTBA 1OYVA 1STOA 4ZN6A 4QU5A 4IEFB 3DPUA 2YN2A 5JXHA 3VU0A 4K9SA 2AZ4A 3OUUA 4GRIA 1IVYA 3H5TA 4QATA 1A76A 5TMPA 4JVMA 3DZDA 3G5TA 2YFKA 4UU8A 1LI5A 4Z3KA 5M34A 1SVLA 2FPIB 3T34A 1NW5A 1N0HA 3W04A 3DO8A 4GUDA 5IJWA 3THXA 2ZZNA 2B8WA 4XM1A 2NU8B 2PGAA 3B36A 4H4EA 3V8MA 1O9HA 2QUAA 1DIGA 3GWZA 2C5SA 1EVIA 4J2TA 2W6MA 4QU9A 1M2WA 1MW9X 1NXWA 1ZRHA 3HCEA 4XSVA 5CA1F 1S2OA 2P8SA 4GGMX 2WTNA 5A3JA 1UK9A 3UATA 3DJYA 2G07A 2JFUA 3DKIA 4NV1A 2WICA 4CN8A 3RR2A 4B3TB 4IXNA 1FQWA 4CFSA 1TE2A 4JI4B 2FH5B 3G1TA 1N2XA 3AP3A 4I9UA 1TM2A 1HL3A 2DUJA 1F2UB 4ARIA 4AKGA 4AZSA 2I3AA 5IDQA 3ZW7A 4N47A 4YFVA 1O77A 2DFVA 3H2ZA 1TZMA 3ILSA 4BFWA 3OIWA 3MUFA 1XIVA 3H7IA 2QQFA 1W9MA 2QS9A 2FSGA 1KP2A 3ZE1B 1UZLA 1WV1A 2G5TA 4QYXA 2FW6A 4PW0A 1E0SA 2EG5A 1TM4E 1Z0ZA 3MMSA 4PINA 1YHYA 3T1YB 2ETXA 2VTKA 1J99A 3PTZA 3WGVA 1U2PA 4JA2A 1W8DA 3WMWA 4C4YA 5B2FA 4CDNA 2G7MC 1SBNE 2ZYIA 2GPTA 2Q1WA 1YKGA 2CF5A 1VBKA 2VJDA 3OD5A 2VYCA 4QZVA 3DV0A 3TSWA 3IEVA 1OI2A 1NGSA 2FEMA 1XK7A 1JQAA 2PBZA 5CLIA 1VOTA 4Y0AA 1SAYA 3U48A 4B3JA 4L5JA 3TEFA 2OHVA 2WUDA 3ZLVA 3LGXA 3CX3A 2AUTA 4A6DA 3NAZA 2D74A 2O0HA 3LV8A 2YVAA 3DDCA 2H3EA 1G8KA 1X70A 3DMGA 3H2KA 4RU1A 5E1BA 5FBHA 4BNDA 4KZKA 4MKRA 3CSDA 3S6JA 4ARCA 2BGJA 1G8MA 1P6UA 1BGVA 1NP3A 1TJ3A 5BSVA 4G4JA 4C7MA 4RD0A 5AH0A 1LPSA 1NQAO 2AV6A 1XEFA 1VECA 4FYYA 4IJMA 4MGHA 5BW5A 1ZKDA 2H8KA 1G21B 3SAJA 3H0CA 3N2EA 3OM8A 3PUZA 3MSXA 4V03A 5FA8A 5M2QA 3QUQA 3UMRA 5KTKA 3PJEA 4LBYA 2FPWA 3HU5A 3ZIAA 2A88A 3HLKA 2PFGA 3CSUA 1TFRA 3OJLA 3SS8A 2XB4A 3HDQA 1QRDA 1CBUA 1Z2DA 3JQ6A 1TVMA 3LO8A 1ZMRA 3JYQA 3PDIA 4MH0R 3A0RB 4RFVA 4ROTA 