3SD4A

Crystal structure of the first tudor domain of human phf20
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
GHMHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3sd4A00
4A4HA 2P0KA 4UC4A 2MWPA 3NTKA 2G3RA 2GF7A 2M0OA 3FDRA 4A4FA 3M9QA 3OB9A 4Z02A 2B8AA 2JTFA 2VYTA 3PNWC 4X34A 5KE2A 3OYNA 4FU6A 3S3NA 2MWOA 5M9OA 2M16A 2RJCA 4E7JA 4HCZA 4IUTA 2DIGA 5J26A 2CKKA 3LLRA 2EKOA 2LTOA 2O4XB 3E9FA 4II1A 3SD4A 5KE3A 2XDPA 4IUQA 2X35A 2DAQA 2RHXA 4QVZA 4B9WA 3OY9A 3OA6A 3OYAA 3S3MA 4IKFA 2EQUA 4Q5WA 3OYDA 2L3RA 2E5QA 4N4IA 1WGSA 4C5HA 5C6SA 3OYEA 3OYMA 4OVAA 4C5EA 2HQXA 2R58A 4N4GA 3UWNA 4EDUA 1N27A 3L2RA 2EQJA 2WACA 2LRQA 2X4YA 4RG2A 2EQKA 4BACA 3CEYA 3H8ZA 3MO8A 2GFUA 1KHCA 2RHZA 2PQWA 3ME9A 4QQDA 5C0MA 2BUDA 2BIVA 5KCOA 3DLMA 3E9GA 4BE2A 4IURA 2EFIA 2JZ2A 2RJEA 2M1HA 5D6WA 3OYKA 3OYHA 4N4HA 3MEWA 2RI5A 1G5VA 2D9TA 2RI3A 4FL6A 4E7LA 4C5GA 4BD3A 4BE1A 4ZTFA 4PL6A 3NTIA 2E6NA 4GY5A 2R57A 4CRIA 3META 4QQGA 3H6ZA 5IAYA 2RI2A 2LVMA 3S3OA 5FROA 2RO0A 1OYXA 3FLGA 3PMTA 5J39A 4PLIA 2X4XA 3P8HA 3FC3A 3GOXA 3OYIA 5FRNA 2QQRA 1MHNA 3UT1A 4E7HA 1OI1A 2XK0A 2L8DA 3NTHA 4IUUA 4A4EA 4LD6A 3DB4A 5KH6A 1WJQA 3OYLA 3QJ6A 3MEAA 1RI0A 3QBYA 5FRMA 2HQEA 3OQ5A 1OZ2A 4IUPA 3OS0A 3PMIA 4BDZA 3OYFA 2NLUA 3MP6A 4QQ6A 2DIQA 3OYCA 3OYJA 1SSFA 2BKDN 2RHUA 2O4XA 3L42A 1OZ3A 3ASKA 4NS5A 2K3YA 2R5MA 3QKJA 5D6YA 5IN1A 2FHDA 3PFSA 3OYBA 3MEUA 4E7KA 2RHIA 3S6WA 4E7IA 3C4SA 2QQSA 3EAEA 4B9XA 4PLLA 3L2WA 3P8DA 3LYIA 4BDYA 3MP1A 3LH0A 3OMCA 4C5IA 2LCCA 3ZEHA 3F70A 2R5AA 2IG0A 3LGLA 3OS1A 4BE0A 4ZTJA 5CIUA 3OYGA 2L89A 3OS2A 4A4GA 3L2UA 2RJDA 1XNIA 2F5KA 2K3XA 4L59A 3LX7A 3QIIA 4IUVA 2RHYA 5D6XA 1WJSA 3Q1JA 5KCHA 2GFAA 2YRVA 3LGFA 1WJRA 2RJFA 3L2VA 3KUFA 4QW2A 3L2QA 3BDLA 3DB3A 3MP8A 2EQMA 3O8VA 1H3ZA 3MEVA 2X4WA 3OMGA 3FEOA 2LDMA
chains in the Genus database with same CATH superfamily
1Y0MA 2XHCA 2MWPA 2K5IA 3ULRB 4RMOA 1M3CA 1HJDA 3I55Q 3H0FA 2EAYA 2HQHA 1I8FA 3WVEB 4F16A 1YCSB 4AT1B 3I56T 4YTLA 1I81A 1ZSZB 2MI6A 3L1AA 2XDPA 4C92E 4J6WA 2CP5A 2D0NA 3CMEQ 1PSFA 1B07A 1YJWT 5FWBA 3LWHA 4RUGA 2E5QA 1Q82U 2AIRB 4QKUA 3L2ZA 3CCRA 3MO8A 2RK2A 4GLMA 4JDSA 4D8DA 3CC7T 3QDFA 4FT4A 2F69A 4ELZC 1M2OA 5CAIA 3CCUT 5KYUA 4LNPA 5IHNA 1UECA 2QQRA 4C92D 1X2QA 3A8GB 2CH4A 1MNDA 3DB4A 1WHHA 4PJLA 4RCCA 4FT2A 4XAXB 1EZZB 2GBQA 4HVVA 4MDWA 3VS0A 1KQSP 4HVUA 2HMAA 2RK1A 5IXBA 5L8RE 4E7ZA 3OMCA 1AHJB 5LL6S 4MMKA 3CCET 1TOVA 3RUXA 1YHQQ 2KQWA 3EH1A 4PJMA 2XG8D 3GBQA 2GFAA 5GMKh 2QQBA 3G6EQ 3V7RA 1KFZA 2MK5A 2VB6A 1G3YA 3CC2A 1M27C 2EQIA 3J7AF 2DD5A 2PNIA 3FDRA 3UA7A 4HCKA 1AZEA 2DE0X 3QYGB 2ABLA 2YLBA 3VUBA 3HFOA 2P0QA 5L23A 5GAOn 2J05A 2CKKA 3UATA 2NUZA 2H8HA 4J9BA 2JW4A 5CO7A 1JJ2A 2VASA 1U1TA 2YHTA 3SWNC 3KBGA 1PD0A 3QZ5B 2E41A 2HEQA 2HQXA 3NPFA 4EDUA 4IIOA 3JCMg 2A0FB 2WACA 3G71Q 1VQOT 4M77F 4J6YA 2ZPGB 3REAB 3CCJA 3JCMX 2BUDA 4C8QD 4C92B 1SF9A 4WTOB 1WQWA 1K1ZA 3OYHA 3MJXA 3EFOA 2RI3A 3M4GA 4PL6A 3HRUA 1JB0E 3ER0A 4MZTA 5GAOp 2DL8A 5J39A 2CS7A 1RI9A 1BKBA 1BIBA 2K5FA 3OBYA 2KSSA 3MEAA 4LXCA 1OZ2A 1IHVA 4J9DA 2LJ0A 3EG1A 4ESRA 2RHUA 1AVZC 4JS4A 4XTXA 4M7AE 2RH2A 5GANd 4RG8A 1YITA 4PLLA 5KYWB 2CDTA 4BE0A 2YSQA 4A54A 4HVWA 2KMTA 1C6VX 1G8XA 2M9UA 1OX8A 1D1BA 1E6GA 3NFCA 5GAN5 4C92G 2DTIA 1SHFA 3MCAB 2G6FX 3DB3A 4HXJA 3MEVA 2K57A 1HD3A 3VS3A 2OTLT 4FSXA 1RLPC 1WYXA 1SRMA 3CCVA 4M7AD 2GF7A 2OAWA 1KSWA 3UDCA 1LPLA 4KGXB 4X34A 1C1AA 5LJ5d 2DBKA 1K9MR 2OI3A 1X6OA 3VS7A 2FYKA 3EGXB 1W1FA 1ZSZC 2LTOA 1NJIC 3E9FA 1VQKQ 1UJ0A 1M90U 4C8QB 5CK9A 3OYAA 3M0TA 1G83A 1RUWA 1PM3A 2MYSA 4GBQA 4KH1B 1WX6A 3UWNA 3O5ZA 2NUPA 3CEYA 1VQ6T 1NZ9A 2BIVA 4OB2B 4FCYA 3CMAQ 4M78F 1VQ8Q 2HAXA 3H41A 2LVMA 4BUGA 2DEUA 2HL3A 2FB7A 2L8DA 3SFMA 3OYYA 4RTVA 2DKGA 3QJ6A 1RI0A 1TU0B 1VOMA 1UGVA 3RBBB 5LJ3d 1WIEA 3CXCA 2KE9A 3OW2S 4ZN3A 4LD9K 4C8QG 2JVVA 1UGQB 2QQSA 5DLOA 1ZHIA 3CCLT 1BB9A 2QEXQ 4M75B 1IB8A 2R5AA 2DL4A 1MUZA 2O9SA 4A4GA 2JOYA 3TU4K 3RMSA 3EH2A 5GANe 4M7AB 4J9EA 2QYZA 1WJRA 2ROLA 5GAMe 3EGUA 1JU5C 3A8OB 1PRMC 1GBQA 1I5LA 1VYVA 3J81E 3JCMd 2WSFE 1YJ9A 3GF5A 1IGQA 3PNWC 3PGGA 2K79A 5M9OA 1NM7A 1QVFP 4Z88A 4OF1A 3VS4A 4II1A 7AT1B 4B9WA 3D7SB 1TSFA 4IKFA 4BY6B 8ATCB 4PJNA 2K2VA 1VQMA 4N4IA 1QVGP 2ED0A 1X6BA 1OU8A 1QP3A 3JAME 1Q86U 1N27A 1FYNA 2V1RA 4RG2A 3I5RA 3JCMW 4M7AG 3E9GA 4C92C 1UGPB 4XTZA 1Q7YC 1PC0A 4N0AA 3EG3A 1UE9A 5FROA 1RAHB 4CC3A 4RTWA 1VA7A 2A7YA 4IUUA 1AD5A 1WJQA 4IUPA 2K3BA 2YDLA 1GRIA 1VQ7T 3L42A 1VQ9T 2BZ8A 5I2SA 2I0NA 2E70A 1Q7YR 5GAN3 2DJZA 1UHCA 2HD0A 2E10A 2O9VA 3L2WA 2QDLA 3EGDA 1BU1A 1VQNQ 3CD6T 2AZSA 2CREA 2BZYA 3I5SA 5DM7R 1BCMA 2FZGB 1DJ7B 1JEGA 2YLCA 5A0DA 1Y07A 2XDDA 1Y96A 3L2VA 4AG2C 2E64A 2EQMA 1VQ5T 3X28B 4DA4A 1YJNA 3JB9I 5CKHA 2JTEA 4FSSA 4RTUA 4R55A 4A4FA 2A36A 2DXUA 4M78A 5EC7A 3PIPA 1U5SA 3OYNA 4OGCA 4QVCA 2JMCA 3CPWP 4M4ZA 2M16A 2ZCFB 1K9MU 5GJWB 1T3SA 1WNLA 3QXEB 4ATOA 3QSUA 2DAQA 3CCRQ 4C8QC 5GANj 3S3MA 3JCMe 2DZ9A 1KJWA 1ACMB 5GAMj 2BTTA 4XTYA 4JRQA 2EQKA 5GAN6 2RHZA 5KCOA 4HT8A 4PJOE 1S1NA 1RAGB 2K2MA 2GQVA 4BE1A 1WHGA 2QXFA 4CRIA 2FRWA 2M0YA 1NYGA 4XTWA 5HY6A 1NBEB 1R0BG 1Z9QA 3P8HA 2ED1A 1D0XA 1RAAB 2OAUA 3SWNB 3M0UA 2CT3A 5DLQE 3MHXA 3PMIA 4FW2A 4XU1A 3TEEA 2NLUA 3GIBA 3OYCA 4PJOF 2DEQA 1T0JA 4D8KA 2K3YA 1I0CA 1ABQA 1VQLT 4BI4A 1A0NB 5IHIA 1PNJA 1QCOA 2QDYB 3F70A 5I22A 3E2UA 1EFNA 5IH2A 3OS2A 2DVEA 4J9FA 3CC2Q 4CC4B 2QASA 1WXTA 1ZBJA 3FIFA 3QIIA 4M7AC 4IUVA 2RHYA 5GAN7 3TVTA 5GAOl 1M4ZA 5FU7B 1OPKA 1EIFA 1RABB 3VYHB 2DILA 1YIJA 1I1JA 1UHFA 1OPLA 1LJOA 1PKTA 5KYUB 2LCSA 2DL3A 2DERA 1QWEA 1K8AR 1TS9A 3CCMA 3EHQA 3CBMA 1PWTA 1JBMA 1BI2A 2DIGA 1B34A 3GNGA 2LQKA 2GGRA 3CCJQ 2CUDA 2ECZA 4BY6C 1IO6A 1PSEA 3OYDA 4PFOA 2GCXA 3NHNA 3G4ST 2EYXA 2L5QA 4DBFA 2MOXA 5CKDA 2CSQA 1BI0A 2JMAA 1YI2T 6AT1B 3RKYA 5D6WA 4FL6A 1LNXA 3CCQA 1FMWA 2DTHA 1E6HA 2L2PA 2FPEA 2RNAA 4PLIA 2YRCA 4PK4A 1QP2A 3M59A 2JS0A 1YITQ 1IXDA 1D1AA 1FMKA 4LD6A 1PRLC 4EMKA 1W2BS 4C0ZA 3I56A 3QBYA 5CCAA 5GAN4 2RQVA 2DRMA 1N6AA 2P0PA 2LT1A 2DIQA 1SSFA 5GAOq 2O4XA 2F1LA 3JRZA 4JLIA 2RA2A 5EG2A 3OYBA 1SEMA 4KULA 1YJWA 4E47A 4F17A 2VUBA 5A2QE 1AT1B 4XU2A 4K11A 4XTVA 3QWYA 1M9SA 3BE3A 2DTOA 1WPYA 3GP8A 3BW1A 2K3XA 3HRSA 3CC7A 5D6XA 3Q1JA 4JZ3A 3CCVQ 1QVGS 1Y7XA 5FWCA 3OW2A 3CCUA 3CBOA 3OMGA 1M1KC 2DXTA 2FZCB 1CKAA 2JNGA 3HP9A 2LDMA 1XJWB 2FVUA 2YXYA 1VQ4T 1JJ2P 1FWZA 2FPDA 1S72T 3M9QA 4Z02A 4FYXB 3S3NA 5LJ5h 1D09B 1ARKA 3QJYA 2RF0A 2CGHA 2EBPA 2KRSA 3LLRA 5ECAA 2OTJQ 2IIMA 3M0QA 3LH5A 4QVZA 2LJ3A 4J7IA 2MIOA 1M1KR 3CCEA 1O75A 4ZNXA 3DLLA 1KIKA 1IREB 4PJOA 4M77E 2PZ1A 2GFUA 4A63B 1KHCA 4Z8AA 4J9CA 4F7UE 3DLMA 3WXMB 1NG2A 4J9GA 