3SD7A

1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
KKNYEIVLFDLDGTLTDPKEGITKSIQYSLNSFGIKEDLENLDQFIGPPLHDTFKEYYKFEDKKAKEAVEKYREYFADKGIFENKIYENMKEILEMLYKNGKILLVATSKPTVFAETILRYFDIDRYFKYIAGSNLDGTRVNKNEVIQYVLDLCNVKDKDKVIMVGDRKYDIIGAKKIGIDSIGVLYGYGSFEEISESEPTYIVENVESIKDILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
molecule keywords Putative phosphatase
total genus 82
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3sd7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sd7A01
5AK4A 5ALTA 4QQFA 5AW8A 3ZUPA 3CZ4A 1AQ6A 3ZX5A 3CNHA 4F71A 2MSNA 4Y2SA 3DDHA 3WK9A 5ALSA 4GXTA 2I55A 1ZD2P 1Z4NA 1WPGA 3AR4A 1Z4JA 1YMQA 3EF1A 5ALDA 1L7MA 4BX0A 3QUCA 4Y2XA 1T5SA 4AS2A 3QUBA 3NRJA 3L8HA 4GIBA 3R9KA 2HCFA 4AP9A 1RQLA 2C4NA 1U2SA 4XOUA 2FPRA 3MPOA 5ALGA 2O9JA 4UU1A 1ZD5A 3A1EA 2B82A 1RC8A 5FP0A 3QU7A 1QQ5A 3KD3A 4UATA 4PNHA 4OFZA 3U19A 5ALQA 4O8CA 3SHQA 3SF0A 4YIHA 2C88A 5AKXA 5ALXA 3I1YA 4H1WA 4UARA 2G07A 3NANA 3ZTWA 2EARA 3TLMA 4ZEVA 2Q5EA 3PDWA 1O08A 4OD0A 4HGOA 3AR6A 3W5BA 4UMDA 5AW1A 5AW5A 3N28A 3MN1A 1RMYA 1WZCA 4OCZA 2R8EA 4BNDB 5AVUA 2YJ6A 1RLTA 3QLEA 1N8NA 2MU2A 3B9RA 1Q92A 3HYCA 3QXGA 4IG4A 1RQNA 2EATA 1RLMA 5AM0A 2AGVA 2Q4RA 3KBBA 1XVIA 1Y8AA 4J2TA 3WKDA 4EZEA 3OCUA 3DAOA 3SKYA 5IT4A 1U02A 1S2OA 4BNDA 4BX2A 3EF0A 1WVIA 3DNPA 3L0CA 4XPZA 4EELA 2GMWA 3EPRA 3I6BA 3L8GA 3SKXA 2B30A 3UM9A 5AKIA 4KX5A 1L7PA 3EWIA 3AR7A 4XQ0A 4HGNA 2PR7A 2I34A 1CR6A 5A3RA 1SU4A 3UMCA 1LVHA 4G63A 1QQ7A 2WF6A 4NV0A 3QU5A 3QU2A 3QX7A 3U13A 5ALRA 5A3QA 5ALEA 5AW2A 3ZI4A 4UM7A 1XP5A 2R8XA 2YJ3A 4QJBA 3SMVA 2ZXEA 1LTQA 2AH5A 5AW7A 1YJ5A 1Z4IA 4YH1A 5AVXA 2P27A 1NRWA 1ZS9A 5AI9A 2ZOSA 2WF7A 1Q91A 2O2XA 2RAVA 4IFTA 4MUMA 3ZVMA 1RPZA 2ZBEA 2AMYA 2W11A 2HSZA 4CF4A 2BDEA 2DQSA 3MC1A 3VAYA 3QYPA 3WK7A 1RKQA 4NABA 3M1YA 2CFRA 2FI1A 3AR2A 3QU4A 2W4MA 3ZVLA 3KC2A 3UMGA 1IWOA 4DFDA 3U7EB 4E88A 2I33A 3OCVA 4HYTA 4Y2YA 5AK3A 3IRUA 1YV9A 2WFAA 3NASA 3PGLA 1RKUA 3MMZA 2HI0A 5AVWA 1TE2A 4DW8A 2JGAA 3N1UA 4RESA 1EK2A 5AI5A 2BDUA 5T41A 2B8EA 2JAUA 1Z4LA 2C9MA 1T9ZA 3IB6A 4NFLA 5AKHA 4UU0A 3ET4A 3UMBA 5AIBA 2YN4A 1Z5GA 2ZBGA 2B8JA 5ALYA 4BX3A 5AW4A 1NNLA 3E81A 1NF2A 4FFDA 1PW5A 4BEVA 2EAUA 1YNSA 4UASA 2NYVA 3WKBA 2YMMA 5IT0A 5ALKA 2GHQA 3GYGA 3NALA 5AK5A 4EEKA 1N9KA 1TJ4A 1KYTA 1QQ6A 1VJRA 3AR5A 2B1QA 5ALIA 5ALVA 1U2TA 5ALZA 3I28A 3QNMA 2OYCA 1ZD4A 1TA0A 3R4CA 5ALFA 5AI4A 2QLTA 1S8OA 2HEGA 2FUCA 5AI8A 2CFSA 3NUQA 1RKVA 5AKLA 3I76A 2FEAA 3FPBA 2C8LA 4YGYA 1ZRNA 