3SD4A

Crystal structure of the first tudor domain of human phf20
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
b'GHMHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3sd4A00
2EQUA 4E7JA 3SD4A 3MP6A 4BACA 3LH0A 1OZ3A 2VYTA 2RJCA 3NTHA 4QQ6A 3LYIA 4B9WA 3OYDA 2FHDA 2EQJA 2QQRA 5D6WA 3L2VA 4BE1A 3QJ6A 5FRMA 3CEYA 2B8AA 3S3MA 3MP1A 2X4YA 4IUPA 2JTFA 2X4XA 4N4IA 3QBYA 3OY9A 2MWOA 5C0MA 2LCCA 2R57A 4Z02A 3L2UA 4II1A 3OQ5A 3PFSA 4QQDA 3E9FA 4A4FA 3S3OA 2LDMA 5KCHA 2L3RA 4PLIA 3OYCA 4ZTFA 2P0KA 2RI2A 4QW2A 4BE2A 1H3ZA 2X35A 3H6ZA 4PLLA 2RHZA 1WGSA 2G3RA 3ME9A 4FU6A 1XNIA 3OYIA 3FEOA 3OYGA 3PMIA 3OYFA 2PQWA 5KH6A 3E9GA 2YRVA 3FC3A 2LTOA 2LVMA 1SSFA 2E5QA 4Q5WA 4QQGA 4UC4A 3EAEA 3OS1A 3OYEA 3OA6A 2MWPA 5IN1A 3OMGA 4X34A 5D6YA 3PNWC 5D6XA 3LLRA 4C5IA 3QKJA 2RHXA 1OI1A 2WACA 3L42A 3OYLA 2EQMA 2RHUA 2L8DA 4A4EA 2HQXA 2M1HA 4N4HA 5CIUA 2RO0A 2K3YA 2RI3A 2EFIA 2D9TA 3ZEHA 4E7IA 1KHCA 1WJQA 5FRNA 1G5VA 5J39A 4LD6A 2M16A 3NTKA 4BD3A 5KCOA 2IG0A 4BDYA 2QQSA 1RI0A 3MEUA 5C6SA 2L89A 1N27A 2O4XA 3OYAA 4QVZA 4C5GA 3META 1OYXA 2R5MA 2XK0A 3QIIA 4HCZA 4RG2A 4ZTJA 3P8HA 3MP8A 3P8DA 4IKFA 3MEAA 2EQKA 3MEVA 2DAQA 4IUQA 3LGFA 3OYHA 3OYNA 2DIQA 3ASKA 5M9OA 3L2RA 5J26A 3OYKA 4NS5A 2LRQA 2JZ2A 2R5AA 2CKKA 3M9QA 2NLUA 3DLMA 4A4GA 5KE2A 2RJEA 4L59A 3OYBA 3O8VA 3C4SA 3OS2A 4E7HA 4IURA 4IUTA 2RJFA 3S3NA 3OYJA 4E7KA 4IUVA 2RHIA 2E6NA 2GFUA 3L2QA 5FROA 1WJSA 3KUFA 2BIVA 2BKDN 2RJDA 4N4GA 2R58A 3NTIA 3UT1A 2RI5A 3DB3A 1WJRA 1OZ2A 2GF7A 4CRIA 5KE3A 2HQEA 3BDLA 4E7LA 2O4XB 3LX7A 4C5HA 4PL6A 3DB4A 4FL6A 4B9XA 3OB9A 4EDUA 3MO8A 3FLGA 2XDPA 3MEWA 2X4WA 2F5KA 2DIGA 3UWNA 4A4HA 4C5EA 2EKOA 3Q1JA 3H8ZA 4IUUA 3OMCA 1MHNA 4GY5A 4OVAA 5IAYA 3L2WA 3LGLA 2RHYA 4BE0A 2BUDA 3S6WA 3OYMA 2M0OA 3FDRA 3F70A 3GOXA 4BDZA 2K3XA 2GFAA 3PMTA 3OS0A
chains in the Genus database with same CATH superfamily
2QEXT 3MP6A 2HEQA 5KYXB 2CZ7B 2VWFA 1VIFA 4JDSA 4C92A 1XTDA 1YWPA 2EVRA 3CBPA 2A37A 3WVDB 2FRYA 1H3HA 1BI0A 2KXDA 4AG1C 4P5NA 1MUZA 2RM4A 4QW2A 4C92E 4D6WA 1WQ7A 4ZN1A 3H41A 4LN2A 4FSSA 3KFVA 2E5QA 2QA4Q 4UC4A 1SG5A 2WSCE 3QZ5B 5IHNA 3MJXA 2MI6A 2K3YA 2W10A 1W2BP 3VKIA 5GAN6 2X4JA 3M53A 3VRYA 1VQ9T 2O4XA 1IO6A 1RUWA 1D3BA 2KDSA 1VQKQ 2YLBA 3UF4A 1KSWA 4WF2A 1UJ0A 2QDYB 4KUIA 2E3HA 1VQ6Q 4F7UA 2CKKA 1HD3A 3M9QA 3RESA 2RJEA 2DMOA 2EGCA 3I9QA 2BZXA 1QKWA 1X43A 3JAME 2JOYA 1Q81C 1S72T 4F7UE 2GFUA 2DTHA 4C8QG 1M3AA 3UT1A 1VQOQ 3DB3A 4PJOB 2PTKA 1R0BG 2MCNA 5GMKe 3VYHB 1UHCA 1VQ7T 2ZCFB 4FYVB 1QVFS 4OVAA 2GQIA 4J9BA 2FRWA 3PMTA 2K2VA 5GAOr 1O75A 1E6GA 1WZOA 2OTLT 4RTTA 1K8AU 1R8OB 2J6OA 5A0DA 2DXBA 2F1LA 1RAGB 4OMLA 1IRXA 3QO3A 3UA7A 1NPRA 2JTFA 3JCMe 2DXCA 2R57A 3OSVA 5DY9A 3HRTA 2LQNA 5KCHA 4XTVA 7AT1B 3RUXA 3JCMc 2P0KA 4DBFA 4WCIA 5CKHA 1M9SA 2MIOA 3OYIA 3VU3C 4M78F 4PNOA 3OW2A 1X6BA 1KQ2A 1BK2A 2V8KA 3OYEA 2LNVA 3OBYA 1RAHB 2DL5A 2NUZA 3A8LB 5D6YA 5D6XA 1VQPA 1YIJA 4E2FB 4L5GA 3N5BB 2E6ZA 4DBRA 2KK4A 4AFUC 3ZEHA 2CP3A 1WHLA 4KGVB 2M16A 1WXTA 3CMAT 5GANf 2L89A 4HXJA 4M7AD 3TREA 2VKNA 2FZGB 4KGZB 1TWBA 3MEAA 4ZN3A 2CGHA 1W1FA 3L2RA 1LOJA 3J81E 1KQSS 3SWNA 5KYUA 5IHKA 1E7OA 2NLUA 3CCVA 3OYBA 3INZA 5HCKA 1YJWQ 2LCSA 1JXMA 3GLXA 2JMCA 2A7YA 3D7SB 5LJ3j 4C92C 5GAMj 5A2QE 1QVPA 3QHSA 3CCUT 1KK7A 1JJ2P 3M57A 4F17A 3NTIA 2CZ0B 1PHTA 3CCJA 3PE0A 1U06A 3CD6Q 5CO7A 2DIGA 3RIRA 1ABOA 4C0GA 1YHQT 5GAOl 4M75F 1YWOA 4JLGA 1GCPA 5CK9A 4FCYA 3L2ZA 4KBMB 1B34B 3CPWA 2DJQA 2JTEA 3AHUA 3EGXA 1BI2A 2XHCA 3LH0A 2DEQA 2DJZA 4BE1A 2KR3A 8AT1B 3G71A 4QQDA 3FB9A 1VUBA 2PUOB 2RI2A 2X35A 3FIFA 1N8RR 3R6NA 1Q7YU 1PSEA 2DK3A 3OW2P 2YUPA 3VS6A 2LJ0A 4QQGA 4JS5A 2DL4A 1B3QA 1VQ5T 1J3TA 3VRZA 5KYYB 1JQQA 2WACA 2RHUA 4GLKA 3P8BB 1W70A 4EIKA 3RKWA 5GAOn 2HKQB 4MDWA 4XU2A 1KG1A 1ZBXA 3META 1BB9A 4IKFA 2IIMA 4HCKA 4PFZA 2ESWA 2DIQA 2DA9A 9ATCB 2DBMA 3GIBA 1KQ1A 1YJNA 3QDRB 2HKNA 3GNGA 2HBWA 2ABLA 4IUTA 2RJFA 4J9HA 1D09B 1W4SA 4IUVA 4OB1B 4A63B 1K73R 3M0UA 3X24B 4M77G 2LC4A 3HRUA 2CUDA 1GXIE 2DFUA 2COWA 3VUZA 1IB8A 2VB6A 2K79A 1T3SA 4XTYA 2PU9B 2ZPFB 3FLGA 4M78A 3DKMA 2E5KA 2FPEA 5GANe 3CMET 2WSFE 3OMCA 3NMZC 2DPPB 1D1CA 1NPPA 3CCQA 5CKEA 5LL6S 2LJ3A 4M78E 3CPWP 4ZGEB 1WNLA 2JM9A 1KFZA 4OMPA 2DEUA 2KRNA 2AZVA 5J3BA 4J9GA 2X4XA 4JUVA 3TEEA 3C94A 2Z0WA 2RD1A 3E9FA 3SWNC 5CKFA 4ZTFA 2KBTA 4XU3A 4AMCA 3V8JA 4BE2A 3SDZA 3O5ZA 1WGSA 2E41A 1NZ9A 2CYZB 4QKUA 2YUOA 3OYGA 5KH6A 3EG9A 1D0ZA 1X69A 1JBMA 3OS5A 1AWXA 2JJ9A 2RQRA 3CCSQ 1VQPT 1YIJT 4E7SA 1WXBA 4C5IA 2VXFA 4RUGA 2ZPHB 3RMQA 1LCKA 5DLQE 1MMNA 2EFIA 2X3XD 1Q95G 4C92B 4LD6A 4BD3A 4QVDA 2IG0A 4BDYA 4FYWB 3MPUB 1N27A 2E70A 1M90U 4M75A 1BI3A 1B07A 2VGMA 2YT6A 2JZ2A 2O31A 3CC2Q 2PNIA 4M75E 3TU4K 5GMKm 4Y91A 4E7HA 3CCRA 1SKUB 2WSEE 3CC4Q 2QDLA 5HK3A 2KEAA 1AZEA 1R77A 1WJSA 1UG1A 2BKDN 1AWJA 4OP0A 1Q86U 2E65A 1VQMA 3CCJT 2O4XB 4XAXB 4O5VA 4JRQA 5FW9A 4EDUA 1D3BB 3G7ZA 3MO8A 1NYGA 1YI2Q 1K8AC 1ZSZA 1SEMA 1JB0E 3JSCA 3H8ZA 4F7UB 4IUUA 2K7AA 4IIOA 3FJ5A 4BE0A 2XU8A 3BY7A 4C0DC 2CDTA 2DVEA 3X25B 3G4SA 4KULA 5AYFA 1O9SA 1T3LA 3H0IA 3G6EA 1WI7A 2D0QB 2HSPA 2KSSA 4J8OA 2DTOA 1QVGA 1GL5A 3QBYA 2NUPB 2DE0X 3PFSA 4DBHA 3LWIA 2JS0A 2D8HA 1EIFA 1D0XA 2DBKA 5GAOp 2BTTA 5LJ3d 5GAMd 2NUTB 2PQWA 2W0ZA 1X01A 3M58A 1UDLA 1Q82C 4O6JA 3FRNA 2EQIA 3I35A 1MNEA 4XK8E 5D7UA 3E19A 2JMAA 3CBMA 2D1XA 3LWHA 1VQ8A 5CIUA 1JEGA 4MDXA 3CCLA 5FLXE 1IZ6A 4M78C 4HA8A 1VQLT 1PWTA 2HD0A 3CCEQ 1RI0A 1YJ9Q 2ZAEA 2EWNA 4C5GA 2R5MA 3X20B 2PVGB 3QPHA 1YITQ 1M30A 2DAQA 1WDXA 5LJ5f 3JCMV 5I21A 3ASKA 4OGEA 2V1QA 2K5LA 1R0CB 1W2BA 4JPBW 2K3BA 1PRLC 3MHXA 2OAUA 3GP8A 1SHFA 5I11A 2AZSA 2QEXQ 3HL8A 3EHQA 2ZPBB 1AOJA 3I56Q 2K5IA 4LXCA 4R56A 1RAFB 2GTOA 1WQWA 1PD0A 4HVVA 2ZGWA 4B6MA 2QGFB 2Y4XA 3SWNB 1VOMA 3C12A 3CCQT 1YCSB 3CC7T 4BI3A 1MGQA 2O01E 1KD1R 2VC8A 4DA4A 4JLIA 1BYMA 3GF5A 4A53A 4E7JA 3M0RA 4FW1A 4X1VA 3J7AF 1YITT 5FWCA 1OPKA 5LJ5h 4BACA 4JRIA 1K76A 1TG0A 3OYYA 1PKSA 3M59A 4M75C 1X6GA 3RKYA 3EFOA 1QVGP 3VS4A 2DD4A 4IUPA 3JCMX 3JV3A 2KI7A 2LCCA 3THKA 4M7DG 3HPWA 3T9NA 1G3WA 1JU5C 2V8JA 1VQ9Q 2MOXA 4M4ZA 1QKXA 2VGNA 3JRZA 4OMFB 2DXUA 1AHJB 1S1NA 5GMKi 2HDAA 5IN1A 4ELZC 1VYVA 3I56T 1K9MC 2QAZA 4M77D 4M7AA 2EQMA 2L8DA 4FIBA 4LDYA 4AT1B 1ABQA 4ZNXA 1AWWA 2DL7A 3HKSA 2LT1A 2LJ1A 1S72Q 1GCQA 1ZSZC 2QQSA 2RK1A 2PZ1A 2DRMA 4M7AE 3X28B 2VUBA 2RK2A 5CKBA 2XI9A 2EYYA 1ZX6A 2FL7A 1RL2A 3M5AA 4L59A 1PRMC 1VQ7Q 2LZ6B 1JO8A 4WTOB 4L6V5 3V8LA 3UATA 1FWZA 4C8QF 2E1HA 1M3BA 2EYXA 4J83A 2RPNA 4C0DB 2V8IA 4J9DA 1AVZC 3V7CA 4F16A 2R58A 2OTLQ 2K6DA 4PL6A 3X26B 4Y92A 2RNAA 4FL6A 4B9XA 2MK5A 2XDPA 3CD6A 2X4WA 2RQUA 2DVJA 3BFMA 3I55A 3ZFJA 2QQBA 2RHYA 3CCMA 