3SD4A

Crystal structure of the first tudor domain of human phf20
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
GHMHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGKVLIHFKRWNHRYDEWFCWDSPYLRPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 20
publication title PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3sd4A00
4LD6A 1H3ZA 3H6ZA 3PFSA 5C6SA 3S3MA 4IUQA 2EQUA 4IUTA 2RI3A 5KCOA 2L89A 3ZEHA 5FRMA 5D6WA 2RI5A 3OYLA 3PMTA 5IAYA 2RJEA 2M1HA 4BACA 3SD4A 3OS0A 4RG2A 3L2QA 3OYDA 2CKKA 2WACA 3H8ZA 4A4EA 3OQ5A 3UWNA 3OYKA 3MEUA 4L59A 2EQMA 3OYIA 3FLGA 4FL6A 1WGSA 4E7JA 4E7HA 2G3RA 3CEYA 3E9GA 2O4XB 4Q5WA 1XNIA 1KHCA 3ME9A 2F5KA 2RHIA 1OYXA 4N4GA 4II1A 4BDYA 3E9FA 4IUPA 1OZ2A 3OY9A 3S3OA 3P8HA 2RHZA 2BKDN 4PLLA 3OYEA 2K3YA 2P0KA 1OZ3A 3NTIA 4B9XA 2IG0A 3QJ6A 2QQSA 3KUFA 2R57A 2E6NA 3FDRA 3NTKA 5D6XA 3S6WA 3UT1A 3QBYA 4QW2A 5J26A 2X4XA 3OS2A 2RHYA 2X4YA 2JTFA 5CIUA 3NTHA 2XDPA 3LH0A 2HQEA 3FEOA 3QKJA 4QQ6A 4QQGA 4QVZA 1WJSA 3OB9A 4Z02A 3MEAA 2EQJA 4C5EA 3MO8A 5M9OA 4IUVA 4EDUA 3OMGA 2DAQA 2MWOA 2DIQA 2M0OA 2MWPA 1SSFA 3MEVA 3L2VA 3L2UA 2L8DA 4BD3A 3QIIA 2GFAA 4GY5A 4A4HA 4A4GA 4BE1A 3L42A 2YRVA 3MP8A 3MP1A 4FU6A 2RHXA 4A4FA 5C0MA 3OYJA 2X4WA 3M9QA 3ASKA 3LGLA 1RI0A 3DB4A 4N4IA 3EAEA 3OMCA 2EKOA 1WJQA 3P8DA 4E7IA 3OYAA 5FROA 3PMIA 4C5HA 2E5QA 2O4XA 2PQWA 3O8VA 4N4HA 1WJRA 3F70A 4PLIA 4ZTFA 5KE2A 3S3NA 2L3RA 4BE0A 2K3XA 2FHDA 5FRNA 2R58A 2RJCA 2R5MA 2LVMA 3OA6A 2GFUA 2VYTA 2B8AA 4C5IA 3OYMA 2R5AA 1MHNA 3OYNA 4E7LA 4IURA 2BUDA 4OVAA 2EQKA 4C5GA 4IUUA 3OS1A 3DLMA 3OYHA 2LRQA 3GOXA 4QQDA 5KCHA 3OYCA 2D9TA 3C4SA 4IKFA 3OYFA 3LYIA 4NS5A 4X34A 2LDMA 2LTOA 5J39A 3L2WA 5D6YA 2RJDA 3BDLA 2EFIA 3PNWC 3OYBA 2BIVA 5KE3A 2RHUA 3LX7A 4ZTJA 4BE2A 4E7KA 5IN1A 2LCCA 3OYGA 3LGFA 1G5VA 2XK0A 2M16A 3Q1JA 4HCZA 2JZ2A 4PL6A 2GF7A 2HQXA 3META 1OI1A 2RI2A 3MEWA 4BDZA 5KH6A 4CRIA 2RO0A 2RJFA 2NLUA 3MP6A 3LLRA 1N27A 4UC4A 2X35A 3DB3A 4B9WA 3L2RA 3FC3A 2DIGA 2QQRA
chains in the Genus database with same CATH superfamily
3VS1A 1LJOA 1FX7A 2XKOC 2ZAEA 3HTRA 5LJ3f 1TG0A 1T0HA 4CC7A 2CKKA 1U8RA 3UWNA 3OYIA 1VQLT 3EHRA 1N8RC 2PVOB 1FXXA 2P4TA 1M4ZA 3EGXB 1X6GA 1MV0B 2ZGWA 3L2ZA 1OZ2A 5FW9A 2QQAA 5LJ5g 4P5NA 1SRLA 3NTKA 3KUFA 2KMTA 3CCJA 4N0AA 2D1XA 1Y0MA 5GANg 1G83A 4AFQC 3NTHA 1QVGS 1X6OA 4MZPA 4J9BA 1H641 4AFUC 2CZ0B 1VQLQ 2DX1A 2O31A 4KBMB 2GFAA 3M59A 5I22A 2ZPBB 2GQVA 1GFDA 3HKSA 4DBRA 4J9DA 2KRSA 1VYTA 1KK7A 4M75E 1Z9QA 1LVKA 3OSVA 1WJQA 2HKQB 2KAFA 2DETA 5FROA 4LDXA 2RPNA 2PUOB 3EGXA 2L3RA 1W2BP 3OA6A 3MPUB 3QZ9B 1K4US 2YHTA 1MV3A 1J3TA 4IIMA 2OTLA 1K8AC 3GOXA 1M90U 3QWYA 3CCLT 4C8QC 1S1NA 2MCNA 3UA7A 1QVFA 3VS5A 3EFOB 2LDMA 1NYGA 3J81E 1SEMA 1TXQA 2Y4YA 2C0OA 2K5IA 4J7FA 1TH7A 3OS5A 1GRIA 1ZBXA 2CH4A 2XMFA 1O75A 4FIBA 5CAIA 2HL3A 2RI2A 4C0DB 7AT1B 2KQWA 1SRMA 4OMFB 4M7AB 4M78E 4DOWA 3ZL7C 1OV3A 4PJOB 4M7DB 5KCOA 2E41A 1PSFA 1YHQQ 5AYFA 2EQIA 3HL8A 3CCLQ 2DLPA 2WSCE 3HPWA 1YI2T 2ZPGB 1ZSZC 1T3LA 5GAMg 3CMAT 3JCMg 4PJMA 2O88A 1BCOA 1UFFA 3NHNA 2JM8A 1IREB 3FIFA 1WDXA 2ZCFB 2F5KA 1OU8A 4RCCA 1NJIU 3GBQA 4KUIA 4JRPA 4RG8A 3OYEA 2IG0A 2QQSA 5LJ3e 5A0GA 2VXEA 1M3AA 2PU9B 2VV5A 5J26A 1GCPA 3LH0A 4JJCA 4QVCA 2CP2A 1YI2Q 4RTYA 3V8JA 3I56A 1IZ6A 2E4HA 2AZSA 1Q82C 4J6YA 2QA4A 3NPFA 4Y91A 3VUZA 4M7DA 1X69A 2PTKA 4OP0A 3I5RA 2EYWA 2J6FA 4OF1A 2AIRB 3I9QA 3NFCA 4L6V5 1WX6A 1RI0A 2XHCA 4N4IA 1PD1A 3M0PA 3ULRB 3CD6A 2RN8A 1QMCA 2JJ9A 2QK0A 3RMQA 1EIFA 2E3IA 1Y71A 3GLXA 1M1KU 1IHVA 2CH4W 3CCQA 2H3EB 5GMKi 1E7OA 3JCMP 2X9HA 3IQLA 4PFZA 4IUUA 3DLMA 1AWOA 5KCHA 3EG3A 2W10A 2K6DA 1RAEB 4KT0E 2P84A 2LQKA 1VQPT 3VS2A 4M77G 5KE3A 1X27A 3UA6A 4HT8A 2HQHA 2HL5C 4M75D 3RDVA 4QKUA 4R0KA 2L3PA 1M1GA 2RF0A 1YWOA 1VQKT 3S3MA 3PFSA 1X01A 2DMOA 2DJZA 2EAYA 2RI5A 2L5QA 1G3YA 1VQPQ 1WNLA 2RD1A 1VQ5A 3RBBB 3HSBA 4F7UB 1Y07A 3CEYA 1KHCA 4J9GA 4F7UF 1VQMA 1JO8A 2X51A 2PVDB 1VQKQ 1W2BA 2HD0A 3TEEA 1EZZB 1CSKA 1YJ9A 4QT7A 5GAOl 3OS2A 1AOJA 1K73U 4ZTJA 1GCQC 4QQ6A 5CCAA 4AG2C 1MNDA 2C06A 1AEYA 3M4GA 4ME7A 2EJ9A 3HRTA 1M2OA 1M3CA 4ZNXA 2JN0A 2M0OA 2J6OA 2LX9A 3PE0A 3I55A 3MP8A 4FU6A 2G6FX 3VS7A 4C8QE 4BB7A 1NG2A 2ABLA 4F7UA 2EKOA 3P8DA 2CP6A 4C92C 1F1BB 3O5ZA 1M90R 3G6EA 2LT1A 5GAN5 5KE2A 2HZYA 5GAOp 1U1TA 2EYYA 4PJJA 2H3JA 2R5MA 1FMVA 2IIMA 3HFOA 2ZZDA 4C5GA 2J6KA 1I0CA 1W2BS 3CC4A 1M2VB 4HVVA 4BE2A 1W1FA 2V1RA 3RUXA 1VQ7Q 3EFSA 1H92A 2LQWA 4CRIA 2FL7A 2NLUA 5GMKj 2P0QA 2K79A 4FYXB 4J6WA 1WI7A 3H9NA 4DA4A 3CCET 1FMWA 2I0NA 3CCRA 1NJIR 1R77A 4FSXA 3CC7T 4ELYC 3OS0A 1IXDA 4M7AG 2NYSA 4GLMA 1ZSZB 2LJ3A 4PJOG 4M7DG 1RI9A 2K7AA 1D09B 4K11A 1B3QA 3ME9A 3JB9H 3E9FA 3CMEA 2KROA 4DQ2A 2HBWA 2RHZA 3EHQA 1IGUA 1M2VA 1PSEA 2A37A 1S72A 4FT2A 1Q81U 4CI0C 4NL2A 3CCEQ 1V76A 1WYXA 2MMPA 2QASA 3FEOA 2V8KA 1OU9A 4GBQA 3CC7Q 1TUCA 5LJ5j 4BY6C 5IHIA 1QWEA 2VGNA 2RQWA 2HDAA 5GANj 1M5Q1 1Q95G 1M1KR 2YRVA 4F04B 2RHXA 3GNGA 1YITT 3EG9B 2Z0WA 1ARKA 4LE9A 2VXFA 2HAXA 2QG9B 2GBQA 3V8LA 2FEIA 4A53A 2JXBA 2DBMA 2DZCA 2E5KA 1I07A 4E7LA 5ECAA 3CCMT 5I2SA 5A0DA 3CC2A 3C12A 2L0AA 1U06A 3L2WA 1TSFA 4HVWA 3JB9F 2RHUA 4E7KA 2DRKA 4XU2A 1YITQ 3H0FA 2DZ9A 1YCSB 3OYGA 3LGFA 4HCZA 2HQXA 4PK4A 1OI1A 1SHFA 4JJDA 4AMCA 4KH0B 5GAOn 2JTMA 2QQRA 3EFRA 1PC0A 2DFUA 5FWBA 3EG9A 3QSUA 5LJ3d 4M75C 2CS7A 1D0XA 2QQBA 4JUVA 3CCMQ 2CDTA 1RAHB 4RTUA 4CC2A 2RA2A 5I2MA 4XTWA 1Z9ZA 1ZBJA 3L2QA 3OQ5A 3EG0A 2PNIA 1K73R 4FM4B 2JTEA 5LJ5f 3WVEB 4KUDK 2RHIA 2ZPEB 1V29B 3G71T 5GANf 1ZUKA 1K8AU 1YBYA 1OX8A 2O2OA 2JNGA 4F7UG 2VWFA 1W4SA 3T9NA 3OB9A 3P8BB 2KYBA 3BDUA 4IUVA 1YWPA 2BTTA 4DOVA 2YUPA 3OMGA 2P0PA 3TU4K 1UGSB 1Q86C 1QVFP 5GJVB 5CKHA 4MZMA 4M78C 3RNJA 4C0GA 1OEBA 3G71Q 1B07A 1WPYA 2X4WA 3M0SA 1YJWA 1SPKA 2KGTA 1G8XA 3J80E 1NPPA 2EYQA 2DRMA 1TWBA 5GAOm 3TSZA 4C92B 3S3NA 3JV3A 2J7IA 2EVRA 2MI6A 2EQKA 4E47A 2XIDA 1K0XA 4ESRA 4Y28E 2AZVA 2QDYB 4J83A 2DM1A 3JB9I 4Z89A 4RCBA 3RERA 1FMKA 4HA8A 2LCSA 5KH6A 2RO0A 4J9FA 2HMAA 2PUKB 4KRTA 4M77F 4LD9K 1OOTA 2KI7A 1TTHB 1QW1A 1UHCA 3I56T 3M57A 1UHFA 2QA4T 5GAMf 1I1JA 1PD0A 1PG5B 1RLPC 3OYLA 1W6XA 3JCMf 1YJNA 2FZCB 1VQOT 2DTHA 3SD4A 3U23A 5I21A 1Q81R 3M5AA 2E65A 1PWTA 1YP5A 3EGDB 2PZ1A 4J9IA 5CVIA 2WSEE 4HKEA 2VVKA 2C0IA 1OZ3A 2DL4A 3QJ6A 4JZ3A 2KXDA 3I56Q 2FRWA 4JRQA 2QA4Q 4D6WA 5KYUB 4QQGA 2XDPA 4FYWB 3QO3A 4M77A 3SWNC 1I5OB 1VQOQ 5LJ5e 1PKTA 3PIPA 1B34B 3M0TA 2J06A 2DPPB 5CO7A 3MJXA 3TCJA 3RKXA 1ZUUA 5KYXA 4BI4A 4PNOA 1R0CB 1B7TA 3OYAA 2E3HA 3EGDA 2K4YA 1LOJA 4LUDA 2JVVA 2R58A 4F17A 1QVPA 4OMQA 1VYUA 2MF2A 4OVAA 3RESA 5LL6S 4GLKA 1VQ5T 5KYUA 2NUTB 2HNIA 4J9CA 1WA7A 2OJ2A 5CKEA 1VQMT 2E12A 3FRNA 1B34A 3OSSC 4A54A 2SRCA 3JCMc 4MDWA 2DXBA 