2HF2A 3BWVA 3DV9A 4UMEA 4FE3A 1RMQA 1U7PA 1CQZA 3SLRA 2JAOA 4EX7A 3D6JA 3E84A 5AK6A 5AVZA 3ZVNA 1Z5UA 3OCZA 4Y2UA 2X4DA 1XPJA 3ZW7A 4KNVA 3L0BA 2FPWA 2RB5A 2HX1A 2YFYA 1SWWA 2I54A 3WK4A 2HHLA 4MWOA 1RDFA 2ZBFA 3WGVA 4UAUA 3K1ZA 1YS9A 4JB3A 4CF3A 1TJ3A 3KOOA 3F9RA 4C4SA 1VFPA 3HLTA 3FM9A 5AW6A 5AM4A 4F72A 2I6XA 3L7YA 4BBJA 2AUTA 5AKZA 1RMTA 2JARA 3OCXA 3A1CA 5AM2A 5A3SA 4I9GA 2HDOA 3FVVA 5AESA 1Z4PX 3WK8A 2D2VA 4XE5A 4HGQA 3QUQA 1K1EA 3N5KA 3U7HB 5AVVA 4CNQA 2YY6A 2YJ5A 3AR9A 2FPSA 3WK5A 1JUDA 2G80A 3L1UA 5ALMA 5AVSA 2Q4TA 3L8EA 2HO4A 2FUEA 3L0YA 3R09A 2CN1A 3WKAA 1ZOLA 5AVRA 4YCNA 3OCYA 3ONNA 3P96A 2C8KA 2P9JA 3W5AA 4UW9A 5AKGA 4I9FA 4UMVA 3PCTA 5AHXA 1ZJJA 5AVQA 4NWIA 2B1RA 2IOFA 1WR8A 1QH9A 5AKJA 2R8ZA 4KX3A 2QYHA 1X42A 5ALHA 3NAMA 4EENA 1U7OA 2IA5A 2OM6A 4Y2VA 5E0OA 3L8FA 4HGPA 5AKYA 3RF6A 4J03A 4Y2RA 5ALJA 2WM8A 2WHEA 4CF5A 4Y3UA 5ALUA 2YMPA 3N07A 3FPSA 3M9LA 3OPXA 3ZWKA 1RLOA 5IS2A 4C4TA 2CFTA 4UMFA 2FDRA 5AVYA 3ESRA 2NO4A 2WF8A 4L57A 3J7TA 1RRCA 4RETA 1ZD3A 4BKMA 2P69A 3ZX4A 3U26A 4KNWA 1F5SA 2FPUA 3BA6A 4UM5A 5AI6A 5ALPA 1VJ5A 5ALLA 5AM5A 1L6RA 3FGOA 1YDFA 4OHFA 2BY4A 5AW9A 4ZEXA 3FZQA 3ESQA 4AS3A 2G09A 3B8EA 3SD7A 2OBBA 2P11A 4L6CA 1L8OA 4Y2QA 2FPXA 4KN8A 2IOHA 2JAWA 5AVTA 2YMQA 3KDPA 1O03A 2G1AA 2YJ4A 1MH9A 5ALOA 3QU9A 5AKEA 4KYTA 1QYIA 2PQ0A 4C4RA 3A1DA 2RBKA 3NIWA 4B6JA 4HAIA 3IJ5A 3WKEA 2I7DA 4CE6A 2ODAA 2G0AA 5AICA 4YCLA 2YBDA 4JDPA 2G08A 2NO5A 4BYGA 2WF9A 3S6JA 2PKEA 1L7NA 3ZWDA 4Y2JA 1L8LA 3L5KA 5AW3A 2IOFK 3AR8A 4L6AA 4EX6A 2B0CA 4DWOA 2RARA 3WKCA 5JJBA 1Z4MA 4UAVA 5AIAA 1T5TA 1FEZA 1SWVA 3ED5A 5AKKA 1J8DA 3PGVA 3U7GA 3E58A 3L1VA 1Z4KA 2GFHA 4NAVA 3QUTA 3N8GA 4G9BA 1TJ5A 3W5CA 3ET5A 3W5DA 5AM1A 3AR3A 3E8MA 3OTQA 3KZXA 2GHTA 5ALNA 3B9BA 2HOQA 2YMLA 5AW0A 3A3YA 2W43A 1ZRMA 4HGRA 3OCWA 2MU1A 2WF5A 1J97A 3U7FB 5AM3A 2VKQA 4BEWA 5ALWA 1Z4OA 4Y2TA 5AI0A 3WK6A 4FYPA 4ZEWA 3WGUA 2ZG6A 3RFUA 3QGMA 1Z4QA 1Z88A 2R8YA 4YIKA 2HF7A 4Y2PA 3ZU6A 3ZTYA 2OA0A 2ZBDA 4DCCA 1EK1A 4YCMA 2G06A 2IYEA 2GO7A 1L7OA
chains in the Genus database with same CATH superfamily
1DU4A 3BZCA 5LNK1 4JLNA 3FDJA 5G3YA 4TX1A 5TT0A 4JLUA 3C43A 3SXUB 3BRWD 2WKRA 2A0WA 4K8OA 3OMWA 1HYHA 2XEXA 4JROA 5EUCA 4KFSA 5L9XA 1EXNA 5KO2A 1L7RA 3OE7D 3KQLA 3M3PA 4CGYA 4AQYB 1JHPA 5IZCC 4GQIA 3QF7A 5ALSA 1BFDA 3RAEC 2VJPA 2A6PA 2GEVA 3MRTA 5IK2A 2NSJA 3A10A 4RE5A 4HWRA 4P4MA 4YREA 1KQNA 4EATA 1GQSA 1PO7A 3LUBA 5JCOA 1ZGZA 2D1QA 1XR3A 2H07A 2YY5A 4AKIA 1VPDA 2QT9A 3QMMA 4X3PA 