2JM8A 2MYSA 5LJ5e 2XG8D 2GQVA 2HQHA 4RTZA 2DXTA 1TH7A 2C0IA 3ER0A 4RMOA 1JJ2A 3SD4A 3EFSA 2F69A 4ANJA 1EZZB 1QVFP 2EKHA 3VS2A 2PVOB 2BE9B 3G6ET 2QQRA 3L2VA 2SEMA 4OMNA 4OMQA 1UE9A 3EGUA 1WLPB 4OF1A 5GANj 1PSFA 2OI3A 4VUBA 3S3OA 4M78B 3EHRA 3CMAQ 4RG8A 3GBQA 1VQ4A 1IXDA 2BZ8A 4RTXA 4LDXA 1XNIA 4DBQA 2A08A 3E9GA 2LTOA 1VIEA 1M90C 3OBWA 2OTJT 1VQ8T 4X9DA 3EG0A 4A4EA 3CCLT 1U8RA 2KT1A 4J6YA 3SEMA 1LNXA 5FWBA 4DOVA 3QZ9B 3CCUQ 2J05A 1N8RU 3EFRA 2ATCB 3OYNA 5J26A 1EFNA 2YDLA 1N9SA 2ROTA 1WHMA 1Q86C 3OS2A 3PVQA 1YHQQ 2DETA 4IURA 1X75C 1PM3A 1KQSP 1FMKA 1F1BB 1Q82U 1I8FA 3M0SA 1OOTA 3KUFA 2ZPIB 5EG2A 1VQNA 2EYWA 2KVQG 4M75B 1I1JA 3E1SA 3C95A 1KD1C 1KC8C 3MEWA 2CP0A 1Y96A 2EKOA 1AT1B 3VS3A 3ZL7C 3JCMd 1JXOA 2G6FX 4PJOG 4M7AC 2RQVA 3GOXA 2GFAA 3ZBDA 1K73U 2EQUA 4RTWA 1RLQC 4MZMA 1MMAA 3VV0A 1GCQC 2QYZA 1BCOA 1NLPC 1MMDA 1BCMA 2RN8A 3LYIA 1QMCA 5CR2A 1PD1A 2JUFA 1VQ5Q 2MPXC 4V2SA 4FW2A 2X4YA 4RTUA 2QXFA 1WA7A 1WXUA 4ME7A 2XMFA 4Z02A 2E4HA 2L5QA 4A4FA 2QK0A 4E6RA 1G83A 3OYCA 2IVWA 4HVUA 1ZSZB 1GFCA 4LDVA 1X27A 4BI4A 5LJ3g 5GAN8 3H6ZA 5GAMg 2RHZA 3MKDA 1M4ZA 4C8QA 2L3PA 8ATCB 4N0AA 1T0HA 3WVEB 1WHGA 2LQKA 3OMGA 3QKJA 4C8QE 4KH0B 3L42A 2LT4A 2EBPA 4N4HA 2QG9B 3QYHB 1CKAA 4HCCA 2X51A 4JJBA 5KYNA 1KHIA 4BUGA 4HCZA 5KYXA 3EH2A 2V1RA 2J6FA 5GAN3 3OYKA 2RQTA 4MZTA 2DRKA 3QYGB 1P92A 3CMEQ 4RTYA 1M2VB 5GAN4 4M77F 4F14A 1TU0B 3EG3A 4XU1A 4N4GA 1IHWA 1K9MU 1VYTA 1WJRA 1ZLMA 4M7DD 2DL8A 1GBRA 1CKBA 2LX7A 4ESRA 2DYIA 1YI2A 2QQ9A 4QVCA 1N5ZA 3I55T 1K4US 4ZGDB 5GAN7 1TSFA 4GY5A 3L2WA 3CCMT 5GAN5 4X9CA 2M0OA 2L3QA 1NJIR 1CSKA 1RAIB 1C0MA 5CVIA 2J06A 1VQPQ 1YIJQ 1AEYA 1RABB 4N4IA 4DOWA 2PUKB 3UPUA 2E10A 4Y28E 3H0FA 2VV5A 4J7IA 4PKCC 1I81A 1XOVA 3ME9A 4LNPA 1G3TA 3ULRB 3OYFA 2XKOC 1GBQA 3QJYA 2RH2A 3URGA 2GNCA 3SB2A 4F04B 3PNWC 4OB3B 2K5FA 1OX8A 2M1HA 5FRNA 3EFOB 2RMOA 1U1TA 4LDWA 5CQYA 1K0XA 2VVKA 1YJ9A 1BBZA 2C0TA 2YLCA 2KMTA 2XK0A 2F2VA 1RLPC 4JJCA 2CS7A 3OSSC 2EQKA 4LE9A 1U1SA 3VS0A 3CCJQ 2YSQA 1M1KR 5KE2A 5HKCA 4C8QD 1V29B 2EAYA 3OYJA 1KIKA 4E7KA 3L1AA 5IH2A 2CH4W 5GANd 2RHIA 4M7AB 2IPOB 2O2OA 1Q7YR 1Y57A 2DZCA 2JN0A 3CXCS 5I2MA 1WHHA 2RA2A 2QEXA 1UHFA 1ZHIA 2LCLA 1VQNT 3PGGA 4E7LA 5I2SA 4XQ3A 2P0PA 1FXXA 3CCVT 2F5KA 3A8HB 4DQ2A 3JCMb 1OEBA 1NEBA 2DM1A 1D1AA 3QWXX 3F70A 2COZA 2EJGA 2I0NA 2L0AA 4J6XA 2O88A 1VA7A 2CUBA 2KGTA 2OAWA 4B9WA 2H3EB 2DTIA 3H9NA 3M4GA 2A3LA 1I07A 3OY9A 2COYA 1C1AA 3A98A 5A0LA 2NWMA 3A8MB 1YFNA 5IHIA 1VQLQ 2Y90A 5LJ5j 1VQ9A 4LUDA 4J9CA 4FU6A 2QI2A 4M77A 1H8KA 3HFOA 1ZQ1A 1KD1U 1KC8U 4JRKA 1XJWB 4NOYA 2L2PA 4Q5WA 3UA6A 3OA6A 1MV3A 2MWPA 2FZKB 2YUNA 1YJNQ 2BZYA 4PJMA 5KYWA 5GMKj 4M77E 3JB9J 1N8RC 1YNZA 2HMAA 4QT7A 4RTVA 3G71T 1JRIA 1UJYA 3M54A 2BE7D 2CP5A 2GTJA 1YP5A 3SFMA 1RAEB 1G8XA 1RAAB 3QIIA 1Z9ZA 4XTWA 1QCNA 4IUQA 1Q81R 2QA4A 2KNBB 4C92G 4PJOD 2YRDA 3DLMA 3HHTB 1TUCA 3C4SA 3JCMQ 4EMKA 3CC7Q 3CCQQ 2P4TA 2FYKA 4EMGA 1I4K1 4K11A 2OX7A 1ZUUA 4F7UF 4HT9A 1WFWA 1ZUKA 4XTXA 3KXTA 1HK9A 1QWEA 4J6WA 1VQKA 1UGPB 1D1BA 4PFPA 4LUEA 1ACMB 2GGRA 1K73C 1DJ7B 1VQ6A 2EYQA 1ZSGA 2EJ9A 4AFZC 1YJNT 3V7RA 3CBOA 3UWNA 4A4HA 4FYYB 1LPLA 2O9SA 1HYOA 1G3SA 3JCMg 3JB9F 1Y0MA 2RF0A 1XQHA 4J9IA 3WXMB 1T0JA 1VQOA 2RJCA 1UECA 1EX4A 4F7UG 5D6WA 1IHVA 4FT4A 4M7DF 2JS2A 3CEYA 1GRIA 2MWOA 4J9FA 1MV0B 3REAB 5KYUB 3QWYA 1M8MA 2GCXA 3RERA 3I5SA 4XU0A 3MCAB 3JB9G 2DERA 3PMIA 4BI8B 1IREB 1A0NB 1RI9A 1QVFA 2KXCA 3EAEA 2F5TX 1SRMA 2LQWA 3LLRA 2QGGA 4YTLA 2KRSA 3AT1B 2ENMA 1I0CA 4KT0E 3TVTA 3R6OA 1SF9A 4NL3A 5GAOm 1HXDA 2EPDA 3KBGA 1M1KC 4FT2A 4OGCA 4CC4B 2PVDB 2AHJB 3RNJA 1N6AA 4HKEA 1VQMQ 4R0KA 2YRCA 2LRQA 4NS5A 1M8VA 2DF6A 1X2QA 3EGXB 1UGRB 1NYFA 2H3JA 3QDFA 1NM7A 1ZA2B 3A8GB 2F2XA 4AG2C 2E6NA 1N9RA 3VJPA 2AT1B 1PKTA 1RACB 4JJNK 3GNFB 2BIVA 3RBBB 3G4SQ 3JB9I 1QW1A 3G6EQ 4M77C 3OB9A 2RQWA 3A1PA 3M56A 2HAXA 3RMSA 3CCRT 1YJWA 1OPLA 3JCMh 4FSXA 2XDBA 1Z9QA 4BDZA 5IT9E 1KQSA 3LH5A 1G2BA 1M2OA 1NG2A 2CT3A 2JT4A 1VQMT 2K57A 3NTHA 4KGXB 3OYDA 2CP2A 5DLOA 2EQJA 2AKLA 1YBYA 2C06A 1VQ5A 2ZPGB 3S3MA 2OTJQ 4GLMA 1VQ8Q 5GMKl 2A28A 3EGDA 3CCLQ 1M1FA 2HSEB 5ECAA 2M0YA 3IQLA 4EMKC 3BW1A 2V26A 3VS5A 3FEOA 4GBQA 4RCBA 4FM4B 1HJDA 4J7FA 2C0OA 1E6HA 2H8HA 3G1JA 3FC3A 1W2BS 3G4ST 2LVMA 3LW5E 1OV3A 2EJFA 1OI1A 4PJNA 3CQTA 3VS1A 1G5VA 1KHCA 3M0QA 1Y07A 3QSUA 3MEUA 2Y4YA 5GAN2 3JCMJ 4ZTJA 2NYSA 1OU9A 1M5Q1 3MP8A 4R55A 1X2KA 1K0SA 4OMOA 2QA4T 2NUPA 2HZYA 5M9OA 3EG1A 2R5AA 3M55A 4RKUE 3O8VA 4MZPA 3CMEA 2EGEA 5GANg 5GJWB 4M7DA 2NUTA 1BIBA 2ED1A 3RR6A 1ARKA 1SRLA 2RJDA 5LJ5d 1VQKT 4M7DE 2GF7A 1VQ6T 3J80E 1FYNA 2MF2A 3EG9B 2A0FB 2KT8A 2QTVA 4C5EA 2J7IA 4PJOF 2CSQA 2EW3A 3M0TA 5CCAA 4MMKA 4IIMA 2KYMA 1WIEA 2DILA 4A4KA 1VQOT 1QCOA 1OZ3A 4DEXA 3NGPA 1C6VX 2DO3A 1WPYA 5L23A 5L8RE 2HL5C 3C0CA 2HL3A 5C0MA 3QXEB 3VYGA 1AWOA 2E12A 1OULA 4KUDK 1I5LA 4RCCA 5CKDA 4C92D 2G3RA 1H92A 5AT1B 1M27C 2YRVA 1NJIU 3JB9H 1TTHB 3HTRA 4TVRA 1UGSB 2DL3A 4M78G 1BIAA 4LD9K 5CQXA 4PJLA 2I2LA 2RB6A 2RI3A 2D9TA 1BU1A 1M1GA 2YXYA 2FPFA 1OQKA 1KJWA 4A54A 2KQWA 1WYXA 3P8HA 1AD5A 2FG0A 5FU7C 1FX7A 1UEBA 2CP7A 4M77B 1NEGA 5HK0A 4AFQC 2J6KA 3CCSA 1JJ2S 1VYUA 1V1CA 1NLOC 3I55Q 3DLLA 3BE3A 2CP6A 1I5OB 1PG5B 5KYWB 5GANh 1QLYA 3CCMQ 3REBB 3L2QA 1TUGB 1K8AR 1D0YA 4PFOA 1ZBJA 5I22A 4XTUA 3HSBA 2HQEA 3CC2A 4OMMA 3V8KA 3CXCA 3JB9D 1M1KU 4FYXB 1YJWT 2QQAA 2LMJA 1MHNA 2LNHB 3JCMW 3S6WA 3OYMA 4EMKB 3FDRA 3CC4A 1VQ4Q 4M75G 5LJ3f 5A0GA 5GAMf 5DM7R 4ATOA 1W6XA 3HP9A 1TXQA 2QASA 5FRMA 3CD6T 4BY6C 2FO0A 2ED0A 1Y7XA 4II1A 3OQ5A 3OW2S 2LDMA 1Q82R 2M02A 1QWFA 1VQLA 4XTZA 1K9AA 2JNGA 4M7DC 2AK5A 1ZA1B 2FEIA 2P0QA 4JRPA 2CREA 4PK4A 2XDDA 3OYLA 1FMWA 2KY9A 2JW4A 2RO0A 2X9HA 1X6OA 1UUEA 2P4RA 5KCOA 1VQ4T 4PJOA 3VS7A 3OYAA 4QVZA 5LJ3h 4MMLA 5GAMh 2KROA 4KH1B 1VQNQ 3LGFA 2YWWA 1OX9A 2ZPEB 2L3SA 2KYBA 3V7SA 2B86A 4PJOE 3CCVQ 2DNUA 3CC7A 1NBEB 2XICA 1U5SA 1WX6A 2HCKA 2HBPA 4NL2A 3CCEA 1UFFA 1BI1A 5FROA 1YITA 1QCFA 1UGQB 4CRIA 1OZ2A 1GFDA 3CPFA 2MMPA 2A36A 3CPWS 2EGAA 1Q81U 1U3OA 4AFSC 3CXCP 2CSIA 1YN8A 5IAYA 4CC3A 3H0HA 4PJJA 2BUDA 1SPKA 4D8KA 2GBQA 4JZ4A 2VYTA 3NFCA 4QQ6A 1LVKA 2FHDA 3I56A 3QJ6A 1WHKA 4C8QC 2B8AA 2D0NA 4N0AC 5FU6C 3G71Q 2DX1A 2CZ1B 1IGUA 1PC0A 2AKKA 4C0FA 2ZZDA 2YHTA 5IXFA 3RDVA 4EPCA 4ORZA 1K9MR 1H3ZA 2ROLA 3TSZA 4HT8A 2VASA 5FU7B 1SSFA 2MAMA 2ECZA 1QP3A 3OS1A 2M9UA 2KAFA 4ELYC 2RHXA 2LP5A 2HQXA 2VXEA 3HRSA 4E7IA 5LJ3e 3NTKA 5GAMe 1RADB 2FZCB 4OB0B 2DYBA 3EGDB 4J9EA 1YCYA 1OYXA 5GJVB 4JZ3A 4RG2A 2SRCA 3P8DA 5GAOq 4C92F 4D8DA 4M7AF 2JVVA 4ZGJB 5CAIA 3OYHA 4HCBA 2LQ8A 3CCST 3GPLA 3JCMP 2JXBA 4CC2A 2CZ6B 1B34A 2CH4A 1UGVA 1SHGA 1TUDA 3PIOA 1S72A 2EYZA 5LJ5g 