4OMOA 2MAMA 2NUTA 3CBPA 1HK9A 3C94A 4ZTFA 2E6NA 4JUVA 4GY5A 1AWOA 3VS5A 2C0IA 3OSVA 1UUEA 2AK5A 1Q86C 1SG5A 2J6KA 3FC3A 1QMCA 2XD0A 2RQRA 1C0MA 2XK0A 3CC4T 4AFSC 2QA4T 3OQ5A 3OYFA 2LC4A 1ZSGA 2KROA 4JZ4A 4F7UF 1G3WA 4NS5A 5LJ3h 4ME7A 3QKJA 5IN1A 2CP2A 3PFSA 1Q81C 2LMJA 1ZUUA 3JCMc 5GMKl 1X69A 1N9RA 3I55T 1ZBXA 2IG0A 4TVRA 3OS1A 1VQOA 5FU6B 2K9GA 2QK0A 3V7CA 1UGSB 3IQLA 2NUPB 1MV3A 3A5ZB 4OP0A 2AKLA 4F14A 4J5YA 1N8RU 5GJVB 2F2WA 2YRVA 3CMET 2HKQB 4XU0A 5FU7C 1YJ9Q 2ZPIB 3EFRA 2F5TX 3BDLA 1M5Q1 1Q81R 1UFFA 2X4WA 2A08A 1QKXA 3VKIA 5GAMd 1AZGB 2COWA 1PCXA 3JCMh 3VV0A 1K8AU 2JTFA 1KD1C 1K73C 2KBTA 1VQMQ 5J26A 2E5KA 1XQHA 2RHXA 2PTKA 2PVDB 3THKA 2JN0A 2IPOB 3WVDB 2PVGB 1MV0B 2YUOA 3H9NA 4ZN1A 3V8KA 3OYEA 2RQUA 5KYNA 3CCSQ 4M75F 2COYA 3EFSA 4Y91A 2XDBA 3ME9A 1KD1R 2EGEA 1K73R 2RJEA 3OYKA 2FEIA 4M78E 4KT0E 4M7DF 4R56A 2XIDA 3HTRA 4QT7A 1D0YA 2NYSA 2FRYA 3CXCP 3QG1A 2OTLA 4HA8A 5KYYA 1WFWA 1J3TA 4X9DA 2VWFA 2VV5A 1YHQT 3HHTB 1U06A 3INZA 3G6ET 2OTJT 1VQPQ 2KRNA 2RQTA 1ZUKA 3MP6A 2QAZA 4QQ6A 3V8JA 3VYGA 2WSEE 2KT8A 2CZ7B 1NJIR 3S6WA 5HK0A 1QQJA 3FRNA 4E2FB 3P8DA 1YP5A 3HSBA 4A53A 4C5IA 5IT9E 4M78D 2COZA 1R0CB 2LNHB 1VQ6A 1ABOA 2L89A 1OV3A 3J80E 1R8OB 3KXTA 2LQNA 1YJNQ 2F5KA 4LUDA 1FMVA 4OMNA 2RMOA 4L59A 2ESWA 4KUDK 3JB9F 3FJ5A 5KCHA 2XICA 3L2QA 1PD1A 2H3EB 3O8VA 4AMCA 1WLPB 3G71T 1YWOA 3H0HA 2Y4YA 2KEAA 1Y71A 4A4HA 1ZLMA 4M77G 3NTKA 3TSZA 1NLOC 3OB9A 4JLGA 4XQ3A 5KE2A 1HYOA 3P8BB 1OU9A 4ZGJB 3ZFJA 2DA9A 2DJQA 4HCZA 3MPUB 1K0XA 1IGUA 1E7OA 4FW1A 2DFUA 1TUCA 1WHMA 3CCLA 4FYVB 4KGZB 4C0DB 4DOWA 1H92A 4DBRA 4M77A 4PNOA 3EGDB 1WGSA 4OB0B 5C6SA 1KC8C 4C5EA 1UJYA 2D8HA 2DETA 4F7UA 2SRCA 4HCCA 2LRQA 1U8RA 2E1HA 2QG9B 1XTDA 3FB9A 2EJGA 2M51A 4IURA 2JZ2A 1GFDA 2BZXA 2M1HA 1G5VA 2D9TA 1Y96B 4C5GA 1GXIE 2KGTA 1WA7A 2V8IA 1TTHB 2L0AA 3GLXA 1VIFA 4HT9A 1KQSS 1KC8R 1M1GA 1GCQA 1WHLA 1SKUB 2HQEA 1HXDA 3OS0A 2DZCA 2J6OA 4J9HA 2P4TA 3R6OA 1JJ2S 1CSKA 4ORZA 2RHIA 1BCOA 3CCST 1Q82C 5CKBA 4BDYA 3A8HB 1I07A 5LJ5f 5GMKe 5FU6C 1G3SA 1YIJQ 2CZ6B 2KY9A 3LX7A 1VQKT 2ZPHB 1WJSA 2QQAA 2KK4A 5HK3A 1WQ7A 3CCMQ 1RACB 4J6XA 4OMFB 4EPCA 2Y90A 4M75A 1Q82R 2I2LA 3GPLA 2KYMA 2Z0WA 1VQPT 2X4JA 3JSCA 1LCKA 4DOVA 3CMAT 4PKCC 4JJDA 4M7DA 1VQ8T 4M78G 1VQ7A 1VQ9A 4KGVB 2ZAEA 3HRTA 3CD6A 5DY9A 2DMOA 5I11A 4KH0B 4AFQC 3GNFB 2EGCA 2EPDA 4GLKA 2DXCA 4N4GA 5LJ3f 4CC2A 1VIEA 2PQWA 4JJNK 4LDYA 1RAIB 3LW5E 5KYXA 4LDVA 3AT1B 2C0OA 1X43A 1VQ5A 4BD3A 2QEXT 3I56Q 5CQXA 1WHJA 1OOTA 1OULA 4LE9A 4RTZA 5IAYA 1K4US 2DBMA 1QWFA 1I4K1 3CQTA 3UT1A 1R77A 3SDZA 3RKXA 3DKMA 4J83A 1YJWQ 2CH4W 2EGAA 5GAN8 3PIOA 1PG5B 3X24B 2BKDN 2HCKA 4RTYA 1WDXA 4JJCA 2EIFA 2GTJA 2ROTA 2W10A 2DF6A 3JCMf 4B9XA 4DEYA 3MP1A 1MMGA 3C12A 4J7FA 4E6RA 3M5AA 2KDSA 3CCUQ 2YUPA 2RM4A 2DNUA 4KRTA 1FX7A 3JCMP 3PTAA 1H641 3QZ9B 4N0AC 2VXEA 1PKSA 4PJOD 4UC4A 2IVWA 2XMFA 4EIKA 4ANJA 1N8RC 3SHWA 4EMKB 3URGA 2X9HA 4J8OA 4FU6A 4O6JA 3CCEQ 5GMKj 2L3SA 1VQLA 2RPNA 2O4XB 4PJJA 2X35A 3M0PA 3TCJA 3OA6A 2EQUA 4HCBA 4DQ2A 2CYZB 4C0DC 1D1CA 1D0ZA 1SPKA 2R58A 1UG1A 2X4YA 2JM9A 1RLQC 2D6FA 1O9SA 2JTMA 4JS5A 2EYZA 4BE2A 2EJ9A 3SB2A 1BIAA 1VQNT 2LNVA 2R57A 1X2KA 3X20B 4C0FA 1M8VA 2LZ6B 1SRLA 2K7AA 3JV3A 1UDLA 2E65A 3FLGA 2X4XA 3GOXA 3REBB 3UA6A 3ZBDA 1MHNA 2KXCA 2HZYA 4P5NA 1D3BA 4M78C 1V1CA 2VVKA 1M2VA 2H3JA 1I5OB 1M90C 1VQOQ 2F2XA 4A4KA 2LX7A 2LX9A 1TH7A 4E7SA 1U3OA 4E7IA 5FLXE 3G4SA 3SWNA 3OW2P 2DM1A 2DL5A 2E4HA 3ZEHA 2QTXA 1LOJA 3LGLA 1NPRA 2FZKB 1YI2A 3L2UA 4PJOB 2RJDA 4V2SA 1JRIA 1M1FA 1QLYA 1YBYA 2AKKA 3CCRT 4PFPA 1M90R 4JPBW 2NUTB 2KRMA 2A37A 4LUEA 2J6FA 4B6MA 5GANh 2CP3A 4MZPA 2PU9B 1Q7YU 5AYFA 3VRZA 5GAMh 1QVFS 1WXUA 1X01A 1G2BA 1AOJA 4KBMB 4FYYB 2B8AA 1N9SA 3I9QA 3PE0A 1KG1A 5HKCA 2LQ8A 5LJ5g 4E7JA 3JCMV 3QUIA 3A98A 2VGMA 4C92F 1X27A 2X51A 3EFOB 2MPXC 3OY9A 2A28A 3QO3A 4LN2A 2BE7D 4ZGEB 4O5VA 3HKSA 9ATCB 2KI7A 2DYIA 3BFMA 2F2VA 4VUBA 2EQJA 2OTLQ 2PVOB 3QWXX 4PJOG 4BACA 1IZ6A 3JB9J 2ZGWA 5C0MA 1M3AA 1ZUYA 2ZPEB 1U1SA 2RQWA 4MDXA 1QCNA 2A3LA 1WZOA 4XTUA 1Z9ZA 4DBQA 3EG9A 3META 5CVIA 4QQGA 4AFUC 1TUDA 3BY7A 1VQ4A 1IHWA 3PT9A 1MMDA 1YWPA 2YRDA 5CKEA 3PMTA 3CC2T 3N5BB 1S72A 3M56A 2JXBA 4X9CA 3OYIA 1UTIA 2KYBA 5A0LA 4PFZA 2MF2A 4CC7A 1P92A 1YNZA 5GAN2 4IIMA 3T9NA 1OX9A 2V8KA 4BI8B 3C95A 3PVLA 5LJ3g 1ZSZA 4OMQA 2K5LA 3M57A 2E3IA 2ZPBB 2HBPA 3UF4A 1VQ6Q 3RESA 3M54A 4E7KA 1TXQA 1BI1A 1NPPA 4C8QE 2EJFA 3LH0A 3V7SA 2C0TA 3OS5A 1NEGA 3JB9H 3NGPA 1OEBA 2HNIA 1KQSA 2D8JA 4CI0C 1YFNA 3X26B 1GBRA 3CCJT 3FJPA 1H8KA 2DXBA 3U23A 1LVKA 2C06A 3M55A 4M77D 4ZGDB 2XKOC 1MNEA 4OMPA 5KYYB 5J3BA 4C8QF 3CPWS 1Q86R 1GCPA 1X6GA 2CT4A 4AFZC 3CC4A 1VYUA 2M0OA 2QA4A 1W4SA 3CCLQ 1NYFA 4EMKC 2FG0A 2NWMA 1MGQA 3M0RA 3M4YA 4IUTA 2KVQG 1AWWA 2L3PA 4FIBA 5GAOm 1XOVA 1AWXA 1RL2A 3VS1A 3JCMJ 3MKDA 3G7ZA 8AT1B 1GFCA 1RADB 3RIRA 3I55A 3A1PA 1YITT 4XU3A 3M53A 1TUGB 1ZA1B 2P84A 4OVAA 2CSIA 4M75E 2DK3A 4JRPA 2J06A 2EWNA 3CMEA 1MMAA 5D7UA 2CUBA 2EFIA 5IHKA 4N4HA 4M7DE 1V76A 2EYQA 1K76A 2AZVA 1OYXA 2RN8A 4DEXA 2D0QB 4ELYC 4LDXA 1UGRB 2DYBA 3CCVT 3M0SA 1K9MC 4RTXA 2QI2A 4MZMA 4OMLA 1JQQA 2FPFA 2KT1A 3OYJA 2EKHA 3TQ7P 3CPFA 2R5MA 2ATCB 5D6YA 1Y57A 4M7AF 4M75D 2RD1A 4HKEA 3EAEA 1M3BA 2YUQA 4NOYA 5A0GA 1W6XA 4M7DD 4M77B 4ZTJA 1M8MA 4AG1C 4RTTA 1WI7A 4F7UB 4PJOC 4C92A 5CR2A 1QKWA 3SEMA 4FM4B 1NE8A 5I21A 3KFVA 3HL8A 2YUNA 2MMPA 1YHQA 1Q95G 1ZA2B 4OMMA 1VQ7Q 1VQ9Q 2JM8A 4Z89A 1T0HA 2P0KA 3G6EA 2OTJA 1EX4A 2VYTA 3CD6Q 2HL5C 1K0SA 2RJCA 2AT1B 2O01E 2V1QA 3A8LB 2E3HA 2V8JA 2EKOA 3EG2A 2CP0A 4L5GA 4IUQA 5IXFA 1NEBA 3JB9D 5KYWA 2O31A 2FO0A 4C5HA 1VQ5Q 3OYMA 1RAEB 3L2RA 5CQYA 5GAOr 4F7UG 3C0CA 4JJBA 1VYTA 4JRKA 1G3TA 1WHKA 2FL7A 5HCKA 4E7LA 1UB4A 1V29B 2MCNA 2LJ1A 3G71A 2QQ9A 2RI2A 3S3OA 2RO0A 4NL3A 1M1KU 3ZL7C 4E7HA 4XK8E 3M58A 4DBHA 1YJ9T 2E12A 4WF2A 2EYWA 4M7DB 5GANf 1BI3A 2LQWA 3EGXA 3VJPA 2ZPFB 5GAMf 4C8QA 1W2BP 1BYMA 3RKWA 3G1JA 4EMGA 3MEUA 3HFNA 3A8MB 4NL2A 2KNBB 2VC8A 1VQMT 1SSHA 2LP5A 3AHUA 5GMKi 1XNIA 2OX7A 4M78B 1K9AA 4OB1B 2AHJB 4Y28E 1NLPC 3HPWA 5KYXB 2YWWA 4QW2A 3MP8A 2VXFA 1H3ZA 1BBZA 2VKNA 2BE9B 3RDVA 2HDAA 1AEYA 5GMKm 4OB3B 4M75G 1VQLQ 5LJ5e 1UEBA 2G3RA 3I35A 3QPHA 2DL7A 2X3XD 4QVDA 2O2OA 2MWOA 4M7DG 1W2BA 2L3QA 1KK7A 2JJ9A 1JXOA 3SD4A 3CCSA 4KUIA 1VUBA 2DX1A 3JCMQ 2KAFA 4Q5WA 2GTOA 1Q81U 2L3RA 2JUFA 2W0ZA 4Y92A 3LWIA 2YT6A 1YN8A 1VQKA 1QVFA 3H8ZA 1IRXA 4M7AA 1TWBA 1W70A 4LDUA 3MEWA 4BB7A 1YCYA 4JRIA 1N5ZA 3EHRA 1ZX6A 1JO8A 1WXBA 2XI9A 5AT1B 3RR6A 3X25B 1QVGA 2ZZDA 1VQPA 3H6ZA 3R6NA 4L6V5 3VS2A 4D6WA 3VS6A 1BK2A 2OJ2A 3CMAA 3TREA 1YJNT 1SHGA 5LJ3e 3CCQQ 1OI1A 3OBWA 1VQ8A 1QVPA 1OQKA 3JB9G 2VGNA 2GNCA 