1HMYA 4HATA 4C4AA 1QIGA 2IPLA 3HADA 4JOQA 4RZ2A 1RPJA 3VNSA 1C4KA 3WTCA 5B7NA 2PFSA 1WETA 1M2VA 2YWCA 4UFPA 1H6BA 1U7ZA 3KQPA 3LC0A 5GONF 3I9MA 1KDZA 1TO2E 3U6KA 3G9XA 4G5OA 2DBVO 2O9JA 1SCUB 1CV2A 3AH8A 4JFRA 4E4TA 2R6HA 3LY8A 1U0FA 2I3DA 4C8OA 1XDWA 8ICQA 3OZXA 3AW8A 4FKBA 4LGMA 2NU8A 3GZFA 3CEAA 3HN6A 4BRZA 2YOFA 3U1TA 3W7VA 1TB4A 3RTGA 2JGMA 2VO1A 5KTPA 2P5YA 3TGLA 2B7BA 5M5BA 2ZBPA 2ZWAA 5JARA 2YS7A 221PA 2GESA 5KFMA 3CNLA 1QDLB 3SDSA 4AYBC 2XKKA 2PO7A 2QPOA 2DHRA 4Q9NA 1JGTA 3PJDA 5D86A 4I1SA 4DL9A 1N2EA 1R66A 4YN4A 1KI8A 2QRHA 4AQ7A 2OOKA 4FDMA 3HUTA 1FUUA 1DAHA 4UB5A 1OT5A 4ZEVA 1EGHA 3GVIA 5EWJA 2Q2VA 2C7BA 2C58A 4JGIA 3TLYA 1DADA 5K09A 2I7VA 4IZ6A 5DX1A 3S0JA 1G8SA 2IGBA 3DZBA 2O8DA 2PI4A 1NKEA 5CNKA 1RHQA 4RD2A 2IS2A 3RV3A 3FGPA 2OXRA 3H4MA 3OU2A 4C7KA 5CEJA 1VTKA 2RIRA 4IM7A 2FX5A 4HRAA 1NQTA 3CJRA 3U3RA 1TZ2A 2M9NA 2MU2A 1NK5A 2LPEA 3E05A 4OREX 2IH5A 2O8NA 3P2OA 1DARA 1I6KA 4QYMA 1XZDA 2LE0A 3UK2A 1OI3A 4Y9DA 1CCWA 1ZN2A 3D0QA 3T7DA 4CKCA 4ZCRA 1LNZA 1TRHA 3EXHB 3INNA 1R4ZA 2IXAA 4KGZA 4O4HF 5LCXA 1XVIA 3C7KA 1Y8AA 3E9DA 4J2TA 2O54A 5F9NA 4E2ZA 3LM8A 1S2NA 8MHTA 3HGQA 1QGZA 2ZI6A 3PHJA 4OQXA 2B6NA 2HK8A 1EE2A 2QAGB 2HVIA 4U02A 2Y1EA 3WLTA 4O5AA 1Y6QA 1YRLA 4ZOEA 1AZLA 1Y9JA 5KMGB 1B0AA 1ZWKA 2H52A 2OILA 2Y67A 5HIMA 1JLSA 1KJ9A 4GLBA 2QKYA 5E2IA 3QE2A 3VRHA 2B30A 1IBMB 5HNKA 1QHNA 2NTVA 1G19A 1T0IA 2GPWA 2V7EA 4EG3A 3KL2A 1J8QA 1NUAA 2P6PA 2I34A 4OOEA 4IHAA 4R9SA 1VHJA 3OLYA 3R20A 3NR2A 4GR5A 5P8WA 1PHRA 5JW6A 1NTOA 3TD9A 3RJIA 1SKYB 2EYQA 4FM9A 3ANLA 3B3AA 2V1XA 2YUTA 4YXWA 5KTQA 3E22B 1UDXA 3AEUA 1E3IA 2GM9A 3E70C 5ESXA 1J6UA 3I5YA 2POCA 1XP5A 1PX0A 4L72A 4F2SA 3G5MA 3JTEA 4AF7A 3GLGB 2V1UA 1IXRA 3FSRA 2P6NA 1N1MA 2VDJA 3FROA 2VEOA 4OB6A 4QX6A 3WZMA 1GIAA 1BVYF 1EVZA 3TADA 1GA6A 1MJFA 1RYSA 2FF5A 2P9EA 2VKTA 2ZANA 3BFKA 4KO2S 5F2KA 5DCWA 4YRZA 2ZGVA 1N4DA 3MA0A 1KSHA 3AJEA 1YR2A 3CZCA 2VDRB 5DMHA 4FB4A 1KDPA 2EZ8A 3OQOA 4AS1A 1CQXA 1CY8A 4TMTA 3VYTB 5K6RA 1NV9A 3O1HB 3UK6A 1I4OA 1KTIA 7ICPA 2GD2A 5ER9A 2EW8A 3ZCVA 4YP0A 2XXJA 1GG9A 4DZTA 2BLNA 2WP8J 2JCVA 3A6KA 4Q4CA 1X15A 1WLSA 2AC4A 3ETEA 3HKBB 2MYUA 2EF0A 4JD5A 3RQSA 3LGSA 4I9NA 3WADA 3ZK7A 1Z5PA 4W1SA 3TVYA 2O3RA 3TR6A 4LRQA 2JLXA 5JJKA 2ZIUB 5KFGA 2L2QA 2V9ZA 4MRNA 5L3RA 1Y6GA 1NU6A 1ZBDA 1P73A 1PR0A 2COKA 1PEAA 4CHGA 4YI5A 1KXJA 3F7TA 3RRXA 4RD1A 2AG5A 3PR2B 4Z6FA 4F46A 3G9TA 3WZLA 1OU0A 1Y8ZA 2QNRA 3D3WB 4REMA 4TMWA 3J81j 2O7NA 2BMJA 3GA5A 4FLFA 1R0SA 2IZOA 4PM4A 