4LDUA 2XD0A 2RI5A 5KE3A 2E64A 5EC7A 2X3WD 3CC2T 4BY6B 3TSWA 4HVWA 3PTAA 4M7AG 2M51A 1VQ7A 1AZGB 2DLPA 1PNJA 3PVLA 4JJDA 3BDUA 3CC4T 3UDCA 1OU8A 2FPDA 2DD5A 1Y71A 2XIDA 4M78D 2K3XA 4OB2B 4M7DB 1UTIA 1V76A 5KYYA 1TOVA 2F2WA 2OTLA 3M4YA 4PJOC 4Z88A 1H641 1M2VA 1SSHA 1IGQA 3MP1A 1NJIC 1YI2T 2OTJA 4CI0C 3RKXA 2FB7A 2JTMA 2LX9A 3A8OB 3TCJA 3VUBA 3L2UA 2D8JA 3I5RA 2L3RA 4PLIA 1QQJA 1M90R 4C0ZA 2P84A 4PLLA 3FJPA 1B7TA 6AT1B 3HFNA 1HSQA 1K1ZA 4X34A 2HNIA 2AIRB 1UB4A 3QG1A 1G3YA 1WJQA 2FVUA 5J39A 2K4YA 3SHWA 3CMAA 1Y96B 5C6SA 1Q86R 2CT4A 4Z89A 4BB7A 3A5ZB 3MEVA 3TQ7P 2E3IA 1BKBA 4E47A 2QTXA 3U23A 4KRTA 2K2MA 4JS4A 2K9GA 4A4GA 1TS9A 5HY6A 5IXBA 4M75D 4EMHA 1QP2A 1ZUYA 1NE8A 3S3NA 3PT9A 3CCRQ 3NPFA 3M0PA 3JCMf 3CCET 1KC8R 1YJ9T 2KE9A 2D6FA 3CCUA 3EH1A 4Z8AA 4CC7A 2OJ2A 3BDLA 1PCXA 2DZ9A 2EIFA 3QUIA 3LX7A 4C5HA 4DEYA 1FMVA 3DB4A 4E7ZA 4C8QB 2DKGA 1Q7YC 2KRMA 2YUQA 3E2UA 3NHNA 5FU6B 1MMGA 1MNDA 3PIPA 3EG2A 3Q1JA 5GMKh 1YHQA 3LGLA 4J5YA 1M3CA 2O9VA 1QVGS 1LJOA 1WHJA 3OS0A
chains in the Genus database with same CATH topology
4A4KA 2QEXT 1VQOT 3MP6A 1OZ3A 3G4SA 5CVIA 4KULA 2DO3A 1WPYA 5AYFA 1O9SA 5L8RE 3G6EA 2D0QB 2CZ7B 2KSSA 4J8OA 1VIFA 2DTOA 4JDSA 1QVGA 4C92A 1XTDA 4N4IA 4DOWA 2PUKB 3CBPA 3QBYA 3UPUA 5C0MA 2E10A 3QXEB 3VYGA 4Y28E 3WVDB 3PFSA 1BI0A 2E12A 4P5NA 2VV5A 3LWIA 4KUDK 4J7IA 1I5LA 4PKCC 1EIFA 2RM4A 4QW2A 1I81A 4C92E 5GAOp 4RCCA 1XOVA 4C92D 2G3RA 3ME9A 4D6WA 5CKDA 5LJ3d 1WQ7A 4ZN1A 1G3TA 5GAMd 3OYFA 2PQWA 2XKOC 2YRVA 1NJIU 3QJYA 3JB9H 1X01A 2RH2A 3URGA 2E5QA 3M58A 4UC4A 3SB2A 4TVRA 1UGSB 1Q82C 4O6JA 3FRNA 4XK8E 4M78G 1BIAA 3PNWC 4LD9K 4OB3B 2K5FA 5CQXA 3E19A 3CBMA 2WSCE 3QZ5B 2I2LA 3LWHA 1VQ8A 2MI6A 2M1HA 2RB6A 5CIUA 2K3YA 2RI3A 4MDXA 2D9TA 4BE2A 3CCLA 5FRNA 5FLXE 1IZ6A 3VKIA 5GAN6 1M1GA 4M78C 1U1TA 2X4JA 3M53A 4HA8A 1VQLT 2HD0A 4LDWA 5CQYA 1RI0A 1VQ9T 1YJ9A 2EWNA 2YLCA 4A54A 2O4XA 2KQWA 2KMTA 4C5GA 2R5MA 2XK0A 3X20B 2PVGB 3QPHA 3P8HA 2KDSA 1D3BA 2CS7A 3OSSC 2EQKA 2DAQA 2YLBA 5FU7C 5LJ5f 1FX7A 1UEBA 3JCMV 4WF2A 3ASKA 1U1SA 4OGEA 5I21A 4M77B 5HK0A 2QDYB 4KUIA 4F7UA 2CKKA 3M9QA 3RESA 3CCSA 5KE2A 1JJ2S 2RJEA 5HKCA 4C8QD 1V29B 2K5LA 3DLLA 3JAME 2EAYA 3OYJA 4E7KA 3L1AA 2JOYA 5GANh 1W2BA 1Q81C 5GANd 1S72T 2RHIA 4M7AB 4F7UE 2GFUA 2DZCA 3L2QA 2JN0A 3CXCS 3MHXA 2OAUA 2DTHA 5I2MA 4C8QG 3GP8A 2RA2A 2QEXA 1ZHIA 3UT1A 3HL8A 4XTUA 2LCLA 3DB3A 1VQNT 4PJOB 3HSBA 2ZPBB 3PGGA 2HQEA 4E7LA 5I2SA 4XQ3A 2K5IA 5GMKe 2P0PA 4R56A 1FXXA 3VYHB 3V8KA 1YITA 3CC2A 3CCVT 1WQWA 3CXCA 2F5KA 2ZGWA 3A8HB 4DQ2A 1VQ7T 2ZCFB 3JB9D 1M1KU 3JCMb 2Y4XA 3SWNB 1YJWT 3C12A 3CCQT 3CC7T 2QQAA 4OVAA 1MHNA 1QVFS 3JCMW 4BI3A 1MGQA 2O01E 3S6WA 3OYMA 4EMKB 3FDRA 3CC4A 3F70A 2VC8A 4M75G 2EJGA 3PMTA 2K2VA 3GF5A 4JLIA 3PIPA 1O75A 4DA4A 4A53A 5GAOr 1BYMA 4J6XA 5LJ3f 4E7JA 5A0GA 5GAMf 1YITT 3J7AF 4BACA 5LJ5h 2OTLT 1K8AU 4JRIA 1R8OB 5A0DA 5DM7R 4B9WA 4ATOA 2DXBA 3HP9A 3M59A 2DTIA 3OYYA 4M75C 5FRMA 3M4GA 2A3LA 3RKYA 3CD6T 4BY6C 3QO3A 2DD4A 4IUPA 1NPRA 2JTFA 3JCMe 3OY9A 3JCMX 2LCCA 2DXCA 2R57A 1Y7XA 3OSVA 3OQ5A 4II1A 5DY9A 3OW2S 4M7DG 3HRTA 2LDMA 3HPWA 3T9NA 5A0LA 5KCHA 1G3WA 2V8JA 4XTVA 3A8MB 3RUXA 3JCMc 2P0KA 1VQLA 5CKHA 1M9SA 2Y90A 4XTZA 5LJ5j 1VQ9A 4FU6A 2QI2A 3VU3C 4M77A 3OYIA 2JNGA 4M7DC 3HFOA 1ZQ1A 4M78F 4PNOA 2P0QA 1KC8U 4JRPA 1KD1U 3OW2A 2VGNA 4JRKA 3JRZA 4NOYA 4OMFB 4Q5WA 2DXUA 1KQ2A 2V8KA 1AHJB 3OYEA 2LNVA 3OA6A 3OBYA 2MWPA 5IN1A 5GMKi 4ELZC 3I56T 5GAN8 3A8LB 5D6YA 1K9MC 5D6XA 5GMKj 2XDDA 4M77E 3JB9J 1VQPA 1YIJA 4M77D 1N8RC 4M7AA 4L5GA 3OYLA 2EQMA 2L8DA 4FIBA 4LDYA 2KY9A 3N5BB 2E6ZA 3G71T 2KK4A 2RO0A 3ZEHA 3HKSA 2LT1A 1JRIA 2M16A 1X6OA 3CMAT 3M54A 5KCOA 5GANf 2QQSA 2RK1A 1VQ4T 2L89A 4PJOA 3SFMA 3OYAA 4M7AE 4QVZA 5LJ3h 3QIIA 4MMLA 2VUBA 3TREA 3X28B 5GAMh 2RK2A 4M7AD 5CKBA 4XTWA 3MEAA 4ZN3A 2XI9A 2CGHA 3LGFA 4IUQA 2FL7A 2ZPEB 3L2RA 1RL2A 2QA4A 1LOJA 3J81E 1KQSS 3SWNA 3V7SA 4PJOE 3M5AA 4C92G 4PJOD 2NLUA 3DLMA 3CCVA 3HHTB 4L59A 3OYBA 3INZA 3C4SA 3JCMQ 4EMKA 4L6V5 3V8LA 3CC7A 2XICA 1FWZA 4C8QF 3GLXA 2P4TA 2E1HA 5LJ3j 2A7YA 2FYKA 4C92C 4J83A 5GAMj 5A2QE 4EMGA 1I4K1 1QVPA 2HBPA 4NL2A 4C0DB 2V8IA 3QHSA 3CCEA 3CCUT 1BI1A 4F7UF 4HT9A 5FROA 3V7CA 4XTXA 3M57A 2R58A 1UGQB 3NTIA 4CRIA 1HK9A 4J6WA 1OZ2A 2CZ0B 3KXTA 1VQKA 1UGPB 3CPFA 3CCJA 4PL6A 2MMPA 3X26B 4FL6A 4B9XA 1K73C 1VQ6A 1DJ7B 2EYQA 3CPWS 2EJ9A 2XDPA 1YJNT 5CO7A 1Q81U 3CD6A 2X4WA 2DIGA 3V7RA 3RIRA 3CBOA 3UWNA 4A4HA 3BFMA 4C0GA 1YHQT 3I55A 3ZFJA 5GAOl 1G3SA 5IAYA 4M75F 3JCMg 3JB9F 4JLGA 2QQBA 2RHYA 5CK9A 3L2ZA 2BUDA 4KBMB 3CCMA 5LJ5e 1B34B 1XQHA 2XG8D 2GQVA 3CPWA 3WXMB 2DXTA 1TH7A 3ER0A 4RMOA 1JJ2A 3AHUA 3SD4A 1BI2A 3EFSA 2F69A 2XHCA 3LH0A 2VYTA 1VQOA 2DEQA 2RJCA 3NFCA 4QQ6A 2PVOB 3G6ET 4F7UG 2FHDA 2DJZA 2QQRA 5D6WA 3L2VA 4BE1A 4FT4A 3QJ6A 3I56A 4M7DF 3CEYA 4C8QC 2B8AA 4OF1A 5GANj 1PSFA 4N0AC 2MWOA 4VUBA 5FU6C 3S3OA 3G71A 4QQDA 2CZ1B 4M78B 4C0FA 2GCXA 3FB9A 3RERA 1VUBA 2ZZDA 2PUOB 4RG8A 2RI2A 2YHTA 4XU0A 1H3ZA 4EPCA 1VQ4A 2X35A 3FIFA 4LDXA 1XNIA 3MCAB 3JB9G 3PMIA 4BI8B 4HT8A 1IREB 3E9GA 5FU7B 1Q7YU 1PSEA 2DK3A 2LTOA 1VIEA 1SSFA 2MAMA 1QP3A 4QQGA 1QVFA 3EAEA 3OS1A 2F5TX 4JS5A 1M90C 3OBWA 2M9UA 1VQ5T 2KAFA 4ELYC 3LLRA 2OTJT 4YTLA 2RHXA 4X9DA 2WACA 1VQ8T 4KT0E 2RHUA 4GLKA 3R6OA 3P8BB 2HQXA 4A4EA 4NL3A 3CCLT 1U8RA 5GAOm 2VXEA 3HRSA 4E7IA 1HXDA 5LJ3e 3NTKA 4J6YA 5GAMe 3KBGA 4OB0B 3RKWA 1LNXA 5GAOn 4FT2A 4MDWA 4XU2A 1ZBXA 1M1KC 1KG1A 4OGCA 1YCYA 2PVDB 4DOVA 3QZ9B 2AHJB 1OYXA 3META 4RG2A 1N6AA 3P8DA 4IKFA 4HKEA 5GAOq 4C92F 1N8RU 4M7AF 2JVVA 4ZGJB 3EFRA 5CAIA 3OYHA 3OYNA 2DIQA 4HCBA 5J26A 2LQ8A 4NS5A 2LRQA 3GIBA 1N9SA 3CCST 3GPLA 1M8VA 1KQ1A 1YJNA 1UGRB 3QDRB 1Q86C 3OS2A 2H3JA 3JCMP 2CZ6B 1B34A 3A8GB 3GNGA 4IURA 4IUTA 2RJFA 1X75C 4IUVA 1W4SA 4OB1B 2E6NA 3PIOA 1S72A 1N9RA 3VJPA 3X24B 4JJNK 4M77G 2LC4A 3HRUA 1Q82U 1I8FA 3GNFB 5LJ5g 4LDUA 1GXIE 3KUFA 2BIVA 3VUZA 2XD0A 2RI5A 5KE3A 2ZPIB 4XTYA 5EG2A 2KVQG 2E64A 1VQNA 3JB9I 4M75B 1QW1A 4M77C 3CC2T 3E1SA 3OB9A 3C95A 4BY6B 1KD1C 2PU9B 2ZPFB 3FLGA 4M78A 3PTAA 1KC8C 3MEWA 4M7AG 3M56A 3DKMA 5GANe 3CMET 1Y96A 1VQ7A 2EKOA 2HAXA 2WSFE 3RMSA 3OMCA 2DPPB 3CCRT 1YJWA 1NPPA 3CCQA 3JCMh 4FSXA 3JCMd 3BDUA 3CC4T 2XDBA 5CKEA 5LL6S 3UDCA 2DD5A 4PJOG 4M7AC 1Y71A 4M78E 3GOXA 2XIDA 4BDZA 4M78D 5IT9E 2K3XA 1KQSA 2GFAA 4OB2B 3ZBDA 4ZGEB 4M7DB 1WNLA 1K73U 2EQUA 4MZMA 3VV0A 1VQMT 2K57A 3NTHA 2OTLA 3M4YA 4PJOC 3LYIA 3OYDA 1H641 5DLOA 2EQJA 5CR2A 2JUFA 1YBYA 2C06A 5J3BA 1VQ5A 2ZPGB 4V2SA 3S3MA 3MP1A 2X4YA 1YI2T 1NJIC 2OTJA 4CI0C 3RKXA 2FB7A 2JTMA 2LX9A 2QXFA 2X4XA 3A8OB 4JUVA 3TEEA 5GMKl 3TCJA 3VUBA 3C94A 4ME7A 1M1FA 2L5QA 2RD1A 4Z02A 3E9FA 3SWNC 