3JB9G 3L2RA 2E70A 4B9WA 1VIFA 1KSWA 2LP5A 2BE9B 2DD4A 2KK4A 1D1BA 1YHQT 1A0NB 5IXBA 2CT4A 2DXTA 2FO0A 2LCLA 4XTXA 2RK2A 1UGVA 1Y57A 3HFNA 1IRXA 1VQ5Q 2W0ZA 1PRLC 2CUBA 4X9CA 2JT4A 1X2KA 1ZUYA 1K8AR 2M1HA 5FU7C 1K9MU 1FYNA 4PKCC 3HRSA 1VQMQ 2WACA 3QUIA 3KBGA 3OYKA 1AWXA 1G3WA 1WGSA 1GFCA 3BW1A 4A4KA 3BFMA 3CCSA 4EMGA 3ER0A 2NUTA 1PNJA 1VA7A 1XNIA 2L2PA 1YJ9Q 2LJ0A 1BB9A 3G6ET 4M77D 4L5GA 5GAMe 3JCMe 4M7AF 2R57A 1PM3A 3UT1A 3E2UA 4QW2A 4PJOF 4M7DF 3UATA 4J5YA 5LJ3h 2DVEA 5KYNA 4F14A 3INZA 2DAQA 2FPEA 2MWOA 1SSFA 4BD3A 3CC4T 2M02A 1Y96B 3CBPA 2DF6A 3EFOA 4XU1A 3MP1A 3G6EQ 1HYOA 2KDSA 4ZGDB 1H8KA 2KY9A 1X75C 5CKDA 2DD5A 4E7IA 2YRDA 1QVFS 3O8VA 3G4SA 2CP7A 5CKBA 1D0YA 2E10A 1JB0E 1UJ0A 4M7AA 3D7SB 2CZ6B 2B86A 4WF2A 3CCRT 2COWA 4E7ZA 1KD1U 4PJOA 5CR2A 3OYNA 3HHTB 3CC4Q 1UTIA 2E6ZA 4KGVB 3OW2A 4RUGA 1VQ8A 4C92G 2CYZB 2CUDA 2RJDA 3VU3C 3BE3A 2LQNA 1NBEB 2DXUA 2YDLA 4KGXB 5LJ3g 1G5VA 1VQ4A 1S72T 4PL6A 3L1AA 1SKUB 2HEQA 1KG1A 3LLRA 1N27A 1N6AA 4D8DA 1TOVA 3CCRQ 4RKUE 2KRMA 2VB6A 2L89A 4DBFA 3QG1A 4EMKC 3R6NA 3LWIA 4FCYA 2O9VA 1RAAB 2VASA 4L59A 2QAZA 1BIBA 2M9UA 2LNHB 1S72Q 1UGRB 1ZSGA 2XDBA 1JRIA 4BDYA 3JCMQ 2ECZA 2V1QA 2BKDN 1VQLA 2E6NA 2A28A 2LMJA 3PVLA 2F69A 4JPBW 4F7UE 1ZA2B 1ACMB 1NZ9A 4Z02A 2EQJA 3MO8A 1I81A 4OGEA 5M9OA 4ANJA 3CC2T 2F1LA 2F2VA 3L2UA 5A0LA 3L2VA 3A8MB 4KGZB 1ZLMA 4OMOA 4ZGEB 2RQTA 1VQ6A 4A4FA 4M7AD 1QP2A 3CXCA 1AVZC 1OULA 1NLPC 4PJOD 4M7DD 2Y90A 2AKLA 4AFZC 2EIFA 2PQWA 4N4HA 3F70A 4ZTFA 1YIJT 3VKIA 2GFUA 2VYTA 4D8KA 3CC2Q 2FRYA 3WXMB 1E6GA 4BI8B 2P4RA 4NS5A 5GJWB 2DVJA 2CSQA 4RTTA 3OYBA 2A7YA 2BIVA 2M0YA 2XDDA 3CCLA 4MDXA 2M16A 1VQ7T 4EMHA 1YIJQ 1XTDA 4RTZA 5EC7A 1MMNA 2A08A 3GIBA 1K9MR 3LH5A 2XI9A 1M90C 1GBRA 4LD6A 1H3ZA 3M55A 4AT1B 3G1JA 2YWWA 5FU6C 4C0ZA 2PVGB 2ZPIB 1MNEA 2KVQG 4C8QB 1WZOA 2RJEA 5HY6A 2DILA 5FU7B 1X2QA 3JCMV 2DERA 1VOMA 3FLGA 4BI3A 1U3OA 3QDFA 3TVTA 1YJWT 4OMPA 1YI2A 4N4GA 3REBB 3M0QA 3CMAA 1QKWA 2QTXA 3P8HA 3S3OA 2FPFA 1DJ7B 4HCKA 3S6WA 1YCYA 2F5TX 2X4YA 2OAWA 2HQEA 2V8IA 2IVWA 2CZ1B 4IIOA 5IHKA 1HK9A 2CP0A 3C95A 3C94A 1AT1B 4J7IA 2GQIA 1NJIC 3JCMb 1YJWQ 1RAGB 4C8QA 2LX7A 4A4HA 2DEQA 2LC4A 4DEYA 1Q7YU 1K76A 3L42A 2MPXC 4OMNA 1KC8U 1KD1R 1RAFB 1TS9A 3ASKA 1EX4A 3LGLA 4N0AC 3TQ7P 1ZA1B 4OB0B 2EPDA 1BU1A 2RJCA 4M78G 4QVDA 2DEUA 3CCVA 1ABOA 1WQWA 4R56A 1ZQ1A 3X20B 4C5IA 2OTJT 2BZ8A 2CP5A 4IURA 3GNFB 4XQ3A 1WXBA 3OYCA 3E19A 2LTOA 1ZSZA 2EFIA 3QDRB 3DLLA 2LCCA 2NWMA 1NLOC 3JRZA 4XU3A 1M1KC 2XK0A 3Q1JA 3GP8A 1WHLA 8AT1B 3VJPA 4HCCA 4JDSA 2DL8A 1N8RU 1KQ2A 1BK2A 2DIGA 1JBMA 3SFMA 1AWJA 2OTJQ 5IHNA 3ZEHA 1ABQA 1SSHA 4F16A 2XICA 4HXJA 5IAYA 1JXOA 1VQKA 1WXTA 2YLCA 4A4EA 3MEUA 5HK0A 2K5LA 1QP3A 3CCJT 3E9GA 3VV0A 1MMDA 4IUPA 1M1FA 3H41A 2OAUA 2GGRA 2MAMA 1PRMC 2RK1A 3MEAA 3JAME 2RNAA 1QCFA 3R6OA 3V7RA 2QDLA 2EGEA 2K2VA 3RMSA 3CCJQ 3AT1B 4J9HA 4BE1A 2L3QA 4JLIA 3TREA 1D0ZA 2QYZA 1XQHA 1K73C 3OMCA 2ZPFB 3QXEB 3V7CA 2OTLT 4XK8E 3EH1A 2DO3A 1SF9A 1MMGA 3EG2A 2D8HA 1QWFA 2CT3A 3PGGA 3SHWA 3OYYA 4M7DC 1G3TA 3I5SA 2K57A 2BUDA 2YLBA 2JUFA 3VS6A 2KT8A 2KSSA 2RQRA 3C4SA 3UF4A 2NUZA 4IKFA 2COYA 1X43A 3CCST 3EH2A 2V8JA 3X26B 2RQVA 3JCMX 1HXDA 1KHIA 4DBQA 5GMKm 2CGHA 2OTLQ 2BZYA 3HP9A 4C92F 1WIEA 1VQ9A 3A8GB 3H6ZA 2JMAA 2XG8D 2EQUA 4IUTA 2RI3A 5LJ3j 2EYXA 1ZHIA 5CKFA 5D6WA 3EG1A 3A98A 1GCQA 2DKGA 1KFZA 1UB4A 3CCSQ 1M27C 4M77E 1BI1A 2O01E 3CCEA 1JEGA 2KYMA 1YNZA 3M0RA 4E7HA 1IGQA 3CC7A 1Q82U 2JS2A 4II1A 5GMKe 4C8QG 4FSSA 3G4ST 1U5SA 2QXFA 3QBYA 3JSCA 5CK9A 4C92A 1UG1A 1LPLA 3UDCA 4LNPA 1Q7YR 3JB9D 2EJGA 5L8RE 1VQNA 1KC8R 3GPLA 1VQ8T 3X24B 3OW2P 2YUQA 4JJBA 4XTYA 5EG2A 3QIIA 3CD6T 3FB9A 4XAXB 5HCKA 1NYFA 4GY5A 4JRIA 3RR6A 4OGCA 5LJ5h 2K3BA 1VQ4T 1Q81C 2DE0X 3G4SQ 3FJPA 1I8FA 3CCQT 5GANh 4O6JA 3M56A 1WJRA 2JS0A 4NL3A 2BE7D 1FWZA 1VQ8Q 4ZGJB 2E1HA 4BY6B 3LW5E 5GANe 2RMOA 4JS5A 1RACB 1M9SA 2LRQA 2QTVA 2ROLA 3CD6Q 4Z8AA 3C0CA 1WXUA 1N8RR 2EWNA 1VQ4Q 2LZ6B 1K9AA 1YFNA 1GBQA 3CCQQ 4ORZA 2J05A 3CCMA 1KQ1A 2JOYA 5J3BA 5GAN6 1AZEA 2RJFA 2K5FA 2FPDA 1C1AA 4BUGA 4LDUA 1NEBA 1WFWA 3QZ5B 3PMTA 2GNCA 5A2QE 2HKNA 3RIRA 4RG2A 2VC8A 2QEXA 2HCKA 3H8ZA 1VQ6T 3CCUA 4HCBA 2DTOA 2YRCA 2DK3A 1YJ9T 4C92D 2YUNA 3CXCP 1OYXA 1IO6A 2QI2A 1NE8A 1UDLA 2MOXA 1K1ZA 4R55A 3A8HB 2CREA 4B9XA 3CBOA 1C0MA 1QQJA 1KIKA 1JU5C 4M75B 4J8OA 3OYDA 3G71A 4LUEA 2DBKA 1CKAA 5GAMh 2QGGA 3I55T 4M75F 2AKKA 2EKHA 3JCMh 4M7AE 2DJQA 1VQ6Q 4ELZC 5DM7R 2L8DA 4PJOE 4M7DE 1QCNA 1M8MA 2IPOB 3G7ZA 4XTUA 1OPKA 3JCMJ 3PMIA 2Y4XA 3PT9A 3VS0A 4BE0A 1PCXA 5FRNA 3I55Q 2LVMA 3QHSA 1UGPB 3M0UA 2B8AA 1MHNA 1JJ2P 3DKMA 2WSFE 4M75A 3LWHA 2K9GA 2D9TA 4M78B 2CZ7B 4EPCA 5D6YA 3PNWC 1X6BA 4M78F 3SEMA 2GTOA 3LX7A 2ED0A 4XTVA 3TSWA 1RL2A 2DYBA 2FZGB 4OB2B 5IH2A 3H0HA 2JZ2A 1MGQA 3RKWA 1EFNA 3CPFA 3MP6A 4E7SA 1NPRA 1ZX6A 3OBYA 2AT1B 1M3BA 1Q82R 3OBWA 3NGPA 2DYIA 2X3XD 1D3BB 3CMET 1WQ7A 5IT9E 3CMAQ 2JW4A 2EQMA 1JQQA 2FVUA 1Y96A 5GAN4 2EW3A 1M8VA 1BI3A 5I11A 1WHMA 2O4XB 1WHJA 4M78A 3RKYA 1VQOA 2ROTA 1OQKA 3OY9A 3QYGB 3NTIA 5D6XA 2HBPA 5GAN7 3CCVT 3VYGA 2RHYA 4HVUA 4E7JA 1UJYA 4ZN1A 5FLXE 2NUPB 4NOYA 3CMEQ 1T0JA 1N9RA 4LDYA 2DIQA 3MEVA 2EGCA 2HSPA 3CPWP 4JZ4A 3JB9J 4A4GA 4ZN3A 1D3BA 3OYJA 2MIOA 4KULA 1RAIB 1NEGA 2JM9A 3OW2S 3CBMA 1IB8A 3QYHB 4JS4A 3J7AF 2OI3A 1BI2A 3CCVQ 4C5HA 2O4XA 2DL5A 5GAN2 4PLIA 1AHJB 4OB1B 3SWNB 2D6FA 1D1AA 1M30A 4AFSC 4JRKA 3VS3A 2ENMA 1VYVA 1Y7XA 4QQDA 1CKBA 2EGAA 2LT4A 4X34A 4YTLA 2NUPA 4FYYB 2GTJA 5GMKl 2CSIA 5DY9A 2D8JA 1K0SA 2C0TA 3A8LB 2GF7A 3KFVA 4OMMA 1RUWA 3DB3A 2A0FB 2FB7A 1HJDA 1WHGA 5KYWB 4LN2A 2D0QB 2KNBB 5HKCA 1QKXA 1NM7A 3AHUA 4M78D 1JXMA 3SWNA 4OMLA 1YHQA 3X25B 3PTAA 2MYSA 2G3RA 4Q5WA 2RQUA 3A1PA 4A63B 1Q86U 2LQ8A 5CQXA 3ZBDA 2F2XA 4MMLA 2EJFA 4HT9A 1TU0B 1GL5A 3NMZC 1JJ2A 1K9MC 1R0BG 4QVZA 1UUEA 3E1SA 2KT1A 5CQYA 3CXCS 4C8QF 1G3SA 5LJ5d 5KYWA 5GAN3 5GANd 3X28B 2X3WD 4CC4B 4M75G 1KQSP 1SG5A 5C0MA 3DB4A 3QPHA 1VQ9T 2KBTA 4M77C 9ATCB 1UGQB 2K3XA 2KR3A 5FWCA 2FHDA 2ATCB 1IHWA 2A36A 3OYMA 1OPLA 3VS4A 3OYHA 4CC3A 3N5BB 2YUOA 2L3SA 4RTXA 4C0FA 1BBZA 5J39A 2I2LA 3BDLA 1MUZA 1VQ9Q 1JJ2S 1MMAA 3V8KA 2CP3A 3QWXX 3SB2A 4Y92A 1KD1C 3MEWA 2X4JA 4X9DA 4UC4A 3PIOA 1OX9A 1UECA 1XOVA 1YJNT 1VQNT 5C6SA 4IUQA 2MK5A 4MZTA 4AG1C 1WLPB 2FZKB 5FRMA 3CPWA 8ATCB 4E2FB 1R8OB 2FYKA 4BACA 4EIKA 4LDVA 5GAOr 1VQPA 1QVGP 3I35A 2XU8A 1AZGB 4MMKA 4XU0A 4J6XA 4FYVB 5DLOA 3REAB 4RTVA 5HK3A 1YJNQ 2K3YA 1VQNQ 3A5ZB 5GAMd 1D1CA 2XD0A 3JCMd 1C6VX 2AK5A 3HRUA 3H0IA 2AHJB 1YN8A 3QKJA 2DL7A 4EMKB 2DA9A 2VGMA 2LJ1A 4DBHA 1V1CA 1TUGB 4EDUA 4ATOA 4PJNA 4WTOB 3BY7A 5GAOq 4LDWA 1N9SA 1TUDA 5IXFA 4JJNK 4PFOA 2GCXA 2D0NA 2E64A 2A3LA 1H3HA 2HSEB 