3SCZA

Combining crystallographic, thermodynamic, and molecular dynamics studies of mycobacterium tuberculosis purine nucleoside phosphorylase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
263
structure length
263
Chain Sequence
PDPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining crystallographic, thermodynamic, and molecular dynamics studies of Mycobacterium tuberculosis purine nucleoside phosphorylase
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 78
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3sczA00
3NM6B 3UAWA 1U1GA 4M7WA 1Z33A 3NBQA 1SD2A 2A0WA 2AI3A 3KU4A 4F2PA 5B7PA 2A8YA 2I4TA 1ULBA 4M1EA 1PBNA 4U2KA 4L5YA 3UAVA 4DA7A 4YMLA 2OXFA 3FB1A 4OEHA 1SQ6A 3TL6A 3ONVA 4YO8A 5K1ZA 1Z37A 3EUFA 2QPLA 1M73E 1RFGE 4GKAA 3KVVA 5CCDA 4L6IA 5CCEA 1OV6A 1YR3A 1JDSA 5EUBA 1U1EA 4DAOA 2XRFA 3LBAA 1Z34A 3K8QA 3DPSA 4NSNA 3T94A 4QASA 1CG6A 1K9SA 4IP0A 1PR1A 1T0UA 1PR6A 2Q7OE 1QE5A 3OCCA 4QARA 4R2WA 5CXQA 1ODIA 1CB0A 5IFKA 3E9ZA 3FWPA 3LA8A 1RXSA 4DABA 1RCTE 3NM5A 1ODJA 4WKNA 4R31A 4OGKA 4L5AA 1PWYE 4TYMA 1VMKA 3KVYA 4D9HA 1SD1A 4GLJA 5DK6A 2A0XA 4BMXA 1YBFA 5EFOA 1ZL2A 2QTTA 5F7XA 3E9RA 4DA6A 1G2OA 4EARA 3EEIA 1T8YA 2AI1A 1RXUA 4DANA 1A9PA 3DDOA 3BGSA 4GLFA 2I8AA 1JPVA 1PR2A 1JDVA 1V48A 5B7GA 1A9SA 1V2HE 1Z5PA 2PGAA 3ODGA 3E0QA 4DAEA 1Z39A 5CXSA 1U1FA 1JE1A 4QAQA 1T8SA 1VFNA 1ZOSA 4DARA 3DP9A 3KUKA 2OC4A 2OC9A 4ECEA 5F7OA 1C3XA 5F77A 1JDUA 1Z36A 4JOSA 4TS3A 1OTXA 3INYA 3UAZA 2IQ5A 3OF3A 4FFSA 1JP7A 4F2WA 3SCZA 4BMZA 3UT6A 5B7QA 1RR6A 1PW7A 1NC1A 4OF4A 4WKCA 3FUCA 1ULAA 3UAYA 1N3IA 1PF7E 4TTIA 1Q1GA 1ODKA 2B94A 3F8WA 2HRDA 2HWUA 3LGSA 1T8RA 1T8WA 4MCHA 5I3CA 4WKBA 3FNQA 1V4NA 4BN0A 1RXCA 1FXUA 1YRYE 1Z5NA 2BSXA 4OGLA 3PNSA 4UC0A 1Y1QA 1TGYA 4WKPA 3OZEA 3OZBA 4JP5A 5C80A 2RJ3A 3GB9A 4QEZA 1K3FA 1PKEA 2QDKA 1JDZA 4G8JA 1A9OA 3K8OE 3UAXA 5JPCA 5EPUA 4F3CA 4GMHA 2OECA 3U40A 1Y1SA 3GGSA 5F78A 4NY1A 1RYZA 4TXLA 1LX7A 4PR3A 3C74A 4H1TA 3OOHA 1TCVA 1YQQA 1U1DA 2AI2A 1OVGA 1PR0A 4D8YA 1Z35A 3EUEA 1A9RA 1LV8A 4TXMA 1PR4A 3OZDA 1TGVA 2H8GA 1LVUA 4X24A 4TXJA 2A0YA 4E1VA 4OY3A 3OZCA 4EB8A 3QPBA 3NM4A 4YNBA 2HSWA 1YQUA 4LDNA 3BSFA 1B8NA 4QFBA 3KVRA 3KHSA 5ETJA 1B8OA 1V41E 5F7JA 4BMYA 4MCIA 1I80A 1VHWA 4TXHA 1A9TA 1JDTA 4JWTA 1Y6RA 3ENZA 4WKOA 3FAZA 2GUWA 1NW4A 1SJ9A 5B7NA 1RSZA 4D8VA 4LZWA 3D1VA 3OPVA 4DA0A 2ON6A 3EMVA 5KB3A 4QATA 5F7ZA 4OJTA 4DA8A 4YJKA 3MMSA 5F76A 3BJEA 1PK9A 3PHBE 4G41A 4NS1A 3O4VA 1A9QA 4LNAA 1NC3A 1ODLA 1V3QE 1JE0A 1Y6QA 4TTAA 1A69A 3P0FA 4F3KA 3MB8A 1TCUA 1PR5A 4R2XA 1ECPA 1WTAA 5F73A 2P4SA 4F1WA 1Y1RA 5CYFA 3PHCA 1RXYA 2QSUA 1Z38A 2AC7A 1XE3A 4KN5A 4LKRA 1V45E 1OU4A 4TTJA 1Z5OA 3PNPA 1JYSA 2HN9A 1VHJA 3DF9A 3O6VA 1Y1TA 4LNHA 1U1CA 4L0MA 5FAKA 4MARA 2ISCA 4I2VA 4G89A 2QTGA 1TD1A 1K27A 4P54A 5IU6A 4TXNA 4K6OA 5CYGA 3P0EA 3OOEA 3FOWA 3BL6A 1OUMA 4PNPA 3IEXA 4M3NA 4RJ2A 3IOMA 3DJFA 1OTYA 4TS9A 4D8XA 1PK7A 4L5CA 4D98A 1RT9A
chains in the Genus database with same CATH superfamily
2ORED 3QUCA 1WAMA 5HIMA 4F9GA 2C5HA 4GKBA 3W4JA 4D6XA 2V54A 3C70A 4Q4AA 1T9BA 3CG4A 4TMVA 1BN7A 1YD7A 4GQBA 3F3SA 3F47A 3II6X 2Z1NA 1Q16A 3GL9A 4TSFD 2FN3A 2O9JA 1L5HB 1NI5A 2WFMA 3HDVA 1GKUB 1W0JD 4PAOA 3JV7A 2BD0A 3CH7A 4KQ2A 1CYEA 3KUCA 2DUNA 4B34A 1NRXA 3QU9A 2IYEA 4MVJA 4Q1BA 4XFDA 1ACJA 4CLRA 4DB4A 3SU8A 8AT1A 5AW5A 4MTLA 4KQ6A 1NUSA 2JEOA 3HN2A 5G4LA 5HCNA 3UYLA 4BFVA 1IVSA 3SS9X 3TI9A 2H6EA 5EJ2A 4P58A 4HVAA 3K72B 4JC8A 1W85A 2CFOA 4EJSC 1II8A 1DBIA 2JL1A 2HLNA 5WRFA 2C83A 4OV6B 3HQ4O 1WBBA 2YRWA 3HN6A 4U3JB 1VSVA 1QRRA 3KVVA 4L6IA 3F2VA 5G0TA 3AETA 4J7XA 4UUOA 5CCEA 721PA 3QPAA 3PNLA 3VNQA 2CBZA 3CUKA 3LHIA 4CL8A 1RI3A 4JU9A 4N40A 4F8JA 3RFXA 4EHDA 1RPJA 2I78A 4NBKA 3WWZA 5BQ5A 2K7FA 1HETA 1EFRD 2ZJZA 4H4EA 4DE5A 4J7AA 4GP6A 4RKQA 3I61A 1EK5A 3N5KA 3WHLA 1NYLA 1TO6A 2R00C 2A9OA 2HIAA 1WSBA 2GB4A 4WLOA 5HHTA 2FOLA 1COZA 5C3MA 1OB2A 3TTVA 4CTOA 1G5FA 1BJTA 1NIPA 1QFMA 3MK31 3NBFA 2LW7A 5JH7B 3SJBA 5IC4A 2E87A 1PFKA 3L7BA 3VZCA 1Q14A 1XTIA 1K0UA 4PX3A 3PUZA 4WN9A 3IS3A 1CR0A 3WA7A 2IS6A 1IXSB 4IIJB 3HP4A 1DTSA 2R8YA 3B52X 1SC6A 2MHCA 5DDIP 3WMEA 5JANA 4IJ5A 4X93A 1TW3A 2FLWA 3VPHA 4FYYA 2G09A 2V3WA 3RS7A 3E84A 5JXWA 1YUNA 1WP9A 3I4LA 3GT3A 3I9LA 3N7TA 4K2HA 2YQZA 3AEQA 3VR0A 3SVTA 5HILA 3A3YA 4NARA 4TQ9A 2C3YA 3FFAA 3F5QA 1UFQA 5JHHB 3HH8A 3LNTA 2F3RA 2B83A 1Z26A 2GVNA 2PEYA 1XPJA 3FOBA 4RBNA 3TCNA 4CLOA 1XRRA 1DKPA 1XMIA 1HF3A 1Z47A 4NBWA 4A0GA 4DLRA 1W59A 1N9ZA 3NUGA 3RS8A 4C22A 4RPHA 3NHFA 3V2HA 1XKXA 1ADCA 1O03A 3CURA 3QEBZ 2NNWB 1OGJA 3HVKA 5KO2A 2IEZA 2C7RA 10MHA 2ZULA 2F6RA 4IHJB 5GGXA 4ZA2A 2REOA 4R2HA 3TLAA 1IN5A 4GQIA 1SVKA 1Z22A 3E9RA 1PJZA 5IVIA 4EEXA 1NQTA 4KWHA 1J22A 1VCIA 1YZYA 4DQLA 1EFAA 1RZVA 2P2YA 5DHSA 4YMIA 4ZO6A 1F3LA 1X2BA 3CF2A 1U3WA 4BWGA 5J4KA 3O3MB 4WJZA 4WW0A 1OBOA 1DOZA 3DCYA 2FR8A 2J9XB 1JDVA 1V48A 3WLNA 3PICA 4D0GA 2O8DA 1F8GA 2YWEA 3RH0A 3R8CA 3WO0A 1WKVA 1MUUA 2FG6C 2ICAA 3G9XA 4D4KA 4L5BA 4MS3B 3E0QA 4PYLA 4I4TF 1XZGA 5CXSA 1ISMA 1JJ7A 5JAIA 1MJFA 3D2CA 2HF8A 2DWPA 4HAIA 3RYIB 4F91B 1JYEA 