3G4SQ 5FRMA 1PHTA 4FYWB 2DVJA 4BDZA 1B7TA 1KD1U 2DRKA 5FW9A 1K73U 3BDUA 3QYHB 1YI2Q 2FHDA 3VU3C 1AWJA 1F1BB 1JXMA 2EVRA 2EYYA 3E1SA 4M77C 2JT4A 4BI3A 3H0IA 2CP7A 1FXXA 4RKUE 4J9IA 3QHSA 2QGFB 2QEXA 2SEMA 1B34B 2PUOB 4OGEA 2XU8A 1NJIU 5I2MA 2B86A 3CC7Q 5CKFA 3FEOA 1T3LA 2X3WD 3E19A 2EW3A 2CZ0B 4RCBA 1D3BB 1GCQC 2HBWA 2DLPA 1QCFA 3VUZA 1M2VB 1ZQ1A 3V8LA 1RAFB 5KE3A 2HSPA 2LCLA 2Y4XA 1HSQA 2DPPB 3JCMb 2GQIA 2KXDA 1QW1A 3TSWA 3CPWA 1MMNA 4EMHA 1VQ4Q 3CXCS 2KR3A 4LDWA 4QQDA 4MMLA 1KHIA 5LJ5j 1S72Q 2DO3A 1H3HA 1TG0A 2RI5A 4R0KA 4F04B 3NTIA 3EG0A 2WSCE 2JS2A 2M02A 2D1XA 3PVQA 4M75C 2ENMA 1YIJT 1K8AC 5FRNA 2RB6A 4X1VA 1CKBA 2E6ZA 2LT4A 3NTHA 4A4EA 5KH6A 3OYLA 1X75C 4M7DC 3CCMT 1N8RR 3RERA 1KQ2A 2CZ1B 1OZ3A 3ASKA 2HKNA 1B3QA 2PUKB 2P4RA 3C4SA 3VRYA 3LYIA 3QDRB 2LCCA 3OSSC 5CIUA 3RNJA 3OYGA 2V26A 1KC8U 3RMQA 2O88A 2HSEB 2DD4A 4WCIA 2QGGA 1VQNA 3CC4Q 5LJ3j 3LGFA 2RJFA 2QA4Q 3KUFA 4C0GA 5GANg 1KQ1A 2J7IA 2CP6A 1GL5A 3CCQT 3EG9B 2K6DA 3NMZC 1M30A 5GAMg 2K4YA 3UPUA 2QTVA
chains in the Genus database with same CATH topology
4A4HA 1VQKT 2XHCA 2MWPA 4M77G 3CC4A 3NTKA 2M0OA 4R55A 2K5IA 4A4FA 2QA4A 1W4SA 2DXUA 3OB9A 4M78A 4RMOA 4JLGA 3PIPA 4EMKC 4XQ3A 5KE2A 4OGCA 2EAYA 3P8BB 4QVCA 3OYNA 4ZGJB 1I8FA 1MGQA 3M4YA 3WVEB 2M16A 2ZCFB 3ZFJA 3I56T 4HCZA 4IUTA 1WNLA 2KVQG 4YTLA 4FIBA 5GAOm 1I81A 1XOVA 3QXEB 4ATOA 2MI6A 1RL2A 3JCMJ 3L1AA 3QSUA 2XDPA 3G7ZA 4C92E 2DAQA 4J6WA 4C8QC 3CCLA 5GANj 3S3MA 3RIRA 3JCMe 3I55A 1YITT 1PSFA 2DZ9A 1YJWT 4C0DB 4XU3A 3M53A 4DOWA 3LWHA 5GAMj 2E5QA 4M77A 4PNOA 1Q82U 1WGSA 4OB0B 5C6SA 4XTYA 4OVAA 4C5EA 3L2ZA 4JRQA 1KC8C 4F7UA 4HCCA 4M75E 2DK3A 2LRQA 1U8RA 2EQKA 4JRPA 2E1HA 3CCRA 3MO8A 5GAN6 2RK2A 2RHZA 1XTDA 3FB9A 5KCOA 2EWNA 2EJGA 3CMEA 4HT8A 4JDSA 4PJOE 4IURA 2EFIA 2JZ2A 2M1HA 4N4HA 4M7DE 3CC7T 1G5VA 2D9TA 1Y96B 4C5GA 2GQVA 4BE1A 2EYQA 4FT4A 2QXFA 1GXIE 2F69A 4CRIA 4ELZC 5CAIA 4XTWA 5HY6A 3CCUT 2V8IA 1OYXA 3GLXA 1VIFA 3P8HA 2D0QB 2QQRA 2OAUA 3SWNB 4HT9A 5DLQE 4C92D 4ELYC 3MHXA 1KQSS 3A8GB 4LDXA 1M1GA 1UGRB 3DB4A 3CCVT 1K9MC 2QI2A 2HQEA 4RCCA 1HXDA 4MZMA 3PMIA 2DZCA 4FT2A 4XU1A 2NLUA 3TEEA 3OS0A 4XAXB 3OYCA 3OYJA 4PJOF 3GIBA 2DEQA 4MDWA 2P4TA 3CPFA 3R6OA 1JJ2S 2K3YA 2R5MA 5D6YA 4M7AF 4M75D 2RD1A 1VQLT 2RK1A 2RHIA 4BI4A 4HKEA 3CCST 3EAEA 1Q82C 4NOYA 5CKBA 4BDYA 5L8RE 3OMCA 5A0GA 2QDYB 3A8HB 1AHJB 5LL6S 3F70A 4M7DD 4MMKA 5LJ5f 4M77B 4ZTJA 5GMKe 5FU6C 3CCET 1G3SA 3OS2A 2DVEA 3RUXA 3CPWS 4F7UB 4PJOC 2CZ6B 2KY9A 4C92A 5CR2A 2KQWA 3FIFA 4FM4B 3LX7A 3QIIA 1NE8A 2RHYA 4IUVA 2ZPHB 1WJSA 2QQAA 5I21A 5GAN7 2KK4A 2XG8D 5GAOl 2GFAA 5GMKh 1M4ZA 2QQBA 5FU7B 3V7RA 5HK3A 1WQ7A 4J6XA 3HL8A 4OMFB 1EIFA 4EPCA 2MMPA 1G3YA 1YHQA 3VYHB 3CC2A 1YIJA 2Y90A 4M75A 2I2LA 3GPLA 3J7AF 1LJOA 1VQPT 2DD5A 2P0KA 2X4JA 3JSCA 3G6EA 2OTJA 3FDRA 4DOVA 3CMAT 3CCMA 4PKCC 2VYTA 4M7DA 3QYGB 3CBMA 2YLBA 3VUBA 1VQ8T 3HFOA 4M78G 1JBMA 2P0QA 5GAOn 1VQ7A 1VQ9A 2RJCA 1BI2A 2O01E 2DIGA 3A8LB 2CKKA 2V8JA 2EKOA 1B34A 3GNGA 4L5GA 4IUQA 2LQKA 5CO7A 1JJ2A 3HRTA 4BY6C 3CD6A 3JB9D 5DY9A 1U1TA 2YHTA 1PSEA 3OYDA 2GCXA 3G4ST 3GNFB 3SWNC 3KBGA 3QZ5B 4GLKA 4C5HA 2E41A 2DXCA 3OYMA 2HQXA 2L5QA 4N4GA 4EDUA 3L2RA 5LJ3f 3JCMg 5CKDA 2WACA 1VQOT 5CQYA 4M77F 4J6YA 1BI0A 2ZPGB 4F7UG 5GAOr 1VIEA 3CCJA 1YI2T 3JCMX 4JRKA 2PQWA 1G3TA 4JJNK 2BUDA 4LDYA 4C8QD 4C92B 3LW5E 2FL7A 1WQWA 4LDVA 5D6WA 3RKYA 3OYHA 4E7LA 2RI3A 1UB4A 4FL6A 1LNXA 1V29B 3CCQA 1VQ5A 4BD3A 2DTHA 3M4GA 4PL6A 2QEXT 3HRUA 1JB0E 5CQXA 3G71A 3ER0A 2QQ9A 5IAYA 2RI2A 4MZTA 3S3OA 5GAOp 2RO0A 5J39A 4NL3A 4PLIA 2CS7A 1I4K1 1M1KU 1QP2A 1BKBA 3M59A 3UT1A 4E7HA 3SDZA 4XK8E 3M58A 3DKMA 3RKXA 4J83A 1BIBA 2K5FA 4LD6A 3OBYA 4EMKA 2KSSA 1W2BS 4C0ZA 3MEAA 5GAN8 1YJ9T 3I56A 3QBYA 5CCAA 5GAN4 2E12A 1N6AA 1OZ2A 4WF2A 2P0PA 3PIOA 4M7DB 2LT1A 1BI3A 5GANf 2DIQA 3X24B 1SSFA 2BKDN 3VJPA 5GAOq 2RHUA 2O4XA 4JS4A 2EIFA 4XTXA 2ZPFB 2RH2A 3JRZA 4JLIA 4C8QA 5GAMf 2RA2A 5EG2A 5GANd 3RKWA 4RG8A 3OYBA 1YITA 4EMGA 1BYMA 3MEUA 4KULA 1YJWA 4E47A 3JCMf 2VUBA 4B9XA 4PLLA 5A2QE 3HFNA 4XU2A 3MP1A 3C12A 3A8MB 4XTVA 4J7FA 4BE0A 4NL2A 3M5AA 1M9SA 2KDSA 2VC8A 1VQMT 4A54A 2RM4A 3AHUA 5GMKi 2KMTA 2M9UA 2DTOA 1WPYA 1XNIA 3GP8A 3BW1A 2K3XA 4M78B 4OB1B 2AHJB 3HRSA 4Y28E 3CC7A 3NFCA 1FX7A 5D6XA 3Q1JA 2DTIA 4C92G 5GAN5 3HPWA 3JCMP 3PTAA 1Y7XA 1QVGS 1H641 3MCAB 4QW2A 3OW2A 3DB3A 3MP8A 2VXFA 3CCUA 1H3ZA 3QZ9B 3MEVA 3CBOA 3OMGA 4N0AC 1M1KC 2DXTA 2K57A 2VXEA 2OTLT 4PJOD 5GMKm 2JNGA 3HP9A 2LDMA 4FSXA 4M75G 4OB3B 2FVUA 1VQ4T 5LJ5e 4UC4A 1UEBA 3CCVA 2G3RA 2GF7A 2IVWA 1FWZA 3QPHA 4M7AD 1S72T 3M9QA 4Z02A 3UDCA 4QVDA 1N8RC 4EMKB 3URGA 4X34A 4J8OA 4FU6A 5LJ5d 2MWOA 4O6JA 3S3NA 4M7DG 1W2BA 1X6OA 5LJ5h 2FYKA 3QJYA 5GMKj 2CGHA 1VQLA 3LLRA 2LTOA 2O4XB 3E9FA 1NJIC 3SD4A 3CCSA 2X35A 4KUIA 1M90U 4QVZA 1VUBA 3TCJA 4C8QB 5CK9A 4J7IA 3JCMQ 3OYAA 3OA6A 2KAFA 2EQUA 4Q5WA 4HCBA 1Q81U 4DQ2A 3CCEA 1O75A 2CYZB 4C0DC 3DLLA 2L3RA 2JUFA 1IREB 2R58A 3UWNA 3LWIA 4PJOA 2X4YA 1QVFA 1VQKA 4M77E 3CEYA 3H8ZA 4M7AA 2GFUA 1VQ6T 2D6FA 1NZ9A 1KHCA 1O9SA 2JTMA 4JS5A 2BIVA 4OB2B 4F7UE 3DLMA 4LDUA 3WXMB 4BE2A 2EJ9A 4M7AC 4M78F 3MEWA 3SB2A 4BB7A 1YCYA 1BIAA 2MAMA 3CBPA 1HK9A 3C94A 4JRIA 2HAXA 4ZTFA 1VQNT 2XI9A 2E6NA 4JUVA 4GY5A 2LNVA 2R57A 3X20B 3X25B 4C0FA 2ZZDA 1VQPA 1QVGA 1M8VA 3H6ZA 3OSVA 4L6V5 2LVMA 1Q86C 4D6WA 3FC3A 2E65A 3FLGA 4BUGA 2X4XA 3GOXA 3CMAA 2XD0A 3TREA 1YJNT 3ZBDA 1MHNA 2FB7A 5LJ3e 1OI1A 3OBWA 2XK0A 2L8DA 1VQ8A 1QVPA 4P5NA 3SFMA 3OYYA 3JB9G 2DKGA 3CC4T 3QJ6A 1D3BA 2VGNA 1RI0A 5FRMA 2QA4T 4M78C 3OQ5A 4BDZA 3OYFA 2LC4A 5LJ3d 3CXCA 2H3JA 4F7UF 1KD1U 1G3WA 3OW2S 1M90C 4NS5A 5LJ3h 4ME7A 1K73U 3QKJA 5IN1A 3BDUA 3QYHB 4A4KA 4ZN3A 2FHDA 1TH7A 2LX9A 3PFSA 3VU3C 4LD9K 1Q81C 4C8QG 4E7IA 2JVVA 1UGQB 5FLXE 2QQSA 5DLOA 3G4SA 1ZHIA 3SWNA 3CCLT 3JCMc 5GMKl 1N9RA 3I55T 3ZEHA 3E1SA 1ZBXA 2QTXA 1LOJA 2IG0A 1NPRA 2R5AA 3LGLA 4M75B 4TVRA 5FU6B 4M77C 3V7CA 3OS1A 1VQOA 1YI2A 4A4GA 4BI3A 3L2UA 4PJOB 1UGSB 2JOYA 2RJDA 3TU4K 3RMSA 4V2SA 1JRIA 1FXXA 3A5ZB 4M7AB 5GANe 4RKUE 4OP0A 1M1FA 1YBYA 3CCRT 3QHSA 4J5YA 1N8RU 2YRVA 2QEXA 1WJRA 3CMET 4XU0A 5FU7C 5GAMe 2ZPIB 3EFRA 2F5TX 3BDLA 1M5Q1 3A8OB 1B34B 2PUOB 4OGEA 5GANh 2X4WA 1I5LA 4MZPA 3VKIA 2XU8A 2PU9B 1NJIU 5I2MA 1Q7YU 5GAMd 5CKFA 5AYFA 3FEOA 5GAMh 3J81E 3JCMd 1QVFS 2WSFE 1X01A 1YJ9A 3E19A 4KBMB 3JCMh 3VV0A 1K8AU 2B8AA 2CZ0B 1N9SA 2JTFA 3GF5A 3PNWC 3PGGA 4RCBA 5HKCA 1D3BB 2LQ8A 1KD1C 5LJ5g 1K73C 5M9OA 1KG1A 4E7JA 3JCMV 3VUZA 3QUIA 1ZQ1A 3V8LA 4OF1A 5J26A 5KE3A 4II1A 2VGMA 4C92F 1K9MU 1XQHA 2RHXA 4B9WA 3OY9A 2LCLA 2PVDB 2Y4XA 3QO3A 4BY6B 4IKFA 2DPPB 3JCMb 2JN0A 3WVDB 2PVGB 4ZGEB 1QW1A 2K2VA 4O5VA 1VQMA 4N4IA 