4V2SA 5KYYB 2FG0A 1XJWB 3CPWS 3VYHB 2KRNA 1BCMA 3FJ5A 2DL3A 3GF5A 4C8QD 1W70A 3PVQA 4DEXA 2KE9A 3VRZA 1LNXA 2YSQA 1VUBA 4M4ZA 1UE9A 2ZPHB 2QEXT 1G2BA 1YIJA 3MCAB 1AD5A 2YXYA 3CCUT 4Z88A 4EMKA 3M4YA 3OYFA 3MHXA 3VUBA 4LXCA 3THKA 1E6HA 3JCMW 2KXCA 1U1SA 1RABB 2LNVA 4C0DC 1BIAA 2JMCA 3META 4M7AC 1HSQA 1PKSA 2X35A 3FC3A 1RLQC 2VUBA 1I5LA 2RB6A 4PJOC 5GAMj 5KYYA 1VQ7A 4XTZA 3UPUA 4KH1B 2OX7A 2QEXQ 1T3SA 3WVDB 2RM4A 1Q86R 3CCUQ 2QGFB 1QCOA 1BKBA 4C92E 1P92A 1KQSA 4O5VA 4VUBA 2EBPA 4FL6A 3KXTA 4E6RA 2DXCA 2EYZA 2VKNA 4B6MA 4PLLA 2P0KA 3FDRA 3A8OB 2H8HA 2RH2A 1AWWA 2X4XA 5GAN8 5FU6B 4FW2A 5GMKh 5CIUA 2JTFA 3M58A 2YT6A 1WJSA 3VRYA 4C5EA 2K2MA 3M54A 5L23A 2V26A 4OB3B 4PJLA 2MWPA 5D7UA 3QJYA 2QQ9A 2ESWA 5DLQE 2DTIA 3URGA 1SHGA 3M9QA 3EAEA 1N5ZA 2BZXA 4PFPA 1WHKA 1QLYA 1O9SA 4FT4A 2E5QA 2F2WA 4RTWA 2ED1A 2SEMA 1RADB 6AT1B 1KQSS 5AT1B 1BI0A 2COZA 4M77B 3EGUA 4FW1A 1I4K1 1WHHA 2R5AA 4WCIA 3CQTA 4TVRA 3V7SA 1Q7YC 3MKDA 3OS1A 1KC8C 2O9SA 3LYIA 1QVGA 2DNUA 1GXIE 4X1VA 4JLGA 1BYMA 2OTJA 3SDZA 4J9EA 5IN1A 5KYXB 1VIEA 2KEAA 4RMOA 1HD3A 1PHTA 4BDZA 3ZFJA 1UEBA 2M51A 1YITA 3M53A 1LCKA 1KJWA
chains in the Genus database with same CATH topology
4LD6A 1H3ZA 3EFRA 3M55A 3QSUA 5FU6C 5LJ3d 4C0ZA 4M75C 1LJOA 1FX7A 2CS7A 3OBWA 2QQBA 2PVGB 2ZPIB 4JUVA 2KVQG 2XKOC 4C8QB 5LJ3f 2RJEA 2RA2A 1D3BB 5I2MA 4XTWA 3CMET 5HY6A 1WQ7A 3L2QA 2CKKA 1U8RA 5FU7B 3JCMV 5IT9E 3OQ5A 3UWNA 3OYIA 1VQLT 2EQMA 2FVUA 1Y96A 3FLGA 4BI3A 5GAN4 1YJWT 1BI3A 4FM4B 1N8RC 2PVOB 5LJ5f 1FXXA 2O4XB 2P4TA 3WVEB 1M4ZA 1YI2A 4M78A 3RKYA 4KUDK 2RHIA 4N4GA 1VQOA 2ZPEB 2ZGWA 3CMAA 1V29B 3L2ZA 1OZ2A 3OY9A 3G71T 2QTXA 2QQAA 3P8HA 5LJ5g 4P5NA 5GANf 3S3OA 3QYGB 1K8AU 1DJ7B 3NTIA 3NTKA 3KUFA 5D6XA 1YBYA 2KMTA 3CCJA 4N0AA 3S6WA 2HBPA 1YCYA 5GANg 5GAN7 2JNGA 3VYGA 4F7UG 2F5TX 3CCVT 2RHYA 2X4YA 1W4SA 3NTHA 4E7JA 1QVGS 1X6OA 2HQEA 2V8IA 3T9NA 3OB9A 2IVWA 4ZN1A 3P8BB 5FLXE 2CZ1B 4MZPA 1H641 1HK9A 4NOYA 3BDUA 3C95A 4IUVA 3C94A 1N9RA 4DOVA 2CZ0B 3OMGA 2P0PA 4J7IA 4LDYA 1UGSB 3TU4K 2DIQA 3MEVA 4KBMB 1Q86C 1NJIC 3JCMb 2GFAA 3M59A 5CKHA 4MZMA 4M78C 2ZPBB 2GQVA 4C8QA 3JB9J 4A4HA 2DEQA 2LC4A 3HKSA 4A4GA 3L42A 4C0GA 4ZN3A 1Q7YU 1D3BA 4M75E 1KC8U 3OYJA 1WPYA 2X4WA 4KULA 3ASKA 3LGLA 1YJWA 4N0AC 3OW2S 3CBMA 3OSVA 3QYHB 1NPPA 1WJQA 3J80E 4JS4A 3J7AF 2KAFA 1BI2A 5FROA 4C5HA 2EYQA 2O4XA 5GAN2 4LDXA 2PUOB 4PLIA 5GAOm 4C92B 1AHJB 3S3NA 2L3RA 4OB0B 4OB1B 3SWNB 2RJCA 4M78G 4QVDA 3OA6A 2D6FA 3CCVA 1WQWA 3QZ9B 1ZQ1A 2YHTA 3X20B 4C5IA 2MI6A 4R56A 2OTJT 4JRKA 4IURA 2OTLA 2EQKA 3GNFB 1K8AC 1Y7XA 3GOXA 4XQ3A 4QQDA 4E47A 1M90U 3CCLT 4C8QC 3OYCA 3E19A 2XIDA 2LT4A 1QVFA 4Y28E 4X34A 2LDMA 2LTOA 4YTLA 3J81E 2QDYB 2EFIA 4J83A 3JB9I 2Y4YA 2K5IA 3QDRB 4J7FA 4RCBA 3DLLA 1TH7A 3RERA 2LCCA 3JRZA 4XU3A 5GMKl 3OS5A 1ZBXA 5DY9A 4HA8A 1M1KC 2XK0A 3Q1JA 3A8LB 3GP8A 1O75A 2GF7A 4FIBA 5CAIA 2RI2A 5KH6A 4C0DB 2KQWA 2RO0A 3VJPA 4HCCA 4JDSA 3DB3A 1N8RU 1KQ2A 2FB7A 4OMFB 4M7AB 4M78E 2DIGA 1JBMA 3SFMA 2PUKB 4M77F 4LD9K 4DOWA 4PJOB 4M7DB 5KCOA 2E41A 1PSFA 1QW1A 2D0QB 3I56T 5AYFA 3ZEHA 3M57A 5HKCA 2QA4T 3HL8A 5GAMf 2WSCE 3OYLA 2XICA 3JCMf 1YJNA 4M78D 3AHUA 3HPWA 5IAYA 3SWNA 1YI2T 2ZPGB 1VQKA 1VQOT 2DTHA 3SD4A 1YHQA 2YLCA 5GAMg 5I21A 3CMAT 3JCMg 4A4EA 3M5AA 3MEUA 2E65A 3X25B 5HK0A 2K5LA 3PTAA 1QP3A 1BYMA 3CCJT 2G3RA 3E9GA 1IREB 3FIFA 4Q5WA 3VV0A 2ZCFB 2F5KA 4RCCA 1Q86U 1NJIU 4IUPA 2LQ8A 4KUIA 5CQXA 5CVIA 3ZBDA 2WSEE 1M1FA 4HKEA 2OAUA 4RG8A 4JRPA 3OYEA 1OZ3A 2IG0A 2MAMA 3QJ6A 2QQSA 5LJ3e 5A0GA 2VXEA 2EJFA 4MMLA 4HT9A 2PU9B 2VV5A 5J26A 1JJ2A 1K9MC 4JRQA 4D6WA 4QQGA 2XDPA 3LH0A 2RK1A 3E1SA 4QVZA 5CQYA 3QO3A 4M77A 3CXCS 3SWNC 3MEAA 3JAME 4QVCA 4C8QF 1G3SA 3R6OA 3V8JA 5LJ5e 5LJ5d 3I56A 3V7RA 1IZ6A 5GAN3 1Q82C 4J6YA 2QA4A 3PIPA 2K2VA 3RMSA 4Y91A 3VUZA 4M7DA 1B34B 5GANd 4OP0A 4OF1A 3X28B 2DPPB 4M75G 5CO7A 4BE1A 3NFCA 3TCJA 4JLIA 4L6V5 5C0MA 3TREA 3RKXA 1RI0A 1XQHA 2XHCA 3DB4A 3QPHA 3OMCA 4N4IA 2ZPFB 4BI4A 1K73C 3CD6A 1VQ9T 4PNOA 3QXEB 3RMQA 3V7CA 3OYAA 1EIFA 2OTLT 4XK8E 2K4YA 1LOJA 4M77C 1Y71A 2DO3A 1UGQB 2JVVA 2K3XA 2FHDA 3GLXA 2R58A 1M1KU 1QVPA 3CCQA 3PGGA 5GMKi 3OYMA 3JCMP 3OYYA 4M7DC 1G3TA 2MF2A 2K57A 2BUDA 4OVAA 3RESA 5LL6S 4IUUA 3OYHA 3DLMA 2YLBA 2JUFA 3N5BB 4GLKA 1VQ5T 5KCHA 2KSSA 3C4SA 4C0FA 4IKFA 2HNIA 4KT0E 5J39A 2LQKA 3CCST 1VQPT 5CKEA 2I2LA 3BDLA 2V8JA 4M77G 1VQMT 5KE3A 2E12A 3X26B 3FRNA 4HT8A 1B34A 3OSSC 1JJ2S 4A54A 3V8KA 3JCMc 3JCMX 1HXDA 1KHIA 4M75D 3SB2A 5GMKm 4MDWA 2CGHA 2DXBA 3MEWA 1KD1C 2X4JA 3HP9A 3JB9G 4X9DA 1M1GA 4UC4A 4C92F 3L2RA 2E70A 1XOVA 1VIFA 4B9WA 3PIOA 1YJNT 1VQ9A 1VQNT 3A8GB 1VQKT 2DD4A 2KK4A 3H6ZA 3PFSA 1X01A 5C6SA 3S3MA 1YHQT 2XG8D 4IUQA 2EQUA 4IUTA 2RI3A 4XTXA 2DXTA 2LCLA 2DJZA 2EAYA 4MZTA 2RK2A 5LJ3j 1ZHIA 5CKFA 5D6WA 5FRMA 3HFNA 3CPWA 2RI5A 4X9CA 2DKGA 1UB4A 1R8OB 2L5QA 2M1HA 1G3YA 2FYKA 5FU7C 4BACA 1K9MU 4PKCC 1WNLA 3HRSA 2RD1A 2WACA 4M77E 3QUIA 3KBGA 4LDVA 3OYKA 1VQ5A 1BI1A 1G3WA 2O01E 3CCEA 3HSBA 4F7UB 1WGSA 4A4KA 3BW1A 5GAOr 1Y07A 4E7HA 3BFMA 3CEYA 3CCSA 1VQPA 4EMGA 3ER0A 3CC7A 1Q82U 1XNIA 1KHCA 2XU8A 4MMKA 4F7UF 4XU0A 1VQMA 4II1A 4J6XA 5GMKe 5DLOA 4C8QG 3G6ET 4M77D 3G4ST 2PVDB 5HK3A 4L5GA 2K3YA 5GAMe 3A5ZB 5GAMd 3JCMe 1W2BA 2HD0A 2R57A 3JCMd 2XD0A 3TEEA 4M7AF 3UT1A 2QXFA 1YJ9A 3QBYA 3HRUA 3JSCA 4QW2A 4C92A 5CK9A 5GAOl 2AHJB 4PJOF 3OS2A 3UDCA 4M7DF 1K73U 3JB9D 2EJGA 3QKJA 5L8RE 4ZTJA 1VQNA 4QQ6A 5CCAA 4EMKB 2VGMA 2C06A 3GPLA 3M4GA 4ME7A 2EJ9A 4J5YA 1VQ8T 3X24B 5LJ3h 3HRTA 2DVEA 4EDUA 3INZA 2JN0A 2DAQA 2MWOA 4ATOA 2M0OA 1SSFA 2LX9A 5GAOq 3BY7A 4XTYA 4BD3A 5EG2A 3CC4T 3QIIA 1Y96B 4LDWA 3CBPA 3CD6T 1N9SA 3FB9A 4XAXB 3I55A 4GY5A 4JRIA 4JJNK 4OGCA 3MP8A 4XU1A 3MP1A 5LJ5h 1VQ4T 4FU6A 1Q81C 2GCXA 4C8QE 3FJPA 2E64A 4BB7A 2A3LA 2KDSA 1I8FA 4ZGDB 2KY9A 1X75C 3CCQT 5CKDA 5GANh 4V2SA 4O6JA 2EKOA 4F7UA 2DD5A 3P8DA 4E7IA 4C92C 3M56A 3G6EA 1QVFS 3CPWS 2LT1A 3VYHB 3O8VA 5GAN5 3G4SA 1WJRA 5CKBA 3GF5A 5KE2A 4C8QD 2E10A 1JB0E 5GAOp 1U1TA 4NL3A 4M7AA 2CZ6B 2H3JA 1FWZA 2R5MA 4WF2A 3CCRT 4ZGJB 2E1HA 1KD1U 3HFOA 1LNXA 4BY6B 3LW5E 4PJOA 1VUBA 2ZZDA 5GANe 5CR2A 3OYNA 3HHTB 4JS5A 2ZPHB 4C5GA 2QEXT 1YIJA 3MCAB 1M9SA 2LRQA 2E6ZA 3OW2A 3CCUT 1VQ8A 4C92G 4EMKA 3M4YA 2CYZB 2EWNA 3OYFA 3MHXA 3VUBA 1W2BS 2RJDA 3VU3C 3CC4A 3JCMW 4BE2A 1U1SA 2DXUA 3CCMA 5LJ3g 2LNVA 1G5VA 1VQ4A 1KQ1A 2JOYA 1S72T 4C0DC 4PL6A 1BIAA 3META 3RUXA 5J3BA 3L1AA 5GAN6 3EFSA 4M7AC 4CRIA 1KG1A 2FL7A 2RJFA 2NLUA 3LLRA 1N27A 2K5FA 2X35A 5GMKj 2P0QA 1N6AA 3FC3A 2VUBA 1I5LA 2RB6A 4PJOC 4J6WA 4RKUE 5GAMj 4BUGA 4LDUA 1VQ7A 4XTZA 3UPUA 4DA4A 2L89A 3CCET 3WVDB 2RM4A 3CCRA 3QG1A 4EMKC 1BKBA 3QZ5B 4FSXA 3PMTA 5A2QE 3LWIA 4C92E 4ELYC 