5BWBA 3PQ4A 1HYBA 1ZI8A 2VP0A 3BGDA 5THKA 3FG9A 4G2NA 4INAA 3ID6C 1Q7EA 1TM2A 3BD7A 3LT1A 3VV3A 4C3VA 3IUPA 1NOJA 1IDN1 4F96A 1EK0A 3DZJA 3P2EA 5B58C 4OYHA 2Z04A 2J5BA 2ORVA 1YGPA 3F98A 1F2UB 2BDUA 3GP3A 4CDRA 4PPQA 5JLJA 1CZUA 4TS3A 3GPIA 5IC6A 3DZHA 4Z0HO 3S2SA 3SJCA 3T9AA 3UFBA 1VE6A 3W4KA 3IBCA 3D0OA 1LQTA 1C3EA 3EHDA 4P80A 2ODPA 1JHXA 1GQ2A 1EWYA 1P1HA 5HBRA 1V3UA 1WCIA 3F8TA 4ZIRB 4CM5A 4MNTA 2MSEB 4ZEWA 1NAIA 2FJ0A 1ZJJA 5P8WA 3QPCA 2ZS8A 1J8MF 1I6LA 1WEKA 3R5TA 1X7GA 4ZQGA 3WRYA 1IB0A 2DVMA 3S1LA 1PUXA 3IV9A 3TXYA 3DEFA 4BMZA 4CR6A 1RQ7A 1OFIA 3AY6A 2JIOA 2P5UA 2EW8A 4KQCA 3KR0A 4N12A 2C95A 3UT6A 1X94A 5BRAA 2VC2B 5BUCA 3IT3A 3G9TA 2I1VB 1Y7PA 3CUEF 4ZVTA 4RACA 4K6MA 4KX5A 4JZKA 3KU1A 4ZCPA 4CQLB 2EBFX 4S3MA 2QORA 3T5CA 4WKCA 3R1IA 1AKRA 2ZWPA 3AR8A 3EXIB 5ALWA 1Z28A 3MOSA 1Y89A 4FW8A 5DKFA 4IIXA 3T7CA 1G5QA 4DRXA 4C04A 1SHKA 1ZR2A 4FE4A 1H0HA 1MLDA 3ZZ1A 2WFLB 2AMVA 2UYYA 2PUFA 1T8RA 4UUPA 4LTMA 4ED9A 1ZGJA 4EUSA 1G41A 1ZXLA 4RJTA 2AS0A 2HK6A 1DXYA 3C43A 4TL9A 3MNFA 4XQCA 1FP7A 1ILEA 4REQA 4ZQIA 1RBYA 1JLMA 5HUJA 4QYTA 3TIVA 4BB6A 2AQKA 3CN9A 1CF4A 4PRLA 2REQA 1ICIA 3DMTA 2BRUA 1LGYA 2A67A 1TK3A 4A6DA 3E58A 4MB0A 1MD9A 4ZFNA 2J48A 4EYOA 3GOHA 3L92A 1KO5A 1SBYA 2AFVA 2I2AA 3O1JC 4YK7A 1L1QA 5ICFA 1T1SA 5J9FA 1SXQA 1GV1A 3R8XA 4NK5A 3AUTA 3EGDA 4WVFA 3UG6A 4WJLA 5EKXA 1E8DA 2IWRA 3W5SA 4N3AA 1Q2XA 5EZ6B 3AILA 3JY6A 4ZCQA 5JSYA 3ZDDA 3KQYA 1CRQA 4Q37A 4ZZ2A 1X7XB 3ITEA 3QUBA 4FR2A 4MLZA 3GRKA 3N0VA 4HXEB 3EFOA 2OZKA 2XDQB 4MHSA 5BXYA 3P9RA 1CUIA 3BXPA 3IKLA 5BNFA 4E6PA 1UP4A 3VR4D 5AVWA 2X8WA 3THYB 5KHLB 4LZNA 3R24A 2A9RA 3HA5A 5BYJA 4V0NA 1TO1E 3UK0A 4LF9B 5A3SA 4UTXA 4CM9D 4HNRA 2WVAA 1V8OA 5JJKA 3WL7A 2ZWVA 4OHOA 3TRKA 4YT5A 2ZUVA 4ZCRA 4PYQA 5AO9A 3IMFA 1A9OA 2ZJAA 1DJOA 2AOUA 5FRDA 3CX8A 2PFSA 3FSJX 1NG9A 4ALMA 5K99A 3EIEA 2W2QA 4GMHA 2VNAA 2YV5A 3LCRA 1QK5A 4PO9A 2FMKA 3QHQA 1BQ4A 4HY3A 2VHXA 3DDCA 3ODPA 1N75A 5ALMA 4DYVA 3TN7A 1TRKA 3LT5A 3KQNA 2WU1A 4XEUA 1PUJA 5TY0A 3T9CA 1M2KA 1MAAA 1NFQA 1QPBA 5FI1B 3OPYI 4MRVA 3MAAC 3NH6A 5T57A 5BN3A 2ZE6A 4ZGGA 4KPYA 2FFJA 4PG5A 4IV5A 1XROA 4HDQB 4LXTA 3ZLTA 4G0MA 2QTBA 1IJEA 3KUUA 3HCWA 5GY7A 4PFQA 3EUEA 3ITNA 2C29D 1K3TA 3A6LA 4UMVA 7MHTA 1E5XA 1EUCB 5K6AC 3E8XA 4QJ3A 3T3GA 1JFTA 2AHRA 3E2IA 2H8GA 1RPZA 4DVJA 1U0NA 3DL7A 2NUTA 2VYND 2W9XA 4WQMA 5KX5A 2BZ0A 2ZAIA 4J91A 3QJYA 5KYYA 3U19A 1O89A 2GM9A 2JATA 3CA8A 3PXXA 4JJ4A 3DH0A 3INTA 2BMEA 1FDSA 5ILOA 4W5HA 3VPXA 4E1VA 4ND1A 2JZCA 1E3QA 4C4TA 1SMKA 3P9CA 5DBEX 4EB8A 4U7TB 5H70A 3KAJA 3C3JA 3HWWA 1FNDA 4IO0A 2D1TA 4FCCA 5AW3A 1UEIA 4RPJA 1UBHS 1DMRA 2PKYX 4KC0A 2IPOA 4DM4A 1E5DA 4F7DA 2P75A 2X2PA 1ONSA 1TYDE 2VK2A 1IQ0A 3FUVA 4MUHA 5CX1B 2Y71A 5JSUA 4F56A 2GEKA 1N2HA 1Q3KA 3J7TA 3OFVA 4Q4JA 1ST2A 3ZNNA 1FQWA 1V41E 4YC7A 2QRZA 3T54A 5BN4B 2F2TA 4S1TA 4DXDA 3WLLA 3OZAA 2Z08A 3QMMA 1ULUA 1MC8A 2E5FA 2WWFA 4D7AA 1NMZA 2Q0XA 2ZUDA 3BE5A 1O5TA 2KPOA 2ZBPA 3GJ6A 3UMCA 3V8MA 5AW0A 1Z5GA 4FC7A 1FXWA 1QIIA 4CIVA 4I5GA 3C8ZA 2O2CA 4NC9A 2LIPA 1SKUA 2Z4TA 2IXEA 3CM0A 1HFEL 3WKDA 1J8VA 5IMBA 3IBYA 2QIOA 4UZFA 2ECKA 5JXHA 2A0UA 3D31A 3EW7A 3IIJA 4ZVMA 3DOEA 4RGBA 1UODA 3B7GA 4DNFA 4F8YA 4OX9B 1PQ4A 4LJ9A 2DRIA 3GGCA 2VRCA 4LMBA 2GHRA 1HG0A 1XJ0A 3NKLA 2JH9A 3PDUA 4NWIA 2A59A 4QTXA 3LPDA 3EMVA 4K87A 1TLFA 3EVDA 4CM6A 1TAHA 2HOQA 1LJUA 1TJNA 1VGQA 3O93A 3ICOA 4L4UA 3UATA 4DDVA 2ONYA 4FFNA 4KE6A 2QK4A 4YWHA 1IK4A 5F5LA 4BB0A 2NXNA 5JAMA 5FOWA 5LZ5A 1E2PA 1U0HC 4IXWA 5LQCA 1QFYA 3A1SA 3D3EA 3A7EA 3TW0A 1V43A 2W70A 5U9CA 4HMPA 1JFLA 2GJKA 4X92A 2JJ2D 1BO6A 3H87A 3N8KA 2XNCA 3QVOA 4O4IA 1G59A 4ARIA 1MO2A 1V2GA 4J3NA 1EB8A 4UQOA 4V1CA 3VX4A 3HXMA 1E32A 1KYXA 2JLWA 4IEIA 4PSCA 2B5WA 2JRCA 5CBPA 4E5SA 4G65A 1DO0A 8ADHA 4Z9FA 1QFJA 3RIXA 2AZ4A 4C0SA 3EZLA 4W63A 5K0SA 4I55F 1B0UA 4Q9NA 4MIKA 4DLSA 2WIFA 2WU3A 3QE2A 1MEJA 1JIJA 1PHRA 3ISJA 4UNRA 4BNYA 5B6IA 1UBRS 1JMYA 4MV5A 4AMBA 3MB8A 3PPVA 5GINE 4XFKA 4LPKA 1HLFA 2ZVQX 2PPVA 3C7TA 1J99A 4NBSA 3NHSA 5CK5A 3ET4A 3DMHA 2EP8A 1G55A 2J4DA 5ANRB 3CH5A 4G6ZA 1TEHA 2BGKA 4HFMA 5G3ZA 3RC2A 2BCGY 4X85A 4DIEA 1DJMA 4E51A 1SKYB 1YI1A 4H9GA 1EUYA 4R3WA 3G5LA 4NOJA 3A9VA 3BOSA 3TOXA 5F7XA 4IUDS 5KQSA 2YZ2A 3FPHA 3NVKI 5M5BA 4F1WA 4AECA 4O2BB 2FPKA 1YC2A 3ULKA 2ZTHA 4AT1A 1JSCA 2VP6A 5GVRA 1C3JA 3UM9A 3MT0A 4CKCB 2WIAA 3M5DA 3P5SA 4BX9A 4CQJA 2VAXA 2GHTA 2YCLA 1E6LA 3A05A 2NVOA 3PKJA 4BHTA 2A1TR 2AK2A 2A9FA 2AX3A 3DBHA 4O5OA 3NOQA 3F3YA 3QZUA 4LG1A 1U0LA 4C4RA 1QCZA 4XRRA 1I1HA 4ZYLA 4H16A 1M10A 5FEUA 3IUBA 1KJJA 1KIFA 2EJCA 4L78A 3B9PA 3R09A 4RIEA 1Q1NA 1YDFA 3IKVA 2ZYIA 4XQGA 5JCJA 2FK8A 4JLKA 4EHAA 5D3ZA 1F8FA 2A7XA 4LBVA 2QW0X 1FF9A 1QF7A 1JNXX 1TCCA 3A1WA 4NX2A 4Q1VA 2JGRA 4F11A 1ONOA 1E5VA 5IVKA 1TE2A 1S3IA 3GRYA 2RGNC 4BFSA 1B00A 1PZGA 4HB0A 1AH2A 3A2MA 3O4FA 1K2WA 4FCTA 3R23A 4OHFA 4PXYA 4CM4A 3H5NA 1ZD9A 4LDQA 4AZ3A 3YASA 1D3AA 1TD1A 5B5SA 4HWPA 5JISA 1BXGB 5JD4A 4R1MA 1GAJA 2ZJ2A 1LDGA 2NU9A 4PTLA 4XWAA 4ZOLB 1RLTA 4B4OA 2QMHA 3E7XA 3K20A 4EX6A 2QGZA 5ERYA 3KQLA 3A36A 5CDFA 3ZHTA 4IWYA 2XD4A 2JGKA 1IXKA 