3HKSA 4ZN1A 3V8KA 3OYEA 3CPWA 3BFMA 1QP3A 3JAME 4VUBA 1N27A 1Q86U 4M75F 2EQJA 2PVOB 3EFSA 4RG2A 4PJOG 4Y91A 4EMHA 4BACA 2XDBA 3CXCS 1IZ6A 4LDWA 3ME9A 4QQDA 2ZGWA 1KHIA 2ZPEB 4MMLA 5C0MA 3JCMW 5LJ5j 3JB9J 3E9GA 4C92C 4M7AG 2DO3A 2RJEA 3OYKA 1U1SA 1UGPB 4MDXA 4M78E 4KT0E 4M7DF 2RI5A 4R56A 4XTZA 2XIDA 2A3LA 1Q7YC 3NTIA 4XTUA 4N0AA 3QG1A 3META 2WSCE 4QQGA 5CVIA 2OTLA 4HA8A 3BY7A 1VQ4A 3PT9A 4X9DA 2VV5A 5CKEA 5FROA 1YHQT 3PMTA 3CC2T 3HHTB 3N5BB 4M75C 1S72A 3M56A 1YIJT 4X9CA 1K8AC 3OYIA 5FRNA 2RB6A 5A0LA 2MF2A 2LT4A 1P92A 2E6ZA 2A7YA 3INZA 3NTHA 4IUUA 4A4EA 5GAN2 5KH6A 1WJQA 1X75C 3OYLA 3T9NA 3G6ET 2OTJT 2V8KA 4IUPA 4BI8B 3CCMT 4M7DC 3RERA 3C95A 4QQ6A 3MP6A 3V8JA 1KQ2A 5LJ3g 3VYGA 2CZ1B 2K5LA 2WSEE 1OZ3A 2ZPBB 3ASKA 2HBPA 3L42A 3M57A 1VQ9T 1VQ7T 5I2SA 2PUKB 3RESA 3M54A 2CZ7B 2E70A 4E7KA 5GAN3 3S6WA 2DJZA 3C4SA 1BI1A 5HK0A 2HD0A 1NPPA 2E10A 3L2WA 3FRNA 4C8QE 3P8DA 3LYIA 3QDRB 3HSBA 2EJFA 3LH0A 3V7SA 4A53A 4M78D 4C5IA 2LCCA 5IT9E 3CD6T 3OS5A 3OSSC 5CIUA 3OYGA 3JB9H 1VQ6A 4M7AE 2L89A 2HNIA 3J80E 5DM7R 1R8OB 3KXTA 1DJ7B 1KQSA 1KC8U 3RMQA 2F5KA 4CI0C 4L59A 4KUDK 2YLCA 3JB9F 3X26B 5A0DA 2DD4A 3CCJT 1VQNA 5KCHA 1Y07A 3FJPA 5LJ3j 3LGFA 2XDDA 1Y96A 2DXBA 2RJFA 3L2VA 2XICA 3KUFA 4C0GA 3L2QA 2C06A 3M55A 5GANg 1KQ1A 2E64A 2EQMA 3O8VA 4M77D 3CCQT 1VQ5T 3X28B 4DA4A 4ZGDB 2XKOC 1YJNA 5GAMg 3JB9I 3G71T 5J3BA 5CKHA 4C8QF 2Y4YA 2K4YA 3UPUA 1Y71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4H A;  2P0K A;  4UC4 A;  2MWP A;  3NTK A;  2G3R A;  2GF7 A;  2M0O A;  3FDR A;  4A4F A;  3M9Q A;  3OB9 A;  4Z02 A;  2B8A A;  2JTF A;  2VYT A;  3PNW C;  4X34 A;  5KE2 A;  3OYN A;  4FU6 A;  3S3N A;  2MWO A;  5M9O A;  2M16 A;  2RJC A;  4E7J A;  4HCZ A;  4IUT A;  2DIG A;  5J26 A;  2CKK A;  3LLR A;  2EKO A;  2LTO A;  2O4X B;  3E9F A;  4II1 A;  3SD4 A;  5KE3 A;  2XDP A;  4IUQ A;  2X35 A;  2DAQ A;  2RHX A;  4QVZ A;  4B9W A;  3OY9 A;  3OA6 A;  3OYA A;  3S3M A;  4IKF A;  2EQU A;  4Q5W A;  3OYD A;  2L3R A;  2E5Q A;  4N4I A;  1WGS A;  4C5H A;  5C6S A;  3OYE A;  3OYM A;  4OVA A;  4C5E A;  2HQX A;  2R58 A;  4N4G A;  3UWN A;  4EDU A;  1N27 A;  3L2R A;  2EQJ A;  2WAC A;  2LRQ A;  2X4Y A;  4RG2 A;  2EQK A;  4BAC A;  3CEY A;  3H8Z A;  3MO8 A;  2GFU A;  1KHC A;  2RHZ A;  2PQW A;  3ME9 A;  4QQD A;  5C0M A;  2BUD A;  2BIV A;  5KCO A;  3DLM A;  3E9G A;  4BE2 A;  4IUR A;  2EFI A;  2JZ2 A;  2RJE A;  2M1H A;  5D6W A;  3OYK A;  3OYH A;  4N4H A;  3MEW A;  2RI5 A;  1G5V A;  2D9T A;  2RI3 A;  4FL6 A;  4E7L A;  4C5G A;  4BD3 A;  4BE1 A;  4ZTF A;  4PL6 A;  3NTI A;  2E6N A;  4GY5 A;  2R57 A;  4CRI A;  3MET A;  4QQG A;  3H6Z A;  5IAY A;  2RI2 A;  2LVM A;  3S3O A;  5FRO A;  2RO0 A;  1OYX A;  3FLG A;  3PMT A;  5J39 A;  4PLI A;  2X4X A;  3P8H A;  3FC3 A;  3GOX A;  3OYI A;  5FRN A;  2QQR A;  1MHN A;  3UT1 A;  4E7H A;  1OI1 A;  2XK0 A;  2L8D A;  3NTH A;  4IUU A;  4A4E A;  4LD6 A;  3DB4 A;  5KH6 A;  1WJQ A;  3OYL A;  3QJ6 A;  3MEA A;  1RI0 A;  3QBY A;  5FRM A;  2HQE A;  3OQ5 A;  1OZ2 A;  4IUP A;  3OS0 A;  3PMI A;  4BDZ A;  3OYF A;  2NLU A;  3MP6 A;  4QQ6 A;  2DIQ A;  3OYC A;  3OYJ A;  1SSF A;  2BKD N;  2RHU A;  2O4X A;  3L42 A;  1OZ3 A;  3ASK A;  4NS5 A;  2K3Y A;  2R5M A;  3QKJ A;  5D6Y A;  5IN1 A;  2FHD A;  3PFS A;  3OYB A;  3MEU A;  4E7K A;  2RHI A;  3S6W A;  4E7I A;  3C4S A;  2QQS A;  3EAE A;  4B9X A;  4PLL A;  3L2W A;  3P8D A;  3LYI A;  4BDY A;  3MP1 A;  3LH0 A;  3OMC A;  4C5I A;  2LCC A;  3ZEH A;  3F70 A;  2R5A A;  2IG0 A;  3LGL A;  3OS1 A;  4BE0 A;  4ZTJ A;  5CIU A;  3OYG A;  2L89 A;  3OS2 A;  4A4G A;  3L2U A;  2RJD A;  1XNI A;  2F5K A;  2K3X A;  4L59 A;  3LX7 A;  3QII A;  4IUV A;  2RHY A;  5D6X A;  1WJS A;  3Q1J A;  5KCH A;  2GFA A;  2YRV A;  3LGF A;  1WJR A;  2RJF A;  3L2V A;  3KUF A;  4QW2 A;  3L2Q A;  3BDL A;  3DB3 A;  3MP8 A;  2EQM A;  3O8V A;  1H3Z A;  3MEV A;  2X4W A;  3OMG A;  3FEO A;  2LDM A; 
#chains in the Genus database with same CATH topology
 1Y0M A;  2XHC A;  2MWP A;  2K5I A;  3ULR B;  4RMO A;  1M3C A;  1HJD A;  3I55 Q;  3H0F A;  2EAY A;  2HQH A;  1I8F A;  3WVE B;  4F16 A;  1YCS B;  4AT1 B;  3I56 T;  4YTL A;  1I81 A;  1ZSZ B;  2MI6 A;  3L1A A;  2XDP A;  4C92 E;  4J6W A;  2CP5 A;  2D0N A;  3CME Q;  1PSF A;  1B07 A;  1YJW T;  5FWB A;  3LWH A;  4RUG A;  2E5Q A;  1Q82 U;  2AIR B;  4QKU A;  3L2Z A;  3CCR A;  3MO8 A;  2RK2 A;  4GLM A;  4JDS A;  4D8D A;  3CC7 T;  3QDF A;  4FT4 A;  2F69 A;  4ELZ C;  1M2O A;  5CAI A;  3CCU T;  5KYU A;  4LNP A;  5IHN A;  1UEC A;  2QQR A;  4C92 D;  1X2Q A;  3A8G B;  2CH4 A;  1MND A;  3DB4 A;  1WHH A;  4PJL A;  4RCC A;  4FT2 A;  4XAX B;  1EZZ B;  2GBQ A;  4HVV A;  4MDW A;  3VS0 A;  1KQS P;  4HVU A;  2HMA A;  2RK1 A;  5IXB A;  5L8R E;  4E7Z A;  3OMC A;  1AHJ B;  5LL6 S;  4MMK A;  3CCE T;  1TOV A;  3RUX A;  1YHQ Q;  2KQW A;  3EH1 A;  4PJM A;  2XG8 D;  3GBQ A;  2GFA A;  5GMK h;  2QQB A;  3G6E Q;  3V7R A;  1KFZ A;  2MK5 A;  2VB6 A;  1G3Y A;  3CC2 A;  1M27 C;  2EQI A;  3J7A F;  2DD5 A;  2PNI A;  3FDR A;  3UA7 A;  4HCK A;  1AZE A;  2DE0 X;  3QYG B;  2ABL A;  2YLB A;  3VUB A;  3HFO A;  2P0Q A;  5L23 A;  5GAO n;  2J05 A;  2CKK A;  3UAT A;  2NUZ A;  2H8H A;  4J9B A;  2JW4 A;  5CO7 A;  1JJ2 A;  2VAS A;  1U1T A;  2YHT A;  3SWN C;  3KBG A;  1PD0 A;  3QZ5 B;  2E41 A;  2HEQ A;  2HQX A;  3NPF A;  4EDU A;  4IIO A;  3JCM g;  2A0F B;  2WAC A;  3G71 Q;  1VQO T;  4M77 F;  4J6Y A;  2ZPG B;  3REA B;  3CCJ A;  3JCM X;  2BUD A;  4C8Q D;  4C92 B;  1SF9 A;  4WTO B;  1WQW A;  1K1Z A;  3OYH A;  3MJX A;  3EFO A;  2RI3 A;  3M4G A;  4PL6 A;  3HRU A;  1JB0 E;  3ER0 A;  4MZT A;  5GAO p;  2DL8 A;  5J39 A;  2CS7 A;  1RI9 A;  1BKB A;  1BIB A;  2K5F A;  3OBY A;  2KSS A;  3MEA A;  4LXC A;  1OZ2 A;  1IHV A;  4J9D A;  2LJ0 A;  3EG1 A;  4ESR A;  2RHU A;  1AVZ C;  4JS4 A;  4XTX A;  4M7A E;  2RH2 A;  5GAN d;  4RG8 A;  1YIT A;  4PLL A;  5KYW B;  2CDT A;  4BE0 A;  2YSQ A;  4A54 A;  4HVW A;  2KMT A;  1C6V X;  1G8X A;  2M9U A;  1OX8 A;  1D1B A;  1E6G A;  3NFC A;  5GAN 5;  4C92 G;  2DTI A;  1SHF A;  3MCA B;  2G6F X;  3DB3 A;  4HXJ A;  3MEV A;  2K57 A;  1HD3 A;  3VS3 A;  2OTL T;  4FSX A;  1RLP C;  1WYX A;  1SRM A;  3CCV A;  4M7A D;  2GF7 A;  2OAW A;  1KSW A;  3UDC A;  1LPL A;  4KGX B;  4X34 A;  1C1A A;  5LJ5 d;  2DBK A;  1K9M R;  2OI3 A;  1X6O A;  3VS7 A;  2FYK A;  3EGX B;  1W1F A;  1ZSZ C;  2LTO A;  1NJI C;  3E9F A;  1VQK Q;  1UJ0 A;  1M90 U;  4C8Q B;  5CK9 A;  3OYA A;  3M0T A;  1G83 A;  1RUW A;  1PM3 A;  2MYS A;  4GBQ A;  4KH1 B;  1WX6 A;  3UWN A;  3O5Z A;  2NUP A;  3CEY A;  1VQ6 T;  1NZ9 A;  2BIV A;  4OB2 B;  4FCY