3CC7T 3RIRA 1P92A 3OS0A 4RG2A 1KQSA 2VC8A 2QEXA 4M7AG 4O5VA 3H8ZA 4VUBA 1VQ6T 4L59A 3CCUA 4HCBA 4FL6A 1BIBA 4PJOG 2DTOA 4M7DG 2M9UA 2DK3A 1UGRB 1YJ9T 4C92D 2XDBA 3KXTA 3ME9A 1JRIA 1OYXA 2QI2A 3JB9H 1NE8A 4BDYA 3E9FA 2DXCA 3JCMQ 3CMEA 4DQ2A 2RHZA 2BKDN 4PLLA 4R55A 2P0KA 1PSEA 3A8HB 4B9XA 1VQLA 1S72A 2E6NA 3CBOA 3FDRA 4FT2A 1Q81U 4CI0C 3A8OB 2RH2A 4NL2A 2X4XA 5GAN8 5FU6B 4M75B 2F69A 4J8OA 2JTFA 2MMPA 5CIUA 5GMKh 3OYDA 3G71A 3FEOA 3M58A 4F7UE 1WJSA 1NZ9A 4Z02A 2V8KA 5GAMh 2EQJA 4C5EA 3MO8A 4M75F 1I81A 3I55T 3JCMh 4OGEA 5M9OA 3M54A 5LJ5j 4BY6C 3CC2T 4M7AE 4OB3B 4ELZC 5DM7R 3L2UA 2MWPA 5A0LA 3L2VA 2L8DA 2VGNA 3QJYA 5GANj 3A8MB 4PJOE 4M7DE 1M5Q1 2QQ9A 4ZGEB 5DLQE 2DTIA 2YRVA 3URGA 1VQ6A 2RHXA 4A4FA 4M7AD 1QP2A 3GNGA 3M9QA 3CXCA 3G7ZA 3EAEA 4XTUA 1YITT 4PJOD 4M7DD 2Y90A 3JCMJ 1O9SA 2Y4XA 2EIFA 3PMIA 2E5QA 4FT4A 2PQWA 4N4HA 3F70A 3PT9A 4ZTFA 1YIJT 2VXFA 2HAXA 4BE0A 3VKIA 1KQSS 5FRNA 1BI0A 4M77B 2LVMA 3QHSA 1I4K1 2GFUA 2VYTA 1UGPB 3V8LA 2B8AA 4A53A 2R5AA 1MHNA 2DZCA 4TVRA 4E7LA 3V7SA 1Q7YC 3DKMA 3OS1A 2WSFE 1KC8C 4M75A 3WXMB 3LWHA 3CCMT 5I2SA 2D9TA 4M78B 5A0DA 3LYIA 3CC2A 3C12A 4NS5A 4BI8B 1QVGA 2CZ7B 4EPCA 1GXIE 3L2WA 5D6YA 4JLGA 3PNWC 1M8VA 4M78F 3OYBA 3JB9F 2A7YA 2BIVA 3SDZA 2OTJA 2RHUA 3LX7A 4XTVA 4E7KA 4XU2A 1RL2A 5IN1A 2DZ9A 2XDDA 4OB2B 3CCLA 4MDXA 3OYGA 3LGFA 1VIEA 2M16A 4HCZA 1VQ7T 2JZ2A 4EMHA 2HQXA 4RMOA 1OI1A 4BDZA 1MGQA 3RKWA 1XTDA 3ZFJA 1UEBA 3CPFA 3MP6A 1YITA 3GIBA 1NPRA 3M53A 2XI9A 3OBYA 5GAOn 2JTMA 2QQRA 1M90C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LD6 A;  1H3Z A;  3H6Z A;  3PFS A;  5C6S A;  3S3M A;  4IUQ A;  2EQU A;  4IUT A;  2RI3 A;  5KCO A;  2L89 A;  3ZEH A;  5FRM A;  5D6W A;  2RI5 A;  3OYL A;  3PMT A;  5IAY A;  2RJE A;  2M1H A;  4BAC A;  3SD4 A;  3OS0 A;  4RG2 A;  3L2Q A;  3OYD A;  2CKK A;  2WAC A;  3H8Z A;  4A4E A;  3OQ5 A;  3UWN A;  3OYK A;  3MEU A;  4L59 A;  2EQM A;  3OYI A;  3FLG A;  4FL6 A;  1WGS A;  4E7J A;  4E7H A;  2G3R A;  3CEY A;  3E9G A;  2O4X B;  4Q5W A;  1XNI A;  1KHC A;  3ME9 A;  2F5K A;  2RHI A;  1OYX A;  4N4G A;  4II1 A;  4BDY A;  3E9F A;  4IUP A;  1OZ2 A;  3OY9 A;  3S3O A;  3P8H A;  2RHZ A;  2BKD N;  4PLL A;  3OYE A;  2K3Y A;  2P0K A;  1OZ3 A;  3NTI A;  4B9X A;  2IG0 A;  3QJ6 A;  2QQS A;  3KUF A;  2R57 A;  2E6N A;  3FDR A;  3NTK A;  5D6X A;  3S6W A;  3UT1 A;  3QBY A;  4QW2 A;  5J26 A;  2X4X A;  3OS2 A;  2RHY A;  2X4Y A;  2JTF A;  5CIU A;  3NTH A;  2XDP A;  3LH0 A;  2HQE A;  3FEO A;  3QKJ A;  4QQ6 A;  4QQG A;  4QVZ A;  1WJS A;  3OB9 A;  4Z02 A;  3MEA A;  2EQJ A;  4C5E A;  3MO8 A;  5M9O A;  4IUV A;  4EDU A;  3OMG A;  2DAQ A;  2MWO A;  2DIQ A;  2M0O A;  2MWP A;  1SSF A;  3MEV A;  3L2V A;  3L2U A;  2L8D A;  4BD3 A;  3QII A;  2GFA A;  4GY5 A;  4A4H A;  4A4G A;  4BE1 A;  3L42 A;  2YRV A;  3MP8 A;  3MP1 A;  4FU6 A;  2RHX A;  4A4F A;  5C0M A;  3OYJ A;  2X4W A;  3M9Q A;  3ASK A;  3LGL A;  1RI0 A;  3DB4 A;  4N4I A;  3EAE A;  3OMC A;  2EKO A;  1WJQ A;  3P8D A;  4E7I A;  3OYA A;  5FRO A;  3PMI A;  4C5H A;  2E5Q A;  2O4X A;  2PQW A;  3O8V A;  4N4H A;  1WJR A;  3F70 A;  4PLI A;  4ZTF A;  5KE2 A;  3S3N A;  2L3R A;  4BE0 A;  2K3X A;  2FHD A;  5FRN A;  2R58 A;  2RJC A;  2R5M A;  2LVM A;  3OA6 A;  2GFU A;  2VYT A;  2B8A A;  4C5I A;  3OYM A;  2R5A A;  1MHN A;  3OYN A;  4E7L A;  4IUR A;  2BUD A;  4OVA A;  2EQK A;  4C5G A;  4IUU A;  3OS1 A;  3DLM A;  3OYH A;  2LRQ A;  3GOX A;  4QQD A;  5KCH A;  3OYC A;  2D9T A;  3C4S A;  4IKF A;  3OYF A;  3LYI A;  4NS5 A;  4X34 A;  2LDM A;  2LTO A;  5J39 A;  3L2W A;  5D6Y A;  2RJD A;  3BDL A;  2EFI A;  3PNW C;  3OYB A;  2BIV A;  5KE3 A;  2RHU A;  3LX7 A;  4ZTJ A;  4BE2 A;  4E7K A;  5IN1 A;  2LCC A;  3OYG A;  3LGF A;  1G5V A;  2XK0 A;  2M16 A;  3Q1J A;  4HCZ A;  2JZ2 A;  4PL6 A;  2GF7 A;  2HQX A;  3MET A;  1OI1 A;  2RI2 A;  3MEW A;  4BDZ A;  5KH6 A;  4CRI A;  2RO0 A;  2RJF A;  2NLU A;  3MP6 A;  3LLR A;  1N27 A;  4UC4 A;  2X35 A;  3DB3 A;  4B9W A;  3L2R A;  3FC3 A;  2DIG A;  2QQR A; 
#chains in the Genus database with same CATH topology
 3VS1 A;  1LJO A;  1FX7 A;  2XKO C;  2ZAE A;  3HTR A;  5LJ3 f;  1TG0 A;  1T0H A;  4CC7 A;  2CKK A;  1U8R A;  3UWN A;  3OYI A;  1VQL T;  3EHR A;  1N8R C;  2PVO B;  1FXX A;  2P4T A;  1M4Z A;  3EGX B;  1X6G A;  1MV0 B;  2ZGW A;  3L2Z A;  1OZ2 A;  5FW9 A;  2QQA A;  5LJ5 g;  4P5N A;  1SRL A;  3NTK A;  3KUF A;  2KMT A;  3CCJ A;  4N0A A;  2D1X A;  1Y0M A;  5GAN g;  1G83 A;  4AFQ C;  3NTH A;  1QVG S;  1X6O A;  4MZP A;  4J9B A;  1H64 1;  4AFU C;  2CZ0 B;  1VQL Q;  2DX1 A;  2O31 A;  4KBM B;  2GFA A;  3M59 A;  5I22 A;  2ZPB B;  2GQV A;  1GFD A;  3HKS A;  4DBR A;  4J9D A;  2KRS A;  1VYT A;  1KK7 A;  4M75 E;  1Z9Q A;  1LVK A;  3OSV A;  1WJQ A;  2HKQ B;  2KAF A;  2DET A;  5FRO A;  4LDX A;  2RPN A;  2PUO B;  3EGX A;  2L3R A;  1W2B P;  3OA6 A;  3MPU B;  3QZ9 B;  1K4U S;  2YHT A;  1MV3 A;  1J3T A;  4IIM A;  2OTL A;  1K8A C;  3GOX A;  1M90 U;  3QWY A;  3CCL T;  4C8Q C;  1S1N A;  2MCN A;  3UA7 A;  1QVF A;  3VS5 A;  3EFO B;  2LDM A;  1NYG A;  3J81 E;  1SEM A;  1TXQ A;  2Y4Y A;  2C0O A;  2K5I A;  4J7F A;  1TH7 A;  3OS5 A;  1GRI A;  1ZBX A;  2CH4 A;  2XMF A;  1O75 A;  4FIB A;  5CAI A;  2HL3 A;  2RI2 A;  4C0D B;  7AT1 B;  2KQW A;  1SRM A;  4OMF B;  4M7A B;  4M78 E;  4DOW A;  3ZL7 C;  1OV3 A;  4PJO B;  4M7D B;  5KCO A;  2E41 A;  1PSF A;  1YHQ Q;  5AYF A;  2EQI A;  3HL8 A;  3CCL Q;  2DLP A;  2WSC E;  3HPW A;  1YI2 T;  2ZPG B;  1ZSZ C;  1T3L A;  5GAM g;  3CMA T;  3JCM g;  4PJM A;  2O88 A;  1BCO A;  1UFF A;  3NHN A;  2JM8 A;  1IRE B;  3FIF A;  1WDX A;  2ZCF B;  2F5K A;  1OU8 A;  4RCC A;  1NJI U;  3GBQ A;  4KUI A;  4JRP A;  4RG8 A;  3OYE A;  2IG0 A;  2QQS A;  5LJ3 e;  5A0G A;  2VXE A;  1M3A A;  2PU9 B;  2VV5 A;  5J26 A;  1GCP A;  3LH0 A;  4JJC A;  4QVC A;  2CP2 A;  1YI2 Q;  4RTY A;  3V8J A;  3I56 A;  1IZ6 A;  2E4H A;  2AZS A;  1Q82 C;  4J6Y A;  2QA4 A;  3NPF A;  4Y91 A;  3VUZ A;  4M7D A;  1X69 A;  2PTK A;  4OP0 A;  3I5R A;  2EYW A;  2J6F A;  4OF1 A;  2AIR B;  3I9Q A;  3NFC A;  4L6V 5;  1WX6 A;  1RI0 A;  2XHC A;  4N4I A;  1PD1 A;  3M0P A;  3ULR B;  3CD6 A;  2RN8 A;  1QMC A;  2JJ9 A;  2QK0 A;  3RMQ A;  1EIF A;  2E3I A;  1Y71 A;  3GLX A;  1M1K U;  1IHV A;  2CH4 W;  3CCQ A;  2H3E B;  5GMK i;  1E7O A;  3JCM P;  2X9H A;  3IQL A;  4PFZ A;  4IUU A;  3DLM A;  1AWO A;  5KCH A;  3EG3 A;  2W10 A;  2K6D A;  1RAE B;  4KT0 E;  2P84 A;  2LQK A;  1VQP T;  3VS2 A;  4M77 G;  5KE3 A;  1X27 A;  3UA6 A;  4HT8 A;  2HQH A;  2HL5 C;  4M75 D;  3RDV A;  4QKU A;  4R0K A;  2L3P A;  1M1G A;  2RF0 A;  1YWO A;  1VQK T;  3S3M A;  3PFS A;  