1NJ2A 2O1WA 2PG3A 3B9QA 2R66A 4IV8A 3SK0A 5GGYA 4AKTA 3AIOA 1SUSA 3KR9A 1T2UA 2Y68A 4IQ8A 1XQYA 5FYDA 3R3YA 1LRKA 2FW8A 2YZMA 4FYPA 1KARA 3K3PA 4TS9A 1ADFA 2WPDD 2FPUA 2GZ3A 3FDZA 3HV2A 4WI1A 3TQIA 1AXGA 1QH1A 3NASA 1CTQA 4D98A 2PX4A 2WF8A 3L5OA 3RLFA 5TVGA 3KT0A 1AUOA 1NJ1A 1XJ5A 4FMBB 4S1NA 4Q9HA 3GGDA 3R0VA 3PFFA 4WCFA 3GXBA 1IN8A 3FFBA 3FMVA 4QDZA 5K20A 1XTPA 3CBQA 1LTQA 2A84A 1YBHA 2HK9A 3UMJA 3OI7A 1D1SA 1JHOA 2PBLA 2XMCA 2AJBA 3A10A 3BWBA 4RK1A 2ZB2A 3ZNQA 4ENRA 4UM5A 1ZUHA 2GN2A 4O59O 5IWCA 2LNDA 3IAM1 2C7OA 3VR5D 1M7HA 1I13A 1QVRA 2AE1A 3H4MA 4GGMX 5BR4A 2BHNA 5LA6B 2FUCA 5JC1A 3EMBA 3ONVA 1E2EA 2XA9A 3WTBA 3BCUA 4UMFA 4TQUS 4K3UA 1EWQA 4QBTA 3VPBA 3DMTC 4QE3A 5BP7A 4JLWA 2HREA 3K9FC 2V45A 3RPEA 1YBAA 2X77A 1E94E 1V1RB 1JDSA 1KFBB 2B61A 3DAPA 1AGNA 1Q1AA 7REQA 1WXFA 3UPTA 1X3SA 1N2XA 3TW6A 3JQAB 4RD3A 3N2GA 1LLCA 2IEGA 2ZIFA 1E2DA 4N3BA 1I5OA 3GFRA 3S7ZA 3WMRA 3BFPA 1GEEA 1WXIA 1XVTA 2Q9BA 4MUNA 4RQTA 2E82A 3GYBA 3FKQA 4DKJA 3LZDA 4P4TA 1OPRA 2J5XA 4JQOA 2IV7A 4TKUA 1YC5A 2X0FA 1CY0A 1P5HA 1CSEE 1Z12A 4UHKA 1X0VA 4CGZA 4XPIB 1AF4A 4E31A 3GJSA 3OU2A 3CONA 5YASA 4JJIA 1QGAA 4A8PA 4AN1A 4WBNA 1GTRA 2HSEA 1DRUA 2WIDA 3N2KB 4PG4A 2LZ0A 5DX0A 5B1HA 1RYFA 2J32A 2PFKA 2RCYA 2ZWMA 3CCFA 2J3EA 4PO8A 4Y2YA 5DLQC 5SICE 3S1AB 2A5JA 1XRQA 3NANA 4ZVLA 5TPZA 5C7YA 2WFAA 1N0VC 2R44A 3AUAA 5ITZA 1HNXB 1KRXA 1G291 3L41A 4Y2JA 2VHWA 3LCMA 4TV9F 4BCBA 4AY2A 3CX3A 3N3BC 4EX7A 3LBIA 3NUQA 1IVNA 4DADA 1FSZA 3B7WA 5DO9A 4HVCA 4OGKA 2TSYB 1CUFA 3GW8A 3O26A 3G2JA 2FSFA 4TT3D 3R74A 2HUPA 4NZPA 3VYUB 5IBCA 1Q7BA 2KM1A 1XTKA 2F1IA 3MTAA 4MEBA 3VKHA 1A5SB 1Y8QB 3RV3A 1PTJC 5LN1A 1JLSA 3C3XA 2OK8A 1N1DA 4CJXA 4EL0A 1JSZA 4E70A 1D8TA 5DK4A 2C3PA 4YV7A 2NXEA 3UJCA 1PZFA 3QLVC 4DLPA 6LDHA 4X8LA 2R751 1FRZA 1KJWA 4HMOA 5K7SA 5KX5F 5FPHA 3IT0A 4TLMB 4BRUA 2Q2NA 5HIKA 5KC8A 1BGVA 5GOTA 5K01A 2CUNA 4D3ZA 3RIYA 1JJIA 2AKYA 3ESAA 1XDDA 1CUGA 3GJ0A 1G2OA 3M34A 4PICA 3ZN2A 5TIIA 3NDIA 2GYYA 4LZPA 5REQB 1ZBQA 3AIIA 2OCDA 4BMPB 4C0LA 2FPOA 4IAOA 1EFVA 1X1AA 2KS6A 1YZLA 2XDYA 3DT9A 3OOJA 4HX2A 3VR2D 3W78A 2V0NA 1XPUA 3ZCRA 5AI4A 1KNXA 3GLTA 1R6AA 4H3VA 1RC8A 1NJSA 2VJDA 1EUDA 3TMKA 4D3FA 5BNZA 3AESA 1ZGGA 5B7GA 2CYBA 1QLWA 1N5OX 2G1JA 4KXWA 5E7JA 4YLYA 2GVZC 1W87A 1VIAA 2BELA 3P2MA 1WX1A 1GT91 4U1RA 5AVRA 2P9BA 4EMTA 1B6SA 3L1HA 5JVDB 2F48A 2PMKA 3ZCPA 4DAEA 2HA7A 3FTNA 4DLLA 1ESDA 2QN6A 2X9VA 1GGEA 3VSBA 3G1TA 1WA5A 1SFRA 1ZGCA 4Y8VA 5CFNA 3L43A 3P4UA 4JOBA 3EXFB 3QBDA 3BIOA 2X6RA 1XLVA 2CHGA 3U4QA 1E2GA 2IDMA 4K9DA 4MRMB 1C3XA 2GCPA 3EZ7A 4YCCA 5M29A 4CMEA 1NY6A 2HA5A 2ZBQA 4Y6LA 5LJLA 2JHAA 2WQ7A 4OBXA 5HKKD 5ESXA 2BFMA 1T9GS 3FNHA 3NIBA 4P38A 1TU3A 1B6TA 3TEFA 2B8EA 3SICE 2EKDA 4AJIA 3I6ZA 2IY8A 4ZAFA 3SXUB 3L01A 4PR0A 5ESWA 2INGX 4NEHB 2FRDC 2VNIA 2MU1A 2VTEA 2XAUA 4C88A 2WINI 3ZLJA 5HNKA 3KSZO 2CF5A 2L42A 2VVTA 3G2KA 2PL3A 1HT2E 1V5FA 4UJ5A 1NVVR 4O33A 3ROFA 2B1JA 1ULZA 2GHIA 1CXZA 2AF4C 1SBQA 4UE6A 5F2NA 2FWMX 3TEMA 2IUYA 3U37A 3R41A 2A86A 3U4HA 1UK8A 2BYTA 4JMLA 1OLUA 3EOZA 3IPXA 4DIFA 2HC9A 2WTXA 4FNAA 1BW9B 1P2SA 1Z82A 1G2PA 4Q82A 3UJ8A 4GOOD 5FX2A 1NRIA 1X8KA 4LOIA 1GKIA 2NYAA 3U3KA 3SZMA 3WE7A 5M7EA 5FWYA 1EESA 1YVUA 4YRKA 1RACA 1VGVA 1Q7CA 1X7YA 2HSGA 3IA2A 2EFHB 1CB7A 1YQGA 2H5JA 4I19A 3RUDA 3B1VA 1Y48E 1A3CA 2BGMA 3DHWC 1XD2B 4YHHB 1MW8X 3FCUB 3MJCA 1WG8A 3JWIA 2PJRA 2IKQA 3QWFA 5T41A 5AIBA 3JQEA 1OLOA 1Q1GA 1FUIA 4GH5A 1QZZA 1HSOA 1D1PA 1P31A 2CJFA 2VSXA 1AN9A 1ZI6A 1CUBA 5IYZF 5J4LA 5AKXA 2XTAA 1XXHE 2OBBA 2RGCA 1EWKA 1T8WA 2XUKA 3AYZB 3G2PA 4ILKA 4S1OA 4MCHA 3ZK7A 3KDSE 3NNSA 2AQIA 4IDHA 1AQJA 4Z0TA 1LW6E 4INZA 2I29A 2VQSA 3FPEA 3C5EA 5EXPA 3H6HA 1H6BA 4IVPA 2GLUA 3PI7A 1TEVA 4MRSA 1NTOA 3D6UA 4GC9A 4H7KA 4YAUA 4DV6B 1RRMA 2VNKA 2O23A 3BMQB 4X60A 1RI5A 4TWAA 1RXCA 5AVOA 3OFND 4EO4A 2PRJA 3F0TA 2VYNA 3QELA 4N76A 1YFJA 3U3RA 3TIIA 5FLYA 3NPMA 2FPSA 4FWBA 5HR5A 1PVDA 5IM4A 1QKIA 1TDJA 4WZBE 4N7RA 3TOCA 4FKMA 5KTOA 1A8UA 1O6ZA 1TGYA 1T0PA 5BN3B 3G7UA 1TAQA 4OHCA 3OZBA 3U7IA 5CDFE 1PEYA 3WIBA 4CKBA 3H8JA 2PGXA 4ZQEA 2B4YA 3KHTA 5C1DA 3QNMA 2IC5A 4QDUA 4QUKA 3DT6A 3NV9A 3L02A 3O8QB 4WLVA 5AKLA 3LQFA 1YB2A 2EHDA 1RZRD 4I50A 3E3NA 5CHYA 5KWVA 3IAM6 1SBTA 1NBIA 2QDKA 3OQIB 1CLUA 4O6VA 3SY8A 3N2KA 4LF6B 3WGMA 1T1GA 3EUWA 1O97D 4X91A 2HUNA 3CPHA 3KK0A 3RTGA 1FMJA 3R9IA 3W8DA 4BUCA 2FUEA 5BT9A 1SN7A 4OB8A 4BUZA 2D13A 3GGJA 3ZCTA 4CLOB 3FF1A 5A0FA 3NTOA 1D2GA 5AICA 2ATXA 3H3XA 1KSGA 3V4OA 3EXEA 2FQXA 3GARA 4U7WA 3Q7IA 1GD1O 1Q0RA 3EPKA 4ZO8A 3V4VB 2HT1A 1BHJA 3SOZA 3KL4A 4GLLA 3OJFA 4CBVA 3C0KA 1BHQ1 1HTTA 2EGHA 4CF5A 1HDYA 3WXMA 2QRUA 4RIGA 3DFZA 4WRRA 1GSIA 3LZ6A 5E6SA 1DDGA 4CGYA 3DFFA 2NYUA 4NCIA 5B58T 1TA0A 3SXJA 1JHPA 1TQDA 2G6BA 2XNDD 1U7HA 2BZSA 3HJUA 4XOUA 3S6JA 4PONA 3T7JA 1KJYA 2WJIA 1R0XA 4PGFA 5HM8A 2X3YA 2CCJA 4UUBA 1G6KA 5JNTA 2VA8A 4DSZA 4FLFA 3JTMA 3SNHA 1T4MA 3Q3VA 4HF7A 4G4SO 4LTNA 3L49A 3NETA 4D99A 2AJCA 1E9AA 2PL1A 2Q41A 1KQNA 3ZV3A 2WU8A 2NUBA 2QYOA 3EFHA 3N3AC 3S44A 4I4TB 1XRLA 3AFNA 3T5AA 3ZWQA 5C81A 4ETMA 1UK6A 4JJGA 4OH7A 1JEQA 5JQWA 