A;  3CMA Q;  4M78 F;  1VQ8 Q;  2HAX A;  3H41 A;  2LVM A;  4BUG A;  2DEU A;  2HL3 A;  2FB7 A;  2L8D A;  3SFM A;  3OYY A;  4RTV A;  2DKG A;  3QJ6 A;  1RI0 A;  1TU0 B;  1VOM A;  1UGV A;  3RBB B;  5LJ3 d;  1WIE A;  3CXC A;  2KE9 A;  3OW2 S;  4ZN3 A;  4LD9 K;  4C8Q G;  2JVV A;  1UGQ B;  2QQS A;  5DLO A;  1ZHI A;  3CCL T;  1BB9 A;  2QEX Q;  4M75 B;  1IB8 A;  2R5A A;  2DL4 A;  1MUZ A;  2O9S A;  4A4G A;  2JOY A;  3TU4 K;  3RMS A;  3EH2 A;  5GAN e;  4M7A B;  4J9E A;  2QYZ A;  1WJR A;  2ROL A;  5GAM e;  3EGU A;  1JU5 C;  3A8O B;  1PRM C;  1GBQ A;  1I5L A;  1VYV A;  3J81 E;  3JCM d;  2WSF E;  1YJ9 A;  3GF5 A;  1IGQ A;  3PNW C;  3PGG A;  2K79 A;  5M9O A;  1NM7 A;  1QVF P;  4Z88 A;  4OF1 A;  3VS4 A;  4II1 A;  7AT1 B;  4B9W A;  3D7S B;  1TSF A;  4IKF A;  4BY6 B;  8ATC B;  4PJN A;  2K2V A;  1VQM A;  4N4I A;  1QVG P;  2ED0 A;  1X6B A;  1OU8 A;  1QP3 A;  3JAM E;  1Q86 U;  1N27 A;  1FYN A;  2V1R A;  4RG2 A;  3I5R A;  3JCM W;  4M7A G;  3E9G A;  4C92 C;  1UGP B;  4XTZ A;  1Q7Y C;  1PC0 A;  4N0A A;  3EG3 A;  1UE9 A;  5FRO A;  1RAH B;  4CC3 A;  4RTW A;  1VA7 A;  2A7Y A;  4IUU A;  1AD5 A;  1WJQ A;  4IUP A;  2K3B A;  2YDL A;  1GRI A;  1VQ7 T;  3L42 A;  1VQ9 T;  2BZ8 A;  5I2S A;  2I0N A;  2E70 A;  1Q7Y R;  5GAN 3;  2DJZ A;  1UHC A;  2HD0 A;  2E10 A;  2O9V A;  3L2W A;  2QDL A;  3EGD A;  1BU1 A;  1VQN Q;  3CD6 T;  2AZS A;  2CRE A;  2BZY A;  3I5S A;  5DM7 R;  1BCM A;  2FZG B;  1DJ7 B;  1JEG A;  2YLC A;  5A0D A;  1Y07 A;  2XDD A;  1Y96 A;  3L2V A;  4AG2 C;  2E64 A;  2EQM A;  1VQ5 T;  3X28 B;  4DA4 A;  1YJN A;  3JB9 I;  5CKH A;  2JTE A;  4FSS A;  4RTU A;  4R55 A;  4A4F A;  2A36 A;  2DXU A;  4M78 A;  5EC7 A;  3PIP A;  1U5S A;  3OYN A;  4OGC A;  4QVC A;  2JMC A;  3CPW P;  4M4Z A;  2M16 A;  2ZCF B;  1K9M U;  5GJW B;  1T3S A;  1WNL A;  3QXE B;  4ATO A;  3QSU A;  2DAQ A;  3CCR Q;  4C8Q C;  5GAN j;  3S3M A;  3JCM e;  2DZ9 A;  1KJW A;  1ACM B;  5GAM j;  2BTT A;  4XTY A;  4JRQ A;  2EQK A;  5GAN 6;  2RHZ A;  5KCO A;  4HT8 A;  4PJO E;  1S1N A;  1RAG B;  2K2M A;  2GQV A;  4BE1 A;  1WHG A;  2QXF A;  4CRI A;  2FRW A;  2M0Y A;  1NYG A;  4XTW A;  5HY6 A;  1NBE B;  1R0B G;  1Z9Q A;  3P8H A;  2ED1 A;  1D0X A;  1RAA B;  2OAU A;  3SWN B;  3M0U A;  2CT3 A;  5DLQ E;  3MHX A;  3PMI A;  4FW2 A;  4XU1 A;  3TEE A;  2NLU A;  3GIB A;  3OYC A;  4PJO F;  2DEQ A;  1T0J A;  4D8K A;  2K3Y A;  1I0C A;  1ABQ A;  1VQL T;  4BI4 A;  1A0N B;  5IHI A;  1PNJ A;  1QCO A;  2QDY B;  3F70 A;  5I22 A;  3E2U A;  1EFN A;  5IH2 A;  3OS2 A;  2DVE A;  4J9F A;  3CC2 Q;  4CC4 B;  2QAS A;  1WXT A;  1ZBJ A;  3FIF A;  3QII A;  4M7A C;  4IUV A;  2RHY A;  5GAN 7;  3TVT A;  5GAO l;  1M4Z A;  5FU7 B;  1OPK A;  1EIF A;  1RAB B;  3VYH B;  2DIL A;  1YIJ A;  1I1J A;  1UHF A;  1OPL A;  1LJO A;  1PKT A;  5KYU B;  2LCS A;  2DL3 A;  2DER A;  1QWE A;  1K8A R;  1TS9 A;  3CCM A;  3EHQ A;  3CBM A;  1PWT A;  1JBM A;  1BI2 A;  2DIG A;  1B34 A;  3GNG A;  2LQK A;  2GGR A;  3CCJ Q;  2CUD A;  2ECZ A;  4BY6 C;  1IO6 A;  1PSE A;  3OYD A;  4PFO A;  2GCX A;  3NHN A;  3G4S T;  2EYX A;  2L5Q A;  4DBF A;  2MOX A;  5CKD A;  2CSQ A;  1BI0 A;  2JMA A;  1YI2 T;  6AT1 B;  3RKY A;  5D6W A;  4FL6 A;  1LNX A;  3CCQ A;  1FMW A;  2DTH A;  1E6H A;  2L2P A;  2FPE A;  2RNA A;  4PLI A;  2YRC A;  4PK4 A;  1QP2 A;  3M59 A;  2JS0 A;  1YIT Q;  1IXD A;  1D1A A;  1FMK A;  4LD6 A;  1PRL C;  4EMK A;  1W2B S;  4C0Z A;  3I56 A;  3QBY A;  5CCA A;  5GAN 4;  2RQV A;  2DRM A;  1N6A A;  2P0P A;  2LT1 A;  2DIQ A;  1SSF A;  5GAO q;  2O4X A;  2F1L A;  3JRZ A;  4JLI A;  2RA2 A;  5EG2 A;  3OYB A;  1SEM A;  4KUL A;  1YJW A;  4E47 A;  4F17 A;  2VUB A;  5A2Q E;  1AT1 B;  4XU2 A;  4K11 A;  4XTV A;  3QWY A;  1M9S A;  3BE3 A;  2DTO A;  1WPY A;  3GP8 A;  3BW1 A;  2K3X A;  3HRS A;  3CC7 A;  5D6X A;  3Q1J A;  4JZ3 A;  3CCV Q;  1QVG S;  1Y7X A;  5FWC A;  3OW2 A;  3CCU A;  3CBO A;  3OMG A;  1M1K C;  2DXT A;  2FZC B;  1CKA A;  2JNG A;  3HP9 A;  2LDM A;  1XJW B;  2FVU A;  2YXY A;  1VQ4 T;  1JJ2 P;  1FWZ A;  2FPD A;  1S72 T;  3M9Q A;  4Z02 A;  4FYX B;  3S3N A;  5LJ5 h;  1D09 B;  1ARK A;  3QJY A;  2RF0 A;  2CGH A;  2EBP A;  2KRS A;  3LLR A;  5ECA A;  2OTJ Q;  2IIM A;  3M0Q A;  3LH5 A;  4QVZ A;  2LJ3 A;  4J7I A;  2MIO A;  1M1K R;  3CCE A;  1O75 A;  4ZNX A;  3DLL A;  1KIK A;  1IRE B;  4PJO A;  4M77 E;  2PZ1 A;  2GFU A;  4A63 B;  1KHC A;  4Z8A A;  4J9C A;  4F7U E;  3DLM A;  3WXM B;  1NG2 A;  4J9G A;  4OMO A;  2MAM A;  2NUT A;  3CBP A;  1HK9 A;  3C94 A;  4ZTF A;  2E6N A;  4JUV A;  4GY5 A;  1AWO A;  3VS5 A;  2C0I A;  3OSV A;  1UUE A;  2AK5 A;  1Q86 C;  1SG5 A;  2J6K A;  3FC3 A;  1QMC A;  2XD0 A;  2RQR A;  1C0M A;  2XK0 A;  3CC4 T;  4AFS C;  2QA4 T;  3OQ5 A;  3OYF A;  2LC4 A;  1ZSG A;  2KRO A;  4JZ4 A;  4F7U F;  1G3W A;  4NS5 A;  5LJ3 h;  4ME7 A;  3QKJ A;  5IN1 A;  2CP2 A;  3PFS A;  1Q81 C;  2LMJ A;  1ZUU A;  3JCM c;  5GMK l;  1X69 A;  1N9R A;  3I55 T;  1ZBX A;  2IG0 A;  4TVR A;  3OS1 A;  1VQO A;  5FU6 B;  2K9G A;  2QK0 A;  3V7C A;  1UGS B;  3IQL A;  2NUP B;  1MV3 A;  3A5Z B;  4OP0 A;  2AKL A;  4F14 A;  4J5Y A;  1N8R U;  5GJV B;  2F2W A;  2YRV A;  3CME T;  2HKQ B;  4XU0 A;  5FU7 C;  1YJ9 Q;  2ZPI B;  3EFR A;  2F5T X;  3BDL A;  1M5Q 1;  1Q81 R;  1UFF A;  2X4W A;  2A08 A;  1QKX A;  3VKI A;  5GAM d;  1AZG B;  2COW A;  1PCX A;  3JCM h;  3VV0 A;  1K8A U;  2JTF A;  1KD1 C;  1K73 C;  2KBT A;  1VQM Q;  5J26 A;  2E5K A;  1XQH A;  2RHX A;  2PTK A;  2PVD B;  3THK A;  2JN0 A;  2IPO B;  3WVD B;  2PVG B;  1MV0 B;  2YUO A;  3H9N A;  4ZN1 A;  3V8K A;  3OYE A;  2RQU A;  5KYN A;  3CCS Q;  4M75 F;  2COY A;  3EFS A;  4Y91 A;  2XDB A;  3ME9 A;  1KD1 R;  2EGE A;  1K73 R;  2RJE A;  3OYK A;  2FEI A;  4M78 E;  4KT0 E;  4M7D F;  4R56 A;  2XID A;  3HTR A;  4QT7 A;  1D0Y A;  2NYS A;  2FRY A;  3CXC P;  3QG1 A;  2OTL A;  4HA8 A;  5KYY A;  1WFW A;  1J3T A;  4X9D A;  2VWF A;  2VV5 A;  1YHQ T;  3HHT B;  1U06 A;  3INZ A;  3G6E T;  2OTJ T;  1VQP Q;  2KRN A;  2RQT A;  1ZUK A;  3MP6 A;  2QAZ A;  4QQ6 A;  3V8J A;  3VYG A;  2WSE E;  2KT8 A;  2CZ7 B;  1NJI R;  3S6W A;  5HK0 A;  1QQJ A;  3FRN A;  4E2F B;  3P8D A;  1YP5 A;  3HSB A;  4A53 A;  4C5I A;  5IT9 E;  4M78 D;  2COZ A;  1R0C B;  2LNH B;  1VQ6 A;  1ABO A;  2L89 A;  1OV3 A;  3J80 E;  1R8O B;  3KXT A;  2LQN A;  1YJN Q;  2F5K A;  4LUD A;  1FMV A;  4OMN A;  2RMO A;  4L59 A;  2ESW A;  4KUD K;  3JB9 F;  3FJ5 A;  5KCH A;  2XIC A;  3L2Q A;  1PD1 A;  2H3E B;  3O8V A;  4AMC A;  1WLP B;  3G71 T;  1YWO A;  3H0H A;  2Y4Y A;  2KEA A;  1Y71 A;  4A4H A;  1ZLM A;  4M77 G;  3NTK A;  3TSZ A;  1NLO C;  3OB9 A;  4JLG