4A4FA 5CKFA 2L3RA 4PLIA 3OYCA 4ZTFA 2IVWA 4XU3A 4C0ZA 4LDVA 4BI4A 3V8JA 4EMKC 5LJ3g 3SDZA 3H6ZA 4PLLA 3BW1A 5GAMg 1WGSA 2E41A 1NZ9A 2RHZA 2CYZB 1M4ZA 3FJPA 3FEOA 4RCBA 4C8QA 4FM4B 3OYGA 4J7FA 5KH6A 3FC3A 1W2BS 4N0AA 3G4ST 2LVMA 3WVEB 3LW5E 1JBMA 3OS5A 3HFNA 2LQKA 3OMGA 4X34A 2HNIA 1VQPT 1YIJT 1UB4A 2EJFA 4C5IA 2VXFA 3QKJA 4C8QE 1OI1A 3L42A 2LT4A 2ZPHB 3QG1A 3RMQA 1G3YA 4N4HA 5DLQE 2EFIA 3QYHB 1G5VA 1KHCA 1WJQA 2FVUA 4C92B 5J39A 4LD6A 2K4YA 4BD3A 4QVDA 1Y07A 2IG0A 4BDYA 3QSUA 3CMAA 3MEUA 1Y96B 2Y4YA 1N27A 5C6SA 5GAN2 2E70A 4HCCA 1M90U 1KHIA 4M75A 4BUGA 3JCMJ 4HCZA 4ZTJA 4BB7A 1BI3A 4R55A 1M5Q1 3A5ZB 3MP8A 3MEVA 2QA4T 1BKBA 2VGMA 4E47A 2QTXA 5M9OA 5GAN3 3OYKA 2JZ2A 2R5AA 3M55A 4MZTA 4JS4A 4A4GA 4M75E 4RKUE 5HY6A 3TU4K 4M75D 3O8VA 3QYGB 4EMHA 1P92A 4MZPA 5GMKm 1QP2A 4Y91A 3CMEA 4E7HA 1NE8A 5GAN4 3S3NA 5GANg 3PT9A 4M77F 3CCRA 4M7DA 1BIBA 2WSEE 3JCMf 3CCET 1YJ9T 5HK3A 4XU1A 2D6FA 3CCUA 3L2UA 1WJSA 4N4GA 2BKDN 2RJDA 5LJ5d 1VQKT 4OP0A 1K9MU 1Q86U 1WJRA 2E65A 2GF7A 1VQMA 4M7DD 4M7DE 3BDLA 3CCJT 2DZ9A 2EIFA 2O4XB 3QUIA 4XAXB 3LX7A 4O5VA 4C5HA 4JRQA 1VQ6T 3DB4A 3J80E 4C8QB 4EDUA 2DKGA 1D3BB 3G7ZA 3MO8A 1Q7YC 2MF2A 1YI2A 2QQ9A 4QVCA 5FU6B 1K8AC 3I55T 1JB0E 3JSCA 4PJOF 3Q1JA 4C5EA 4ZGDB 3H8ZA 4F7UB 5GMKh 5GAN7 4IUUA 1YHQA 4GY5A 3L2WA 3LGLA 3CCMT 5CCAA 5GAN5 4J5YA 2XU8A 4X9CA 4BE0A 4MMKA 3BY7A 2M0OA 1QVGS 1LJOA 4C0DC 3X25B 2DVEA 3OS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQU A;  4E7J A;  3SD4 A;  3MP6 A;  4BAC A;  3LH0 A;  1OZ3 A;  2VYT A;  2RJC A;  3NTH A;  4QQ6 A;  3LYI A;  4B9W A;  3OYD A;  2FHD A;  2EQJ A;  2QQR A;  5D6W A;  3L2V A;  4BE1 A;  3QJ6 A;  5FRM A;  3CEY A;  2B8A A;  3S3M A;  3MP1 A;  2X4Y A;  4IUP A;  2JTF A;  2X4X A;  4N4I A;  3QBY A;  3OY9 A;  2MWO A;  5C0M A;  2LCC A;  2R57 A;  4Z02 A;  3L2U A;  4II1 A;  3OQ5 A;  3PFS A;  4QQD A;  3E9F A;  4A4F A;  3S3O A;  2LDM A;  5KCH A;  2L3R A;  4PLI A;  3OYC A;  4ZTF A;  2P0K A;  2RI2 A;  4QW2 A;  4BE2 A;  1H3Z A;  2X35 A;  3H6Z A;  4PLL A;  2RHZ A;  1WGS A;  2G3R A;  3ME9 A;  4FU6 A;  1XNI A;  3OYI A;  3FEO A;  3OYG A;  3PMI A;  3OYF A;  2PQW A;  5KH6 A;  3E9G A;  2YRV A;  3FC3 A;  2LTO A;  2LVM A;  1SSF A;  2E5Q A;  4Q5W A;  4QQG A;  4UC4 A;  3EAE A;  3OS1 A;  3OYE A;  3OA6 A;  2MWP A;  5IN1 A;  3OMG A;  4X34 A;  5D6Y A;  3PNW C;  5D6X A;  3LLR A;  4C5I A;  3QKJ A;  2RHX A;  1OI1 A;  2WAC A;  3L42 A;  3OYL A;  2EQM A;  2RHU A;  2L8D A;  4A4E A;  2HQX A;  2M1H A;  4N4H A;  5CIU A;  2RO0 A;  2K3Y A;  2RI3 A;  2EFI A;  2D9T A;  3ZEH A;  4E7I A;  1KHC A;  1WJQ A;  5FRN A;  1G5V A;  5J39 A;  4LD6 A;  2M16 A;  3NTK A;  4BD3 A;  5KCO A;  2IG0 A;  4BDY A;  2QQS A;  1RI0 A;  3MEU A;  5C6S A;  2L89 A;  1N27 A;  2O4X A;  3OYA A;  4QVZ A;  4C5G A;  3MET A;  1OYX A;  2R5M A;  2XK0 A;  3QII A;  4HCZ A;  4RG2 A;  4ZTJ A;  3P8H A;  3MP8 A;  3P8D A;  4IKF A;  3MEA A;  2EQK A;  3MEV A;  2DAQ A;  4IUQ A;  3LGF A;  3OYH A;  3OYN A;  2DIQ A;  3ASK A;  5M9O A;  3L2R A;  5J26 A;  3OYK A;  4NS5 A;  2LRQ A;  2JZ2 A;  2R5A A;  2CKK A;  3M9Q A;  2NLU A;  3DLM A;  4A4G A;  5KE2 A;  2RJE A;  4L59 A;  3OYB A;  3O8V A;  3C4S A;  3OS2 A;  4E7H A;  4IUR A;  4IUT A;  2RJF A;  3S3N A;  3OYJ A;  4E7K A;  4IUV A;  2RHI A;  2E6N A;  2GFU A;  3L2Q A;  5FRO A;  1WJS A;  3KUF A;  2BIV A;  2BKD N;  2RJD A;  4N4G A;  2R58 A;  3NTI A;  3UT1 A;  2RI5 A;  3DB3 A;  1WJR A;  1OZ2 A;  2GF7 A;  4CRI A;  5KE3 A;  2HQE A;  3BDL A;  4E7L A;  2O4X B;  3LX7 A;  4C5H A;  4PL6 A;  3DB4 A;  4FL6 A;  4B9X A;  3OB9 A;  4EDU A;  3MO8 A;  3FLG A;  2XDP A;  3MEW A;  2X4W A;  2F5K A;  2DIG A;  3UWN A;  4A4H A;  4C5E A;  2EKO A;  3Q1J A;  3H8Z A;  4IUU A;  3OMC A;  1MHN A;  4GY5 A;  4OVA A;  5IAY A;  3L2W A;  3LGL A;  2RHY A;  4BE0 A;  2BUD A;  3S6W A;  3OYM A;  2M0O A;  3FDR A;  3F70 A;  3GOX A;  4BDZ A;  2K3X A;  2GFA A;  3PMT A;  3OS0 A; 
#chains in the Genus database with same CATH topology
 2QEX T;  3MP6 A;  2HEQ A;  5KYX B;  2CZ7 B;  2VWF A;  1VIF A;  4JDS A;  4C92 A;  1XTD A;  1YWP A;  2EVR A;  3CBP A;  2A37 A;  3WVD B;  2FRY A;  1H3H A;  1BI0 A;  2KXD A;  4AG1 C;  4P5N A;  1MUZ A;  2RM4 A;  4QW2 A;  4C92 E;  4D6W A;  1WQ7 A;  4ZN1 A;  3H41 A;  4LN2 A;  4FSS A;  3KFV A;  2E5Q A;  2QA4 Q;  4UC4 A;  1SG5 A;  2WSC E;  3QZ5 B;  5IHN A;  3MJX A;  2MI6 A;  2K3Y A;  2W10 A;  1W2B P;  3VKI A;  5GAN 6;  2X4J A;  3M53 A;  3VRY A;  1VQ9 T;  2O4X A;  1IO6 A;  1RUW A;  1D3B A;  2KDS A;  1VQK Q;  2YLB A;  3UF4 A;  1KSW A;  4WF2 A;  1UJ0 A;  2QDY B;  4KUI A;  2E3H A;  1VQ6 Q;  4F7U A;  2CKK A;  1HD3 A;  3M9Q A;  3RES A;  2RJE A;  2DMO A;  2EGC A;  3I9Q A;  2BZX A;  1QKW A;  1X43 A;  3JAM E;  2JOY A;  1Q81 C;  1S72 T;  4F7U E;  2GFU A;  2DTH A;  4C8Q G;  1M3A A;  3UT1 A;  1VQO Q;  3DB3 A;  4PJO B;  2PTK A;  1R0B G;  2MCN A;  5GMK e;  3VYH B;  1UHC A;  1VQ7 T;  2ZCF B;  4FYV B;  1QVF S;  4OVA A;  2GQI A;  4J9B A;  2FRW A;  3PMT A;  2K2V A;  5GAO r;  1O75 A;  1E6G A;  1WZO A;  2OTL T;  4RTT A;  1K8A U;  1R8O B;  2J6O A;  5A0D A;  2DXB A;  2F1L A;  1RAG B;  4OML A;  1IRX A;  3QO3 A;  3UA7 A;  1NPR A;  2JTF A;  3JCM e;  2DXC A;  2R57 A;  3OSV A;  5DY9 A;  3HRT A;  2LQN A;  5KCH A;  4XTV A;  7AT1 B;  3RUX A;  3JCM c;  2P0K A;  4DBF A;  4WCI A;  5CKH A;  1M9S A;  2MIO A;  3OYI A;  3VU3 C;  4M78 F;  4PNO A;  3OW2 A;  1X6B A;  1KQ2 A;  1BK2 A;  2V8K A;  3OYE A;  2LNV A;  3OBY A;  1RAH B;  2DL5 A;  2NUZ A;  3A8L B;  5D6Y A;  5D6X A;  1VQP A;  1YIJ A;  4E2F B;  4L5G A;  3N5B B;  2E6Z A;  4DBR A;  2KK4 A;  4AFU C;  3ZEH A;  2CP3 A;  1WHL A;  4KGV B;  2M16 A;  1WXT A;  3CMA T;  5GAN f;  2L89 A;  4HXJ A;  4M7A D;  3TRE A;  2VKN A;  2FZG B;  4KGZ B;  1TWB A;  3MEA A;  4ZN3 A;  2CGH A;  1W1F A;  3L2R A;  1LOJ A;  3J81 E;  1KQS S;  3SWN A;  5KYU A;  5IHK A;  1E7O A;  2NLU A;  3CCV A;  3OYB A;  3INZ A;  5HCK A;  1YJW Q;  2LCS A;  1JXM A;  3GLX A;  2JMC A;  2A7Y A;  3D7S B;  5LJ3 j;  4C92 C;  5GAM j;  5A2Q E;  1QVP A;  3QHS A;  3CCU T;  1KK7 A;  1JJ2 P;  3M57 A;  4F17 A;  3NTI A;  2CZ0 B;  1PHT A;  3CCJ A;  3PE0 A;  1U06 A;  3CD6 Q;  5CO7 A;  2DIG A;  3RIR A;  1ABO A;  4C0G A;  1YHQ T;  5GAO l;  4M75 F;  1YWO A;  4JLG A;  1GCP A;  5CK9 A;  4FCY A;  3L2Z A;  4KBM B;  1B34 B;  3CPW A;  2DJQ A;  2JTE A;  3AHU A;  3EGX A;  1BI2 A;  2XHC A;  3LH0 A;  2DEQ A;  2DJZ A;  4BE1 A;  2KR3 A;  8AT1 B;  3G71 A;  4QQD A;  3FB9 A;  1VUB A;  2PUO B;  2RI2 A;  2X35 A;  3FIF A;  1N8R R;  3R6N A;  1Q7Y U;  1PSE A;  2DK3 A;  3OW2 P;  2YUP A;  3VS6 A;  2LJ0 A;  4QQG A;  4JS5 A;  2DL4 A;  1B3Q