1X01 A;  2DMO A;  2DJZ A;  2EAY A;  2RI5 A;  2L5Q A;  1G3Y A;  1VQP Q;  1WNL A;  2RD1 A;  1VQ5 A;  3RBB B;  3HSB A;  4F7U B;  1Y07 A;  3CEY A;  1KHC A;  4J9G A;  4F7U F;  1VQM A;  1JO8 A;  2X51 A;  2PVD B;  1VQK Q;  1W2B A;  2HD0 A;  3TEE A;  1EZZ B;  1CSK A;  1YJ9 A;  4QT7 A;  5GAO l;  3OS2 A;  1AOJ A;  1K73 U;  4ZTJ A;  1GCQ C;  4QQ6 A;  5CCA A;  4AG2 C;  1MND A;  2C06 A;  1AEY A;  3M4G A;  4ME7 A;  2EJ9 A;  3HRT A;  1M2O A;  1M3C A;  4ZNX A;  2JN0 A;  2M0O A;  2J6O A;  2LX9 A;  3PE0 A;  3I55 A;  3MP8 A;  4FU6 A;  2G6F X;  3VS7 A;  4C8Q E;  4BB7 A;  1NG2 A;  2ABL A;  4F7U A;  2EKO A;  3P8D A;  2CP6 A;  4C92 C;  1F1B B;  3O5Z A;  1M90 R;  3G6E A;  2LT1 A;  5GAN 5;  5KE2 A;  2HZY A;  5GAO p;  1U1T A;  2EYY A;  4PJJ A;  2H3J A;  2R5M A;  1FMV A;  2IIM A;  3HFO A;  2ZZD A;  4C5G A;  2J6K A;  1I0C A;  1W2B S;  3CC4 A;  1M2V B;  4HVV A;  4BE2 A;  1W1F A;  2V1R A;  3RUX A;  1VQ7 Q;  3EFS A;  1H92 A;  2LQW A;  4CRI A;  2FL7 A;  2NLU A;  5GMK j;  2P0Q A;  2K79 A;  4FYX B;  4J6W A;  1WI7 A;  3H9N A;  4DA4 A;  3CCE T;  1FMW A;  2I0N A;  3CCR A;  1NJI R;  1R77 A;  4FSX A;  3CC7 T;  4ELY C;  3OS0 A;  1IXD A;  4M7A G;  2NYS A;  4GLM A;  1ZSZ B;  2LJ3 A;  4PJO G;  4M7D G;  1RI9 A;  2K7A A;  1D09 B;  4K11 A;  1B3Q A;  3ME9 A;  3JB9 H;  3E9F A;  3CME A;  2KRO A;  4DQ2 A;  2HBW A;  2RHZ A;  3EHQ A;  1IGU A;  1M2V A;  1PSE A;  2A37 A;  1S72 A;  4FT2 A;  1Q81 U;  4CI0 C;  4NL2 A;  3CCE Q;  1V76 A;  1WYX A;  2MMP A;  2QAS A;  3FEO A;  2V8K A;  1OU9 A;  4GBQ A;  3CC7 Q;  1TUC A;  5LJ5 j;  4BY6 C;  5IHI A;  1QWE A;  2VGN A;  2RQW A;  2HDA A;  5GAN j;  1M5Q 1;  1Q95 G;  1M1K R;  2YRV A;  4F04 B;  2RHX A;  3GNG A;  1YIT T;  3EG9 B;  2Z0W A;  1ARK A;  4LE9 A;  2VXF A;  2HAX A;  2QG9 B;  2GBQ A;  3V8L A;  2FEI A;  4A53 A;  2JXB A;  2DBM A;  2DZC A;  2E5K A;  1I07 A;  4E7L A;  5ECA A;  3CCM T;  5I2S A;  5A0D A;  3CC2 A;  3C12 A;  2L0A A;  1U06 A;  3L2W A;  1TSF A;  4HVW A;  3JB9 F;  2RHU A;  4E7K A;  2DRK A;  4XU2 A;  1YIT Q;  3H0F A;  2DZ9 A;  1YCS B;  3OYG A;  3LGF A;  4HCZ A;  2HQX A;  4PK4 A;  1OI1 A;  1SHF A;  4JJD A;  4AMC A;  4KH0 B;  5GAO n;  2JTM A;  2QQR A;  3EFR A;  1PC0 A;  2DFU A;  5FWB A;  3EG9 A;  3QSU A;  5LJ3 d;  4M75 C;  2CS7 A;  1D0X A;  2QQB A;  4JUV A;  3CCM Q;  2CDT A;  1RAH B;  4RTU A;  4CC2 A;  2RA2 A;  5I2M A;  4XTW A;  1Z9Z A;  1ZBJ A;  3L2Q A;  3OQ5 A;  3EG0 A;  2PNI A;  1K73 R;  4FM4 B;  2JTE A;  5LJ5 f;  3WVE B;  4KUD K;  2RHI A;  2ZPE B;  1V29 B;  3G71 T;  5GAN f;  1ZUK A;  1K8A U;  1YBY A;  1OX8 A;  2O2O A;  2JNG A;  4F7U G;  2VWF A;  1W4S A;  3T9N A;  3OB9 A;  3P8B B;  2KYB A;  3BDU A;  4IUV A;  1YWP A;  2BTT A;  4DOV A;  2YUP A;  3OMG A;  2P0P A;  3TU4 K;  1UGS B;  1Q86 C;  1QVF P;  5GJV B;  5CKH A;  4MZM A;  4M78 C;  3RNJ A;  4C0G A;  1OEB A;  3G71 Q;  1B07 A;  1WPY A;  2X4W A;  3M0S A;  1YJW A;  1SPK A;  2KGT A;  1G8X A;  3J80 E;  1NPP A;  2EYQ A;  2DRM A;  1TWB A;  5GAO m;  3TSZ A;  4C92 B;  3S3N A;  3JV3 A;  2J7I A;  2EVR A;  2MI6 A;  2EQK A;  4E47 A;  2XID A;  1K0X A;  4ESR A;  4Y28 E;  2AZV A;  2QDY B;  4J83 A;  2DM1 A;  3JB9 I;  4Z89 A;  4RCB A;  3RER A;  1FMK A;  4HA8 A;  2LCS A;  5KH6 A;  2RO0 A;  4J9F A;  2HMA A;  2PUK B;  4KRT A;  4M77 F;  4LD9 K;  1OOT A;  2KI7 A;  1TTH B;  1QW1 A;  1UHC A;  3I56 T;  3M57 A;  1UHF A;  2QA4 T;  5GAM f;  1I1J A;  1PD0 A;  1PG5 B;  1RLP C;  3OYL A;  1W6X A;  3JCM f;  1YJN A;  2FZC B;  1VQO T;  2DTH A;  3SD4 A;  3U23 A;  5I21 A;  1Q81 R;  3M5A A;  2E65 A;  1PWT A;  1YP5 A;  3EGD B;  2PZ1 A;  4J9I A;  5CVI A;  2WSE E;  4HKE A;  2VVK A;  2C0I A;  1OZ3 A;  2DL4 A;  3QJ6 A;  4JZ3 A;  2KXD A;  3I56 Q;  2FRW A;  4JRQ A;  2QA4 Q;  4D6W A;  5KYU B;  4QQG A;  2XDP A;  4FYW B;  3QO3 A;  4M77 A;  3SWN C;  1I5O B;  1VQO Q;  5LJ5 e;  1PKT A;  3PIP A;  1B34 B;  3M0T A;  2J06 A;  2DPP B;  5CO7 A;  3MJX A;  3TCJ A;  3RKX A;  1ZUU A;  5KYX A;  4BI4 A;  4PNO A;  1R0C B;  1B7T A;  3OYA A;  2E3H A;  3EGD A;  2K4Y A;  1LOJ A;  4LUD A;  2JVV A;  2R58 A;  4F17 A;  1QVP A;  4OMQ A;  1VYU A;  2MF2 A;  4OVA A;  3RES A;  5LL6 S;  4GLK A;  1VQ5 T;  5KYU A;  2NUT B;  2HNI A;  4J9C A;  1WA7 A;  2OJ2 A;  5CKE A;  1VQM T;  2E12 A;  3FRN A;  1B34 A;  3OSS C;  4A54 A;  2SRC A;  3JCM c;  4MDW A;  2DXB A;  3JB9 G;  3L2R A;  2E70 A;  4B9W A;  1VIF A;  1KSW A;  2LP5 A;  2BE9 B;  2DD4 A;  2KK4 A;  1D1B A;  1YHQ T;  1A0N B;  5IXB A;  2CT4 A;  2DXT A;  2FO0 A;  2LCL A;  4XTX A;  2RK2 A;  1UGV A;  1Y57 A;  3HFN A;  1IRX A;  1VQ5 Q;  2W0Z A;  1PRL C;  2CUB A;  4X9C A;  2JT4 A;  1X2K A;  1ZUY A;  1K8A R;  2M1H A;  5FU7 C;  1K9M U;  1FYN A;  4PKC C;  3HRS A;  1VQM Q;  2WAC A;  3QUI A;  3KBG A;  3OYK A;  1AWX A;  1G3W A;  1WGS A;  1GFC A;  3BW1 A;  4A4K A;  3BFM A;  3CCS A;  4EMG A;  3ER0 A;  2NUT A;  1PNJ A;  1VA7 A;  1XNI A;  2L2P A;  1YJ9 Q;  2LJ0 A;  1BB9 A;  3G6E T;  4M77 D;  4L5G A;  5GAM e;  3JCM e;  4M7A F;  2R57 A;  1PM3 A;  3UT1 A;  3E2U A;  4QW2 A;  4PJO F;  4M7D F;  3UAT A;  4J5Y A;  5LJ3 h;  2DVE A;  5KYN A;  4F14 A;  3INZ A;  2DAQ A;  2FPE A;  2MWO A;  1SSF A;  4BD3 A;  3CC4 T;  2M02 A;  1Y96 B;  3CBP A;  2DF6 A;  3EFO A;  4XU1 A;  3MP1 A;  3G6E Q;  1HYO A;  2KDS A;  4ZGD B;  1H8K A;  2KY9 A;  1X75 C;  5CKD A;  2DD5 A;  4E7I A;  2YRD A;  1QVF S;  3O8V A;  3G4S A;  2CP7 A;  5CKB A;  1D0Y A;  2E10 A;  1JB0 E;  1UJ0 A;  4M7A A;  3D7S B;  2CZ6 B;  2B86 A;  4WF2 A;  3CCR T;  2COW A;  4E7Z A;  1KD1 U;  4PJO A;  5CR2 A;  3OYN A;  3HHT B;  3CC4 Q;  1UTI A;  2E6Z A;  4KGV B;  3OW2 A;  4RUG A;  1VQ8 A;  4C92 G;  2CYZ B;  2CUD A;  2RJD A;  3VU3 C;  3BE3 A;  2LQN A;  1NBE B;  2DXU A;  2YDL A;  4KGX B;  5LJ3 g;  1G5V A;  1VQ4 A;  1S72 T;  4PL6 A;  3L1A A;  1SKU B;  2HEQ A;  1KG1 A;  3LLR A;  1N27 A;  1N6A A;  4D8D A;  1TOV A;  3CCR Q;  4RKU E;  2KRM A;  2VB6 A;  2L89 A;  4DBF A;  3QG1 A;  4EMK C;  3R6N A;  3LWI A;  4FCY A;  2O9V A;  1RAA B;  2VAS A;  4L59 A;  2QAZ A;  1BIB A;  2M9U A;  2LNH B;  1S72 Q;  1UGR B;  1ZSG A;  2XDB A;  1JRI A;  4BDY A;  3JCM Q;  2ECZ A;  2V1Q A;  2BKD N;  1VQL A;  2E6N A;  2A28 A;  2LMJ A;  3PVL A;  2F69 A;  4JPB W;  4F7U E;  1ZA2 B;  1ACM B;  1NZ9 A;  4Z02 A;  2EQJ A;  3MO8 A;  1I81 A;  4OGE A;  5M9O A;  4ANJ A;  3CC2 T;  2F1L A;  2F2V A;  3L2U A;  5A0L A;  3L2V A;  3A8M B;  4KGZ B;  1ZLM A;  4OMO A;  4ZGE B;  2RQT A;  1VQ6 A;  4A4F A;  4M7A D;  1QP2 A;  3CXC A;  1AVZ C;  1OUL A;  1NLP C;  4PJO D;  4M7D D;  2Y90 A;  2AKL A;  4AFZ C;  2EIF A;  2PQW A;  4N4H A;  3F70 A;  4ZTF A;  1YIJ T;  3VKI A;  2GFU A;  2VYT A;  4D8K A;  3CC2 Q;  