3B1FA 1AO0A 3X1XA 5ITVA 1SA0A 2D2VA 3SSNA 3DZBA 4D82A 1N2SA 4DILA 3NYQA 1VRVA 3ECCA 2WYWA 3NHUA 1G6HA 1OWPA 3PPWA 2X76A 4F45A 4IM7A 4D42A 3EEOA 2O5CA 5KTTA 4AJHA 3FJYA 2HSWA 1H8EA 4MVJD 5ELLA 4BWFB 1JIVA 1YB5A 2QLLA 2J6HA 4DIMA 3ZNOA 2X41A 1FP1D 2H63A 3CNNA 4ZVUA 1S2OA 1S5PA 2Y6VA 4Z6KA 2ZDQA 4I1SA 1BIFA 4D92A 2PSEA 3R0QA 4M0DA 4YAOA 1M8JA 3KSMA 3ACDA 3DYIA 3BBPA 3NHJA 1DG1G 4Z8XA 2ZI6A 3EARA 3EG9A 4BGUA 3BAZA 4HYTA 3R0ZA 1A9TA 3MPOA 3AKZA 4YS6A 3T38A 2IBTA 4B3MB 1RQNA 3GJXC 4WNAA 4DYHA 3VKUA 3L04A 5SZHB 5AI6A 3RUHA 3MWDA 1EXNA 1SIOA 1F0NA 2Q99A 4LYYA 2CC2A 1U9CA 5AMXA 4HNUA 3LT2A 1YKFA 3WJAA 5AVZA 1USWA 1SWWA 2W11A 1G3UA 3M4YA 1R9GA 3L0PA 4DDMA 4B2YA 1EE9A 3M1IA 1XHEA 4L08A 4DA0A 3IBGA 2AVDA 3V34A 3FGNA 2IXDA 4XFJA 3LDFA 1XCPA 3CRNA 4IDFA 4JC0A 3PNOA 1VTKA 5E3HA 5E8RA 4XYLA 5ED4A 2V1UA 4Y7CA 1QFZA 1YS1X 4OJTA 2J3IA 2EQ5A 2VBGA 3GCGA 5JJIA 4JS0A 1O0BA 1J5PA 1GKKA 2Q3JA 1E1CA 3SHVA 4C0WA 2G1AA 4RQUA 2IXAA 3X3HA 1RHQA 1IEXA 2W2KA 3EIXA 3L7JA 1DHRA 4CT5A 1D2HA 4EF4A 5LU9A 5CNIA 1CC1S 1CVLA 5IDXA 3DZIA 5A4IS 4L8FA 5DNEA 5K0TA 4FD2A 2AG0A 4YRLA 5CB4F 1NMSA 1SCQA 4MI6A 3MM4A 2YY7A 5SYMA 3L0BA 4F86A 6REQA 2WB2A 3Q1LA 4LNAA 2H7YA 2V0CA 1RAFA 3AERA 4NV0A 3DCNA 1OZ0A 4HPXB 3T5MA 4LV5B 3BRWD 3C45A 4TTAA 1U5BA 3HXOA 3DFIA 4M9ZA 4MYSA 1YV9A 4F3KA 1NWHA 4XRGA 3D0QA 4NE7A 3MGGA 1L4EA 1HZZC 4QT0A 4CCAA 5FLKA 1PWZA 4HUQB 3U0VA 2REXB 3PNBA 4C05A 1TCUA 5FNVA 1H65A 2CUZA 4HYEA 1NJGA 1EP9A 1YE3A 2HEIA 2ZJ5A 2IYVA 4FQ7A 2Y1LA 1Q20A 3RG8A 4GHWA 3VDXA 2O05A 1FJHA 1KE2A 3BMQA 2I6QA 2PYZA 1C9KA 3P2IA 1G64A 2FQ1A 2J0VA 3HVUA 2ZYVX 3LUHA 3NRCA 4ND7A 4PZUA 5DJ5A 4AZ0A 3A4MA 1XU9A 3CG0A 3DBRB 3GIWA 3HJRA 1AQNA 4D5GA 3N53A 1RHRA 2CLHB 3HYNA 2QB5A 1UZMA 2R25B 4QAJA 4RFSB 1L4HA 5FA5A 4AYTA 1V6SA 5I5GA 5AK4A 1MX9A 3UWSA 3QLUA 1JQAA 2WICA 5IT9A 1HLGA 3HU2A 4AYXA 3NI2A 2GAOA 1B8VA 4DLYA 2IW3A 1GSAA 4R9UC 4QUHA 5DYGA 3TKAA 4B31A 1G7CA 2E6KA 1YF3A 2GFQA 4FB4A 1JG3A 4JASB 1KGSA 1LZKA 3A70A 1QHIA 1ZOIA 2QMUA 1JYSA 3KNZA 1MX1A 2XSZA 1DWPA 1UAYA 4H7JA 1X80A 4NDAA 2YMLA 1JQKA 5BQOA 4FXOA 1VYHA 5CG1A 4O4IB 3UBMA 2OILA 4QG3A 3QBVA 3KXLA 4UXIA 1Y1TA 1LXCA 2WU0A 1U1CA 2PIAA 3L9WA 1VI5A 2X42A 1ZG3A 5DYTA 1XZIA 4MXDA 3H5WA 3L7IA 3LSYA 1FFXA 4LXQA 4R7ZA 3EDCA 4MEJA 1OB5A 2YFQA 1R6VA 3D2BA 1DJLA 3PFWO 1T13A 3IQWA 2V58A 3MWEA 2OV3A 4NU5A 5CW1A 1TW2A 1SG6A 3RTBA 1P7PA 3F6YA 2HX1A 2JKZA 4RH0A 2QT0A 4KMOA 3R7SA 3T0GA 3RIHA 2VJBA 5K0BA 2IE8A 1ZIPA 2JJMA 1R37A 2H2DA 3JVDA 1CV2A 3M89A 1NFRA 2C9OA 5EXSA 3GJ3A 4UULA 2ST1A 3AM3A 4EPYA 3N6VA 3CZPA 2WJAA 4RSRA 3B6ZA 3G85A 4AJPA 4JUAA 4FR0A 1JS1X 2GEVA 2QA5A 2A3NA 3IOCA 4NPCA 3A4NA 2I4LA 5FQNA 3UWDA 4BL5A 2FPXA 3GUYA 2GCOA 1RZRA 1Z45A 3UNXA 3HB5X 4O2BA 1XZEA 2P41A 5A6SA 5F3DA 3CRRA 4WXHA 3ZI7A 1Y4SA 3ZHBA 3JYQA 5JNVA 1E6WA 3VU0A 1WBJB 2QX7A 2PUDA 2O3SA 2EX4A 3MILA 4I46A 2OK7A 3BM5A 2CWWA 2DUUA 2XDWA 3FGPA 2ZRJA 1FDTA 1WOMA 2DQZA 2ZRAA 4OP1A 1CUJA 1G4AE 1HEUA 1FRQA 2WZCA 4BATA 3A6GA 4IS3A 4LJLA 4D56A 3QLTA 1NLUA 1T3TA 2WTNA 2OPHA 3RR2A 4UUMA 1N2OA 1ZGAA 4L9RA 1BGXT 1EXWA 2Z3VA 1XTZA 4LRYA 4MPTA 4X8HA 5JS7A 2VUUA 4URUR 5JD6A 5IAJA 2XZLA 4L07A 5K3DA 1CETA 5TGDA 2O2SA 1NVAA 4JEUA 2DTXA 1I1NA 2A8YA 4KIWA 5A4FS 1ORTA 2P4HX 5G0WA 2J08A 2YIJA 4RFLA 1EVKA 1U0JA 2ZRIA 4JQYA 4KNWA 4S35A 1PBNA 4BB9A 4F5DA 2PZKA 3RREA 2NW6A 3IXQA 3DHNA 3H75A 3L1UA 4J75A 5D5HA 1K63A 1HUQA 3K96A 4ZAWA 3UMFA 5H3CA 1JTFA 1DAPA 5IKEA 2PCJA 2I7CA 1D04A 2QTCA 4FJ1A 4MPJA 4ARZA 3EUFA 3LT0A 1EUZA 3U39A 4WUTA 4DBLC 4YUWA 2AFIA 3HLYA 2HPAA 1MN6A 2UYGA 3MYRA 3WS7A 5F23A 3MJVA 1OV6A 1QQ5A 1KYVA 2GN4A 2QRHA 1UWVA 2BKEA 1ACLA 1Y4ZA 5K8TA 4PLZA 1LPSA 5E9JA 5C1BA 4REQB 3CNLA 3NTVA 3OLZA 4J76A 4LNUB 2XRFA 4HAYA 4PHFA 4U7FA 1MC4A 2QLFA 4NFHA 3SSMA 4F60A 1KS9A 1R10A 2ZT8A 4ND2A 3MJTA 2WLTA 3O4GA 1G3QA 4PBTA 4BQPA 4Y2UA 2H1VA 3OTHA 1N9KA 4RIHA 4R0MA 1NQXA 4J07A 5G2OA 4ARUA 2BKVA 2ZG6A 6NULA 1TX4B 2CBGA 2QD2A 1QV6A 3D02A 3O74A 3C7CB 1JBKA 5EQJB 3WRXA 4M7OA 3B7PA 4IOJA 1DPFA 1E9BA 3L06A 4Q15A 4QULA 4RQAA 5FR2A 5C7IO 3EGCA 5IASA 1ZD4A 2KB0A 1NRJB 3X1JA 1P91A 4C01A 5UKDA 1QIGA 3STVA 3V8PA 4AVYA 2PUGA 1V0JA 4GRAA 4QDOA 5AW8A 1JVSA 5DBFA 3ED1A 4Y7DA 5DHPA 5AXDA 5H02A 2N1BA 1W30A 2W5UA 1RLUA 1RAGA 2IV3A 5IFKA 1NE2A 4G4JA 4BVFA 2HIMA 3EA4A 3OHMA 4XIIA 4C6RA 1BRTA 3CVXA 3OKFA 3M3DA 2JAUA 1YZ3A 3I42A 3LA8A 1XX6A 3ORQA 1ODJA 1Q19A 1E59A 2BR3A 2XYGA 1UKBA 4FSXA 4D0NA 1X7ZA 5DN6D 2R0QC 3AVVA 3RGGA 2QVZX 3AR5A 2XW6A 3L7AA 4YDQA 4N6OA 2P30A 2PT7A 2VSNA 4BX3A 4M87A 2EQAA 2Y93A 4KR3A 1O58A 4M55A 4URYR 3KWJA 3CS3A 3DD5A 4AMZA 4BPBA 1DEOA 4GLJA 1OI2A 1L5VA 1T5DX 3I9FA 3RS2A 4HD8A 1XZQA 3B1XA 3VR6A 1DAEA 2YASA 5LD2B 4V3BA 1Y9DA 2WM2A 3IE2A 1UC4B 3KHUA 1WRBA 3QVUA 2CLEB 4G0OA 5EFOA 2DPXA 4RULA 4BFWA 4JWKA 4G37A 3E05A 1BFKA 2AMFA 4LSMA 4O2AB 1U3FA 3NC1C 1SELA 1B7GO 3OE4A 3GFFA 3BWCA 4JGBA 1CYDA 4Y2TA 4OK5A 5IX8A 3CLSD 2OZLA 1NDHA 2P9FA 3DO8A 3Q7SA 5I4KA 1XELA 2UYHA 1PLLA 3BGSA 1I3MA 3MXTA 1W35A 2AX4A 2XTNA 4LDJA 4AXXA 1MR3F 4QHSA 4EJ0A 4V2UA 1Z25A 1K4MA 2H4WA 2OCYC 4LY3A 5DHQA 2IYOA 3J81A 3UAGA 1OX4A 1TU0A 2W98A 