A;  1VQ5 T;  1J3T A;  3VRZ A;  5KYY B;  1JQQ A;  2WAC A;  2RHU A;  4GLK A;  3P8B B;  1W70 A;  4EIK A;  3RKW A;  5GAO n;  2HKQ B;  4MDW A;  4XU2 A;  1KG1 A;  1ZBX A;  3MET A;  1BB9 A;  4IKF A;  2IIM A;  4HCK A;  4PFZ A;  2ESW A;  2DIQ A;  2DA9 A;  9ATC B;  2DBM A;  3GIB A;  1KQ1 A;  1YJN A;  3QDR B;  2HKN A;  3GNG A;  2HBW A;  2ABL A;  4IUT A;  2RJF A;  4J9H A;  1D09 B;  1W4S A;  4IUV A;  4OB1 B;  4A63 B;  1K73 R;  3M0U A;  3X24 B;  4M77 G;  2LC4 A;  3HRU A;  2CUD A;  1GXI E;  2DFU A;  2COW A;  3VUZ A;  1IB8 A;  2VB6 A;  2K79 A;  1T3S A;  4XTY A;  2PU9 B;  2ZPF B;  3FLG A;  4M78 A;  3DKM A;  2E5K A;  2FPE A;  5GAN e;  3CME T;  2WSF E;  3OMC A;  3NMZ C;  2DPP B;  1D1C A;  1NPP A;  3CCQ A;  5CKE A;  5LL6 S;  2LJ3 A;  4M78 E;  3CPW P;  4ZGE B;  1WNL A;  2JM9 A;  1KFZ A;  4OMP A;  2DEU A;  2KRN A;  2AZV A;  5J3B A;  4J9G A;  2X4X A;  4JUV A;  3TEE A;  3C94 A;  2Z0W A;  2RD1 A;  3E9F A;  3SWN C;  5CKF A;  4ZTF A;  2KBT A;  4XU3 A;  4AMC A;  3V8J A;  4BE2 A;  3SDZ A;  3O5Z A;  1WGS A;  2E41 A;  1NZ9 A;  2CYZ B;  4QKU A;  2YUO A;  3OYG A;  5KH6 A;  3EG9 A;  1D0Z A;  1X69 A;  1JBM A;  3OS5 A;  1AWX A;  2JJ9 A;  2RQR A;  3CCS Q;  1VQP T;  1YIJ T;  4E7S A;  1WXB A;  4C5I A;  2VXF A;  4RUG A;  2ZPH B;  3RMQ A;  1LCK A;  5DLQ E;  1MMN A;  2EFI A;  2X3X D;  1Q95 G;  4C92 B;  4LD6 A;  4BD3 A;  4QVD A;  2IG0 A;  4BDY A;  4FYW B;  3MPU B;  1N27 A;  2E70 A;  1M90 U;  4M75 A;  1BI3 A;  1B07 A;  2VGM A;  2YT6 A;  2JZ2 A;  2O31 A;  3CC2 Q;  2PNI A;  4M75 E;  3TU4 K;  5GMK m;  4Y91 A;  4E7H A;  3CCR A;  1SKU B;  2WSE E;  3CC4 Q;  2QDL A;  5HK3 A;  2KEA A;  1AZE A;  1R77 A;  1WJS A;  1UG1 A;  2BKD N;  1AWJ A;  4OP0 A;  1Q86 U;  2E65 A;  1VQM A;  3CCJ T;  2O4X B;  4XAX B;  4O5V A;  4JRQ A;  5FW9 A;  4EDU A;  1D3B B;  3G7Z A;  3MO8 A;  1NYG A;  1YI2 Q;  1K8A C;  1ZSZ A;  1SEM A;  1JB0 E;  3JSC A;  3H8Z A;  4F7U B;  4IUU A;  2K7A A;  4IIO A;  3FJ5 A;  4BE0 A;  2XU8 A;  3BY7 A;  4C0D C;  2CDT A;  2DVE A;  3X25 B;  3G4S A;  4KUL A;  5AYF A;  1O9S A;  1T3L A;  3H0I A;  3G6E A;  1WI7 A;  2D0Q B;  2HSP A;  2KSS A;  4J8O A;  2DTO A;  1QVG A;  1GL5 A;  3QBY A;  2NUP B;  2DE0 X;  3PFS A;  4DBH A;  3LWI A;  2JS0 A;  2D8H A;  1EIF A;  1D0X A;  2DBK A;  5GAO p;  2BTT A;  5LJ3 d;  5GAM d;  2NUT B;  2PQW A;  2W0Z A;  1X01 A;  3M58 A;  1UDL A;  1Q82 C;  4O6J A;  3FRN A;  2EQI A;  3I35 A;  1MNE A;  4XK8 E;  5D7U A;  3E19 A;  2JMA A;  3CBM A;  2D1X A;  3LWH A;  1VQ8 A;  5CIU A;  1JEG A;  4MDX A;  3CCL A;  5FLX E;  1IZ6 A;  4M78 C;  4HA8 A;  1VQL T;  1PWT A;  2HD0 A;  3CCE Q;  1RI0 A;  1YJ9 Q;  2ZAE A;  2EWN A;  4C5G A;  2R5M A;  3X20 B;  2PVG B;  3QPH A;  1YIT Q;  1M30 A;  2DAQ A;  1WDX A;  5LJ5 f;  3JCM V;  5I21 A;  3ASK A;  4OGE A;  2V1Q A;  2K5L A;  1R0C B;  1W2B A;  4JPB W;  2K3B A;  1PRL C;  3MHX A;  2OAU A;  3GP8 A;  1SHF A;  5I11 A;  2AZS A;  2QEX Q;  3HL8 A;  3EHQ A;  2ZPB B;  1AOJ A;  3I56 Q;  2K5I A;  4LXC A;  4R56 A;  1RAF B;  2GTO A;  1WQW A;  1PD0 A;  4HVV A;  2ZGW A;  4B6M A;  2QGF B;  2Y4X A;  3SWN B;  1VOM A;  3C12 A;  3CCQ T;  1YCS B;  3CC7 T;  4BI3 A;  1MGQ A;  2O01 E;  1KD1 R;  2VC8 A;  4DA4 A;  4JLI A;  1BYM A;  3GF5 A;  4A53 A;  4E7J A;  3M0R A;  4FW1 A;  4X1V A;  3J7A F;  1YIT T;  5FWC A;  1OPK A;  5LJ5 h;  4BAC A;  4JRI A;  1K76 A;  1TG0 A;  3OYY A;  1PKS A;  3M59 A;  4M75 C;  1X6G A;  3RKY A;  3EFO A;  1QVG P;  3VS4 A;  2DD4 A;  4IUP A;  3JCM X;  3JV3 A;  2KI7 A;  2LCC A;  3THK A;  4M7D G;  3HPW A;  3T9N A;  1G3W A;  1JU5 C;  2V8J A;  1VQ9 Q;  2MOX A;  4M4Z A;  1QKX A;  2VGN A;  3JRZ A;  4OMF B;  2DXU A;  1AHJ B;  1S1N A;  5GMK i;  2HDA A;  5IN1 A;  4ELZ C;  1VYV A;  3I56 T;  1K9M C;  2QAZ A;  4M77 D;  4M7A A;  2EQM A;  2L8D A;  4FIB A;  4LDY A;  4AT1 B;  1ABQ A;  4ZNX A;  1AWW A;  2DL7 A;  3HKS A;  2LT1 A;  2LJ1 A;  1S72 Q;  1GCQ A;  1ZSZ C;  2QQS A;  2RK1 A;  2PZ1 A;  2DRM A;  4M7A E;  3X28 B;  2VUB A;  2RK2 A;  5CKB A;  2XI9 A;  2EYY A;  1ZX6 A;  2FL7 A;  1RL2 A;  3M5A A;  4L59 A;  1PRM C;  1VQ7 Q;  2LZ6 B;  1JO8 A;  4WTO B;  4L6V 5;  3V8L A;  3UAT A;  1FWZ A;  4C8Q F;  2E1H A;  1M3B A;  2EYX A;  4J83 A;  2RPN A;  4C0D B;  2V8I A;  4J9D A;  1AVZ C;  3V7C A;  4F16 A;  2R58 A;  2OTL Q;  2K6D A;  4PL6 A;  3X26 B;  4Y92 A;  2RNA A;  4FL6 A;  4B9X A;  2MK5 A;  2XDP A;  3CD6 A;  2X4W A;  2RQU A;  2DVJ A;  3BFM A;  3I55 A;  3ZFJ A;  2QQB A;  2RHY A;  3CCM A;  2JM8 A;  2MYS A;  5LJ5 e;  2XG8 D;  2GQV A;  2HQH A;  4RTZ A;  2DXT A;  1TH7 A;  2C0I A;  3ER0 A;  4RMO A;  1JJ2 A;  3SD4 A;  3EFS A;  2F69 A;  4ANJ A;  1EZZ B;  1QVF P;  2EKH A;  3VS2 A;  2PVO B;  2BE9 B;  3G6E T;  2QQR A;  3L2V A;  2SEM A;  4OMN A;  4OMQ A;  1UE9 A;  3EGU A;  1WLP B;  4OF1 A;  5GAN j;  1PSF A;  2OI3 A;  4VUB A;  3S3O A;  4M78 B;  3EHR A;  3CMA Q;  4RG8 A;  3GBQ A;  1VQ4 A;  1IXD A;  2BZ8 A;  4RTX A;  4LDX A;  1XNI A;  4DBQ A;  2A08 A;  3E9G A;  2LTO A;  1VIE A;  1M90 C;  3OBW A;  2OTJ T;  1VQ8 T;  4X9D A;  3EG0 A;  4A4E A;  3CCL T;  1U8R A;  2KT1 A;  4J6Y A;  3SEM A;  1LNX A;  5FWB A;  4DOV A;  3QZ9 B;  3CCU Q;  2J05 A;  1N8R U;  3EFR A;  2ATC B;  3OYN A;  5J26 A;  1EFN A;  2YDL A;  1N9S A;  2ROT A;  1WHM A;  1Q86 C;  3OS2 A;  3PVQ A;  1YHQ Q;  2DET A;  4IUR A;  1X75 C;  1PM3 A;  1KQS P;  1FMK A;  1F1B B;  1Q82 U;  1I8F A;  3M0S A;  1OOT A;  3KUF A;  2ZPI B;  5EG2 A;  1VQN A;  2EYW A;  2KVQ G;  4M75 B;  1I1J A;  3E1S A;  3C95 A;  1KD1 C;  1KC8 C;  3MEW A;  2CP0 A;  1Y96 A;  2EKO A;  1AT1 B;  3VS3 A;  3ZL7 C;  3JCM d;  1JXO A;  2G6F X;  4PJO G;  4M7A C;  2RQV A;  3GOX A;  2GFA A;  3ZBD A;  1K73 U;  2EQU A;  4RTW A;  1RLQ C;  4MZM A;  1MMA A;  3VV0 A;  1GCQ C;  2QYZ A;  1BCO A;  1NLP C;  1MMD A;  1BCM A;  2RN8 A;  3LYI A;  1QMC A;  5CR2 A;  1PD1 A;  2JUF A;  1VQ5 Q;  2MPX C;  4V2S A;  4FW2 A;  2X4Y A;  4RTU A;  2QXF A;  1WA7 A;  1WXU A;  4ME7 A;  2XMF A;  4Z02 A;  2E4H A;  2L5Q A;  4A4F A;  2QK0 A;  4E6R A;  1G83 A;  3OYC A;  2IVW A;  4HVU A;  1ZSZ B;  1GFC A;  4LDV A;  1X27 A;  4BI4 A;  5LJ3 g;  5GAN 8;  3H6Z A;  5GAM g;  2RHZ A;  3MKD A;  1M4Z A;  4C8Q A;  2L3P A;  8ATC B;  4N0A A;  1T0H A;  3WVE B;  1WHG A;  2LQK A;  3OMG A;  3QKJ A;  4C8Q E;  4KH0 B;  3L42 A;  2LT4 A;  2EBP A;  4N4H A;  2QG9 B;  3QYH B;  1CKA A;  4HCC A;  2X51 A;  4JJB A;  5KYN A;  1KHI A;  4BUG A;  4HCZ A;  5KYX A;  3EH2 A;  2V1R A;  2J6F A;  5GAN 3;  3OYK A;  2RQT A;  4MZT A;  2DRK A;  3QYG B;  1P92 A;  3CME Q;  4RTY A;  1M2V B;  5GAN 4;  4M77 F;  4F14 A;  1TU0 B;  3EG3 A;  4XU1 A;  4N4G A;  1IHW A;  1K9M U;  1VYT A;  1WJR