2FRY A;  3WXM B;  1E6G A;  4BI8 B;  2P4R A;  4NS5 A;  5GJW B;  2DVJ A;  2CSQ A;  4RTT A;  3OYB A;  2A7Y A;  2BIV A;  2M0Y A;  2XDD A;  3CCL A;  4MDX A;  2M16 A;  1VQ7 T;  4EMH A;  1YIJ Q;  1XTD A;  4RTZ A;  5EC7 A;  1MMN A;  2A08 A;  3GIB A;  1K9M R;  3LH5 A;  2XI9 A;  1M90 C;  1GBR A;  4LD6 A;  1H3Z A;  3M55 A;  4AT1 B;  3G1J A;  2YWW A;  5FU6 C;  4C0Z A;  2PVG B;  2ZPI B;  1MNE A;  2KVQ G;  4C8Q B;  1WZO A;  2RJE A;  5HY6 A;  2DIL A;  5FU7 B;  1X2Q A;  3JCM V;  2DER A;  1VOM A;  3FLG A;  4BI3 A;  1U3O A;  3QDF A;  3TVT A;  1YJW T;  4OMP A;  1YI2 A;  4N4G A;  3REB B;  3M0Q A;  3CMA A;  1QKW A;  2QTX A;  3P8H A;  3S3O A;  2FPF A;  1DJ7 B;  4HCK A;  3S6W A;  1YCY A;  2F5T X;  2X4Y A;  2OAW A;  2HQE A;  2V8I A;  2IVW A;  2CZ1 B;  4IIO A;  5IHK A;  1HK9 A;  2CP0 A;  3C95 A;  3C94 A;  1AT1 B;  4J7I A;  2GQI A;  1NJI C;  3JCM b;  1YJW Q;  1RAG B;  4C8Q A;  2LX7 A;  4A4H A;  2DEQ A;  2LC4 A;  4DEY A;  1Q7Y U;  1K76 A;  3L42 A;  2MPX C;  4OMN A;  1KC8 U;  1KD1 R;  1RAF B;  1TS9 A;  3ASK A;  1EX4 A;  3LGL A;  4N0A C;  3TQ7 P;  1ZA1 B;  4OB0 B;  2EPD A;  1BU1 A;  2RJC A;  4M78 G;  4QVD A;  2DEU A;  3CCV A;  1ABO A;  1WQW A;  4R56 A;  1ZQ1 A;  3X20 B;  4C5I A;  2OTJ T;  2BZ8 A;  2CP5 A;  4IUR A;  3GNF B;  4XQ3 A;  1WXB A;  3OYC A;  3E19 A;  2LTO A;  1ZSZ A;  2EFI A;  3QDR B;  3DLL A;  2LCC A;  2NWM A;  1NLO C;  3JRZ A;  4XU3 A;  1M1K C;  2XK0 A;  3Q1J A;  3GP8 A;  1WHL A;  8AT1 B;  3VJP A;  4HCC A;  4JDS A;  2DL8 A;  1N8R U;  1KQ2 A;  1BK2 A;  2DIG A;  1JBM A;  3SFM A;  1AWJ A;  2OTJ Q;  5IHN A;  3ZEH A;  1ABQ A;  1SSH A;  4F16 A;  2XIC A;  4HXJ A;  5IAY A;  1JXO A;  1VQK A;  1WXT A;  2YLC A;  4A4E A;  3MEU A;  5HK0 A;  2K5L A;  1QP3 A;  3CCJ T;  3E9G A;  3VV0 A;  1MMD A;  4IUP A;  1M1F A;  3H41 A;  2OAU A;  2GGR A;  2MAM A;  1PRM C;  2RK1 A;  3MEA A;  3JAM E;  2RNA A;  1QCF A;  3R6O A;  3V7R A;  2QDL A;  2EGE A;  2K2V A;  3RMS A;  3CCJ Q;  3AT1 B;  4J9H A;  4BE1 A;  2L3Q A;  4JLI A;  3TRE A;  1D0Z A;  2QYZ A;  1XQH A;  1K73 C;  3OMC A;  2ZPF B;  3QXE B;  3V7C A;  2OTL T;  4XK8 E;  3EH1 A;  2DO3 A;  1SF9 A;  1MMG A;  3EG2 A;  2D8H A;  1QWF A;  2CT3 A;  3PGG A;  3SHW A;  3OYY A;  4M7D C;  1G3T A;  3I5S A;  2K57 A;  2BUD A;  2YLB A;  2JUF A;  3VS6 A;  2KT8 A;  2KSS A;  2RQR A;  3C4S A;  3UF4 A;  2NUZ A;  4IKF A;  2COY A;  1X43 A;  3CCS T;  3EH2 A;  2V8J A;  3X26 B;  2RQV A;  3JCM X;  1HXD A;  1KHI A;  4DBQ A;  5GMK m;  2CGH A;  2OTL Q;  2BZY A;  3HP9 A;  4C92 F;  1WIE A;  1VQ9 A;  3A8G B;  3H6Z A;  2JMA A;  2XG8 D;  2EQU A;  4IUT A;  2RI3 A;  5LJ3 j;  2EYX A;  1ZHI A;  5CKF A;  5D6W A;  3EG1 A;  3A98 A;  1GCQ A;  2DKG A;  1KFZ A;  1UB4 A;  3CCS Q;  1M27 C;  4M77 E;  1BI1 A;  2O01 E;  3CCE A;  1JEG A;  2KYM A;  1YNZ A;  3M0R A;  4E7H A;  1IGQ A;  3CC7 A;  1Q82 U;  2JS2 A;  4II1 A;  5GMK e;  4C8Q G;  4FSS A;  3G4S T;  1U5S A;  2QXF A;  3QBY A;  3JSC A;  5CK9 A;  4C92 A;  1UG1 A;  1LPL A;  3UDC A;  4LNP A;  1Q7Y R;  3JB9 D;  2EJG A;  5L8R E;  1VQN A;  1KC8 R;  3GPL A;  1VQ8 T;  3X24 B;  3OW2 P;  2YUQ A;  4JJB A;  4XTY A;  5EG2 A;  3QII A;  3CD6 T;  3FB9 A;  4XAX B;  5HCK A;  1NYF A;  4GY5 A;  4JRI A;  3RR6 A;  4OGC A;  5LJ5 h;  2K3B A;  1VQ4 T;  1Q81 C;  2DE0 X;  3G4S Q;  3FJP A;  1I8F A;  3CCQ T;  5GAN h;  4O6J A;  3M56 A;  1WJR A;  2JS0 A;  4NL3 A;  2BE7 D;  1FWZ A;  1VQ8 Q;  4ZGJ B;  2E1H A;  4BY6 B;  3LW5 E;  5GAN e;  2RMO A;  4JS5 A;  1RAC B;  1M9S A;  2LRQ A;  2QTV A;  2ROL A;  3CD6 Q;  4Z8A A;  3C0C A;  1WXU A;  1N8R R;  2EWN A;  1VQ4 Q;  2LZ6 B;  1K9A A;  1YFN A;  1GBQ A;  3CCQ Q;  4ORZ A;  2J05 A;  3CCM A;  1KQ1 A;  2JOY A;  5J3B A;  5GAN 6;  1AZE A;  2RJF A;  2K5F A;  2FPD A;  1C1A A;  4BUG A;  4LDU A;  1NEB A;  1WFW A;  3QZ5 B;  3PMT A;  2GNC A;  5A2Q E;  2HKN A;  3RIR A;  4RG2 A;  2VC8 A;  2QEX A;  2HCK A;  3H8Z A;  1VQ6 T;  3CCU A;  4HCB A;  2DTO A;  2YRC A;  2DK3 A;  1YJ9 T;  4C92 D;  2YUN A;  3CXC P;  1OYX A;  1IO6 A;  2QI2 A;  1NE8 A;  1UDL A;  2MOX A;  1K1Z A;  4R55 A;  3A8H B;  2CRE A;  4B9X A;  3CBO A;  1C0M A;  1QQJ A;  1KIK A;  1JU5 C;  4M75 B;  4J8O A;  3OYD A;  3G71 A;  4LUE A;  2DBK A;  1CKA A;  5GAM h;  2QGG A;  3I55 T;  4M75 F;  2AKK A;  2EKH A;  3JCM h;  4M7A E;  2DJQ A;  1VQ6 Q;  4ELZ C;  5DM7 R;  2L8D A;  4PJO E;  4M7D E;  1QCN A;  1M8M A;  2IPO B;  3G7Z A;  4XTU A;  1OPK A;  3JCM J;  3PMI A;  2Y4X A;  3PT9 A;  3VS0 A;  4BE0 A;  1PCX A;  5FRN A;  3I55 Q;  2LVM A;  3QHS A;  1UGP B;  3M0U A;  2B8A A;  1MHN A;  1JJ2 P;  3DKM A;  2WSF E;  4M75 A;  3LWH A;  2K9G A;  2D9T A;  4M78 B;  2CZ7 B;  4EPC A;  5D6Y A;  3PNW C;  1X6B A;  4M78 F;  3SEM A;  2GTO A;  3LX7 A;  2ED0 A;  4XTV A;  3TSW A;  1RL2 A;  2DYB A;  2FZG B;  4OB2 B;  5IH2 A;  3H0H A;  2JZ2 A;  1MGQ A;  3RKW A;  1EFN A;  3CPF A;  3MP6 A;  4E7S A;  1NPR A;  1ZX6 A;  3OBY A;  2AT1 B;  1M3B A;  1Q82 R;  3OBW A;  3NGP A;  2DYI A;  2X3X D;  1D3B B;  3CME T;  1WQ7 A;  5IT9 E;  3CMA Q;  2JW4 A;  2EQM A;  1JQQ A;  2FVU A;  1Y96 A;  5GAN 4;  2EW3 A;  1M8V A;  1BI3 A;  5I11 A;  1WHM A;  2O4X B;  1WHJ A;  4M78 A;  3RKY A;  1VQO A;  2ROT A;  1OQK A;  3OY9 A;  3QYG B;  3NTI A;  5D6X A;  2HBP A;  5GAN 7;  3CCV T;  3VYG A;  2RHY A;  4HVU A;  4E7J A;  1UJY A;  4ZN1 A;  5FLX E;  2NUP B;  4NOY A;  3CME Q;  1T0J A;  1N9R A;  4LDY A;  2DIQ A;  3MEV A;  2EGC A;  2HSP A;  3CPW P;  4JZ4 A;  3JB9 J;  4A4G A;  4ZN3 A;  1D3B A;  3OYJ A;  2MIO A;  4KUL A;  1RAI B;  1NEG A;  2JM9 A;  3OW2 S;  3CBM A;  1IB8 A;  3QYH B;  4JS4 A;  3J7A F;  2OI3 A;  1BI2 A;  3CCV Q;  4C5H A;  2O4X A;  2DL5 A;  5GAN 2;  4PLI A;  1AHJ B;  4OB1 B;  3SWN B;  2D6F A;  1D1A A;  1M30 A;  4AFS C;  4JRK A;  3VS3 A;  2ENM A;  1VYV A;  1Y7X A;  4QQD A;  1CKB A;  2EGA A;  2LT4 A;  4X34 A;  4YTL A;  2NUP A;  4FYY B;  2GTJ A;  5GMK l;  2CSI A;  5DY9 A;  2D8J A;  1K0S A;  2C0T A;  3A8L B;  2GF7 A;  3KFV A;  4OMM A;  1RUW A;  3DB3 A;  2A0F B;  2FB7 A;  1HJD A;  1WHG A;  5KYW B;  4LN2 A;  2D0Q B;  2KNB B;  5HKC A;  1QKX A;  1NM7 A;  3AHU A;  4M78 D;  1JXM A;  3SWN A;  4OML A;  1YHQ A;  3X25 B;  3PTA A;  2MYS A;  2G3R A;  4Q5W A;  2RQU A;  3A1P A;  4A63 B;  1Q86 U;  2LQ8 A;  5CQX A;  3ZBD A;  2F2X A;  4MML A;  2EJF A;  4HT9 A;  1TU0 B;  1GL5 A;  3NMZ C;  1JJ2 A;  1K9M C;  1R0B G;  4QVZ A;  1UUE A;  3E1S A;  2KT1 A;  5CQY A;  3CXC S;  4C8Q F;  1G3S A;  5LJ5 d;  5KYW A;  5GAN 3;  5GAN d;  3X28 B;  2X3W D;  4CC4 B;  4M75 G;  1KQS P;  1SG5 A;  5C0M A;  3DB4 A;  3QPH A;  1VQ9 T;  2KBT A;  4M77 C;  9ATC B;  1UGQ B;  2K3X A;  2KR3 A;  5FWC A;  2FHD A;  2ATC B;  1IHW A;  