3OPYB 1Z5PA 4RJJA 3KTDA 5FTJA 1BYUA 5BMVB 4HLCA 3EXIA 3QENA 1P2GA 1VLMA 3UT5A 3ESDA 3EY9A 4A73A 3C4VA 1KO1A 1OLSB 3DTVB 5A9SA 1XTRA 5JHGB 5AK6A 1BEEA 1M6EX 3OJOA 4RZ3A 3FYUA 3AB3A 4GI2A 2YV3A 1RZUA 1U9IC 2QRPA 2WUEA 1IPEA 2ZS7A 3WHPA 4FM9A 1LK0A 1LQ2A 1TT5B 1VL0A 2E3JA 1VB5A 1Y5LA 2VP9A 1DFGA 3BD9A 3C8DA 4KQEA 4MRMA 3EVFA 4BU0A 4ZGBA 2XB9A 1M7BA 2P4UA 8OHMA 1YA4A 4ZN6A 4AZSA 2QUAA 3VM6A 4GR5A 4S05A 3AEUB 1XPRA 3CJTA 5BN4A 2I91A 2ANBA 3MGKA 5TPWA 3ZCSA 4DOMA 1W93A 2ZSJA 1NXOA 1RLMA 1YIDA 1KI7A 1MV8A 4JEHA 2GCGA 2WPNA 5ALPA 1KP2A 4B6GA 5LOVB 5KTPA 1XD2A 2ZIGA 2DFKB 3QVJA 3EEBA 2ROQA 4O1MA 5EYPB 2BM8A 2V98A 5CA0F 4NKRA 3DGFC 4B4WA 3FOEC 3QVGB 1RWKA 3I8OA 2Q0SA 1EFVB 1KZ9A 3BPSA 3LPCA 4MVJI 2JNWA 3CVOA 4RKEA 3R9XA 4R7GA 2AZDA 3Q11A 4Z2YA 4XUGB 4AWBA 2W6ZA 3UUWA 6PFKA 1K06A 2WHEA 1IYZA 4NH0A 4ZALA 2AOXA 3EIOA 4RD2A 1H8HA 4QU0A 1FP2A 1GG8A 3QLJA 1U2SA 1JH8A 1I4OA 5JTUA 5C51B 4CMCA 3RUIA 1PS0A 2F17A 3IELA 3SR0A 5JCOC 2ABWA 3COVA 3K16A 1YIAA 3Q8MA 1P7YA 1T5SA 3CT4A 1ULAA 5LLSA 4CKBB 5CDYA 5BW6B 1Z8FA 3K0BA 4QREA 2YOGA 3PFBA 3SHQA 1Q0HA 4XLTA 1ZGBA 4LUCA 4AMVA 1UOQA 2B36A 3ANMA 2OO5A 4P53A 2I3AA 1RQXA 4BNNA 2VYQA 4A5SA 5JQGA 3UG7A 4ENQA 1RI2A 4OXRA 3OCZA 5IVDA 5C0OE 1EVQA 3C3PA 3JYOA 5CLHA 4EUFA 4W9NC 3ZU6A 3FCYA 3DZ8A 1ENOA 2V6IA 3QNWA 4GYYA 1UM9B 4QBIA 3ZOKA 4ZVQA 2FPMA 4RAOA 1TA9A 2FSGA 5LP1A 1HYEA 5J47A 3PGA1 5EIOA 4KVGA 3O7MA 4RNCA 3HFSA 2JFQA 4R84A 4HDCA 4HEJA 1ABFA 1QHYA 1FYEA 2OCLA 4CCYB 5ES4B 3N2ZB 1Q7TA 5LYJA 3VJMA 2IUSA 1UBTS 5K8IA 5HX7A 4FYMA 1FRFS 4JLNA 3EDQA 4DEVA 2B4AA 4UCWA 3JVIA 1UJNA 1WXDA 2A6PA 3WJ1A 1V6CA 1A1VA 4ND5A 5JS1A 2RE8A 4KMRA 1P2UA 3AIMA 2I6UA 2BT4A 4OQXA 2R97A 3W6OA 3GEDA 5B3JA 3V2IA 3ZS8A 4AKIA 2JVIA 4Q47A 2C1EA 4XB1A 1GUAA 3PYLA 2WF5A 1SXJC 1YUBA 2JGMA 3JD1A 4R16A 5KMGB 3VR4A 4FFVA 3DW3X 4P3XA 4R1TA 2B30A 4HSEA 4CTMA 1PE0A 2R65A 3GBVA 5EP4A 1J7JA 1GITA 5JPCA 3V3TA 3ER8A 2GN8A 3M4XA 3TZ6A 4HDMB 4MEAA 4URXR 4MS1B 1GG9A 2RFLA 2SBTA 2YY5A 4K86A 1K9VF 2QD3A 4BVAA 3ISTA 4EG8A 3WGJA 1XSEA 4BLUA 1N7JA 5JUWA 2KLBA 3EZXA 5DPMA 3NHZA 3UGKA 4F04A 4YX9A 4TOIA 3M33A 2QU7A 3D4OA 5KIAA 2KSQA 4RENA 4S2EA 3RVOA 1Y34E 2Q4RA 2IFTA 5EIBD 3QFFA 3SS7X 1E1KA 2ZI4A 3OKPA 4NU0A 4QDJA 2BMWA 4IDNA 2GAJA 4W9RA 1TCVA 4F0JA 1ECFA 1AZSC 2FUKA 1U1DA 3DPUA 4HNTA 2X7HA 1H85A 4L4SA 1PD1A 1PR0A 1Z6PA 1J1ZA 1Q91A 3MGCA 1IY9A 3P2YA 4EHJA 2FWAA 3QFRA 2WZDA 3TNJA 3AL2A 3VOAA 4IWNA 4K0KB 5SY6A 3MQ4A 3SKYA 4KACA 4O08A 5EP2A 3OJXA 4J0CA 4DYDA 1UWLA 3L8CA 3VHXB 5KCZA 2C4WA 4FUQA 4C5CA 2QLMA 2YWBA 4Q34A 5MDHA 3ZEIA 2Q1TA 3OLVA 2A1UB 3V46A 4YGXB 4TYYA 2N0SA 4OFWA 4U9UA 3ONFA 3SJUA 4JP8A 4ERXA 1NSFA 4C21A 3TZLA 1EIWA 2QXUA 4OMCA 1A1SA 1NTRA 4TWIA 3HKDB 2MTBA 2CJPA 2WD7B 2PUTA 3K71B 2O4CA 2CW5A 4XYBA 2Z3ZA 4RA9A 2FWIA 3TEJA 2FSIA 2X40A 1A4UA 1FFEA 2HJHA 3P52A 3P0HA 5D3MA 3T5GA 3JVUA 3DG9A 2J8ZA 1RPNA 1ZN2A 4LRTB 4KLRA 2FSPA 1R5BA 2JIDA 3O2NA 1TZMA 2QGNA 3Q7TA 3QXGA 3HYTA 3LVBA 4PSUA 4DXAA 1S9HA 3FCEA 3H9UA 2XXBA 4YTEA 2WHRA 4HWOA 2V7VA 4TKMA 4ZHSA 2Q3MA 3QUQA 5A03A 3KALA 2E4UA 1DIHA 1CFZA 1Z0SA 4IIGA 1GTL1 3KVOA 3I1JA 1B26A 2VHCA 2WWRA 1M1YB 4LC1A 4U8GA 5AM2A 1V9LA 1GNLA 3GRUA 3HBMA 5ALLA 3B3AA 3GEBA 1WDLA 4ZZ0A 1BJKA 4QTTB 5ITSA 1UMKA 3IQFA 1NQUA 3ZHZA 1NA5A 3N8DA 3D8HA 3E4CA 1W5BA 3O83A 4CN8A 3QEAZ 4YHBA 4R9VA 4QTYA 3K70C 4FGWA 2FVXA 4KVAA 4WN3A 1E6EA 2GK7A 3DCIA 5PGMA 4D8VA 3IPCA 4EL5A 1ND5A 1BE0A 4E08A 4L02A 3EW9A 5IKXA 4OK6A 2QVCA 3NGMA 4R8KA 3V4ZA 3KZMA 4YAEA 1A7JA 1KYYA 4CQMA 4DA8A 2DOKA 5CB6A 4TT8A 2WMOB 5BYBA 4DMMA 5KPDA 3L4JA 3ADKA 2QNIA 1TJPB 1XN1A 3U7GA 2ZXUA 3FZQA 3NIGB 5B2EA 3QFTA 3KT3A 2J3KA 5JMWA 2RH4A 3IJ5A 1V9CA 3DNFA 4LJSA 4EHNA 1H4VB 1UFVA 1FEZA 1ZJ5A 1IUKA 3W6NA 4EFNA 2MSCB 3L7MA 2QP4A 2UYQA 3PUXA 1I3OA 4JCOA 1W4LA 2A5YB 4Q21A 4RWZA 1YMQA 1COWD 2R4UA 3F6BX 1A7AA 1M83A 1V3QE 1G60A 2GAAA 4IDEA 4DJJA 3WSWA 3RAEC 1OC2A 2WWVD 2KYRA 2A14A 2OV2A 3HHEA 4CDNA 1EE1A 4KV7A 4DMGA 4O4HF 3MERA 1CQWA 1KY3A 1NSYA 3E9MA 4B74A 2WWGA 4DJDC 3IAFA 2J9ZB 5BUZA 2W2PA 2JARA 4JLOA 3IP1A 1THZA 3JZFA 5HSGA 5DCYA 4HP8A 3ZD6A 4IDDA 4OIFA 1IE3A 3I1YA 3L1VA 4ROSA 3HCRA 4CI0B 4O4LF 2EX1A 4JLPA 4GC5A 4MUXA 1UKEA 1CQIB 2YTZA 3JQCA 3O0DA 4JIMA 5KCMA 4D9FA 2QTWB 2VRBA 3RB8A 1KK1A 1TZ2A 1FDRA 1HSZA 3N39C 4I8XA 1MHTA 5KDLA 4O0LA 4QIHA 2PS3A 2ZRFA 2CWDA 4DMCA 3IUSA 4X1YB 2QV0A 3ZQ6A 4LGCA 4RF4A 1MPTA 3LH5A 3G2MA 1A9XB 1FYXA 2ZB7A 4NENA 1LV7A 3KYDB 2OHXA 1LBTA 4KDEA 1KZ4A 3T4EA 2ZBVA 2C7BA 4I55B 4PZ0A 4ALKA 1QU3A 3LCCA 2G6TA 1YI0A 4HXGA 3PGMA 4QOIA 1V5EA 4BZWA 4DDTA 3QPUA 4FC6A 5CLQA 2YRFA 1IEWA 1KHHA 5JLAA 3VR1A 1WXHA 5DSTA 4HGPA 3QVKA 2QTMA 3ADDA 1L5SA 2Z0MA 1OT3A 1KDPA 2CDCA 4YDRA 4E5NA 1XKQA 3DD1A 1KEEB 3O6VA 4BAUA 4Q3LA 4H1WA 1UPBA 1OJ7A 1WMEA 2C9BA 2VS1A 3EFBA 3AQ4A 5I7OA 1G7RA 1XTSA 1NZDA 1DC7A 1WXEA 1E5QA 2Q49A 1TM1E 4LZLA 3T7IA 1X19A 3COYA 4MS1A 1HDXA 1MEOA 5L4NA 3G59A 3QFHA 2YXLA 3G6WA 4Y1EA 1XN4A 2F1KA 2PQ2A 4Z5XA 2PUEA 1IN1A 1DKQA 4H0FA 2EBHX 1I7QB 5JSQA 1O6CA 2NUPB 2QTGA 1U7XA 3FRIA 1SXGA 3KJQA 3UJPA 3V33A 4KQ1A 3EMDA 3WZLA 4X9XA 4C6SA 1QRSA 3VO8A 5IJ0A 2CHVA 