A;  4XQ3 A;  5KE2 A;  1HYO A;  3P8B B;  1OU9 A;  4ZGJ B;  3ZFJ A;  2DA9 A;  2DJQ A;  4HCZ A;  3MPU B;  1K0X A;  1IGU A;  1E7O A;  4FW1 A;  2DFU A;  1TUC A;  1WHM A;  3CCL A;  4FYV B;  4KGZ B;  4C0D B;  4DOW A;  1H92 A;  4DBR A;  4M77 A;  4PNO A;  3EGD B;  1WGS A;  4OB0 B;  5C6S A;  1KC8 C;  4C5E A;  1UJY A;  2D8H A;  2DET A;  4F7U A;  2SRC A;  4HCC A;  2LRQ A;  1U8R A;  2E1H A;  2QG9 B;  1XTD A;  3FB9 A;  2EJG A;  2M51 A;  4IUR A;  2JZ2 A;  1GFD A;  2BZX A;  2M1H A;  1G5V A;  2D9T A;  1Y96 B;  4C5G A;  1GXI E;  2KGT A;  1WA7 A;  2V8I A;  1TTH B;  2L0A A;  3GLX A;  1VIF A;  4HT9 A;  1KQS S;  1KC8 R;  1M1G A;  1GCQ A;  1WHL A;  1SKU B;  2HQE A;  1HXD A;  3OS0 A;  2DZC A;  2J6O A;  4J9H A;  2P4T A;  3R6O A;  1JJ2 S;  1CSK A;  4ORZ A;  2RHI A;  1BCO A;  3CCS T;  1Q82 C;  5CKB A;  4BDY A;  3A8H B;  1I07 A;  5LJ5 f;  5GMK e;  5FU6 C;  1G3S A;  1YIJ Q;  2CZ6 B;  2KY9 A;  3LX7 A;  1VQK T;  2ZPH B;  1WJS A;  2QQA A;  2KK4 A;  5HK3 A;  1WQ7 A;  3CCM Q;  1RAC B;  4J6X A;  4OMF B;  4EPC A;  2Y90 A;  4M75 A;  1Q82 R;  2I2L A;  3GPL A;  2KYM A;  2Z0W A;  1VQP T;  2X4J A;  3JSC A;  1LCK A;  4DOV A;  3CMA T;  4PKC C;  4JJD A;  4M7D A;  1VQ8 T;  4M78 G;  1VQ7 A;  1VQ9 A;  4KGV B;  2ZAE A;  3HRT A;  3CD6 A;  5DY9 A;  2DMO A;  5I11 A;  4KH0 B;  4AFQ C;  3GNF B;  2EGC A;  2EPD A;  4GLK A;  2DXC A;  4N4G A;  5LJ3 f;  4CC2 A;  1VIE A;  2PQW A;  4JJN K;  4LDY A;  1RAI B;  3LW5 E;  5KYX A;  4LDV A;  3AT1 B;  2C0O A;  1X43 A;  1VQ5 A;  4BD3 A;  2QEX T;  3I56 Q;  5CQX A;  1WHJ A;  1OOT A;  1OUL A;  4LE9 A;  4RTZ A;  5IAY A;  1K4U S;  2DBM A;  1QWF A;  1I4K 1;  3CQT A;  3UT1 A;  1R77 A;  3SDZ A;  3RKX A;  3DKM A;  4J83 A;  1YJW Q;  2CH4 W;  2EGA A;  5GAN 8;  3PIO A;  1PG5 B;  3X24 B;  2BKD N;  2HCK A;  4RTY A;  1WDX A;  4JJC A;  2EIF A;  2GTJ A;  2ROT A;  2W10 A;  2DF6 A;  3JCM f;  4B9X A;  4DEY A;  3MP1 A;  1MMG A;  3C12 A;  4J7F A;  4E6R A;  3M5A A;  2KDS A;  3CCU Q;  2YUP A;  2RM4 A;  2DNU A;  4KRT A;  1FX7 A;  3JCM P;  3PTA A;  1H64 1;  3QZ9 B;  4N0A C;  2VXE A;  1PKS A;  4PJO D;  4UC4 A;  2IVW A;  2XMF A;  4EIK A;  4ANJ A;  1N8R C;  3SHW A;  4EMK B;  3URG A;  2X9H A;  4J8O A;  4FU6 A;  4O6J A;  3CCE Q;  5GMK j;  2L3S A;  1VQL A;  2RPN A;  2O4X B;  4PJJ A;  2X35 A;  3M0P A;  3TCJ A;  3OA6 A;  2EQU A;  4HCB A;  4DQ2 A;  2CYZ B;  4C0D C;  1D1C A;  1D0Z A;  1SPK A;  2R58 A;  1UG1 A;  2X4Y A;  2JM9 A;  1RLQ C;  2D6F A;  1O9S A;  2JTM A;  4JS5 A;  2EYZ A;  4BE2 A;  2EJ9 A;  3SB2 A;  1BIA A;  1VQN T;  2LNV A;  2R57 A;  1X2K A;  3X20 B;  4C0F A;  1M8V A;  2LZ6 B;  1SRL A;  2K7A A;  3JV3 A;  1UDL A;  2E65 A;  3FLG A;  2X4X A;  3GOX A;  3REB B;  3UA6 A;  3ZBD A;  1MHN A;  2KXC A;  2HZY A;  4P5N A;  1D3B A;  4M78 C;  1V1C A;  2VVK A;  1M2V A;  2H3J A;  1I5O B;  1M90 C;  1VQO Q;  2F2X A;  4A4K A;  2LX7 A;  2LX9 A;  1TH7 A;  4E7S A;  1U3O A;  4E7I A;  5FLX E;  3G4S A;  3SWN A;  3OW2 P;  2DM1 A;  2DL5 A;  2E4H A;  3ZEH A;  2QTX A;  1LOJ A;  3LGL A;  1NPR A;  2FZK B;  1YI2 A;  3L2U A;  4PJO B;  2RJD A;  4V2S A;  1JRI A;  1M1F A;  1QLY A;  1YBY A;  2AKK A;  3CCR T;  4PFP A;  1M90 R;  4JPB W;  2NUT B;  2KRM A;  2A37 A;  4LUE A;  2J6F A;  4B6M A;  5GAN h;  2CP3 A;  4MZP A;  2PU9 B;  1Q7Y U;  5AYF A;  3VRZ A;  5GAM h;  1QVF S;  1WXU A;  1X01 A;  1G2B A;  1AOJ A;  4KBM B;  4FYY B;  2B8A A;  1N9S A;  3I9Q A;  3PE0 A;  1KG1 A;  5HKC A;  2LQ8 A;  5LJ5 g;  4E7J A;  3JCM V;  3QUI A;  3A98 A;  2VGM A;  4C92 F;  1X27 A;  2X51 A;  3EFO B;  2MPX C;  3OY9 A;  2A28 A;  3QO3 A;  4LN2 A;  2BE7 D;  4ZGE B;  4O5V A;  3HKS A;  9ATC B;  2KI7 A;  2DYI A;  3BFM A;  2F2V A;  4VUB A;  2EQJ A;  2OTL Q;  2PVO B;  3QWX X;  4PJO G;  4BAC A;  1IZ6 A;  3JB9 J;  2ZGW A;  5C0M A;  1M3A A;  1ZUY A;  2ZPE B;  1U1S A;  2RQW A;  4MDX A;  1QCN A;  2A3L A;  1WZO A;  4XTU A;  1Z9Z A;  4DBQ A;  3EG9 A;  3MET A;  5CVI A;  4QQG A;  4AFU C;  1TUD A;  3BY7 A;  1VQ4 A;  1IHW A;  3PT9 A;  1MMD A;  1YWP A;  2YRD A;  5CKE A;  3PMT A;  3CC2 T;  3N5B B;  1S72 A;  3M56 A;  2JXB A;  4X9C A;  3OYI A;  1UTI A;  2KYB A;  5A0L A;  4PFZ A;  2MF2 A;  4CC7 A;  1P92 A;  1YNZ A;  5GAN 2;  4IIM A;  3T9N A;  1OX9 A;  2V8K A;  4BI8 B;  3C95 A;  3PVL A;  5LJ3 g;  1ZSZ A;  4OMQ A;  2K5L A;  3M57 A;  2E3I A;  2ZPB B;  2HBP A;  3UF4 A;  1VQ6 Q;  3RES A;  3M54 A;  4E7K A;  1TXQ A;  1BI1 A;  1NPP A;  4C8Q E;  2EJF A;  3LH0 A;  3V7S A;  2C0T A;  3OS5 A;  1NEG A;  3JB9 H;  3NGP A;  1OEB A;  2HNI A;  1KQS A;  2D8J A;  4CI0 C;  1YFN A;  3X26 B;  1GBR A;  3CCJ T;  3FJP A;  1H8K A;  2DXB A;  3U23 A;  1LVK A;  2C06 A;  3M55 A;  4M77 D;  4ZGD B;  2XKO C;  1MNE A;  4OMP A;  5KYY B;  5J3B A;  4C8Q F;  3CPW S;  1Q86 R;  1GCP A;  1X6G A;  2CT4 A;  4AFZ C;  3CC4 A;  1VYU A;  2M0O A;  2QA4 A;  1W4S A;  3CCL Q;  1NYF A;  4EMK C;  2FG0 A;  2NWM A;  1MGQ A;  3M0R A;  3M4Y A;  4IUT A;  2KVQ G;  1AWW A;  2L3P A;  4FIB A;  5GAO m;  1XOV A;  1AWX A;  1RL2 A;  3VS1 A;  3JCM J;  3MKD A;  3G7Z A;  8AT1 B;  1GFC A;  1RAD B;  3RIR A;  3I55 A;  3A1P A;  1YIT T;  4XU3 A;  3M53 A;  1TUG B;  1ZA1 B;  2P84 A;  4OVA A;  2CSI A;  4M75 E;  2DK3 A;  4JRP A;  2J06 A;  2EWN A;  3CME A;  1MMA A;  5D7U A;  2CUB A;  2EFI A;  5IHK A;  4N4H A;  4M7D E;  1V76 A;  2EYQ A;  1K76 A;  2AZV A;  1OYX A;  2RN8 A;  4DEX A;  2D0Q B;  4ELY C;  4LDX A;  1UGR B;  2DYB A;  3CCV T;  3M0S A;  1K9M C;  4RTX A;  2QI2 A;  4MZM A;  4OML A;  1JQQ A;  2FPF A;  2KT1 A;  3OYJ A;  2EKH A;  3TQ7 P;  3CPF A;  2R5M A;  2ATC B;  5D6Y A;  1Y57 A;  4M7A F;  4M75 D;  2RD1 A;  4HKE A;  3EAE A;  1M3B A;  2YUQ A;  4NOY A;  5A0G A;  1W6X A;  4M7D D;  4M77 B;  4ZTJ A;  1M8M A;  4AG1 C;  4RTT A;  1WI7 A;  4F7U B;  4PJO C;  4C92 A;  5CR2 A;  1QKW A;  3SEM A;  4FM4 B;  1NE8 A;  5I21 A;  3KFV A;  3HL8 A;  2YUN A;  2MMP A;  1YHQ A;  1Q95 G;  1ZA2 B;  4OMM A;  1VQ7 Q;  1VQ9 Q;  2JM8 A;  4Z89 A;  1T0H A;  2P0K A;  3G6E A;  2OTJ A;  1EX4 A;  2VYT A;  3CD6 Q;  2HL5 C;  1K0S A;  2RJC A;  2AT1 B;  2O01 E;  2V1Q A;  3A8L B;  2E3H A;  2V8J A;  2EKO A;  3EG2 A;  2CP0 A;  4L5G A;  4IUQ A;  5IXF A;  1NEB A;  3JB9 D;  5KYW A;  2O31 A;  2FO0 A;  4C5H A;  1VQ5 Q;  3OYM A;  1RAE B;  3L2R A;  5CQY A;  5GAO r;  4F7U G;  3C0C A;  4JJB A;  1VYT A;  4JRK A;  1G3T A;  1WHK A;  2FL7 A;  5HCK A;  4E7L A;  1UB4 A;  1V29 B;  2MCN A;  2LJ1 A;  3G71 A;  2QQ9 A;  2RI2 A;  3S3O A;  2RO0 A;  4NL3 A;  1M1K U;  3ZL7 C;  4E7H A;  4XK8 E;  3M58 A;  4DBH A;  1YJ9 T;  2E12 A;  4WF2 A;  2EYW A;  4M7D B;  5GAN f;  1BI3 A;  2LQW A;  3EGX A;  3VJP A;  2ZPF B;  5GAM f;  