1JAHA 4HNAB 4RPCA 3V1LA 5DK6A 4F84A 2LW7A 1YS4A 3MA0A 1PT8A 1P91A 1WD7A 4KQEA 3RANA 3OLWA 5BOVA 4RSHA 2IPLA 4L07A 2VYNA 4Y2RA 5IJZA 2X5OA 3M6MD 2EBWA 2A0FA 2I4TA 1ZEJA 3O8LA 5IVIA 3R6DA 1L5SA 2PH5A 2WJ4A 1MABA 3G7UA 3X0DA 3OZRA 1PJCA 4RE6A 3M4YA 2NGRA 3EUEA 1NN3A 2O07A 3DOFA 3KPYA 4UQOA 1P1KA 2P4QA 3B9RA 2FWPA 3FD8A 2B4YA 4PCVA 5I45A 1Z4QA 3C7AA 4DSAA 4GLFA 1RLMA 2H1SA 2EX4A 3AOEC 5CUQA 4OYRA 2ECKA 3WP0A 3WB0A 4GWKA 2NVUA 1U28A 1WHSA 3H9GA 5B2ZA 3FLEA 4XDGA 1E2QA 2Y76A 4YUZA 1GUFA 1UKAA 2B25A 3AHDA 4KQ2A 1X8KA 3UA4A 1JEOA 3KTAA 5I6DA 1KSFX 1VHTA 1T8RA 1WBDA 5BMVB 5ESRA 2J6CA 2XRFA 4H1HA 3GNTA 2X41A 4AKEA 1DNPA 2PGIA 3EEOA 1KVQA 2D5AA 1J0BA 1WP9A 3HB9A 3TL3A 2C4NA 4TYMA 1RNLA 5D3MA 3K5IA 1FDUA 1T9GS 1Y7HA 1MLDA 3ZHUA 4KHPB 2DECA 5H3CA 2C7OA 4C0QC 1D03A 4NNJA 5G4KA 5B3KA 1O9GA 2EKZA 3IIEA 3LHIA 4RJIA 1U99A 1SEPA 2G7ZA 1RQ7A 2GCOA 1XQ1A 5JMPA 5WRFA 5JXIA 2GK4A 2DP4E 3L0CA 1JXOA 1SQ0A 1XRLA 2XVAA 4O4JA 2JAQA 1YGYA 1G8AA 3LQ2A 4Z4EA 1X39A 4DQXA 3I04M 3IBYA 4I0WB 2GO7A 2H17A 3TNLA 2H11A 3UG7A 3PR2B 2QAIA 1ZS9A 3WYGA 2B7BA 2JCGA 4Y1EA 4DIUA 2C0QA 2QGFA 4ND8A 5LJLA 3QE4A 3UJ6A 9MHTA 4LWZA 4Q7JB 4M99A 3DS8A 4FB4A 2HM7A 1V11A 4Z7QB 5FX2A 2H4HA 1ZJZA 1L6RA 2I6XA 2RI1A 3EGOA 1M8JA 2Z3VA 3N74A 5LZ2A 1NVVR 4LTNA 1MAVA 4E2FA 2C78A 1NNLA 2NO5A 3R7LA 4HGYA 4DDKA 3ZLTA 1P72A 3B70A 4QREA 4A0QA 3V32A 4BVBA 1XOIA 1CJKC 3HVHA 3EGDB 1QG0A 2RKOA 3NTVA 1M0EA 2IYRA 3RIXA 1JBKA 1PJ8A 2GA8A 1QIMA 1FUEA 3K5HA 4JODA 1YFJA 4OAOA 1Z6ZA 4X3OA 2FGKA 3O8QB 3ZCUA 1F8UA 1AHIA 3NUQA 3OZTA 4L5CA 2RGYA 3A32A 3AZOA 5DIZA 3RC1A 1LC3A 4B87A 1LQ2A 1CUAA 3PDIB 2R0QC 4ILEA 