2YY6A 3REGA 4DQ0A 1SKMA 5I7WA 4KWEA 2XIQA 4K6OA 3MBKA 1VJ5A 3TUJC 1XP5A 1VE7A 1XLUA 1DSSG 1FMLA 2IXGA 1M2OB 3WGOA 1NOKA 2PO7A 3R5FA 3HJFA 3AY3A 4CODB 4L73A 3VH3A 3FOWA 2BTQA 3OZTA 3RK4A 4LV8B 3GN1A 1PJCA 1CS0B 4H17A 3LQKA 4E7PA 1SBZA 3HK2A 1NG1A 2I3DA 3DAYA 3DZKA 3FTCA 4MAMA 5LYJB 2F3TA 4I6EA 1WUIS 1FE8A 2YS7A 4N41A 1PK7A 3DE0X 5TJ9A 1K86A 2A1UA 4N7JA 1Z8HA 3EZ9A 4ZPJA 5IJZA 1D7OA 4J16A 4E3ZA 1G9TA 1PLJA 1XL1A 3PE4A 3C7DB 1PNQA 3I2KA 5DW3A 3CLRD 5CTJA 2NUTB 2WD8A 3PJFA 2UZIR 4A2PA 3EIFA 4PGAA 2YJ3A 1PJSA 2QP3A 2CHEA 5AW4A 3CRZA 1N5IA 3Q85A 4XLLA 4Q6BA 4IILA 5H82A 2X13A 2QX9A 3B9RA 1PO7A 1PJ4A 2WF7A 3OZIA 4KUGA 3FNEA 5L3ZA 1FFDA 4JLSA 4BE4A 5J2TF 4YXFA 2FE4A 4NG5A 3UICA 2H9YA 5IH3A 1HNWB 2HYDA 3VJRA 1D1QA 4KQKA 2VXCA 1U8FO 3BCHA 3UAVA 4UU8A 1JSLA 1N34B 2W2XA 3O4RA 4OEHA 4D46A 2VSYA 4DREA 4J4BA 1JXMA 1PFUA 3F90A 1SKAA 1LRLA 1OZHA 1JPJA 2HBQA 4LHSA 2C2ZA 4R9NA 1ZD2P 4L5JA 2FPWA 3FCCA 4P8RA 3QKSA 1GTJ1 5EPOA 1JN0A 3B36A 1IJFA 3QI2A 4MUIA 3OZSA 3T34A 3ZWKA 4ZI3A 2XNHA 4BIMA 1FUUA 1W85B 3CSUA 5LMCA 2R47A 5AKIA 5FBRB 3NIWA 3UV6A 2H8KA 3ZDAA 1UOPA 2Y1GA 1GGVA 1PWEA 3UKDA 3DULA 3EBLA 4DV0B 5BWLA 3FWHA 4CN9A 2XZOA 1CCWA 2XQFA 4N8SA 5HWSA 1SEPA 1TVKA 1AQYA 2GX6A 4XVCA 2DF8A 2P62A 2OORC 3LYAA 4TL7A 5CLGA 4ZMBA 5DGTA 5EIEA 4U02A 1UBJS 3K8YA 2FUG1 5B3JC 4QM7A 4H6VA 3AZQA 1T5OA 1K4YA 1AKMA 1YFZA 4HVLA 3I83A 1HOTA 2NSHA 4I66A 1X8XA 2BC9A 1E3MA 1FLDA 3BWEA 3I5XA 4LFCB 4MWCA 4BCCA 4ASUA 4RTQA 4TWRA 3MFQA 2OXRA 5CD9A 1CB0A 3DR5A 3OE7D 2CMKA 4H6XA 4MCAA 1QX3A 2QI9F 4N0MA 2OYRA 3NH9A 4Z49A 5BUQA 3A9RA 1KAGA 2FDXA 2WUGA 4KYIB 4PHGA 5E6UA 5FBHA 1ZCAA 5DGHA 1UMDA 5GAJA 1KTIA 1RCTE 2GLXA 4KE8A 3GNQA 3C14C 4BN4A 2H2AA 5GADl 4OQNA 2MYUA 2QENA 1RNLA 3ELDA 2C59A 2CL6X 1QLJA 4IZ6A 4K2AA 5MN4A 4W9NA 5I7HA 1BS9A 5G1PA 1NJ5A 3FKJA 4RZQA 1G17A 1G8JA 3WYGA 1USUA 2BR5A 2ZB4A 3ES9A 3FIUA 1E9EA 2GPAA 5HRUA 4LRSB 4JLDA 2WJVA 1TU4A 3QX7A 2C2YA 2AOUB 2PGLA 4HJXA 5AVSA 2EW2A 1D7AA 2EAUA 3O31A 1KZ6A 1EKXA 4FFBA 1ZP6A 4XSVA 4LISA 4I9UA 4YRJA 1JG7A 1X1EA 3KKPA 4A92A 4J0DA 4EARA 1X80B 2ZQ5A 2F8MA 2QTHA 4LFAB 2W6ID 3H8VA 4KAJA 1FYDA 4YP0A 1QRTA 2YW2A 2A9VA 1XJWA 3ZTTA 1UBNA 2JZOA 1R6XA 2AI1A 3DSRA 3AXTA 3WQHA 4GLFA 3I6QA 1OXUA 1V3TA 3IFSA 5DHUA 5JJ5A 2ISSD 3P19A 3MB5A 2M6KA 4MR7A 3WLOA 1TTQB 1DELA 2RGYA 1X9HA 3ZZNA 1E69A 5IC5A 2OHVA 2O2GA 2ZKLA 3W5VA 1MZPA 5KX5B 3GG2A 1JVNA 1V1JA 1JQ5A 2FFAA 2PGDA 3BIJA 3IT1A 1GQSA 2IXBA 2POQX 3KUKA 3P71T 2OC4A 4GSKA 4I99A 5JRZA 1ZIOA 4ZD6A 3BHNA 4CQNA 3GA5A 3NHBA 3UW3A 5F7OA 2O8FA 1NZJA 2PYIA 2QTVA 2W37A 1YRBA 4QJ4A 4LYHA 4G1CA 4CIAA 4DWJA 4BGVA 1E3IA 4F8EA 5ABPA 4FPXA 1WZEA 3RJ9A 3N0RA 1OAKA 2A88A 2WAAA 3BFVA 3IP8A 1U0GA 4HWRA 3L40A 4RS3A 4JJ7A 4AK9A 4BX8A 1IEVA 2OFFA 1NASA 2G5TA 1Y9JA 1U98A 2GF9A 2JZNA 2XUPA 3AI1A 1U7UA 3LRTA 1GPH1 4BVHA 5M04A 1GHTA 1HFWA 3PRHA 2DG2A 1PFQA 4X6UA 2H2FA 2FEOA 2VT3A 4RJIA 4CFZA 3BILA 1I7DA 3AL0C 4QSMA 2IPAB 2QN1A 3EVEA 1H93A 1UBLS 3KTAA 4B3JA 3F1KA 4Q9IA 3SBXA 1M33A 3N28A 5K3BA 4I5EA 3MELA 2J09A 1KOLA 1QIFA 1I7LA 1N0IA 4HZUB 3T15A 2QPOA 3VH4A 3PXCX 2CB0A 4JMPA 1P5JA 3AVTA 1W5EA 1IAVA 1DKMA 3BTUA 2R5FA 4LGVA 4DQVA 3N74A 5I45A 3CVWA 3DVAB 1IG3A 4BIIA 2IX3A 4WA7A 4A4DA 2ATEA 4ZYZA 1P29A 3GD7A 2Q45A 2HRDA 3H9EO 3LUAA 2Y92A 3SQLA 2FQYA 2Z2YA 4B33A 3E18A 5I9BA 4RA9B 2QSYA 3SNKA 4XDGA 1KF0A 4UBNA 1TYCA 4II3A 4MRRA 4CT0A 2WFZA 1T10A 4WKBA 1QIJA 2NLOA 2XT9A 4KR7A 2EXXA 5FA6A 4G0PA 1UR5A 4ASUD 2J5QA 3GLFB 3AFIA 2HF9A 1WHSA 4TL8A 4WOJA 5IULC 4YCAA 1H3EA 3FCAA 1BWQA 1R88A 3Q1KA 1RHKA 4R01A 5FWYB 2YHAA 2Q50A 3GR6A 3D4LA 2Q4BA 3QKSB 3QUTA 5CIWA 4DGQA 3CE6A 1ADJA 2VJYA 3V9AA 4G0YA 1I2DA 2QE7D 3AU8A 4ER6A 4ZC1A 3C3EA 5JSHA 5KJEA 4CEHA 1P4GA 2YVUA 3OEEA 1F7VA 3K9LA 1RYBA 3NP7A 2VUSA 2PXAA 1Z73A 1TM7E 3AJRA 3MGBA 4FS3A 2HAEA 3VPAA 1V5IA 5C35A 3W8NA 3DKVA 4B2IA 3MTGA 1VG8A 1ADBA 4HLNA 1EAYA 2RHWA 2V6GA 1KFKB 1PQUA 1TCAA 2DM6A 2QVGA 1DBWA 4D74A 4BEJA 2NVUA 5ICMA 4M9RA 5JV5A 5AK0A 4FUTA 2C7VA 3UJNA 2FW9A 3TM4A 1U7DA 3KYJB 4D9IA 1JDZA 2ZRGA 4G1VA 1QYWA 4KU4A 1GSOA 1I9CA 1VOTA 2DLDA 3PIIA 4EPTA 3KR1A 4N6NA 3EF3A 3GVXA 3OCXA 3RTDA 4Q4HA 3VRHA 1D09A 4HKTA 4FNMA 4MZDA 621PA 5A0VA 4URHA 3G0OA 1CZHA 2O8NA 3CLRC 3Q3IA 5L3QA 1VIDA 4X71A 5D3MB 1L3CA 1XMXA 1M1NA 1MQAA 4LHYA 1ZEJA 2YZ7A 3T61A 4JZYA 2C9DA 3L7OA 3LGXA 2PIDA 2G06A 3OT4A 4RW0A 4RELA 4S12A 4ZOLA 5D7NA 5ALTA 2NU9B 4BNDB 3DE4X 3UC5A 4DCNA 3K9NA 3JQ7A 1VKNA 3UJHA 2DX7A 2EIXA 4UPEA 1N2BA 3ELYA 1PCXA 1GP2A 4ZQBA 3RBAA 5ER9A 1L5HA 3KQHA 1Z7BA 4ALLA 1O95D 2D2FA 4TXMA 4JENA 4E5YA 3B5EA 1MXHA 1WDWB 3IKMB 4I9FA 2WJHA 4B09A 1I33A 2CLMB 3K4HA 5JSZB 1A4XA 2CXHA 1JLRA 2FPPB 2Z2ZA 5JW6A 3U09A 4YAIA 5BYKA 3IAHA 5JCPA 1KOFA 3GDHA 2JD2A 4OLJA 1C8LA 1SXJB 4A1OA 1P80A 2MYPA 1YKSA 1CDDA 4GZ5A 2PLWA 1MJGA 4WINA 5DULA 2OCKA 1WLYA 2P1RA 3KV3O 5JH7A 1TZJA 1OLSA 3VVBA 3L6RA 4UNIA 4X65B 1M5UA 3LW8A 1A76A 1PX2A 1R3DA 3H9BA 4AJOA 1YQUA 2WJPA 2ZLBA 2ZRLA 2P79A 4HRYA 2K4MA 3RIEA 4U2EA 1QLHA 5TVKA 2WWYA 1XB2A 1OH8A 2EGUA 2R6R1 4IEEA 4BV8A 5BSGA 3FYUC 1K2VN 3D3NA 4HDMA 4QLAA 5AESA 3AR2A 1B8OA 2PXCA 5FUWA 1SNYA 