4C8Q A;  1W2B P;  1BYM A;  3RKW A;  3G1J A;  4EMG A;  3MEU A;  3HFN A;  3A8M B;  4NL2 A;  2KNB B;  2VC8 A;  1VQM T;  1SSH A;  2LP5 A;  3AHU A;  5GMK i;  1XNI A;  2OX7 A;  4M78 B;  1K9A A;  4OB1 B;  2AHJ B;  4Y28 E;  1NLP C;  3HPW A;  5KYX B;  2YWW A;  4QW2 A;  3MP8 A;  2VXF A;  1H3Z A;  1BBZ A;  2VKN A;  2BE9 B;  3RDV A;  2HDA A;  1AEY A;  5GMK m;  4OB3 B;  4M75 G;  1VQL Q;  5LJ5 e;  1UEB A;  2G3R A;  3I35 A;  3QPH A;  2DL7 A;  2X3X D;  4QVD A;  2O2O A;  2MWO A;  4M7D G;  1W2B A;  2L3Q A;  1KK7 A;  2JJ9 A;  1JXO A;  3SD4 A;  3CCS A;  4KUI A;  1VUB A;  2DX1 A;  3JCM Q;  2KAF A;  4Q5W A;  2GTO A;  1Q81 U;  2L3R A;  2JUF A;  2W0Z A;  4Y92 A;  3LWI A;  2YT6 A;  1YN8 A;  1VQK A;  1QVF A;  3H8Z A;  1IRX A;  4M7A A;  1TWB A;  1W70 A;  4LDU A;  3MEW A;  4BB7 A;  1YCY A;  4JRI A;  1N5Z A;  3EHR A;  1ZX6 A;  1JO8 A;  1WXB A;  2XI9 A;  5AT1 B;  3RR6 A;  3X25 B;  1QVG A;  2ZZD A;  1VQP A;  3H6Z A;  3R6N A;  4L6V 5;  3VS2 A;  4D6W A;  3VS6 A;  1BK2 A;  2OJ2 A;  3CMA A;  3TRE A;  1YJN T;  1SHG A;  5LJ3 e;  3CCQ Q;  1OI1 A;  3OBW A;  1VQ8 A;  1QVP A;  1OQK A;  3JB9 G;  2VGN A;  2GNC A;  3G4S Q;  5FRM A;  1PHT A;  4FYW B;  2DVJ A;  4BDZ A;  1B7T A;  1KD1 U;  2DRK A;  5FW9 A;  1K73 U;  3BDU A;  3QYH B;  1YI2 Q;  2FHD A;  3VU3 C;  1AWJ A;  1F1B B;  1JXM A;  2EVR A;  2EYY A;  3E1S A;  4M77 C;  2JT4 A;  4BI3 A;  3H0I A;  2CP7 A;  1FXX A;  4RKU E;  4J9I A;  3QHS A;  2QGF B;  2QEX A;  2SEM A;  1B34 B;  2PUO B;  4OGE A;  2XU8 A;  1NJI U;  5I2M A;  2B86 A;  3CC7 Q;  5CKF A;  3FEO A;  1T3L A;  2X3W D;  3E19 A;  2EW3 A;  2CZ0 B;  4RCB A;  1D3B B;  1GCQ C;  2HBW A;  2DLP A;  1QCF A;  3VUZ A;  1M2V B;  1ZQ1 A;  3V8L A;  1RAF B;  5KE3 A;  2HSP A;  2LCL A;  2Y4X A;  1HSQ A;  2DPP B;  3JCM b;  2GQI A;  2KXD A;  1QW1 A;  3TSW A;  3CPW A;  1MMN A;  4EMH A;  1VQ4 Q;  3CXC S;  2KR3 A;  4LDW A;  4QQD A;  4MML A;  1KHI A;  5LJ5 j;  1S72 Q;  2DO3 A;  1H3H A;  1TG0 A;  2RI5 A;  4R0K A;  4F04 B;  3NTI A;  3EG0 A;  2WSC E;  2JS2 A;  2M02 A;  2D1X A;  3PVQ A;  4M75 C;  2ENM A;  1YIJ T;  1K8A C;  5FRN A;  2RB6 A;  4X1V A;  1CKB A;  2E6Z A;  2LT4 A;  3NTH A;  4A4E A;  5KH6 A;  3OYL A;  1X75 C;  4M7D C;  3CCM T;  1N8R R;  3RER A;  1KQ2 A;  2CZ1 B;  1OZ3 A;  3ASK A;  2HKN A;  1B3Q A;  2PUK B;  2P4R A;  3C4S A;  3VRY A;  3LYI A;  3QDR B;  2LCC A;  3OSS C;  5CIU A;  3RNJ A;  3OYG A;  2V26 A;  1KC8 U;  3RMQ A;  2O88 A;  2HSE B;  2DD4 A;  4WCI A;  2QGG A;  1VQN A;  3CC4 Q;  5LJ3 j;  3LGF A;  2RJF A;  2QA4 Q;  3KUF A;  4C0G A;  5GAN g;  1KQ1 A;  2J7I A;  2CP6 A;  1GL5 A;  3CCQ T;  3EG9 B;  2K6D A;  3NMZ C;  1M30 A;  5GAM g;  2K4Y A;  3UPU A;  2QTV A; 
#chains in the Genus database with same CATH homology
 4A4H A;  1VQK T;  2XHC A;  2MWP A;  4M77 G;  3CC4 A;  3NTK A;  2M0O A;  4R55 A;  2K5I A;  4A4F A;  2QA4 A;  1W4S A;  2DXU A;  3OB9 A;  4M78 A;  4RMO A;  4JLG A;  3PIP A;  4EMK C;  4XQ3 A;  5KE2 A;  4OGC A;  2EAY A;  3P8B B;  4QVC A;  3OYN A;  4ZGJ B;  1I8F A;  1MGQ A;  3M4Y A;  3WVE B;  2M16 A;  2ZCF B;  3ZFJ A;  3I56 T;  4HCZ A;  4IUT A;  1WNL A;  2KVQ G;  4YTL A;  4FIB A;  5GAO m;  1I81 A;  1XOV A;  3QXE B;  4ATO A;  2MI6 A;  1RL2 A;  3JCM J;  3L1A A;  3QSU A;  2XDP A;  3G7Z A;  4C92 E;  2DAQ A;  4J6W A;  4C8Q C;  3CCL A;  5GAN j;  3S3M A;  3RIR A;  3JCM e;  3I55 A;  1YIT T;  1PSF A;  2DZ9 A;  1YJW T;  4C0D B;  4XU3 A;  3M53 A;  4DOW A;  3LWH A;  5GAM j;  2E5Q A;  4M77 A;  4PNO A;  1Q82 U;  1WGS A;  4OB0 B;  5C6S A;  4XTY A;  4OVA A;  4C5E A;  3L2Z A;  4JRQ A;  1KC8 C;  4F7U A;  4HCC A;  4M75 E;  2DK3 A;  2LRQ A;  1U8R A;  2EQK A;  4JRP A;  2E1H A;  3CCR A;  3MO8 A;  5GAN 6;  2RK2 A;  2RHZ A;  1XTD A;  3FB9 A;  5KCO A;  2EWN A;  2EJG A;  3CME A;  4HT8 A;  4JDS A;  4PJO E;  4IUR A;  2EFI A;  2JZ2 A;  2M1H A;  4N4H A;  4M7D E;  3CC7 T;  1G5V A;  2D9T A;  1Y96 B;  4C5G A;  2GQV A;  4BE1 A;  2EYQ A;  4FT4 A;  2QXF A;  1GXI E;  2F69 A;  4CRI A;  4ELZ C;  5CAI A;  4XTW A;  5HY6 A;  3CCU T;  2V8I A;  1OYX A;  3GLX A;  1VIF A;  3P8H A;  2D0Q B;  2QQR A;  2OAU A;  3SWN B;  4HT9 A;  5DLQ E;  4C92 D;  4ELY C;  3MHX A;  1KQS S;  3A8G B;  4LDX A;  1M1G A;  1UGR B;  3DB4 A;  3CCV T;  1K9M C;  2QI2 A;  2HQE A;  4RCC A;  1HXD A;  4MZM A;  3PMI A;  2DZC A;  4FT2 A;  4XU1 A;  2NLU A;  3TEE A;  3OS0 A;  4XAX B;  3OYC A;  3OYJ A;  4PJO F;  3GIB A;  2DEQ A;  4MDW A;  2P4T A;  3CPF A;  3R6O A;  1JJ2 S;  2K3Y A;  2R5M A;  5D6Y A;  4M7A F;  4M75 D;  2RD1 A;  1VQL T;  2RK1 A;  2RHI A;  4BI4 A;  4HKE A;  3CCS T;  3EAE A;  1Q82 C;  4NOY A;  5CKB A;  4BDY A;  5L8R E;  3OMC A;  5A0G A;  2QDY B;  3A8H B;  1AHJ B;  5LL6 S;  3F70 A;  4M7D D;  4MMK A;  5LJ5 f;  4M77 B;  4ZTJ A;  5GMK e;  5FU6 C;  3CCE T;  1G3S A;  3OS2 A;  2DVE A;  3RUX A;  3CPW S;  4F7U B;  4PJO C;  2CZ6 B;  2KY9 A;  4C92 A;  5CR2 A;  2KQW A;  3FIF A;  4FM4 B;  3LX7 A;  3QII A;  1NE8 A;  2RHY A;  4IUV A;  2ZPH B;  1WJS A;  2QQA A;  5I21 A;  5GAN 7;  2KK4 A;  2XG8 D;  5GAO l;  2GFA A;  5GMK h;  1M4Z A;  2QQB A;  5FU7 B;  3V7R A;  5HK3 A;  1WQ7 A;  4J6X A;  3HL8 A;  4OMF B;  1EIF A;  4EPC A;  2MMP A;  1G3Y A;  1YHQ A;  3VYH B;  3CC2 A;  1YIJ A;  2Y90 A;  4M75 A;  2I2L A;  3GPL A;  3J7A F;  1LJO A;  1VQP T;  2DD5 A;  2P0K A;  2X4J A;  3JSC A;  3G6E A;  2OTJ A;  3FDR A;  4DOV A;  3CMA T;  3CCM A;  4PKC C;  2VYT A;  4M7D A;  3QYG B;  3CBM A;  2YLB A;  3VUB A;  1VQ8 T;  3HFO A;  4M78 G;  1JBM A;  2P0Q A;  5GAO n;  1VQ7 A;  1VQ9 A;  2RJC A;  1BI2 A;  2O01 E;  2DIG A;  3A8L B;  2CKK A;  2V8J A;  2EKO A;  1B34 A;  3GNG A;  4L5G A;  4IUQ A;  2LQK A;  5CO7 A;  1JJ2 A;  3HRT A;  4BY6 C;  3CD6 A;  3JB9 D;  5DY9 A;  1U1T A;  2YHT A;  1PSE A;  3OYD A;  2GCX A;  3G4S T;  3GNF B;  3SWN C;  3KBG A;  3QZ5 B;  4GLK A;  4C5H A;  2E41 A;  2DXC A;  3OYM A;  2HQX A;  2L5Q A;  4N4G A;  4EDU A;  3L2R A;  5LJ3 f;  3JCM g;  5CKD A;  2WAC A;  1VQO T;  5CQY A;  4M77 F;  4J6Y A;  1BI0 A;  2ZPG B;  4F7U G;  5GAO r;  1VIE A;  3CCJ A;  1YI2 T;  3JCM X;  4JRK A;  2PQW A;  1G3T A;  4JJN K;  2BUD A;  4LDY A;  4C8Q D;  4C92 B;  3LW5 E;  2FL7 A;  1WQW A;  4LDV A;  5D6W A;  3RKY A;  3OYH A;  4E7L A;  2RI3 A;  1UB4 A;  4FL6 A;  1LNX A;  1V29 B;  3CCQ A;  1VQ5 A;  4BD3 A;  2DTH A;  3M4G A;  4PL6 A;  2QEX T;  3HRU A;  1JB0 E;  5CQX A;  3G71 A;  3ER0 A;  2QQ9 A;  5IAY A;  2RI2 A;  4MZT A;  3S3O A;  5GAO p;  2RO0 A;  5J39 A;  4NL3 A;  4PLI A;  2CS7 A;  1I4K 1;  1M1K U;  1QP2 A;  1BKB A;  3M59 A;  3UT1 A;  4E7H A;  3SDZ A;  4XK8 E;  3M58 A;  3DKM A;  3RKX A;  4J83 A;  1BIB A;  2K5F A;  4LD6 A;  3OBY A;  