A;  1ZLM A;  4M7D D;  2DL8 A;  1GBR A;  1CKB A;  2LX7 A;  4ESR A;  2DYI A;  1YI2 A;  2QQ9 A;  4QVC A;  1N5Z A;  3I55 T;  1K4U S;  4ZGD B;  5GAN 7;  1TSF A;  4GY5 A;  3L2W A;  3CCM T;  5GAN 5;  4X9C A;  2M0O A;  2L3Q A;  1NJI R;  1CSK A;  1RAI B;  1C0M A;  5CVI A;  2J06 A;  1VQP Q;  1YIJ Q;  1AEY A;  1RAB B;  4N4I A;  4DOW A;  2PUK B;  3UPU A;  2E10 A;  4Y28 E;  3H0F A;  2VV5 A;  4J7I A;  4PKC C;  1I81 A;  1XOV A;  3ME9 A;  4LNP A;  1G3T A;  3ULR B;  3OYF A;  2XKO C;  1GBQ A;  3QJY A;  2RH2 A;  3URG A;  2GNC A;  3SB2 A;  4F04 B;  3PNW C;  4OB3 B;  2K5F A;  1OX8 A;  2M1H A;  5FRN A;  3EFO B;  2RMO A;  1U1T A;  4LDW A;  5CQY A;  1K0X A;  2VVK A;  1YJ9 A;  1BBZ A;  2C0T A;  2YLC A;  2KMT A;  2XK0 A;  2F2V A;  1RLP C;  4JJC A;  2CS7 A;  3OSS C;  2EQK A;  4LE9 A;  1U1S A;  3VS0 A;  3CCJ Q;  2YSQ A;  1M1K R;  5KE2 A;  5HKC A;  4C8Q D;  1V29 B;  2EAY A;  3OYJ A;  1KIK A;  4E7K A;  3L1A A;  5IH2 A;  2CH4 W;  5GAN d;  2RHI A;  4M7A B;  2IPO B;  2O2O A;  1Q7Y R;  1Y57 A;  2DZC A;  2JN0 A;  3CXC S;  5I2M A;  1WHH A;  2RA2 A;  2QEX A;  1UHF A;  1ZHI A;  2LCL A;  1VQN T;  3PGG A;  4E7L A;  5I2S A;  4XQ3 A;  2P0P A;  1FXX A;  3CCV T;  2F5K A;  3A8H B;  4DQ2 A;  3JCM b;  1OEB A;  1NEB A;  2DM1 A;  1D1A A;  3QWX X;  3F70 A;  2COZ A;  2EJG A;  2I0N A;  2L0A A;  4J6X A;  2O88 A;  1VA7 A;  2CUB A;  2KGT A;  2OAW A;  4B9W A;  2H3E B;  2DTI A;  3H9N A;  3M4G A;  2A3L A;  1I07 A;  3OY9 A;  2COY A;  1C1A A;  3A98 A;  5A0L A;  2NWM A;  3A8M B;  1YFN A;  5IHI A;  1VQL Q;  2Y90 A;  5LJ5 j;  1VQ9 A;  4LUD A;  4J9C A;  4FU6 A;  2QI2 A;  4M77 A;  1H8K A;  3HFO A;  1ZQ1 A;  1KD1 U;  1KC8 U;  4JRK A;  1XJW B;  4NOY A;  2L2P A;  4Q5W A;  3UA6 A;  3OA6 A;  1MV3 A;  2MWP A;  2FZK B;  2YUN A;  1YJN Q;  2BZY A;  4PJM A;  5KYW A;  5GMK j;  4M77 E;  3JB9 J;  1N8R C;  1YNZ A;  2HMA A;  4QT7 A;  4RTV A;  3G71 T;  1JRI A;  1UJY A;  3M54 A;  2BE7 D;  2CP5 A;  2GTJ A;  1YP5 A;  3SFM A;  1RAE B;  1G8X A;  1RAA B;  3QII A;  1Z9Z A;  4XTW A;  1QCN A;  4IUQ A;  1Q81 R;  2QA4 A;  2KNB B;  4C92 G;  4PJO D;  2YRD A;  3DLM A;  3HHT B;  1TUC A;  3C4S A;  3JCM Q;  4EMK A;  3CC7 Q;  3CCQ Q;  2P4T A;  2FYK A;  4EMG A;  1I4K 1;  4K11 A;  2OX7 A;  1ZUU A;  4F7U F;  4HT9 A;  1WFW A;  1ZUK A;  4XTX A;  3KXT A;  1HK9 A;  1QWE A;  4J6W A;  1VQK A;  1UGP B;  1D1B A;  4PFP A;  4LUE A;  1ACM B;  2GGR A;  1K73 C;  1DJ7 B;  1VQ6 A;  2EYQ A;  1ZSG A;  2EJ9 A;  4AFZ C;  1YJN T;  3V7R A;  3CBO A;  3UWN A;  4A4H A;  4FYY B;  1LPL A;  2O9S A;  1HYO A;  1G3S A;  3JCM g;  3JB9 F;  1Y0M A;  2RF0 A;  1XQH A;  4J9I A;  3WXM B;  1T0J A;  1VQO A;  2RJC A;  1UEC A;  1EX4 A;  4F7U G;  5D6W A;  1IHV A;  4FT4 A;  4M7D F;  2JS2 A;  3CEY A;  1GRI A;  2MWO A;  4J9F A;  1MV0 B;  3REA B;  5KYU B;  3QWY A;  1M8M A;  2GCX A;  3RER A;  3I5S A;  4XU0 A;  3MCA B;  3JB9 G;  2DER A;  3PMI A;  4BI8 B;  1IRE B;  1A0N B;  1RI9 A;  1QVF A;  2KXC A;  3EAE A;  2F5T X;  1SRM A;  2LQW A;  3LLR A;  2QGG A;  4YTL A;  2KRS A;  3AT1 B;  2ENM A;  1I0C A;  4KT0 E;  3TVT A;  3R6O A;  1SF9 A;  4NL3 A;  5GAO m;  1HXD A;  2EPD A;  3KBG A;  1M1K C;  4FT2 A;  4OGC A;  4CC4 B;  2PVD B;  2AHJ B;  3RNJ A;  1N6A A;  4HKE A;  1VQM Q;  4R0K A;  2YRC A;  2LRQ A;  4NS5 A;  1M8V A;  2DF6 A;  1X2Q A;  3EGX B;  1UGR B;  1NYF A;  2H3J A;  3QDF A;  1NM7 A;  1ZA2 B;  3A8G B;  2F2X A;  4AG2 C;  2E6N A;  1N9R A;  3VJP A;  2AT1 B;  1PKT A;  1RAC B;  4JJN K;  3GNF B;  2BIV A;  3RBB B;  3G4S Q;  3JB9 I;  1QW1 A;  3G6E Q;  4M77 C;  3OB9 A;  2RQW A;  3A1P A;  3M56 A;  2HAX A;  3RMS A;  3CCR T;  1YJW A;  1OPL A;  3JCM h;  4FSX A;  2XDB A;  1Z9Q A;  4BDZ A;  5IT9 E;  1KQS A;  3LH5 A;  1G2B A;  1M2O A;  1NG2 A;  2CT3 A;  2JT4 A;  1VQM T;  2K57 A;  3NTH A;  4KGX B;  3OYD A;  2CP2 A;  5DLO A;  2EQJ A;  2AKL A;  1YBY A;  2C06 A;  1VQ5 A;  2ZPG B;  3S3M A;  2OTJ Q;  4GLM A;  1VQ8 Q;  5GMK l;  2A28 A;  3EGD A;  3CCL Q;  1M1F A;  2HSE B;  5ECA A;  2M0Y A;  3IQL A;  4EMK C;  3BW1 A;  2V26 A;  3VS5 A;  3FEO A;  4GBQ A;  4RCB A;  4FM4 B;  1HJD A;  4J7F A;  2C0O A;  1E6H A;  2H8H A;  3G1J A;  3FC3 A;  1W2B S;  3G4S T;  2LVM A;  3LW5 E;  1OV3 A;  2EJF A;  1OI1 A;  4PJN A;  3CQT A;  3VS1 A;  1G5V A;  1KHC A;  3M0Q A;  1Y07 A;  3QSU A;  3MEU A;  2Y4Y A;  5GAN 2;  3JCM J;  4ZTJ A;  2NYS A;  1OU9 A;  1M5Q 1;  3MP8 A;  4R55 A;  1X2K A;  1K0S A;  4OMO A;  2QA4 T;  2NUP A;  2HZY A;  5M9O A;  3EG1 A;  2R5A A;  3M55 A;  4RKU E;  3O8V A;  4MZP A;  3CME A;  2EGE A;  5GAN g;  5GJW B;  4M7D A;  2NUT A;  1BIB A;  2ED1 A;  3RR6 A;  1ARK A;  1SRL A;  2RJD A;  5LJ5 d;  1VQK T;  4M7D E;  2GF7 A;  1VQ6 T;  3J80 E;  1FYN A;  2MF2 A;  3EG9 B;  2A0F B;  2KT8 A;  2QTV A;  4C5E A;  2J7I A;  4PJO F;  2CSQ A;  2EW3 A;  3M0T A;  5CCA A;  4MMK A;  4IIM A;  2KYM A;  1WIE A;  2DIL A;  4A4K A;  1VQO T;  1QCO A;  1OZ3 A;  4DEX A;  3NGP A;  1C6V X;  2DO3 A;  1WPY A;  5L23 A;  5L8R E;  2HL5 C;  3C0C A;  2HL3 A;  5C0M A;  3QXE B;  3VYG A;  1AWO A;  2E12 A;  1OUL A;  4KUD K;  1I5L A;  4RCC A;  5CKD A;  4C92 D;  2G3R A;  1H92 A;  5AT1 B;  1M27 C;  2YRV A;  1NJI U;  3JB9 H;  1TTH B;  3HTR A;  4TVR A;  1UGS B;  2DL3 A;  4M78 G;  1BIA A;  4LD9 K;  5CQX A;  4PJL A;  2I2L A;  2RB6 A;  2RI3 A;  2D9T A;  1BU1 A;  1M1G A;  2YXY A;  2FPF A;  1OQK A;  1KJW A;  4A54 A;  2KQW A;  1WYX A;  3P8H A;  1AD5 A;  2FG0 A;  5FU7 C;  1FX7 A;  1UEB A;  2CP7 A;  4M77 B;  1NEG A;  5HK0 A;  4AFQ C;  2J6K A;  3CCS A;  1JJ2 S;  1VYU A;  1V1C A;  1NLO C;  3I55 Q;  3DLL A;  3BE3 A;  2CP6 A;  1I5O B;  1PG5 B;  5KYW B;  5GAN h;  1QLY A;  3CCM Q;  3REB B;  3L2Q A;  1TUG B;  1K8A R;  1D0Y A;  4PFO A;  1ZBJ A;  5I22 A;  4XTU A;  3HSB A;  2HQE A;  3CC2 A;  4OMM A;  3V8K A;  3CXC A;  3JB9 D;  1M1K U;  4FYX B;  1YJW T;  2QQA A;  2LMJ A;  1MHN A;  2LNH B;  3JCM W;  3S6W A;  3OYM A;  4EMK B;  3FDR A;  3CC4 A;  1VQ4 Q;  4M75 G;  5LJ3 f;  5A0G A;  5GAM f;  5DM7 R;  4ATO A;  1W6X A;  3HP9 A;  1TXQ A;  2QAS A;  5FRM A;  3CD6 T;  4BY6 C;  2FO0 A;  2ED0 A;  1Y7X A;  4II1 A;  3OQ5 A;  3OW2 S;  2LDM A;  1Q82 R;  2M02 A;  1QWF A;  1VQL A;  4XTZ A;  1K9A A;  2JNG A;  4M7D C;  2AK5 A;  1ZA1 B;  2FEI A;  2P0Q A;  4JRP A;  2CRE A;  4PK4 A;  2XDD A;  3OYL A;  1FMW A;  2KY9 A;  2JW4 A;  2RO0 A;  2X9H A;  1X6O A;  1UUE A;  2P4R A;  5KCO A;  1VQ4 T;  4PJO A;  3VS7 A;  3OYA A;  4QVZ A;  5LJ3 h;  4MML A;  5GAM h;  2KRO A;  4KH1 B;  1VQN Q;  3LGF A;  2YWW A;  1OX9 A;  2ZPE B;  2L3S A;  2KYB A;  3V7S A;  2B86 A;  4PJO E;  3CCV Q;  2DNU A;  3CC7 A;  1NBE B;  2XIC A;  1U5S A;  1WX6 A;  