5GTIU 5HUQA 1LS6A 1IOVA 1VHDA 1SVMA 4XVUA 4DCUA 3JALB 2SCUA 1PJTA 5J2BA 3H7AA 3RAJA 5FFFA 2ZJYA 4YMWA 1TQ6A 2BCEA 2FSUA 2YYZA 3AO0B 5JZMA 1ZQWA 3LK7A 5F9HA 2GCPA 3UJ7A 4Z54A 5HR6A 1N0UA 3LWZA 3RBVA 4E11A 2IP4A 3D81A 4NDAA 5G53C 1B4FA 4UU0A 5MFZA 1ONOA 2AIRA 2GPBA 5FA6A 4BFLA 5CFLA 3OICA 3BM5A 4EPWA 4LJXA 3R6GA 1ONSA 4KHZA 3W2HA 3VI4B 5BPCA 2JBWA 4DIBA 1GPH1 2YXNA 1CUHA 3Q3JB 2IODA 4MQUA 5AW4A 2OEPA 1YFLA 5MGNA 4AUNA 3E81A 1HEIA 1NF2A 4QZBA 1AKQA 3RRJA 4BEVA 1DFHA 3FLMA 1BNOA 3G2HA 1YHNA 3KHTA 3QMPA 4IR7A 4WN9B 5DTIA 4PTLA 4PRLA 1X87A 3OPQA 2MMGA 3KZOA 1VMKA 3F53A 1LU9A 5J1TB 2J0EA 5CGZA 2JI7A 3REQB 3T61A 4CLOA 4KWEA 2HU5A 4FUTA 4PLHA 4LYJA 2YB4A 4BLOA 2RHCA 1QQ6A 1RACA 4IFBA 4M8IA 4N9QA 5C46F 1WV0A 4JXZA 1KYVA 2I6GA 3AR5A 4TQUS 5HK8A 1C0IA 3TD2A 4DSZA 3HFRA 3UBTA 2AFIB 1V2GA 3SQMA 2B92A 1Z15A 1G8KA 3CZMA 4Z51A 4J9LA 1X39A 2EBWA 1O97C 2YIMA 3AGPA 4MV9A 1U0EA 3W3AA 3VDXA 3SU8A 1LS1A 3VZBA 4E32A 5A4AA 4QG3A 5K99A 1VKNA 1RJEA 2JIMA 3TCXB 4B6FA 3GLFE 3ABSB 3EBOA 2JLYA 3EAFA 1N5DA 3A8TA 2ZBUA 2QW1A 4Q4AB 5G40A 1YBHA 1SVNA 1X9WA 3QM1A 2YWRA 4GLXA 2F3UA 3CYMA 1CT9A 3ICQB 3ASZA 3ADOA 3V97A 3DV9A 3ICXA 7ICMA 7REQA 5JMTA 1SVWA 2I4IA 2HA3A 5BSRA 4FE3A 5UKDA 4RBNA 1CERA 3DWEX 3JPWA 3V6KA 3P4XA 1T0BA 1YS4A 1N9ZA 1ZBQA 1JJVA 3KQVA 2YWXA 4M1OA 3WWZA 3ZDDA 3HXMA 5C4MA 3H5IA 3ZWXA 4RYDA 3HCPA 4U8HA 5DASA 1ZR2A 5L7TA 1H9AA 1QYWA 4PRKA 4WZZA 2WYUA 2H17A 4TV8B 4FS8A 5JNWA 3H6HA 1OFIA 3LOUA 4O3PA 3I52A 1C4XA 4ETWA 1XZPA 1BOFA 2BQRA 2C9BA 2IZ6A 4H6VA 1SHTX 4FFVA 4QLBA 4TL9A 4NBLA 1E3DA 2ZM5A 3PPWA 1ESNA 3NBZC 1E1MA 3AQIA 4Q15A 5LWHA 3CGWA 1U47A 1XD8A 8ICMA 2AX3A 2I4LA 3AF3A 1VFPA 2F9FA 2FSVC 1EX1A 1X1DA 3EGXA 1G0NA 1GO3F 4Y1FA 5HMLA 1X7YA 2O3JA 2P2NA 4NXMB 4LGCA 1E59A 5IUKC 3MOGA 2VT3A 3DL2A 3RFTA 2FWRA 5BSEA 1QIKA 4DEXA 3ITKA 1Y89A 1MC8A 3PGA1 3HRKA 4C5CA 5DPMA 2BFOA 4I9GA 3CUYA 4QZCA 4EW2A 1X1TA 4V39A 3U40A 1KJZA 5C4IA 4WNYA 1GAEO 4KLEA 3LH5A 4FNMA 5E0KB 1M34B 1JBQA 2B8WA 1S0MA 5D85A 4BFTA 4DLGA 2Z56A 3CLRC 4OJLA 1XYYA 3BXFA 3TQSA 3THWA 1S9FA 3USCS 4G07A 5DHFA 5KT5A 3SFTA 3MWYW 3VFDA 2Y99A 3AEUB 4Z8XA 2YJ5A 1V41E 3KZVA 2A1AA 4F11A 3DHVA 1MO5A 1NW4A 3CCFA 2CFOA 2MMCA 3JZDA 1OOEA 1IEVA 2AJBA 3R44A 3VOTA 3TLAA 3KS9A 4KBFA 1GUYA 1O9HA 3PGJA 5EYPA 1ZEJA 3IN5A 3M49A 4G3XA 4GE3A 1XMJA 4M9SA 5T3UA 4DLSA 5AVSA 3M9NB 2Y1OA 3IMFA 1DAPA 4QW8A 3TFRA 2ESEA 1AUVA 2C2OA 3FUCA 3QE0A 4C7OA 5B2EA 4RLQA 3GRUA 4CUJA 2PG3A 3GDXA 1C3XA 2HQ1A 4TTRA 2WD8A 1DMRA 2QRQA 4C0SA 2EAOA 