2A36 A;  3OYM A;  1OPL A;  3VS4 A;  3OYH A;  4CC3 A;  3N5B B;  2YUO A;  2L3S A;  4RTX A;  4C0F A;  1BBZ A;  5J39 A;  2I2L A;  3BDL A;  1MUZ A;  1VQ9 Q;  1JJ2 S;  1MMA A;  3V8K A;  2CP3 A;  3QWX X;  3SB2 A;  4Y92 A;  1KD1 C;  3MEW A;  2X4J A;  4X9D A;  4UC4 A;  3PIO A;  1OX9 A;  1UEC A;  1XOV A;  1YJN T;  1VQN T;  5C6S A;  4IUQ A;  2MK5 A;  4MZT A;  4AG1 C;  1WLP B;  2FZK B;  5FRM A;  3CPW A;  8ATC B;  4E2F B;  1R8O B;  2FYK A;  4BAC A;  4EIK A;  4LDV A;  5GAO r;  1VQP A;  1QVG P;  3I35 A;  2XU8 A;  1AZG B;  4MMK A;  4XU0 A;  4J6X A;  4FYV B;  5DLO A;  3REA B;  4RTV A;  5HK3 A;  1YJN Q;  2K3Y A;  1VQN Q;  3A5Z B;  5GAM d;  1D1C A;  2XD0 A;  3JCM d;  1C6V X;  2AK5 A;  3HRU A;  3H0I A;  2AHJ B;  1YN8 A;  3QKJ A;  2DL7 A;  4EMK B;  2DA9 A;  2VGM A;  2LJ1 A;  4DBH A;  1V1C A;  1TUG B;  4EDU A;  4ATO A;  4PJN A;  4WTO B;  3BY7 A;  5GAO q;  4LDW A;  1N9S A;  1TUD A;  5IXF A;  4JJN K;  4PFO A;  2GCX A;  2D0N A;  2E64 A;  2A3L A;  1H3H A;  2HSE B;  4V2S A;  5KYY B;  2FG0 A;  1XJW B;  3CPW S;  3VYH B;  2KRN A;  1BCM A;  3FJ5 A;  2DL3 A;  3GF5 A;  4C8Q D;  1W70 A;  3PVQ A;  4DEX A;  2KE9 A;  3VRZ A;  1LNX A;  2YSQ A;  1VUB A;  4M4Z A;  1UE9 A;  2ZPH B;  2QEX T;  1G2B A;  1YIJ A;  3MCA B;  1AD5 A;  2YXY A;  3CCU T;  4Z88 A;  4EMK A;  3M4Y A;  3OYF A;  3MHX A;  3VUB A;  4LXC A;  3THK A;  1E6H A;  3JCM W;  2KXC A;  1U1S A;  1RAB B;  2LNV A;  4C0D C;  1BIA A;  2JMC A;  3MET A;  4M7A C;  1HSQ A;  1PKS A;  2X35 A;  3FC3 A;  1RLQ C;  2VUB A;  1I5L A;  2RB6 A;  4PJO C;  5GAM j;  5KYY A;  1VQ7 A;  4XTZ A;  3UPU A;  4KH1 B;  2OX7 A;  2QEX Q;  1T3S A;  3WVD B;  2RM4 A;  1Q86 R;  3CCU Q;  2QGF B;  1QCO A;  1BKB A;  4C92 E;  1P92 A;  1KQS A;  4O5V A;  4VUB A;  2EBP A;  4FL6 A;  3KXT A;  4E6R A;  2DXC A;  2EYZ A;  2VKN A;  4B6M A;  4PLL A;  2P0K A;  3FDR A;  3A8O B;  2H8H A;  2RH2 A;  1AWW A;  2X4X A;  5GAN 8;  5FU6 B;  4FW2 A;  5GMK h;  5CIU A;  2JTF A;  3M58 A;  2YT6 A;  1WJS A;  3VRY A;  4C5E A;  2K2M A;  3M54 A;  5L23 A;  2V26 A;  4OB3 B;  4PJL A;  2MWP A;  5D7U A;  3QJY A;  2QQ9 A;  2ESW A;  5DLQ E;  2DTI A;  3URG A;  1SHG A;  3M9Q A;  3EAE A;  1N5Z A;  2BZX A;  4PFP A;  1WHK A;  1QLY A;  1O9S A;  4FT4 A;  2E5Q A;  2F2W A;  4RTW A;  2ED1 A;  2SEM A;  1RAD B;  6AT1 B;  1KQS S;  5AT1 B;  1BI0 A;  2COZ A;  4M77 B;  3EGU A;  4FW1 A;  1I4K 1;  1WHH A;  2R5A A;  4WCI A;  3CQT A;  4TVR A;  3V7S A;  1Q7Y C;  3MKD A;  3OS1 A;  1KC8 C;  2O9S A;  3LYI A;  1QVG A;  2DNU A;  1GXI E;  4X1V A;  4JLG A;  1BYM A;  2OTJ A;  3SDZ A;  4J9E A;  5IN1 A;  5KYX B;  1VIE A;  2KEA A;  4RMO A;  1HD3 A;  1PHT A;  4BDZ A;  3ZFJ A;  1UEB A;  2M51 A;  1YIT A;  3M53 A;  1LCK A;  1KJW A; 
#chains in the Genus database with same CATH homology
 4LD6 A;  1H3Z A;  3EFR A;  3M55 A;  3QSU A;  5FU6 C;  5LJ3 d;  4C0Z A;  4M75 C;  1LJO A;  1FX7 A;  2CS7 A;  3OBW A;  2QQB A;  2PVG B;  2ZPI B;  4JUV A;  2KVQ G;  2XKO C;  4C8Q B;  5LJ3 f;  2RJE A;  2RA2 A;  1D3B B;  5I2M A;  4XTW A;  3CME T;  5HY6 A;  1WQ7 A;  3L2Q A;  2CKK A;  1U8R A;  5FU7 B;  3JCM V;  5IT9 E;  3OQ5 A;  3UWN A;  3OYI A;  1VQL T;  2EQM A;  2FVU A;  1Y96 A;  3FLG A;  4BI3 A;  5GAN 4;  1YJW T;  1BI3 A;  4FM4 B;  1N8R C;  2PVO B;  5LJ5 f;  1FXX A;  2O4X B;  2P4T A;  3WVE B;  1M4Z A;  1YI2 A;  4M78 A;  3RKY A;  4KUD K;  2RHI A;  4N4G A;  1VQO A;  2ZPE B;  2ZGW A;  3CMA A;  1V29 B;  3L2Z A;  1OZ2 A;  3OY9 A;  3G71 T;  2QTX A;  2QQA A;  3P8H A;  5LJ5 g;  4P5N A;  5GAN f;  3S3O A;  3QYG B;  1K8A U;  1DJ7 B;  3NTI A;  3NTK A;  3KUF A;  5D6X A;  1YBY A;  2KMT A;  3CCJ A;  4N0A A;  3S6W A;  2HBP A;  1YCY A;  5GAN g;  5GAN 7;  2JNG A;  3VYG A;  4F7U G;  2F5T X;  3CCV T;  2RHY A;  2X4Y A;  1W4S A;  3NTH A;  4E7J A;  1QVG S;  1X6O A;  2HQE A;  2V8I A;  3T9N A;  3OB9 A;  2IVW A;  4ZN1 A;  3P8B B;  5FLX E;  2CZ1 B;  4MZP A;  1H64 1;  1HK9 A;  4NOY A;  3BDU A;  3C95 A;  4IUV A;  3C94 A;  1N9R A;  4DOV A;  2CZ0 B;  3OMG A;  2P0P A;  4J7I A;  4LDY A;  1UGS B;  3TU4 K;  2DIQ A;  3MEV A;  4KBM B;  1Q86 C;  1NJI C;  3JCM b;  2GFA A;  3M59 A;  5CKH A;  4MZM A;  4M78 C;  2ZPB B;  2GQV A;  4C8Q A;  3JB9 J;  4A4H A;  2DEQ A;  2LC4 A;  3HKS A;  4A4G A;  3L42 A;  4C0G A;  4ZN3 A;  1Q7Y U;  1D3B A;  4M75 E;  1KC8 U;  3OYJ A;  1WPY A;  2X4W A;  4KUL A;  3ASK A;  3LGL A;  1YJW A;  4N0A C;  3OW2 S;  3CBM A;  3OSV A;  3QYH B;  1NPP A;  1WJQ A;  3J80 E;  4JS4 A;  3J7A F;  2KAF A;  1BI2 A;  5FRO A;  4C5H A;  2EYQ A;  2O4X A;  5GAN 2;  4LDX A;  2PUO B;  4PLI A;  5GAO m;  4C92 B;  1AHJ B;  3S3N A;  2L3R A;  4OB0 B;  4OB1 B;  3SWN B;  2RJC A;  4M78 G;  4QVD A;  3OA6 A;  2D6F A;  3CCV A;  1WQW A;  3QZ9 B;  1ZQ1 A;  2YHT A;  3X20 B;  4C5I A;  2MI6 A;  4R56 A;  2OTJ T;  4JRK A;  4IUR A;  2OTL A;  2EQK A;  3GNF B;  1K8A C;  1Y7X A;  3GOX A;  4XQ3 A;  4QQD A;  4E47 A;  1M90 U;  3CCL T;  4C8Q C;  3OYC A;  3E19 A;  2XID A;  2LT4 A;  1QVF A;  4Y28 E;  4X34 A;  2LDM A;  2LTO A;  4YTL A;  3J81 E;  2QDY B;  2EFI A;  4J83 A;  3JB9 I;  2Y4Y A;  2K5I A;  3QDR B;  4J7F A;  4RCB A;  3DLL A;  1TH7 A;  3RER A;  2LCC A;  3JRZ A;  4XU3 A;  5GMK l;  3OS5 A;  1ZBX A;  5DY9 A;  4HA8 A;  1M1K C;  2XK0 A;  3Q1J A;  3A8L B;  3GP8 A;  1O75 A;  2GF7 A;  4FIB A;  5CAI A;  2RI2 A;  5KH6 A;  4C0D B;  2KQW A;  2RO0 A;  3VJP A;  4HCC A;  4JDS A;  3DB3 A;  1N8R U;  1KQ2 A;  2FB7 A;  4OMF B;  4M7A B;  4M78 E;  2DIG A;  1JBM A;  3SFM A;  2PUK B;  4M77 F;  4LD9 K;  4DOW A;  4PJO B;  4M7D B;  5KCO A;  2E41 A;  1PSF A;  1QW1 A;  2D0Q B;  3I56 T;  5AYF A;  3ZEH A;  3M57 A;  5HKC A;  2QA4 T;  3HL8 A;  5GAM f;  2WSC E;  3OYL A;  2XIC A;  3JCM f;  1YJN A;  4M78 D;  3AHU A;  3HPW A;  5IAY A;  3SWN A;  1YI2 T;  2ZPG B;  1VQK A;  1VQO T;  2DTH A;  3SD4 A;  1YHQ A;  2YLC A;  5GAM g;  5I21 A;  3CMA T;  3JCM g;  4A4E A;  3M5A A;  3MEU A;  2E65 A;  3X25 B;  5HK0 A;  2K5L A;  3PTA A;  1QP3 A;  1BYM A;  3CCJ T;  2G3R A;  3E9G A;  1IRE B;  3FIF A;  4Q5W A;  3VV0 A;  2ZCF B;  2F5K A;  4RCC A;  1Q86 U;  1NJI U;  4IUP A;  2LQ8 A;  4KUI A;  5CQX A;  5CVI A;  3ZBD A;  2WSE E;  1M1F A;  4HKE A;  2OAU A;  4RG8 A;  4JRP A;  3OYE A;  1OZ3 A;  2IG0 A;  2MAM A;  3QJ6 A;  2QQS A;  5LJ3 e;  5A0G A;  2VXE A;  2EJF A;  4MML A;  4HT9 A;  2PU9 B;  2VV5 A;  5J26 A;  1JJ2 A;  1K9M C;  4JRQ A;  4D6W A;  4QQG A;  2XDP A;  3LH0 A;  2RK1 A;  3E1S A;  4QVZ A;  5CQY A;  3QO3 A;  4M77 A;  3CXC S;  3SWN C;  3MEA A;  3JAM E;  4QVC A;  4C8Q F;  1G3S A;  3R6O A;  3V8J A;  5LJ5 e;  5LJ5 d;  3I56 A;  3V7R A;  1IZ6 A;  5GAN 3;  1Q82 C;  4J6Y A;  2QA4 A;  3PIP A;  2K2V A;  3RMS A;  