5JDCA 3E2PA 3OWXA 1WQ4A 3PE3A 1F06A 1L1RA 3GNLA 4U7JA 5EP3A 1YRQA 1XCBA 4UUQA 4A8JB 1L7QA 1QO7A 1YR7A 1QS0B 1W2WB 2JBWA 1XRJA 3C7KA 1Q11A 1HDCA 1L5QA 2IHYA 3QW4B 5HIIA 4N6GA 3ZDEA 1TZBA 1CRLA 3CC8A 1JPNA 5LM3A 4FBMA 4I4TA 3N7UA 3ND8A 1P4AA 2CZGA 2WJGA 4IMRA 4H18A 3QKRA 3TDKA 2GUWA 1QC5A 4MP8A 4RDHA 4Y2XA 3TZCA 4TUYB 3FPGA 3KOOA 2PRKA 2OCGA 2HI0A 3V80A 3B6IA 4JCCA 3GJ8A 4G3XA 4DR4B 1X7HA 4MICA 3IO3A 4KREA 2WNSA 4DCPA 2GA8A 4JXKA 2GK6A 2HTEA 5KB3A 1TUBA 2CVQA 4LI0A 4OL9A 4H08A 5G40A 3TLKA 2L82A 1TUEA 1Z2PX 3FPSA 4PG6A 3OSZA 4TMZA 1YMVA 1PGOA 1QE3A 1I1QB 1SXHA 1D2CA 3EXHB 3L1KA 5EKUA 4B35A 4C7OA 3OLYA 1RQPA 1CE8A 2XHZA 1MDBA 4GIBA 4QQKA 4KN6A 3RC3A 3H4VA 3OH8A 3ZIDA 4Y3UA 3FAKA 4HZUA 2X7JA 4ITRC 3NGXA 2YXEA 4MRNA 2BY4A 3FFTA 5D01A 5GV8A 3UMRA 4DXHA 2GJ8A 4YXWD 2Q5CA 4NS1A 5GIPE 4V0QA 2O54A 4WGFA 4NULA 5EJ9A 3DGEC 4NHEA 2ZTLA 3OU6A 1WQ3A 5CA1A 2HQSA 5FBLB 5F51A 2JB9A 4XIGS 2RC5A 1ZC3A 1Y4UA 4EGFA 2YJ6A 5DM2A 1AHIA 3TBKA 4DTIA 3FLAA 1N0UA 3P0FA 4I50B 2XY4A 3UHFA 4DZZA 5ARBA 2F4NA 1CIPA 1U2RA 5I51A 2BGIA 3ZCUA 1PSWA 1HMYA 4EKIA 4D6YA 5HYVA 3QEOA 2DBZA 4TKLA 1LPNA 1XCMA 1E4VA 3PHLA 3R5SA 5LYYA 4UATA 4PY2A 1H4QA 2TECE 3U7EB 4INJA 5CNJA 2RHHA 4CT4B 1L5ZA 4MYCA 4OJMX 2CVFA 3A0RB 1YB6A 2B82A 2EOAA 2V59A 5CYOA 3NVAA 3ZHXA 3D7RA 1KJZA 3EBPA 5E9QA 4EHHA 1EXMA 4H4CA 1YBMA 4BO9A 4XDHA 2RHTA 3NDRA 5CVCA 5IUNC 1Y3IA 2I1LA 1IXZA 3D81A 3K53A 3SR3A 3KWFA 2O8EA 2XDAA 2J31A 4K6GA 4A6PA 1X1CA 3OP4A 2CSUA 4M6WA 3U0BA 5EL0A 1LWOA 3M9XA 4HNHA 3TQHA 3T41A 2AC7A 3AW9A 3IAAA 3OE5A 2F90A 4LKRA 3OX3A 1R5JA 1E9SA 2XZTA 1WW2A 1E7YA 5LQKA 3ZJ4A 5J3JA 3EFOB 4U00A 4BQFA 2GESA 3K0AA 4PQFA 5IJ0B 5HGJA 4C4OA 1PI3A 4RTSA 2AOTA 3DMPA 5E7QA 3IUYA 3PBKA 1PR9A 5AVYA 1TO2E 2YHIA 1AN0A 2WSSD 3I23A 4FHCA 4H7EA 4ICIA 1JEOA 2RHMA 1B6GA 2WDZA 4DBLE 2WT8A 4M49A 3EWNA 3DNPA 4JA0A 1MG5A 5C8DA 2ZM5A 2G4LA 1KYZA 2YC4C 3EVGA 3EY4A 4CDGA 1RADA 4ALIA 3GPBA 1GLNA 1U80A 5HQ3B 3IR7A 1YSCA 2WHQA 4C0BA 3JD3A 2X0NA 1JI3A 3BH6A 3GZNA 3NHAA 3QXHA 3SLGA 1I2MA 5AKJA 5DZSA 4A26A 1TKCA 3QF4B 4EA9A 2DUWA 1P2BA 1DXQA 3NCHA 2Q4OA 1CR4A 4GXRA 3HUTA 2WOJA 4Q05A 4Y2HA 3WRVA 5BV8A 4REOA 1Z4MA 4P54A 4Z4CA 4MYHA 1QQ7A 1A2QA 3DEZA 3EODA 4XM2A 3R3HA 1JU9A 5JWHA 4PNEA 5IU6A 4LVNA 4XWGA 5L3RA 1FQOA 3FE2A 5BV2P 2A9PA 2CL7X 1EM8A 4ZVVA 2KI5A 1NPTO 2O3RA 3P0EA 4HDKA 4AY5A 4LSWA 4CL3A 3CVVA 3V32A 4LJRA 1N8TA 2JG3A 3TNDA 2PWZA 1JEAA 4UTOA 4XEHA 1AF7A 4Y30A 1ESZA 3G8YA 5AUPB 5AK3A 1NLMA 3GRRA 3EAQA 4EJ2A 2JI4A 3SXUA 5BVGB 3GZJA 4XJVA 1JR3D 4M3NA 3EC7A 3LUFA 4HFJA 3IP3A 1O6GA 3FOZA 3DJFA 4LHZA 1B8PA 1V26A 1Y9ZA 3PF8A 5EJAA 1DFHA 1LWNA 3VTZA 5FBQB 1VKRA 1YS6A 4IRXA 2O0JA 2LDXA 3CZMA 5GMOA 3S40A 1IBKB 4PQRA 3COSA 1J0CA 1CY6A 5GM2A 1UM8A 2O8VA 2XMGA 3NTLA 5BQPA 2DSTA 3SC3A 3THYA 2ZROA 521PA 4CIBA 1IAQA 4QUDA 4BLOA 1P4SA 2ID7A 2X2OA 4ZMSA 3MMXA 1EGQA 3RRXA 2DR0A 3JYLA 3LD9A 1KE1A 3KQVA 3U2QA 1MABA 3HBNA 4ZDWA 3E35A 3UFXA 3SPXA 5FNZA 1DDOA 5DGDA 4BDSA 5B7PA 4OXIA 1E98A 3CLHA 1F2TB 1V1MB 2XGSA 4P7JA 1KJNA 4BNWA 3A1VA 3F7NA 2VOJA 1KIMA 3JQRA 4M1EA 3B1ZA 4BMDA 3SQNA 3FUTA 4QGBA 1XFDA 2P2GA 4YAGA 4F3RA 2R1TA 2C94A 3ZXUB 4Q4DA 1Y3AA 2RHCA 3PEEA 2VZ9A 1EVIA 4ZVOA 5BXQC 3BK2A 4ZYVA 4QUGA 1EFPA 3W06A 4OGFA 1OD6A 4GRIA 3DE7X 4O4HA 1WPRA 5EHNA 1UXHA 3QEKA 2D8AA 3X1YA 4GKAA 2AB0A 3UWMA 1W0CA 3BZBA 3R6GA 3AH8A 2XUIA 3VJLA 1FFSA 4ISBA 3PG5A 1TF2A 2ZSFA 2YBEA 1W4RA 4Y1RB 5EUMA 2WTBA 2PY6A 5EJGA 3I6YA 4C3OB 1QQAA 1C14A 2PMEA 1BMTA 2OY0A 2YJGA 4KIUA 3VOSA 3NAGA 1QHHA 2H00A 3G7NA 4FCVA 3ZWAA 1GG5A 4XX0A 4GEGA 5LR6A 4NPHA 3BXXA 3DKKA 2VTDA 1HPLA 4NBNA 4NSNA 1U6KA 4TMKA 4E88A 2QZJA 2RJOA 4EUKA 5F52A 2F9FA 1CG6A 1LCIA 2JEYA 5HQTA 3GAFA 2CJYA 3KS9A 4WY2A 2OO3A 4BVJA 1NVGA 1PR6A 1ZIXA 1YS7A 1LI7A 2C2KA 3QPVA 3D6VA 5KYYB 2VO1A 4BZPA 1FDUA 1CIJA 3PXUA 1ADGA 3LLUA 1IM5A 3IVXA 1Y8AA 2JFHA 3DCJA 4QARA 4C6HA 3T3OA 1P4RA 1VRCA 4ZO4A 3U4GA 4EJSB 2CXXA 3I9OA 5EMHA 1DIOB 4BWVA 3VYVA 2VH2A 3JWJA 4CIXA 5ERGB 3EBOA 2DJIA 1FVOA 4M1OA 1T26A 5AJYA 4UQLA 1PTKA 3W5HA 1CJUC 1EGHA 1DEAA 1B23P 1T5LA 2XQVA 3LPAA 5EGSA 2Q21A 1HDRA 3HJHA 1B2RA 5EVJA 5H80A 3Q88A 4OAPA 2C07A 3ASVA 5CUQA 3HSYA 3TI7A 4RL6A 1NNLA 1S2LA 5E4YA 3LO5A 1UJBA 1D2EA 1WKBA 4DLNA 3E3AA 4HQKA 4EKYA 4G5OA 3VVLA 3CZ5A 3STTA 1F6DA 1MOSA 1WMBA 3GY0A 3F8SA 5CB4A 2OD7A 1N1MA 4EYEA 3DMDA 3R6TA 2XYRA 3N2LA 2VYCA 2RHOA 4L8LA 1IM8A 1SUPA 5J2TA 5CD1A 1X7YB 2EEZA 2QMOA 3Q9UA 3VPFA 4CG1A 2B4QA 4J6EA 3FSEA 1Y3FE 3I45A 3MTDA 1ZNYA 3BE6A 1IJBA 1SU6A 1W96A 2ZUBA 3FLBA 3PE6A 1NW7A 4KYUA 3GGOA 4A5OA 5CP8A 1JQEA 3AEXA 2D54A 4MPPA 1FNMA 3AEZA 4KTTE 4NS4A 3RRBA 3E22B 3MWYW 1GA1A 1NVUQ 2O14A 3IODA 4KQMA 3EQ6A 2N75A 1QYRA 5HCIA 4IYRA 3IHWA 4Z7QB 3EZ2A 5FTLA 1Y3HA 2X6TA 2GZ2A 5ALSA 3M6UA 4MITA 2OXCA 3WB9A 4R98A 1UEXC 2WM8A 3S3TA 1MKYA 1QO9A 2HRBA 2I9PA 3F78A 4BMNA 1QV7A 2QBYB 2WNIA 4QQ8A 3WNVA 4KTVE 5ALKA 2DKNA 4DQKA 4OD0A 2NP6A 1P39A 2WSLA 2HMYB 3IEUA 4H3HB 2ZTUA 4INOA 4TN5A 1KBQA 2G28A 2ZIZA 3HYCA 2RD2A 2NU8A 3T52A 3I9NA 2HRQA 4I3FA 4MQFB 4RNDB 3M4JA 2XUGA 5AOBA 1AK2A 4HH3C 4E2YA 1TT7A 1R4MA 5CIQA 1H23A 4LXGA 3I5MA 1FVHA 