4YLYA 5A5VA 2O5CA 2NIPA 2PBFA 3FDXA 1SKMA 3A0HU 3ONDA 2ZIGA 1Q21A 1CS0B 1JIHA 2PUGA 3EIFA 4UW9A 4PH5A 2WJZB 4W7HA 2BAGA 2NZVG 2A5YB 5TXGA 3UAWA 4NWIA 4I1IA 2VSNA 3K1RB 1EFRD 2V7BA 3BIWA 4TV8F 1DKQA 4RVNA 1DRJA 2VQSA 3PC8A 4OQLA 1X42A 4F5QA 2BCRA 1EUDA 2BSXA 2ZJ4A 3H65A 2AFIE 3IAFA 5FUVA 5BUQA 2V5AA 1K4MA 3F0TA 2P9GA 1L4KA 3AFIA 3AKCA 1Z0AA 2XWJI 8ICGA 2CKMA 2GWRA 3C16C 4GZ3A 1AKWA 1Z7GA 2VANA 5JD5A 3UMYA 4PHDA 1P2GA 4IX9A 5EGSA 4IMPA 1DUVG 5IJWA 3N07A 2KOBA 4NLZA 4N7BA 3MB8A 3UJAA 1Y0BA 1SD2A 2ODGA 3BK1A 5E6SB 2EX4A 3SR6A 2NO7A 2ZSIA 3V3TA 2HHAA 3O8OA 2UYGA 5FCDA 5KNDH 2AOVA 4PZZA 4KLLA 2W9XA 4BWFB 2E1EA 3SM3A 5H5JA 3C6YA 3BC1A 5LLSA 3LKVA 4LVOA 1JDPA 3QFFA 3VVCA 4B87A 2QAGC 1OHHA 1XQ9A 2PSHA 3HKDA 4BYMA 1QH0A 3TX6A 1HDIA 1EM8B 1RWPA 2ZTUA 2A58A 2ONZA 4G1BA 3PX2A 3MJCA 2KG5A 4LZDA 4WXHA 4ARZA 4KO3S 2R8KA 5BO5A 3T3EA 4WKOA 4ER7A 3BWXA 4EVQA 3G0HA 2F9MA 5DQGA 1U1GA 2FOLA 3BRCA 3OMXA 4IJ5A 4EMBA 3U44B 3RK4A 4LF6B 1G55A 1U7WA 2DUJA 2P5TB 1MA3A 4IH4A 4UTXA 4QU8A 4D9MA 3KEFA 1QQBA 2AG1A 5DOZA 4F38A 2O8FB 4Q12A 5C7IO 1I1OA 3CA8A 3OQIA 3PNLA 2XIQA 3Q3VA 4UAZA 3BQ9A 5ERYA 3SXJA 1EX9A 3AFOA 1QTQA 4KDEA 4ESVA 1JF8A 1R5JA 1YR7A 2X22A 3BXOA 4V3CA 5JXIA 2R68A 3AIIA 2QX9A 4N0QA 3W7BA 1DOHA 1L3CA 3OOSA 5H3LA 2JAHA 4YAGA 3TNYA 4X1IB 4JOCA 5AJWA 1P9WA 3N0TA 1SBZA 4N47A 4D8WA 3MJHA 2BMVA 5JR3A 4H1VA 1KFTA 4JU9A 3MCAA 4PZNA 2I2DA 5ESWA 2JXJA 3YASA 1P33A 3U7QB 4P80A 1QRSA 2X40A 2PS0A 3IQGX 2NO5A 1PK8A 2H00A 4WCFC 4RNNA 1RWVA 2CK3A 2PKQO 4Q18A 3PSFA 1IAVA 5KL8B 1QMGA 1XZQA 3K3PA 2IEIA 4MYRA 1UKZA 4Q34A 1Q12A 3JWHA 5EIOA 1L8LA 1P44A 1NGSA 1PWZA 4A6DA 4B34A 2G9VA 3HS3A 5D51S 3D2CA 7REQB 4NPAA 4FSHA 2BE9A 2O0MA 2QRLA 3QW4B 3OQPA 3ITNA 4L9WA 4W9NA 2CV0A 2NO6A 2VWQA 2MUTA 1ZUNB 4MULA 3ZS8A 1MAUA 3HEBA 4M2YA 3OU6A 3PZBA 1FP1D 2BHTA 4X93A 2IE0A 3PYMA 5E6RA 1JEDA 1K88A 4KXNA 3RRNA 2LYBA 1FDOA 1Z4KA 9ICEA 2GB4A 4PZDA 4KN4A 1V8DA 4K2AA 2ISSD 5TC4A 3LBNA 4D9IA 3GLFA 1QVAA 4Q03A 1HUZA 1QYDA 4FZLA 5DTJA 1GZ3A 2J85A 3BQMB 1YL7A 4Y6QA 3KZXA 4HN4B 4JASB 4J4TA 4ZT6A 2L19A 1Q77A 1ID8A 4KGVA 4KR2A 4IP0A 4F7DA 2I2AA 3A3YA 3H2BA 5HF5A 4HVAA 4B9NA 1BD4A 2NZUG 5EA2A 3U0BA 5IRCD 2ZDGA 2JGDA 4CM1A 4MJ7A 1ZH8A 4J9QA 4BXOA 3KDSE 5L3QA 2D06A 2C78A 3IMGA 2G1UA 2AUNA 3STTA 3D43A 1A9OA 1JXMA 1SBHA 4CJXA 3H2ZA 4RVDA 2OYYA 2P41A 5HCNA 1BQ3A 1NVXQ 2QQ0A 2LW7A 4HKTA 4P0PB 1RYZA 1Z8NA 2PD4A 3GRYA 4H7JA 4PAQA 4QYSA 3BYZA 4DY4A 1VYVA 5ICMA 2WJWA 1LRJA 2QN6A 4C3ZA 2GF9A 4RTKA 5DSTA 4M8SA 4KTTE 