4Y91 A;  3VUZ A;  4M7D A;  1B34 B;  5GAN d;  4OP0 A;  4OF1 A;  3X28 B;  2DPP B;  4M75 G;  5CO7 A;  4BE1 A;  3NFC A;  3TCJ A;  4JLI A;  4L6V 5;  5C0M A;  3TRE A;  3RKX A;  1RI0 A;  1XQH A;  2XHC A;  3DB4 A;  3QPH A;  3OMC A;  4N4I A;  2ZPF B;  4BI4 A;  1K73 C;  3CD6 A;  1VQ9 T;  4PNO A;  3QXE B;  3RMQ A;  3V7C A;  3OYA A;  1EIF A;  2OTL T;  4XK8 E;  2K4Y A;  1LOJ A;  4M77 C;  1Y71 A;  2DO3 A;  1UGQ B;  2JVV A;  2K3X A;  2FHD A;  3GLX A;  2R58 A;  1M1K U;  1QVP A;  3CCQ A;  3PGG A;  5GMK i;  3OYM A;  3JCM P;  3OYY A;  4M7D C;  1G3T A;  2MF2 A;  2K57 A;  2BUD A;  4OVA A;  3RES A;  5LL6 S;  4IUU A;  3OYH A;  3DLM A;  2YLB A;  2JUF A;  3N5B B;  4GLK A;  1VQ5 T;  5KCH A;  2KSS A;  3C4S A;  4C0F A;  4IKF A;  2HNI A;  4KT0 E;  5J39 A;  2LQK A;  3CCS T;  1VQP T;  5CKE A;  2I2L A;  3BDL A;  2V8J A;  4M77 G;  1VQM T;  5KE3 A;  2E12 A;  3X26 B;  3FRN A;  4HT8 A;  1B34 A;  3OSS C;  1JJ2 S;  4A54 A;  3V8K A;  3JCM c;  3JCM X;  1HXD A;  1KHI A;  4M75 D;  3SB2 A;  5GMK m;  4MDW A;  2CGH A;  2DXB A;  3MEW A;  1KD1 C;  2X4J A;  3HP9 A;  3JB9 G;  4X9D A;  1M1G A;  4UC4 A;  4C92 F;  3L2R A;  2E70 A;  1XOV A;  1VIF A;  4B9W A;  3PIO A;  1YJN T;  1VQ9 A;  1VQN T;  3A8G B;  1VQK T;  2DD4 A;  2KK4 A;  3H6Z A;  3PFS A;  1X01 A;  5C6S A;  3S3M A;  1YHQ T;  2XG8 D;  4IUQ A;  2EQU A;  4IUT A;  2RI3 A;  4XTX A;  2DXT A;  2LCL A;  2DJZ A;  2EAY A;  4MZT A;  2RK2 A;  5LJ3 j;  1ZHI A;  5CKF A;  5D6W A;  5FRM A;  3HFN A;  3CPW A;  2RI5 A;  4X9C A;  2DKG A;  1UB4 A;  1R8O B;  2L5Q A;  2M1H A;  1G3Y A;  2FYK A;  5FU7 C;  4BAC A;  1K9M U;  4PKC C;  1WNL A;  3HRS A;  2RD1 A;  2WAC A;  4M77 E;  3QUI A;  3KBG A;  4LDV A;  3OYK A;  1VQ5 A;  1BI1 A;  1G3W A;  2O01 E;  3CCE A;  3HSB A;  4F7U B;  1WGS A;  4A4K A;  3BW1 A;  5GAO r;  1Y07 A;  4E7H A;  3BFM A;  3CEY A;  3CCS A;  1VQP A;  4EMG A;  3ER0 A;  3CC7 A;  1Q82 U;  1XNI A;  1KHC A;  2XU8 A;  4MMK A;  4F7U F;  4XU0 A;  1VQM A;  4II1 A;  4J6X A;  5GMK e;  5DLO A;  4C8Q G;  3G6E T;  4M77 D;  3G4S T;  2PVD B;  5HK3 A;  4L5G A;  2K3Y A;  5GAM e;  3A5Z B;  5GAM d;  3JCM e;  1W2B A;  2HD0 A;  2R57 A;  3JCM d;  2XD0 A;  3TEE A;  4M7A F;  3UT1 A;  2QXF A;  1YJ9 A;  3QBY A;  3HRU A;  3JSC A;  4QW2 A;  4C92 A;  5CK9 A;  5GAO l;  2AHJ B;  4PJO F;  3OS2 A;  3UDC A;  4M7D F;  1K73 U;  3JB9 D;  2EJG A;  3QKJ A;  5L8R E;  4ZTJ A;  1VQN A;  4QQ6 A;  5CCA A;  4EMK B;  2VGM A;  2C06 A;  3GPL A;  3M4G A;  4ME7 A;  2EJ9 A;  4J5Y A;  1VQ8 T;  3X24 B;  5LJ3 h;  3HRT A;  2DVE A;  4EDU A;  3INZ A;  2JN0 A;  2DAQ A;  2MWO A;  4ATO A;  2M0O A;  1SSF A;  2LX9 A;  5GAO q;  3BY7 A;  4XTY A;  4BD3 A;  5EG2 A;  3CC4 T;  3QII A;  1Y96 B;  4LDW A;  3CBP A;  3CD6 T;  1N9S A;  3FB9 A;  4XAX B;  3I55 A;  4GY5 A;  4JRI A;  4JJN K;  4OGC A;  3MP8 A;  4XU1 A;  3MP1 A;  5LJ5 h;  1VQ4 T;  4FU6 A;  1Q81 C;  2GCX A;  4C8Q E;  3FJP A;  2E64 A;  4BB7 A;  2A3L A;  2KDS A;  1I8F A;  4ZGD B;  2KY9 A;  1X75 C;  3CCQ T;  5CKD A;  5GAN h;  4V2S A;  4O6J A;  2EKO A;  4F7U A;  2DD5 A;  3P8D A;  4E7I A;  4C92 C;  3M56 A;  3G6E A;  1QVF S;  3CPW S;  2LT1 A;  3VYH B;  3O8V A;  5GAN 5;  3G4S A;  1WJR A;  5CKB A;  3GF5 A;  5KE2 A;  4C8Q D;  2E10 A;  1JB0 E;  5GAO p;  1U1T A;  4NL3 A;  4M7A A;  2CZ6 B;  2H3J A;  1FWZ A;  2R5M A;  4WF2 A;  3CCR T;  4ZGJ B;  2E1H A;  1KD1 U;  3HFO A;  1LNX A;  4BY6 B;  3LW5 E;  4PJO A;  1VUB A;  2ZZD A;  5GAN e;  5CR2 A;  3OYN A;  3HHT B;  4JS5 A;  2ZPH B;  4C5G A;  2QEX T;  1YIJ A;  3MCA B;  1M9S A;  2LRQ A;  2E6Z A;  3OW2 A;  3CCU T;  1VQ8 A;  4C92 G;  4EMK A;  3M4Y A;  2CYZ B;  2EWN A;  3OYF A;  3MHX A;  3VUB A;  1W2B S;  2RJD A;  3VU3 C;  3CC4 A;  3JCM W;  4BE2 A;  1U1S A;  2DXU A;  3CCM A;  5LJ3 g;  2LNV A;  1G5V A;  1VQ4 A;  1KQ1 A;  2JOY A;  1S72 T;  4C0D C;  4PL6 A;  1BIA A;  3MET A;  3RUX A;  5J3B A;  3L1A A;  5GAN 6;  3EFS A;  4M7A C;  4CRI A;  1KG1 A;  2FL7 A;  2RJF A;  2NLU A;  3LLR A;  1N27 A;  2K5F A;  2X35 A;  5GMK j;  2P0Q A;  1N6A A;  3FC3 A;  2VUB A;  1I5L A;  2RB6 A;  4PJO C;  4J6W A;  4RKU E;  5GAM j;  4BUG A;  4LDU A;  1VQ7 A;  4XTZ A;  3UPU A;  4DA4 A;  2L89 A;  3CCE T;  3WVD B;  2RM4 A;  3CCR A;  3QG1 A;  4EMK C;  1BKB A;  3QZ5 B;  4FSX A;  3PMT A;  5A2Q E;  3LWI A;  4C92 E;  4ELY C;  3CC7 T;  3RIR A;  1P92 A;  3OS0 A;  4RG2 A;  1KQS A;  2VC8 A;  2QEX A;  4M7A G;  4O5V A;  3H8Z A;  4VUB A;  1VQ6 T;  4L59 A;  3CCU A;  4HCB A;  4FL6 A;  1BIB A;  4PJO G;  2DTO A;  4M7D G;  2M9U A;  2DK3 A;  1UGR B;  1YJ9 T;  4C92 D;  2XDB A;  3KXT A;  3ME9 A;  1JRI A;  1OYX A;  2QI2 A;  3JB9 H;  1NE8 A;  4BDY A;  3E9F A;  2DXC A;  3JCM Q;  3CME A;  4DQ2 A;  2RHZ A;  2BKD N;  4PLL A;  4R55 A;  2P0K A;  1PSE A;  3A8H B;  4B9X A;  1VQL A;  1S72 A;  2E6N A;  3CBO A;  3FDR A;  4FT2 A;  1Q81 U;  4CI0 C;  3A8O B;  2RH2 A;  4NL2 A;  2X4X A;  5GAN 8;  5FU6 B;  4M75 B;  2F69 A;  4J8O A;  2JTF A;  2MMP A;  5CIU A;  5GMK h;  3OYD A;  3G71 A;  3FEO A;  3M58 A;  4F7U E;  1WJS A;  1NZ9 A;  4Z02 A;  2V8K A;  5GAM h;  2EQJ A;  4C5E A;  3MO8 A;  4M75 F;  1I81 A;  3I55 T;  3JCM h;  4OGE A;  5M9O A;  3M54 A;  5LJ5 j;  4BY6 C;  3CC2 T;  4M7A E;  4OB3 B;  4ELZ C;  5DM7 R;  3L2U A;  2MWP A;  5A0L A;  3L2V A;  2L8D A;  2VGN A;  3QJY A;  5GAN j;  3A8M B;  4PJO E;  4M7D E;  1M5Q 1;  2QQ9 A;  4ZGE B;  5DLQ E;  2DTI A;  2YRV A;  3URG A;  1VQ6 A;  2RHX A;  4A4F A;  4M7A D;  1QP2 A;  3GNG A;  3M9Q A;  3CXC A;  3G7Z A;  3EAE A;  4XTU A;  1YIT T;  4PJO D;  4M7D D;  2Y90 A;  3JCM J;  1O9S A;  2Y4X A;  2EIF A;  3PMI A;  2E5Q A;  4FT4 A;  2PQW A;  4N4H A;  3F70 A;  3PT9 A;  4ZTF A;  1YIJ T;  2VXF A;  2HAX A;  4BE0 A;  3VKI A;  1KQS S;  5FRN A;  1BI0 A;  4M77 B;  2LVM A;  3QHS A;  1I4K 1;  2GFU A;  2VYT A;  1UGP B;  3V8L A;  2B8A A;  4A53 A;  2R5A A;  1MHN A;  2DZC A;  4TVR A;  4E7L A;  3V7S A;  1Q7Y C;  3DKM A;  3OS1 A;  2WSF E;  1KC8 C;  4M75 A;  3WXM B;  3LWH A;  3CCM T;  5I2S A;  2D9T A;  4M78 B;  5A0D A;  3LYI A;  3CC2 A;  3C12 A;  4NS5 A;  4BI8 B;  1QVG A;  2CZ7 B;  4EPC A;  1GXI E;  3L2W A;  5D6Y A;  4JLG A;  3PNW C;  1M8V A;  4M78 F;  3OYB A;  3JB9 F;  2A7Y A;  2BIV A;  3SDZ A;  2OTJ A;  2RHU A;  3LX7 A;  4XTV A;  4E7K A;  4XU2 A;  1RL2 A;  5IN1 A;  2DZ9 A;  2XDD A;  4OB2 B;  3CCL A;  4MDX A;  3OYG A;  3LGF A;  1VIE A;  2M16 A;  4HCZ A;  1VQ7 T;  2JZ2 A;  4EMH A;  2HQX A;  4RMO A;  1OI1 A;  4BDZ A;  1MGQ A;  3RKW A;  1XTD A;  3ZFJ A;  1UEB A;  3CPF A;  3MP6 A;  1YIT A;  3GIB A;  1NPR A;  3M53 A;  2XI9 A;  3OBY A;  5GAO n;  2JTM A;  2QQR A;  1M90 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...