2FPGB 3GZNB 3CEHA 2CCGA 1CQIA 1I6KA 2HZ7A 4KB5A 3IUEA 6CHYA 1DWUA 1QE5A 2PLRA 2RG1A 3ANSA 3BL8A 3KZMA 2HMAA 5FUVA 4B3CA 5JSHA 1OX5A 2QR2A 3WYCA 3ZN2A 2RIRA 4B76A 2J0SA 2UXDB 3J81k 4B3FX 1S02A 5JJIA 2Y77A 3I1IA 1KEUA 3ROXA 4D9FA 2YZ2A 1RP7A 3F6PA 3QUBA 2HI0A 1BHQ1 2Z1MA 4WBXC 1JSCA 1JWLA 2DMRA 2VDUE 1E3TA 4V0RA 3E3OA 4WCVA 1KIMA 1R6AA 2B94A 3PHBE 2Q5FA 3DWIA 5EPOA 4EUSA 1P4HA 4OL9A 4ARSA 2IELA 5JV5A 2GCNA 1HNZB 4AMZA 4X54A 3FMOB 4BEJA 2C99A 4K88A 2IIQA 2IBMA 1MT0A 3QQPA 3M6WA 5JAHA 2H1LA 2ATEA 4EG0A 4IMPA 3T3OA 4IO1A 3T7IA 2O8BA 1CRZA 2CYCA 4KDEA 4J1TC 3VA7A 3EGXA 2O8DA 2I7XA 4UPVA 1FXSA 2PKRA 5FUQA 1T1GA 1E89A 1SK8A 4QGBA 4QPZA 5LM3A 3JY6A 3ZUGA 1W88A 3T95A 4CG3A 4WZBA 5KJFA 4KJZA 4G2NA 2CF6A 3GQBB 4UUMA 3AUXA 4HAYA 1FBNA 2O1XA 2JB9A 3DO6A 5BSRA 3TOZA 4CMEC 3GLIE 2P0AA 4AJKA 1IAVA 4FBLA 3AB7A 3FCAA 4AL4A 2D0IA 3KJFA 4JJEA 3QEBZ 1XFAA 2C8LA 4YJHA 1NQTA 3AILA 3W1EA 1SVSA 1XEWY 3GAMA 2ONJA 4JXXA 4PYJA 4FCTA 1ADBA 4I50F 4Q6WA 4PYOA 4V3BA 2O8FB 2A1TS 1JA0A 1FTSA 4YJFB 4MW4A 2GCOB 3BXGA 4LJ9A 1F60A 4EVQA 4P7BA 1E8NA 5F7OA 3ZDQA 3GT3A 4GQIA 3T7DA 1L7BA 1XDWA 1XCLA 3DAYA 3LC7O 2XXAB 2CXSA 2EX0A 5CLQA 3FKJA 1NVBA 4YROA 4GBED 2NP6A 2VJOA 4G4GA 3RFUA 3X1XA 2A94A 3FSJX 3A6EA 2C96A 3NJ4A 2RGNA 1VJ5A 4IDFA 3JQAA 1OA0A 1C7EA 3ZU6A 3QPUA 1YSCA 3M89A 1QVWA 2WB4A 4MUBA 5YASA 2XOKD 3OZFA 1B6TA 2F48A 4UMFA 4W8GA 4LV5B 1GU1A 1ZCAA 1JIVA 3ZCTA 1MUUA 2P2ZA 2QGZA 1YA8A 5T3YA 2IPNA 1VCIA 3CYFA 3JRNA 2QN1A 3OM0A 5C3UA 4A6XA 3UT6A 3WGUA 2D7DA 2WWHA 1FDWA 2ONZA 4DYVA 1VP3A 2I1WA 3EC1A 3NHWA 4UOZA 1KI2A 3I2IA 1D04A 1MVLA 1L5GB 5JAPA 4U7JA 1L2TA 3LNTA 2FUCA <