1NF3A 1RI4A 2PRYA 2C07A 4ECZA 1C7IA 1K9VF 3DMTA 4PHFA 4PNZA 5KDLA 1R6VA 5JNVA 4WDQA 1LBQA 4C3VA 1HFKA 4U5QA 1E94E 1KSFX 3RVBA 5CDUA 5HR5A 1ATZA 3T1YB 4OO1J 4CG1A 1YQQA 5AK4A 1YT3A 1Y8QA 2P2YA 5HUHA 1QKJA 1X1RA 2Q28A 1DO8A 5JAZA 1P80A 2VN8A 4NJEA 1YI1A 3DF7A 2D8MA 3KKMA 5A9TA 4I1PA 5IJAA 3CNHA 2JDID 3CVOA 3JS5A 4NK5A 2OCEA 3B3FA 2W6JA 3R3XA 4YRPA 3PRHA 3T9CA 3RB4A 3JZMA 4S1OA 2E2WA 4ITUA 3DDHA 2FEMA 5J2AA 6LDHA 4L8FA 5BOSB 3KXKA 5AXCA 1KERA 4X1IA 3WLFA 5JRTA 3V1UA 5CH3A 1EHIA 3P2JA 1ZWLA 1L5FA 2H92A 4WN9A 2JBHA 4TN5A 4BE4A 3S3TA 3QUBA 2P6UA 3SF8B 1N34B 3F2CA 4FLEA 1KKMA 2J4FA 1RC1A 4JBWA 3RH4A 3NEPX 1ZESA 4URWR 1G4UR 5EHZA 2J7KA 2RRDA 3LDHA 1RZRA 2AN1A 3P19A 1I7LA 1C2TA 1WPXA 2XCUA 2R8GA 5F3DA 1R74A 4TUSA 3ZI7A 4M9UA 3K0FB 1D2GA 3I2HA 3OETA 5I9LA 1ZQAA 3LSYA 4MDHA 2Q1UA 2PZJA 3CPJB 2WUGA 2O06A 3CG4A 3KQWA 1D8BA 2FOIA 4I2EA 2I6SA 4L4UA 4P4SB 3W5IA 3FYHA 2D4AA 4QUKA 1Q20A 2KW5A 5FBLB 1I5OA 1UPTA 5CB8A 1QQ5A 2W54A 3EBPA 5BVGB 1WUDA 3HLKA 1DAEA 3I9KA 4N49A 3IKVA 3SQOA 1NQOA 1QQAA 4BTVA 4FWBA 3LBFA 1D2RA 4RENA 3AHEA 3TIGA 1CUSA 1MXHA 2BOVA 4RK4A 3ZTWA 3TLMA 4NNPA 4TZ0A 4KPYA 2V4ZA 1QGYA 1T2CA 4CODB 2CMFA 5ERGB 4JVNA 4LE1A 4P7FA 3F5FA 3PE3A 4F5WA 1B6TA 3ESDA 2ZPUA 3H1PA 4ZC8A 4J75A 4YP5A 3B5IA 2VF5X 1BEZA 1ZQVA 2PZLA 3BVPA 3EXHC 3I8SA 4YR9A 5ES4B 3IQIX 4BWYA 3ZHZA 1NKTA 4NDNE 3S8YA 4H6PA 1ZGAA 2MINA 2JIRA 3FNRA 1Y1RA 2QTZA 2VHQA 1TT7A 1OIXA 3CU5A 3HPOA 1JAXA 2XUOA 1GTSA 4P34A 1LB2B 2GCEA 3C24A 2A7XA 1TQ2A 5LOVA 4ZYXA 4L4YA 4AAYA 4ED1A 3OIGA 4EY8A 1U6JA 3T9AA 3LYUA 2A0UA 2IOYA 4R2IA 1EA7A 2G9RA 2CMDA 5E2BA 2IXFA 3TBHA 3TNDA 1GKKA 2B99A 4BNYA 4CCHA 1LH0A 1USVA 2OZEA 5FOSA 4CG0A 4PS1A 4C6RA 4EZEA 1KE2A 2AWNA 5DBAA 1M1XB 3OZWA 3NHMA 1ZGBA 3QJ5A 1M2JA 4ECRA 2HLHA 5J4VA 4ASUD 3KKKA 3MR2A 1G63A 5LM3A 2UU9B 1AJEA 1RQ2A 2E4XA 1ZHOA 2VLIA 3MTBA 4XWAA 2Q1WA 3UQZA 1G2IA 1LW7A 2OMKA 1VMDA 3G0IA 2AXTU 4XPIA 1Z6ZA 5I7WA 3WA6A 1YMUA 4IL5A 1LDMA 4KLRA 3LLCA 3Q12A 4MV6A 2ECFA 2CMKA 3CSDA 5DW0A 2IIPA 1ZM4A 2WTBA 3IQZA 4W7SA 5IU6A 4RQ4A 4B75A 4A15A 1B7GO 3B5EA 3ETHA 4R8UB 5J8YC 1JIXA 2OORC 3OTWA 5LZ2A 3EPLA 3ESXA 4DMLA 2WIJA 3UAZA 2Y77A 3NGMA 1K6MA 3ZI4A 1ZM9A 4LXQA 4M0LA 3B1KA 4NULA 4XB6B 4AJIA 3LVQE 1GKUB 5HP4A 1OFHA 4TSFD 2X0NA 2VK8A 5D3KA 3E3MA 1U63A 3KU4A 3NZEA 2VZLA 4TQ9A 4RM3A 1YULA 4IJMA 3W8NA 2AH5A 3DEFA 1HJPA 4DLKA 4RV4A 5AW7A 2FDCA 2ZXFA 1ZS9A 3DJYA 3EHDA 4D9BA 2WF7A 2PV7A 3IHKA 4KN6A 5DSZA 5ILGA 3BF8A 4F5OA 2A19A 1GQFA 1LTKA 2BP7B 2F8SA 1RBMA 1NJGA 