2HCK A;  2HBP A;  4NL2 A;  3CCE A;  1UFF A;  1BI1 A;  5FRO A;  1YIT A;  1QCF A;  1UGQ B;  4CRI A;  1OZ2 A;  1GFD A;  3CPF A;  2MMP A;  2A36 A;  3CPW S;  2EGA A;  1Q81 U;  1U3O A;  4AFS C;  3CXC P;  2CSI A;  1YN8 A;  5IAY A;  4CC3 A;  3H0H A;  4PJJ A;  2BUD A;  1SPK A;  4D8K A;  2GBQ A;  4JZ4 A;  2VYT A;  3NFC A;  4QQ6 A;  1LVK A;  2FHD A;  3I56 A;  3QJ6 A;  1WHK A;  4C8Q C;  2B8A A;  2D0N A;  4N0A C;  5FU6 C;  3G71 Q;  2DX1 A;  2CZ1 B;  1IGU A;  1PC0 A;  2AKK A;  4C0F A;  2ZZD A;  2YHT A;  5IXF A;  3RDV A;  4EPC A;  4ORZ A;  1K9M R;  1H3Z A;  2ROL A;  3TSZ A;  4HT8 A;  2VAS A;  5FU7 B;  1SSF A;  2MAM A;  2ECZ A;  1QP3 A;  3OS1 A;  2M9U A;  2KAF A;  4ELY C;  2RHX A;  2LP5 A;  2HQX A;  2VXE A;  3HRS A;  4E7I A;  5LJ3 e;  3NTK A;  5GAM e;  1RAD B;  2FZC B;  4OB0 B;  2DYB A;  3EGD B;  4J9E A;  1YCY A;  1OYX A;  5GJV B;  4JZ3 A;  4RG2 A;  2SRC A;  3P8D A;  5GAO q;  4C92 F;  4D8D A;  4M7A F;  2JVV A;  4ZGJ B;  5CAI A;  3OYH A;  4HCB A;  2LQ8 A;  3CCS T;  3GPL A;  3JCM P;  2JXB A;  4CC2 A;  2CZ6 B;  1B34 A;  2CH4 A;  1UGV A;  1SHG A;  1TUD A;  3PIO A;  1S72 A;  2EYZ A;  5LJ5 g;  4LDU A;  2XD0 A;  2RI5 A;  5KE3 A;  2E64 A;  5EC7 A;  2X3W D;  3CC2 T;  4BY6 B;  3TSW A;  4HVW A;  3PTA A;  4M7A G;  2M51 A;  1VQ7 A;  1AZG B;  2DLP A;  1PNJ A;  3PVL A;  4JJD A;  3BDU A;  3CC4 T;  3UDC A;  1OU8 A;  2FPD A;  2DD5 A;  1Y71 A;  2XID A;  4M78 D;  2K3X A;  4OB2 B;  4M7D B;  1UTI A;  1V76 A;  5KYY A;  1TOV A;  2F2W A;  2OTL A;  3M4Y A;  4PJO C;  4Z88 A;  1H64 1;  1M2V A;  1SSH A;  1IGQ A;  3MP1 A;  1NJI C;  1YI2 T;  2OTJ A;  4CI0 C;  3RKX A;  2FB7 A;  2JTM A;  2LX9 A;  3A8O B;  3TCJ A;  3VUB A;  3L2U A;  2D8J A;  3I5R A;  2L3R A;  4PLI A;  1QQJ A;  1M90 R;  4C0Z A;  2P84 A;  4PLL A;  3FJP A;  1B7T A;  6AT1 B;  3HFN A;  1HSQ A;  1K1Z A;  4X34 A;  2HNI A;  2AIR B;  1UB4 A;  3QG1 A;  1G3Y A;  1WJQ A;  2FVU A;  5J39 A;  2K4Y A;  3SHW A;  3CMA A;  1Y96 B;  5C6S A;  1Q86 R;  2CT4 A;  4Z89 A;  4BB7 A;  3A5Z B;  3MEV A;  3TQ7 P;  2E3I A;  1BKB A;  4E47 A;  2QTX A;  3U23 A;  4KRT A;  2K2M A;  4JS4 A;  2K9G A;  4A4G A;  1TS9 A;  5HY6 A;  5IXB A;  4M75 D;  4EMH A;  1QP2 A;  1ZUY A;  1NE8 A;  3S3N A;  3PT9 A;  3CCR Q;  3NPF A;  3M0P A;  3JCM f;  3CCE T;  1KC8 R;  1YJ9 T;  2KE9 A;  2D6F A;  3CCU A;  3EH1 A;  4Z8A A;  4CC7 A;  2OJ2 A;  3BDL A;  1PCX A;  2DZ9 A;  2EIF A;  3QUI A;  3LX7 A;  4C5H A;  4DEY A;  1FMV A;  3DB4 A;  4E7Z A;  4C8Q B;  2DKG A;  1Q7Y C;  2KRM A;  2YUQ A;  3E2U A;  3NHN A;  5FU6 B;  1MMG A;  1MND A;  3PIP A;  3EG2 A;  3Q1J A;  5GMK h;  1YHQ A;  3LGL A;  4J5Y A;  1M3C A;  2O9V A;  1QVG S;  1LJO A;  1WHJ A;  3OS0 A; 
#chains in the Genus database with same CATH homology
 4A4K A;  2QEX T;  1VQO T;  3MP6 A;  1OZ3 A;  3G4S A;  5CVI A;  4KUL A;  2DO3 A;  1WPY A;  5AYF A;  1O9S A;  5L8R E;  3G6E A;  2D0Q B;  2CZ7 B;  2KSS A;  4J8O A;  1VIF A;  2DTO A;  4JDS A;  1QVG A;  4C92 A;  1XTD A;  4N4I A;  4DOW A;  2PUK B;  3CBP A;  3QBY A;  3UPU A;  5C0M A;  2E10 A;  3QXE B;  3VYG A;  4Y28 E;  3WVD B;  3PFS A;  1BI0 A;  2E12 A;  4P5N A;  2VV5 A;  3LWI A;  4KUD K;  4J7I A;  1I5L A;  4PKC C;  1EIF A;  2RM4 A;  4QW2 A;  1I81 A;  4C92 E;  5GAO p;  4RCC A;  1XOV A;  4C92 D;  2G3R A;  3ME9 A;  4D6W A;  5CKD A;  5LJ3 d;  1WQ7 A;  4ZN1 A;  1G3T A;  5GAM d;  3OYF A;  2PQW A;  2XKO C;  2YRV A;  1NJI U;  3QJY A;  3JB9 H;  1X01 A;  2RH2 A;  3URG A;  2E5Q A;  3M58 A;  4UC4 A;  3SB2 A;  4TVR A;  1UGS B;  1Q82 C;  4O6J A;  3FRN A;  4XK8 E;  4M78 G;  1BIA A;  3PNW C;  4LD9 K;  4OB3 B;  2K5F A;  5CQX A;  3E19 A;  3CBM A;  2WSC E;  3QZ5 B;  2I2L A;  3LWH A;  1VQ8 A;  2MI6 A;  2M1H A;  2RB6 A;  5CIU A;  2K3Y A;  2RI3 A;  4MDX A;  2D9T A;  4BE2 A;  3CCL A;  5FRN A;  5FLX E;  1IZ6 A;  3VKI A;  5GAN 6;  1M1G A;  4M78 C;  1U1T A;  2X4J A;  3M53 A;  4HA8 A;  1VQL T;  2HD0 A;  4LDW A;  5CQY A;  1RI0 A;  1VQ9 T;  1YJ9 A;  2EWN A;  2YLC A;  4A54 A;  2O4X A;  2KQW A;  2KMT A;  4C5G A;  2R5M A;  2XK0 A;  3X20 B;  2PVG B;  3QPH A;  3P8H A;  2KDS A;  1D3B A;  2CS7 A;  3OSS C;  2EQK A;  2DAQ A;  2YLB A;  5FU7 C;  5LJ5 f;  1FX7 A;  1UEB A;  3JCM V;  4WF2 A;  3ASK A;  1U1S A;  4OGE A;  5I21 A;  4M77 B;  5HK0 A;  2QDY B;  4KUI A;  4F7U A;  2CKK A;  3M9Q A;  3RES A;  3CCS A;  5KE2 A;  1JJ2 S;  2RJE A;  5HKC A;  4C8Q D;  1V29 B;  2K5L A;  3DLL A;  3JAM E;  2EAY A;  3OYJ A;  4E7K A;  3L1A A;  2JOY A;  5GAN h;  1W2B A;  1Q81 C;  5GAN d;  1S72 T;  2RHI A;  4M7A B;  4F7U E;  2GFU A;  2DZC A;  3L2Q A;  2JN0 A;  3CXC S;  3MHX A;  2OAU A;  2DTH A;  5I2M A;  4C8Q G;  3GP8 A;  2RA2 A;  2QEX A;  1ZHI A;  3UT1 A;  3HL8 A;  4XTU A;  2LCL A;  3DB3 A;  1VQN T;  4PJO B;  3HSB A;  2ZPB B;  3PGG A;  2HQE A;  4E7L A;  5I2S A;  4XQ3 A;  2K5I A;  5GMK e;  2P0P A;  4R56 A;  1FXX A;  3VYH B;  3V8K A;  1YIT A;  3CC2 A;  3CCV T;  1WQW A;  3CXC A;  2F5K A;  2ZGW A;  3A8H B;  4DQ2 A;  1VQ7 T;  2ZCF B;  3JB9 D;  1M1K U;  3JCM b;  2Y4X A;  3SWN B;  1YJW T;  3C12 A;  3CCQ T;  3CC7 T;  2QQA A;  4OVA A;  1MHN A;  1QVF S;  3JCM W;  4BI3 A;  1MGQ A;  2O01 E;  3S6W A;  3OYM A;  4EMK B;  3FDR A;  3CC4 A;  3F70 A;  2VC8 A;  4M75 G;  2EJG A;  3PMT A;  2K2V A;  3GF5 A;  4JLI A;  3PIP A;  1O75 A;  4DA4 A;  4A53 A;  5GAO r;  1BYM A;  4J6X A;  5LJ3 f;  4E7J A;  5A0G A;  5GAM f;  1YIT T;  3J7A F;  4BAC A;  5LJ5 h;  2OTL T;  1K8A U;  4JRI A;  1R8O B;  5A0D A;  5DM7 R;  4B9W A;  4ATO A;  2DXB A;  3HP9 A;  3M59 A;  2DTI A;  3OYY A;  4M75 C;  5FRM A;  3M4G A;  2A3L A;  3RKY A;  3CD6 T;  4BY6 C;  3QO3 A;  2DD4 A;  4IUP A;  1NPR A;  2JTF A;  3JCM e;  3OY9 A;  3JCM X;  2LCC A;  2DXC A;  2R57 A;  1Y7X A;  3OSV A;  3OQ5 A;  4II1 A;  5DY9 A;  3OW2 S;  4M7D G;  3HRT A;  2LDM A;  3HPW A;  3T9N A;  5A0L A;  5KCH A;  1G3W A;  2V8J A;  4XTV A;  3A8M B;  3RUX A;  3JCM c;  2P0K A;  1VQL A;  5CKH A;  1M9S A;  2Y90 A;  4XTZ A;  5LJ5 j;  1VQ9 A;  4FU6 A;  2QI2 A;  3VU3 C;  4M77 A;  3OYI A;  2JNG A;  4M7D C;  3HFO A;  1ZQ1 A;  4M78 F;  4PNO A;  2P0Q A;  1KC8 U;  4JRP A;  1KD1 U;  3OW2 A;  2VGN A;  4JRK A;  3JRZ A;  4NOY A;  4OMF B;  4Q5W A;  2DXU A;  1KQ2 A;  2V8K A;  1AHJ B;  3OYE A;  2LNV A;  3OA6 A;  3OBY A;  2MWP A;  5IN1 A;  5GMK i;  4ELZ C;  3I56 T;  5GAN 8;  3A8L B;  5D6Y A;  1K9M C;  5D6X A;  5GMK j;  2XDD A;  4M77 E;  3JB9 J;  1VQP A;  1YIJ A;  4M77 D;  1N8R C;  4M7A A;  4L5G A;  3OYL A;  2EQM A;  2L8D A;  4FIB A;  4LDY A;  2KY9 A;  3N5B B;  2E6Z A;  3G71 T;  2KK4 A;  2RO0 A;  3ZEH A;  3HKS A;  2LT1 A;  1JRI A;  2M16 A;  1X6O A;  3CMA T;  3M54 A;  5KCO A;  5GAN f;  