3L6DA 3CY6A 4OI2A 4IGFA 4KNVA 3KPUA 4MWBA 2NQ8A 3MMZA 1U0RA 1YDWA 2HF2A 3DVQX 5BURA 2O06A 5TSDA 3UC9A 3GVPA 3KDPA 4QLBA 3GQBA 2J85A 3HS3A 3ESCA 3IVCA 4Y6SA 1S3GA 4OQQA 4WNIA 1EG7A 5FBKA 2B8TA 2PX3A 3DL0A 1SXPA 3BQNB 1ZRMA 1N8SA 3OPMA 3ZDBA 3ABOB 2NGRA 4JI5B 4IXDA 5GPBA 5HVNA 4L3OA 4JKYA 1NE7A 2TMGA 2WSSA 1GEGA 1XNHA 3E1GA 4UTZA 4CQMD 4MK4A 5B30A 1SKQA 3N0TA 4ZZIA 2VK1A 1R5OA 3CZAA 4NAUA 4NESA 4Q4AB 2BEWB 1U7ZA 3ZV6A 2D6FA 5BOVA 2GN9A 4H77A 1RLIA 4JBNA 2YVAA 4HQOA 3RSHA 1BD4A 2BMJA 1TOAA 4RMJA 3VR3A 1GYQA 1RR6A 4Q5IA 4AY4A 5BPHA 1KKLA 2GUGA 4JT4A 3O2JA 3UXYA 1KVSA 4Q1AA 5H9VA 5JNWA 1XQVA 1P17A 4QD3A 4BVKA 3IEIA 3CLUC 3HUEA 5J1TB 3KXPA 3PFKA 1EVLA 3HYSA 3QH4A 1W6RA 3VZBA 4YT8A 2XNJA 3DO6A 4LRUA 1GUZA 3PXDA 4P6VF 1LDYA 2BUCA 3ZU2A 5D84A 3D6NB 4TTIA 1F0KA 1JL3A 1KH1A 3KQQA 3PDHA 2C98A 4PZLA 3RBVA 1RWPA 4HQLA 1MW9X 4LKOA 2W43A 4EK9A 3FZYA 5LOVF 2QZSA 3JR3A 4GRDA 3AETB 2GBFA 3SKXA 1UDCA 2WKRA 2XQJA 3F6RA 4KXNA 3DBHB 3TR6A 4BJ6A 2ZVPX 4J90A 1SC3A 2YRXA 3L4SO 3AKYA 3T7EA 1GZ7A 2QL5A 4UHBA 1Q6ZA 3FSGA 3DOHA 4BEBA 4FKBA 1HFKA 1Q3TA 1DFIA 2Z3WA 2HZ7A 3M3HA 3U3XA 1TIPA 1X9IA 4N48A 3H1PA 2QUHA 2ZR7A 4M1QA 3ONEA 5EINA 3GUVA 1DBRA 1KWGA 1Y6GA 3QBEA 1PFGA 2I03A 3E1SA 4FN4A 1XZPA 2JDIA 2QX4A 5TXGA 3V6LA 4BLTA 4YUZA 3AKDA 1YBVA 5CVEA 4B83A 3DUWA 4HB3A 5C9ZA 4ZYUA 1K6IA 2AG8A 4YP1A 1DKLA 2OAP1 5FO0A 4R68A 1R0YA 4U2DA 4IIEA 3R3XA 1ICEA 2IGTA 2OQVA 3OFKA 3ZGYA 1SK8A 1XZKA 1JQ3A 2CHUA 3DV0A 5FTNA 5IZCA 2WQ6A 1C1DB 4OSEA 1C9YA 2EYUA 4UNPA 3NKVA 3VVMA 3GMIA 1M6VA 1QHGA 2WD7A 3P5BA 4XVHA 3MWFA 1E77A 1SKBA 2O50A 3WLEA 3WRWA 3PQ7A 1BSVA 4FMDB 3LNCA 3K8OE 5FJIA 3BIFA 3ZHSA 3DV2A 3I30X 4NOMA 2D5BA 1XQXA 4RD6A 4GMXA 4EW1A 2IU6A 4PHTA 2BEUB 2VHQA 1FFBA 1U9ZA 2E6UX 2HDOA 2Z57A 3AUSA 5LA6A 4D0RA 4FGLA 1Y1SA 5THQA 3KG2A 3AJ9A 4IMJB 4MKIA 4YN3A 4C78A 3FOFC 4AQ7A 1SVMA 3ZDCA 3UJDA 4TMWA 2C4TA 3OT1B 3WDMA 5L6LB 2ZSHA 4MAFA 3LY9A 1TI7A 5LDDC 3AFMA 2QXYA 3A11A 1VPVA 1L3IA 1Z2OX 3OZVA 1UFRA 5C31A 4B84A 1OVGA 3OIVA 1R4NB 1E1RD 5FPTA 1X77A 5EJ4A 5AP9A 1PGPA 3L5KA 1SUAA 3BWXA 3L8GA 2AA3A 2DPYA 1RBZA 2P9TA 4QX6A 2O3UA 3DC7A 3S28A 4DWWA 3OQOA 5DLYA 2O2EA 1Y82A 4B3HA 4J43A 5J63A 1K6EA 3F6EX 4D43A 2FMTA 4YMTA 2P35A 3SLRA 4BEWA 1LBQA 1HT0A 1R8XA 5BSWA 3TSOA 1O8BA 1HH4A 5A02A 1F8UA 5ALHA 4AIIA 1JA9A 1I24A 4MW1A 3VFDA 1T0BA 4B48A 2DBQA 2AG5A 4DR1B 3WGYA 1N5JA 1PKXA 2B21A 2N3ZA 3RVRA 4RCVA 1DJNA 3QBTA 1U7WA 4QWWA 3QVLA 5LUBA 3LUBA 3TTTA 4TS4A 5JMPA 3R75A 5GONB 2PX6A 1BOFA 1Z75A 1ARZA 4LDNA 5FPYA 3W2FA 4B3TB 1EU1A 3L1IA 2F8LA 7REQB 2P9YA 4UW9A 3FX2A 5MN5A 4W6QA 3V4RA 1V9SA 4AWAA 1FDVA 3PX2A 4AG3A 2A0FA 3GO4A 1O6BA 3H9QA 1F2UA 4P9NA 3QEMA 1ZCFA 1YOVB 2CK3D 2DGDA 3LC1O 3PVCA 3ZYZA 4MUGA 4UZEA 2EV9A 4FSHA 2JA2A 4IOMA 3NJ8A 1I80A 1LC0A 1ZCJA 1O0SA 3GMSA 3MXOA 2VQDA 3L8DA 2OBNA 4PVCA 1BJRE 4JBHA 4K9QA 4NBUA 4Y1GA 5DI9A 1X3LA 4A8JA 4R69A 2CXUA 1ZRNA 2ZPUA 1BX3A 4LOJA 2ZAMA 3KEOA 4RD4A 5IPFA 5J4VA 4EA8A 5HM6A 2FPIA 5KNBA 1CQZA 1WQ1R 4P3KA 2PGJA 4X3PA 1SWVA 3TTYA 3MZ0A 4V0LA 3DWEX 3AOEC 3R0XA 4CEIB 1JFFA 1T6YA 3HRHA 4PLCA 3N2EA 5L6MB 5A62A 1WU8A 1PS9A 4QYMA 5A9RA 1EFCA 2XUHA 3C3BA 3Q2KA 3QX8A 4GZLA 1XDSA 4LZWA 1UBEA 1N8NA 4W8HA 2G76A 3I5UA 2SICE 3QSYA 1NVFA 4UJ3A 3HV0A 1ID8A 3WGVA 4WSOA 3SZLA 4C5BA 4DCJA 1RVV1 3T95A 2Y8EA 3WHKA 2V7TA 1XJCA 4CHTA 1ZUNB 3EZFA 5BWMA 3K2QA 2XNDA 4C4YA 3PC8A 2O2HA 1ULSA 4XD7D 1Q77A 1ENYA 4DG9A 1GRNA 1SVLA 3FCOA 2YH2A 2O19A 4UBIA 2J3MA 3UXEA 4DJ5X 3HGMA 3CR7A 3K6SB 4UBMA 1I6WA 2QRNA 4IOKA 3MS7A 3B13B 4V24A 3C3CA 1NRWA 3TE6A 1AKEA 4RAQA 3M1YA 4RF2A 3RVNA 4DV1B 5KJ6A 1NC3A 1U8ZA 1E1CB 3C24A 4EG4A 3GV0A 3IQIX 1I2CA 2GO1A 1C1XB 2II6A 4IEFB 3PC7A 4WFIA 4DEXA 1G2QA 2K2WA 3D6TB 5AJTA 3ZWOA 2XBLA 4JLBA 1UFKA 4X61A 3TW8A 3W9BA 4S04A 2K2QB 4BRZA 4HN4B 2MSKA 5AKGA 3T9FA 2NAPA 4C1BA 4MPRA 4BTEA 2G80A 3FZGA 3MGAA 2WA2A 3H5IA 4OHBA 4QDKA 1DIRA 5B6JA 5IAGA 4E07A 4HGYA 4H15A 3WICA 3SC2A 4WLEA 4CLHA 4M21A 4ZK2A 4CU5A 5D87A 4YYZA 4GL2A 3NBZC 3EH2A 3VR3D 1J6UA 2EC5A 1IB6A 4TTPA 3TGWA 1JW9B 2OM6A 2IEDA 2XCUA 4OQYA 4M0KA 2F3PA 2XMDA 3U1BA 3DLBA 5JT1A 3QPWA 5LBIA 4BJ3A 2W6IA 3CSDA 4YALA 3LXUX 4FK8A 2J9FB 5IWAB 5AXCA 2R6DA 3HCAA 3QTLA 1W0JA 1CVIA 3IOEA 3PA6A 4LDRA 5IJ9B 2NTYC 2NTJA 3BXZA 1IOWA 4X1KB 4M1ZA 3ZBTA 1NYQA 4M83A 4EBFA 3GJZA 2AJDA 1VJTA 3AUXA 1Z0AA 1ZONA 2FEMA 2TMDA 3SLKA 4C4ZA 2UUCB 3M9WA 3W5UA 3BKXA 3EK2A 3FPFA 4M0FA 1RQRA 4XX0B 1GPUA 4BMSA 4RPKA 2DFLA 3WO1A 4LN1A 3U16A 1ISPA 1XVVA 1N2IA 2R8BA 1ZDMA 2ANCA 3BTSA 1OBFO 1AMOA 3U3JA 1WO8A 3IEMA 2XADA 4XGIA 1UC9A 3BXEA 3WBBA 4DMFA 2CNLA 3R3SA 1E1MA 1HKHA 4TKVB 2ZAOA 1JKMA 1JA1A 3RYFA 5B6PA 1Z74A 3NT5A 4TSKA 4XDZA 1E2JA 4XD2A 1KJQA 1Q22A 2HJSA 4P3OA 5LDGA 3HXPA 4HXFB 5DTQA 1KZHA 3T5TA 2AXQA 4WNYA 4A2QA 4D57A 3D8SA 4A3SA 3FMGA 3GJQA 3LV8A 1FFGA 4RVOA 4S1WA 2HV9A 3D8UA 1G8PA 2ZIWB 1C9NA 3TQSA 4UDXX 1AXRA 5U1PA 1TKAA 4H7PA 5K2OA 3BN3A 1HKUA 3DFKA 1WMSA 4QFCA 5KNDA 3H7AA 4Z4EA 1IUOA 3OLXA 4PYRA 5K0LA 2VK4A 3I6IA 4PTZA 1TF7A 4QXQA 2XCLA 4L4XA 2NZJA 2V7QA 4OATA 5DCUA 1J20A 1H5UA 1OUMA 4WK6A 3W8FA 4DCVA 4F3YA 5BSFA 5JEDA 2WIKA 4JR1A <