3IEVA 5CB4B 1G7TA 4NCXA 3D6VA 1T94A 1DBQA 3FR7A 4R0VA 2BQ3A 1KMQA 1LSUA 1N2SA 1ZIPA 4LHXA 4GWGA 2QWXA 4I36A 1ZQKA 3VAYA 3CRW1 3H2JA 1RKQA 4RU1A 4PXSA 4B6OA 1QOPB 5IAJA 2JHAA 5DE3A 2O48X 2X1HA 2PQ2A 2ZRKA 2D0IA 2L42A 2HQOA 4U4AA 5GWXA 2AN9A 1B8PA 2BN4A 5C0OE 4KIJA 5CT6A 1W5SA 1S1CA 3AEZA 2WVHA 3E7FA 3KC2A 2M6KA 4D3FA 4UBCA 3ZHYA 1ICEA 2P3LA 3B1FA 3DE6X 4LYAA 5DOVA 5ERXA 4ZKEA 4E7PA 1S0UA 2I33A 4C8KA 1QPGA 4MW5A 3F67A 5B4TA 2ORED 4D0SA 3H5RA 3EHEA 4WFQA 5BN5B 1OX4A 1R0CA 5CJ7A 4QBFA 5E1OA 1OTXA 2GO1A 4EBDA 3KO8A 2CLLB 4JQZA 5B1SA 4E5DA 5IFLA 3CKMA 1B23P 1C1YA 5A5DA 1HO3A 2JMGA 5HE8A 2CJPA 3D8SA 4XZ3A 3SC3A 1D8AA 2B5OA 3QH4A 3T7IA 1IBRA 5DGIA 4LY3A 3RW9A 3A2NA 2W93A 2F9LA 2G88A 3V4FA 2V6IA 4KHPB 2ECQA 1KRXA 4B46A 3RVLA 2LCFA 4XX0A 4D43A 3KYDB 1ZGJA 5ALYA 4H0FA 5D1HA 3B8HA 1CR0A 1V35A 2HGZA 2VP4A 3P9ZA 1R8QA 1C1HA 4KXXA 1AK2A 4P3OA 4CKWB 4PIMA 1G6OA 4Z9BA 2JJ8A 3V1KA 1ZQXA 4MUYA 1RKBA 3PEEA 2KVCA 1KZGB 1THTA 1PWEA 2IEYA 1RG6A 5ALKA 1KJYA 1M6YA 1B22A 1GPMA 1HSZA 4DQSA 9ICSA 1REQB 1K4YA 4QTXA 4S0XA 4UDXX 2BPGA 1N9KA 5FBHA 3W9BA 4DPLA 2YUIA 3SPXA 1F8XA 2KTQA 5J0SA 4C08A 2FPLA 4G4SP 4TUQA 2GBIA 2Z2KA 2ZTMA 4OYRA 4PYMA 4LQLA 1ZN9A 1B2LA 4ECUA 3ZD8A 2JLRA 2WG2A 4X91A 5ALVA 1JV2B 3VR3D 3D6UA 3QKIA 4FMDB 4MLDA 1RS0A 4RGBA 4Q3BA 5FOWA 4YRMA 2FF7A 3I2YX 4ZT2A 1N5IA 1TAQA 5G1OA 1CIJA 4B6PA 4QDOA 3PR1A 5AI8A 2Q07A 2PSJA 3V4SA 4DREA 4DQXA 4WHMA 3TRFA 1W19A 3HWRA 5EUQB 3DGEC 5FUXA 4AJEA 3R5JA 5F9MA 1GPNA 1OASA 2WWYA 2HHVA 1NA5A 1Z6GA 3GELA 1OBOA 1JQ3A 3LMKA 4OQFA 5H80A 3BRWA 1V7CA 3SYLA 5HIKA 3IILA 2R751 2VUHB 4INJA 2OBFA 1PAUA 3PSPA 1U7PA 4PWZA 3SYZA 1G3QA 2K6GA 3LPMA 4RK1A 4JP8A 5CPBA 4R4JA 4ADSG 3SLRA 2FPGB 4AZ3B 2UZIR 1RAFA 3AQ4A 4C7JA 1JAIA 3PYLA 3QBDA 3R0QA 5DHSA 4EM6A 5CFPA 2L18A 1FNBA 1QE3A 1VM6A 2GZAA 4AW9A 4M0FA 3ZW7A 5I6DA 2GK4A 3S1AB 4JKOA 4RK6A 5JZVA 1FQWA 3B13B 5IKXA 1XDZA 1ZQLA 2J6SA 2QTHA 5BNTA 4KB5A 2IHVA 4MXDA 3UPQA 1Z36A 3KEGA 4Q7JB 3UGJA 1VYTA 4MAAA 2I54A 1W6UA 2ZRCA 5FPQA 5LDGA 4EUSA 3LUKA 3N7TA 4RTOA 2WU4A 1RDFA 1GNLA 3U48A 5D5PA 3GNTA 3KKAC 4QOJA 3KTDA 4TVOA 4X7PA 2HHSA 1UPXA 4ALJA 5EE1A 4OUDA 3DOJA 3T4PA 5IW8A 1GTG1 1SUPA 3SOZA 4HTFB 1FYFA 2Q3JA 2ZUCA 2QI9C 4MUGA 5AW6A 5IIJA 1XROA 1CRXA 1CVIA 1DHRA 1Y3FE 1ZUNA 4XEHA 3RUPA 4ZQHA 1X19A 1A9XA 5THXA 3N2EA 2X9LA 5DK6A 2HT1A 1NFFA 2VRNA 4DJEC 2WIGA 2ZXIA 1ENZA 3WK8A 3PUXA 3N86A 2ZYIA 2RKWA 4FCCA 3MWLA 2J5RA 4JIMA 2I87A 5CLLA 1BWSA 5KKCA 5M34A 2XODA 3IRVA 3E7WA 4EKIA 2ZTDA 1TF5A 5A0FA 