2QQS A;  2RK1 A;  1VQ4 T;  2L89 A;  4PJO A;  3SFM A;  3OYA A;  4M7A E;  4QVZ A;  5LJ3 h;  3QII A;  4MML A;  2VUB A;  3TRE A;  3X28 B;  5GAM h;  2RK2 A;  4M7A D;  5CKB A;  4XTW A;  3MEA A;  4ZN3 A;  2XI9 A;  2CGH A;  3LGF A;  4IUQ A;  2FL7 A;  2ZPE B;  3L2R A;  1RL2 A;  2QA4 A;  1LOJ A;  3J81 E;  1KQS S;  3SWN A;  3V7S A;  4PJO E;  3M5A A;  4C92 G;  4PJO D;  2NLU A;  3DLM A;  3CCV A;  3HHT B;  4L59 A;  3OYB A;  3INZ A;  3C4S A;  3JCM Q;  4EMK A;  4L6V 5;  3V8L A;  3CC7 A;  2XIC A;  1FWZ A;  4C8Q F;  3GLX A;  2P4T A;  2E1H A;  5LJ3 j;  2A7Y A;  2FYK A;  4C92 C;  4J83 A;  5GAM j;  5A2Q E;  4EMG A;  1I4K 1;  1QVP A;  2HBP A;  4NL2 A;  4C0D B;  2V8I A;  3QHS A;  3CCE A;  3CCU T;  1BI1 A;  4F7U F;  4HT9 A;  5FRO A;  3V7C A;  4XTX A;  3M57 A;  2R58 A;  1UGQ B;  3NTI A;  4CRI A;  1HK9 A;  4J6W A;  1OZ2 A;  2CZ0 B;  3KXT A;  1VQK A;  1UGP B;  3CPF A;  3CCJ A;  4PL6 A;  2MMP A;  3X26 B;  4FL6 A;  4B9X A;  1K73 C;  1VQ6 A;  1DJ7 B;  2EYQ A;  3CPW S;  2EJ9 A;  2XDP A;  1YJN T;  5CO7 A;  1Q81 U;  3CD6 A;  2X4W A;  2DIG A;  3V7R A;  3RIR A;  3CBO A;  3UWN A;  4A4H A;  3BFM A;  4C0G A;  1YHQ T;  3I55 A;  3ZFJ A;  5GAO l;  1G3S A;  5IAY A;  4M75 F;  3JCM g;  3JB9 F;  4JLG A;  2QQB A;  2RHY A;  5CK9 A;  3L2Z A;  2BUD A;  4KBM B;  3CCM A;  5LJ5 e;  1B34 B;  1XQH A;  2XG8 D;  2GQV A;  3CPW A;  3WXM B;  2DXT A;  1TH7 A;  3ER0 A;  4RMO A;  1JJ2 A;  3AHU A;  3SD4 A;  1BI2 A;  3EFS A;  2F69 A;  2XHC A;  3LH0 A;  2VYT A;  1VQO A;  2DEQ A;  2RJC A;  3NFC A;  4QQ6 A;  2PVO B;  3G6E T;  4F7U G;  2FHD A;  2DJZ A;  2QQR A;  5D6W A;  3L2V A;  4BE1 A;  4FT4 A;  3QJ6 A;  3I56 A;  4M7D F;  3CEY A;  4C8Q C;  2B8A A;  4OF1 A;  5GAN j;  1PSF A;  4N0A C;  2MWO A;  4VUB A;  5FU6 C;  3S3O A;  3G71 A;  4QQD A;  2CZ1 B;  4M78 B;  4C0F A;  2GCX A;  3FB9 A;  3RER A;  1VUB A;  2ZZD A;  2PUO B;  4RG8 A;  2RI2 A;  2YHT A;  4XU0 A;  1H3Z A;  4EPC A;  1VQ4 A;  2X35 A;  3FIF A;  4LDX A;  1XNI A;  3MCA B;  3JB9 G;  3PMI A;  4BI8 B;  4HT8 A;  1IRE B;  3E9G A;  5FU7 B;  1Q7Y U;  1PSE A;  2DK3 A;  2LTO A;  1VIE A;  1SSF A;  2MAM A;  1QP3 A;  4QQG A;  1QVF A;  3EAE A;  3OS1 A;  2F5T X;  4JS5 A;  1M90 C;  3OBW A;  2M9U A;  1VQ5 T;  2KAF A;  4ELY C;  3LLR A;  2OTJ T;  4YTL A;  2RHX A;  4X9D A;  2WAC A;  1VQ8 T;  4KT0 E;  2RHU A;  4GLK A;  3R6O A;  3P8B B;  2HQX A;  4A4E A;  4NL3 A;  3CCL T;  1U8R A;  5GAO m;  2VXE A;  3HRS A;  4E7I A;  1HXD A;  5LJ3 e;  3NTK A;  4J6Y A;  5GAM e;  3KBG A;  4OB0 B;  3RKW A;  1LNX A;  5GAO n;  4FT2 A;  4MDW A;  4XU2 A;  1ZBX A;  1M1K C;  1KG1 A;  4OGC A;  1YCY A;  2PVD B;  4DOV A;  3QZ9 B;  2AHJ B;  1OYX A;  3MET A;  4RG2 A;  1N6A A;  3P8D A;  4IKF A;  4HKE A;  5GAO q;  4C92 F;  1N8R U;  4M7A F;  2JVV A;  4ZGJ B;  3EFR A;  5CAI A;  3OYH A;  3OYN A;  2DIQ A;  4HCB A;  5J26 A;  2LQ8 A;  4NS5 A;  2LRQ A;  3GIB A;  1N9S A;  3CCS T;  3GPL A;  1M8V A;  1KQ1 A;  1YJN A;  1UGR B;  3QDR B;  1Q86 C;  3OS2 A;  2H3J A;  3JCM P;  2CZ6 B;  1B34 A;  3A8G B;  3GNG A;  4IUR A;  4IUT A;  2RJF A;  1X75 C;  4IUV A;  1W4S A;  4OB1 B;  2E6N A;  3PIO A;  1S72 A;  1N9R A;  3VJP A;  3X24 B;  4JJN K;  4M77 G;  2LC4 A;  3HRU A;  1Q82 U;  1I8F A;  3GNF B;  5LJ5 g;  4LDU A;  1GXI E;  3KUF A;  2BIV A;  3VUZ A;  2XD0 A;  2RI5 A;  5KE3 A;  2ZPI B;  4XTY A;  5EG2 A;  2KVQ G;  2E64 A;  1VQN A;  3JB9 I;  4M75 B;  1QW1 A;  4M77 C;  3CC2 T;  3E1S A;  3OB9 A;  3C95 A;  4BY6 B;  1KD1 C;  2PU9 B;  2ZPF B;  3FLG A;  4M78 A;  3PTA A;  1KC8 C;  3MEW A;  4M7A G;  3M56 A;  3DKM A;  5GAN e;  3CME T;  1Y96 A;  1VQ7 A;  2EKO A;  2HAX A;  2WSF E;  3RMS A;  3OMC A;  2DPP B;  3CCR T;  1YJW A;  1NPP A;  3CCQ A;  3JCM h;  4FSX A;  3JCM d;  3BDU A;  3CC4 T;  2XDB A;  5CKE A;  5LL6 S;  3UDC A;  2DD5 A;  4PJO G;  4M7A C;  1Y71 A;  4M78 E;  3GOX A;  2XID A;  4BDZ A;  4M78 D;  5IT9 E;  2K3X A;  1KQS A;  2GFA A;  4OB2 B;  3ZBD A;  4ZGE B;  4M7D B;  1WNL A;  1K73 U;  2EQU A;  4MZM A;  3VV0 A;  1VQM T;  2K57 A;  3NTH A;  2OTL A;  3M4Y A;  4PJO C;  3LYI A;  3OYD A;  1H64 1;  5DLO A;  2EQJ A;  5CR2 A;  2JUF A;  1YBY A;  2C06 A;  5J3B A;  1VQ5 A;  2ZPG B;  4V2S A;  3S3M A;  3MP1 A;  2X4Y A;  1YI2 T;  1NJI C;  2OTJ A;  4CI0 C;  3RKX A;  2FB7 A;  2JTM A;  2LX9 A;  2QXF A;  2X4X A;  3A8O B;  4JUV A;  3TEE A;  5GMK l;  3TCJ A;  3VUB A;  3C94 A;  4ME7 A;  1M1F A;  2L5Q A;  2RD1 A;  4Z02 A;  3E9F A;  3SWN C;  4A4F A;  5CKF A;  2L3R A;  4PLI A;  3OYC A;  4ZTF A;  2IVW A;  4XU3 A;  4C0Z A;  4LDV A;  4BI4 A;  3V8J A;  4EMK C;  5LJ3 g;  3SDZ A;  3H6Z A;  4PLL A;  3BW1 A;  5GAM g;  1WGS A;  2E41 A;  1NZ9 A;  2RHZ A;  2CYZ B;  1M4Z A;  3FJP A;  3FEO A;  4RCB A;  4C8Q A;  4FM4 B;  3OYG A;  4J7F A;  5KH6 A;  3FC3 A;  1W2B S;  4N0A A;  3G4S T;  2LVM A;  3WVE B;  3LW5 E;  1JBM A;  3OS5 A;  3HFN A;  2LQK A;  3OMG A;  4X34 A;  2HNI A;  1VQP T;  1YIJ T;  1UB4 A;  2EJF A;  4C5I A;  2VXF A;  3QKJ A;  4C8Q E;  1OI1 A;  3L42 A;  2LT4 A;  2ZPH B;  3QG1 A;  3RMQ A;  1G3Y A;  4N4H A;  5DLQ E;  2EFI A;  3QYH B;  1G5V A;  1KHC A;  1WJQ A;  2FVU A;  4C92 B;  5J39 A;  4LD6 A;  2K4Y A;  4BD3 A;  4QVD A;  1Y07 A;  2IG0 A;  4BDY A;  3QSU A;  3CMA A;  3MEU A;  1Y96 B;  2Y4Y A;  1N27 A;  5C6S A;  5GAN 2;  2E70 A;  4HCC A;  1M90 U;  1KHI A;  4M75 A;  4BUG A;  3JCM J;  4HCZ A;  4ZTJ A;  4BB7 A;  1BI3 A;  4R55 A;  1M5Q 1;  3A5Z B;  3MP8 A;  3MEV A;  2QA4 T;  1BKB A;  2VGM A;  4E47 A;  2QTX A;  5M9O A;  5GAN 3;  3OYK A;  2JZ2 A;  2R5A A;  3M55 A;  4MZT A;  4JS4 A;  4A4G A;  4M75 E;  4RKU E;  5HY6 A;  3TU4 K;  4M75 D;  3O8V A;  3QYG B;  4EMH A;  1P92 A;  4MZP A;  5GMK m;  1QP2 A;  4Y91 A;  3CME A;  4E7H A;  1NE8 A;  5GAN 4;  3S3N A;  5GAN g;  3PT9 A;  4M77 F;  3CCR A;  4M7D A;  1BIB A;  2WSE E;  3JCM f;  3CCE T;  1YJ9 T;  5HK3 A;  4XU1 A;  2D6F A;  3CCU A;  3L2U A;  1WJS A;  4N4G A;  2BKD N;  2RJD A;  5LJ5 d;  1VQK T;  4OP0 A;  1K9M U;  1Q86 U;  1WJR A;  2E65 A;  2GF7 A;  1VQM A;  4M7D D;  4M7D E;  3BDL A;  3CCJ T;  2DZ9 A;  2EIF A;  2O4X B;  3QUI A;  4XAX B;  3LX7 A;  4O5V A;  4C5H A;  4JRQ A;  1VQ6 T;  3DB4 A;  3J80 E;  4C8Q B;  4EDU A;  2DKG A;  1D3B B;  3G7Z A;  3MO8 A;  1Q7Y C;  2MF2 A;  1YI2 A;  2QQ9 A;  4QVC A;  5FU6 B;  1K8A C;  3I55 T;  1JB0 E;  3JSC A;  4PJO F;  3Q1J A;  4C5E A;  4ZGD B;  3H8Z A;  4F7U B;  5GMK h;  5GAN 7;  4IUU A;  1YHQ A;  4GY5 A;  3L2W A;  3LGL A;  3CCM T;  5CCA A;  5GAN 5;  4J5Y A;  2XU8 A;  4X9C A;  4BE0 A;  4MMK A;  3BY7 A;  2M0O A;  1QVG S;  1LJO A;  4C0D C;  3X25 B;  2DVE A;  3OS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...