4EMK A;  2KSS A;  1W2B S;  4C0Z A;  3MEA A;  5GAN 8;  1YJ9 T;  3I56 A;  3QBY A;  5CCA A;  5GAN 4;  2E12 A;  1N6A A;  1OZ2 A;  4WF2 A;  2P0P A;  3PIO A;  4M7D B;  2LT1 A;  1BI3 A;  5GAN f;  2DIQ A;  3X24 B;  1SSF A;  2BKD N;  3VJP A;  5GAO q;  2RHU A;  2O4X A;  4JS4 A;  2EIF A;  4XTX A;  2ZPF B;  2RH2 A;  3JRZ A;  4JLI A;  4C8Q A;  5GAM f;  2RA2 A;  5EG2 A;  5GAN d;  3RKW A;  4RG8 A;  3OYB A;  1YIT A;  4EMG A;  1BYM A;  3MEU A;  4KUL A;  1YJW A;  4E47 A;  3JCM f;  2VUB A;  4B9X A;  4PLL A;  5A2Q E;  3HFN A;  4XU2 A;  3MP1 A;  3C12 A;  3A8M B;  4XTV A;  4J7F A;  4BE0 A;  4NL2 A;  3M5A A;  1M9S A;  2KDS A;  2VC8 A;  1VQM T;  4A54 A;  2RM4 A;  3AHU A;  5GMK i;  2KMT A;  2M9U A;  2DTO A;  1WPY A;  1XNI A;  3GP8 A;  3BW1 A;  2K3X A;  4M78 B;  4OB1 B;  2AHJ B;  3HRS A;  4Y28 E;  3CC7 A;  3NFC A;  1FX7 A;  5D6X A;  3Q1J A;  2DTI A;  4C92 G;  5GAN 5;  3HPW A;  3JCM P;  3PTA A;  1Y7X A;  1QVG S;  1H64 1;  3MCA B;  4QW2 A;  3OW2 A;  3DB3 A;  3MP8 A;  2VXF A;  3CCU A;  1H3Z A;  3QZ9 B;  3MEV A;  3CBO A;  3OMG A;  4N0A C;  1M1K C;  2DXT A;  2K57 A;  2VXE A;  2OTL T;  4PJO D;  5GMK m;  2JNG A;  3HP9 A;  2LDM A;  4FSX A;  4M75 G;  4OB3 B;  2FVU A;  1VQ4 T;  5LJ5 e;  4UC4 A;  1UEB A;  3CCV A;  2G3R A;  2GF7 A;  2IVW A;  1FWZ A;  3QPH A;  4M7A D;  1S72 T;  3M9Q A;  4Z02 A;  3UDC A;  4QVD A;  1N8R C;  4EMK B;  3URG A;  4X34 A;  4J8O A;  4FU6 A;  5LJ5 d;  2MWO A;  4O6J A;  3S3N A;  4M7D G;  1W2B A;  1X6O A;  5LJ5 h;  2FYK A;  3QJY A;  5GMK j;  2CGH A;  1VQL A;  3LLR A;  2LTO A;  2O4X B;  3E9F A;  1NJI C;  3SD4 A;  3CCS A;  2X35 A;  4KUI A;  1M90 U;  4QVZ A;  1VUB A;  3TCJ A;  4C8Q B;  5CK9 A;  4J7I A;  3JCM Q;  3OYA A;  3OA6 A;  2KAF A;  2EQU A;  4Q5W A;  4HCB A;  1Q81 U;  4DQ2 A;  3CCE A;  1O75 A;  2CYZ B;  4C0D C;  3DLL A;  2L3R A;  2JUF A;  1IRE B;  2R58 A;  3UWN A;  3LWI A;  4PJO A;  2X4Y A;  1QVF A;  1VQK A;  4M77 E;  3CEY A;  3H8Z A;  4M7A A;  2GFU A;  1VQ6 T;  2D6F A;  1NZ9 A;  1KHC A;  1O9S A;  2JTM A;  4JS5 A;  2BIV A;  4OB2 B;  4F7U E;  3DLM A;  4LDU A;  3WXM B;  4BE2 A;  2EJ9 A;  4M7A C;  4M78 F;  3MEW A;  3SB2 A;  4BB7 A;  1YCY A;  1BIA A;  2MAM A;  3CBP A;  1HK9 A;  3C94 A;  4JRI A;  2HAX A;  4ZTF A;  1VQN T;  2XI9 A;  2E6N A;  4JUV A;  4GY5 A;  2LNV A;  2R57 A;  3X20 B;  3X25 B;  4C0F A;  2ZZD A;  1VQP A;  1QVG A;  1M8V A;  3H6Z A;  3OSV A;  4L6V 5;  2LVM A;  1Q86 C;  4D6W A;  3FC3 A;  2E65 A;  3FLG A;  4BUG A;  2X4X A;  3GOX A;  3CMA A;  2XD0 A;  3TRE A;  1YJN T;  3ZBD A;  1MHN A;  2FB7 A;  5LJ3 e;  1OI1 A;  3OBW A;  2XK0 A;  2L8D A;  1VQ8 A;  1QVP A;  4P5N A;  3SFM A;  3OYY A;  3JB9 G;  2DKG A;  3CC4 T;  3QJ6 A;  1D3B A;  2VGN A;  1RI0 A;  5FRM A;  2QA4 T;  4M78 C;  3OQ5 A;  4BDZ A;  3OYF A;  2LC4 A;  5LJ3 d;  3CXC A;  2H3J A;  4F7U F;  1KD1 U;  1G3W A;  3OW2 S;  1M90 C;  4NS5 A;  5LJ3 h;  4ME7 A;  1K73 U;  3QKJ A;  5IN1 A;  3BDU A;  3QYH B;  4A4K A;  4ZN3 A;  2FHD A;  1TH7 A;  2LX9 A;  3PFS A;  3VU3 C;  4LD9 K;  1Q81 C;  4C8Q G;  4E7I A;  2JVV A;  1UGQ B;  5FLX E;  2QQS A;  5DLO A;  3G4S A;  1ZHI A;  3SWN A;  3CCL T;  3JCM c;  5GMK l;  1N9R A;  3I55 T;  3ZEH A;  3E1S A;  1ZBX A;  2QTX A;  1LOJ A;  2IG0 A;  1NPR A;  2R5A A;  3LGL A;  4M75 B;  4TVR A;  5FU6 B;  4M77 C;  3V7C A;  3OS1 A;  1VQO A;  1YI2 A;  4A4G A;  4BI3 A;  3L2U A;  4PJO B;  1UGS B;  2JOY A;  2RJD A;  3TU4 K;  3RMS A;  4V2S A;  1JRI A;  1FXX A;  3A5Z B;  4M7A B;  5GAN e;  4RKU E;  4OP0 A;  1M1F A;  1YBY A;  3CCR T;  3QHS A;  4J5Y A;  1N8R U;  2YRV A;  2QEX A;  1WJR A;  3CME T;  4XU0 A;  5FU7 C;  5GAM e;  2ZPI B;  3EFR A;  2F5T X;  3BDL A;  1M5Q 1;  3A8O B;  1B34 B;  2PUO B;  4OGE A;  5GAN h;  2X4W A;  1I5L A;  4MZP A;  3VKI A;  2XU8 A;  2PU9 B;  1NJI U;  5I2M A;  1Q7Y U;  5GAM d;  5CKF A;  5AYF A;  3FEO A;  5GAM h;  3J81 E;  3JCM d;  1QVF S;  2WSF E;  1X01 A;  1YJ9 A;  3E19 A;  4KBM B;  3JCM h;  3VV0 A;  1K8A U;  2B8A A;  2CZ0 B;  1N9S A;  2JTF A;  3GF5 A;  3PNW C;  3PGG A;  4RCB A;  5HKC A;  1D3B B;  2LQ8 A;  1KD1 C;  5LJ5 g;  1K73 C;  5M9O A;  1KG1 A;  4E7J A;  3JCM V;  3VUZ A;  3QUI A;  1ZQ1 A;  3V8L A;  4OF1 A;  5J26 A;  5KE3 A;  4II1 A;  2VGM A;  4C92 F;  1K9M U;  1XQH A;  2RHX A;  4B9W A;  3OY9 A;  2LCL A;  2PVD B;  2Y4X A;  3QO3 A;  4BY6 B;  4IKF A;  2DPP B;  3JCM b;  2JN0 A;  3WVD B;  2PVG B;  4ZGE B;  1QW1 A;  2K2V A;  4O5V A;  1VQM A;  4N4I A;  3HKS A;  4ZN1 A;  3V8K A;  3OYE A;  3CPW A;  3BFM A;  1QP3 A;  3JAM E;  4VUB A;  1N27 A;  1Q86 U;  4M75 F;  2EQJ A;  2PVO B;  3EFS A;  4RG2 A;  4PJO G;  4Y91 A;  4EMH A;  4BAC A;  2XDB A;  3CXC S;  1IZ6 A;  4LDW A;  3ME9 A;  4QQD A;  2ZGW A;  1KHI A;  2ZPE B;  4MML A;  5C0M A;  3JCM W;  5LJ5 j;  3JB9 J;  3E9G A;  4C92 C;  4M7A G;  2DO3 A;  2RJE A;  3OYK A;  1U1S A;  1UGP B;  4MDX A;  4M78 E;  4KT0 E;  4M7D F;  2RI5 A;  4R56 A;  4XTZ A;  2XID A;  2A3L A;  1Q7Y C;  3NTI A;  4XTU A;  4N0A A;  3QG1 A;  3MET A;  2WSC E;  4QQG A;  5CVI A;  2OTL A;  4HA8 A;  3BY7 A;  1VQ4 A;  3PT9 A;  4X9D A;  2VV5 A;  5CKE A;  5FRO A;  1YHQ T;  3PMT A;  3CC2 T;  3HHT B;  3N5B B;  4M75 C;  1S72 A;  3M56 A;  1YIJ T;  4X9C A;  1K8A C;  3OYI A;  5FRN A;  2RB6 A;  5A0L A;  2MF2 A;  2LT4 A;  1P92 A;  2E6Z A;  2A7Y A;  3INZ A;  3NTH A;  4IUU A;  4A4E A;  5GAN 2;  5KH6 A;  1WJQ A;  1X75 C;  3OYL A;  3T9N A;  3G6E T;  2OTJ T;  2V8K A;  4IUP A;  4BI8 B;  3CCM T;  4M7D C;  3RER A;  3C95 A;  4QQ6 A;  3MP6 A;  3V8J A;  1KQ2 A;  5LJ3 g;  3VYG A;  2CZ1 B;  2K5L A;  2WSE E;  1OZ3 A;  2ZPB B;  3ASK A;  2HBP A;  3L42 A;  3M57 A;  1VQ9 T;  1VQ7 T;  5I2S A;  2PUK B;  3RES A;  3M54 A;  2CZ7 B;  2E70 A;  4E7K A;  5GAN 3;  3S6W A;  2DJZ A;  3C4S A;  1BI1 A;  5HK0 A;  2HD0 A;  1NPP A;  2E10 A;  3L2W A;  3FRN A;  4C8Q E;  3P8D A;  3LYI A;  3QDR B;  3HSB A;  2EJF A;  3LH0 A;  3V7S A;  4A53 A;  4M78 D;  4C5I A;  2LCC A;  5IT9 E;  3CD6 T;  3OS5 A;  3OSS C;  5CIU A;  3OYG A;  3JB9 H;  1VQ6 A;  4M7A E;  2L89 A;  2HNI A;  3J80 E;  5DM7 R;  1R8O B;  3KXT A;  1DJ7 B;  1KQS A;  1KC8 U;  3RMQ A;  2F5K A;  4CI0 C;  4L59 A;  4KUD K;  2YLC A;  3JB9 F;  3X26 B;  5A0D A;  2DD4 A;  3CCJ T;  1VQN A;  5KCH A;  1Y07 A;  3FJP A;  5LJ3 j;  3LGF A;  2XDD A;  1Y96 A;  2DXB A;  2RJF A;  3L2V A;  2XIC A;  3KUF A;  4C0G A;  3L2Q A;  2C06 A;  3M55 A;  5GAN g;  1KQ1 A;  2E64 A;  2EQM A;  3O8V A;  4M77 D;  3CCQ T;  1VQ5 T;  3X28 B;  4DA4 A;  4ZGD B;  2XKO C;  1YJN A;  5GAM g;  3JB9 I;  3G71 T;  5J3B A;  5CKH A;  4C8Q F;  2Y4Y A;  2K4Y A;  3UPU A;  1Y71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...