5T4EA 4PHGA 1NBHA 4ARVA 3ANMA 4FX2A 4QULA 4WGFA 1WBBA 2X8JA 1G5HA 1PNTA 5KFCA 3BMQB 3TXXA 1EUYA 4M04A 1JW9B 2ATCA 1G6HA 1CETA 2BHSA 4P35A 4MJXA 3UMVA 1OI4A 3KOXA 1MG5A 5LVAA 2Q3CA 4AZVA 3DMHA 1LRKA 1MNAA 1BMFA 2QIOA 1DTSA 1E20A 2Q6LA 3IELA 4F93B 4CQJA 3G1UA 4GSLA 3A0UA 3L8EA 3OHBA 1L7EA 4ZREA 3ILXA 3I0NA 3UXYA 2XNHA 1F6WA 2H4HA 2Q9BA 2XUJA 2OPHA 3QPWA 4EEYA 1F38A 1KRHA 2R79A 1NHGA 1UJBA 2RHMA 3BD8A 5FA5A 4JLDA 1UAGA 3NRZA 4URVR 1RYHA 2OFFA 2LD4A 2M9MA 1SKRA 1BFUA 5TPWB 3DOEA 1ZQDA 3ONNA 3NHSA 4PGFA 4PLZA 4CLHA 3T7RA 1YDMA 1TW2A 3DTVB 5CA1B 2Z09A 4ZYTA 3CVVA 4DR5B 4IF4A 1ODKA 3GVXA 1Z0JA 3RYIB 2Z0MA 4XB2A 4I9FA 3E2PA 1E2FA 5AHXA 1ZI8A 5HZMA 1JT9A 3T99A 1CIVA 1NLMA 5M29A 3DHNA 4JJZA 2O52A 3KB6A 4WUTA 2QMQA 3KL4A 3OFKA 4RQ7A 2B9EA 2RE8A 1BDHA 3TAQA 2HGSA 4JQSA 1E6KA 2X4GA 1YBAA 5EESA 5J0YA 5FPHA 3MT9A 5B1IA 4XYLA 3IUMA 3PQ8A 2ID4A 2JH7A 2A1TS 3VI3B 2OPBA 2RK4A 2PX8A 4MJ3A 3I09A 5CVVA 4G1FA 4F2RA 5TZVA 2YRWA 4JLBA 3JQBC 4NY1A 5JT1A 1SG0A 3CX7A 3L7CA 4CLEA 4RKQA 4Q4JA 2I99A 3QWIA 3KR1A 4O59O 1XNQB 3EEQA 3GNSA 5HS4A 3HVIA 4MCJA 1U9IC 4XWOA 4YG2A 4I2JA 2O4CA 1RQGA 5KOIA 2AX4A 4HR7A 4BTLA 2JHCA 2OFWA 5H7XA 1TPYA 2ZYVX 1H1TA 4LQDA 4DMMA 1U3GA 2BEWA 2WD9A 2XMZA 1NY6A 2LKYA 1J06A 3NHKA 1UDBA 1DJQA 2JK0A 1RXIA 4KR0A 4HWKA 1M66A 4D9JA 4LF5B 2FPIA 2GEUA 2O8VA 4FI3F 2XH8A 4F3YA 4PGXA 2XGPA 1I2BA 1Z17A 4JL6A 4ZOLA 1HXHA 1P39A 1X9GA 2E4VA 5KFOA 2R84A 1PT7A 4U9HS 3RNOA 5KNDA 3C7CB 1S10A 3V72A 4ZEXA 5I7SA 3R8FA 2UV8A 1ABEA 1WMFA 2FP4A 3SDZA 2WE8A 2JFZA 2YVQA 3N3BC 2AC7A 4BUZA 1L4HA 4AWAA 1XN1A 1J0EA 4OA8A 1EAMA 4X95A 3MRXA 1BKYA 2XC9A 1R8JA 1ZOOA 2BV3A 1BPZA 2PRKA 2RHHA 2H1IA 2X3YA 2XBLA 1XJWA 3GCGA 2C42A 4X61A 1FFWA 3MT0A 1IMJA 1UWVA 4Q47A 4M9ZA 1JSCA 2G1AA 3RB0A 4WVLA 4OTZA 1N61A 2RHFA 5L7YA 3UV7A 2ZRAA 3GFTA 3QU9A 1JB1A 3SS7X 2VZ8A 5BVHB 2DCMA 3AQEA 1QVWA 4GC7A 3A1DA 3ASUA 3NIWA 1OXTA 3O4VA 1QLNA 1MAWA 1AS3A 4MS4B 1C50A 2Z8ZA 5B7GA 1G66A 3U56A 3MELA 1B26A 1BJRE 3G9QA 2D2FA 4FVTA 4NVRA 1U9JA 3HCRA 3SEZA 3C5CA 2B4AA 4JVOA 4LZOA 5I9NA 7ICKA 4JB0A 3EUWA 4HNHA 3RANA 5BSFA 2H63A 5HJEA 4LZNA 1UWKA 1POXA 3ZJTA 5KYUB 1VSBA 2XQJA 4MARA 2R8JA 2FZVA 2CCJA 3BJRA 3BTSA 2BFEA 1SD1A 2WAOA 3MCZA 1NQWA 3NJRA 3AEQA 4D8TA 1DGQA 3NLLA 3R0JA 4FJ1A 4FZRA 4IEFB 4JX9A 4XUCA 3VZCA 1C0EA 3F8TA 4CV0A 4J9VA 4LOIA 2ZKIA 3UOWA 4C2AA 5DULA 3SOPA 3EDMA 9GPBA 2IMWP 1JHXA 1CSEE 4DCOA 5KCZA 4XSGA 4JV0A 3HV2A 2REQB 5JAHA 2DQYA 1GZVA 1R5NA 1VPEA 2C3MA 2JDIA 4L5IA 1UEXC 4OBWA 5NULA 3RVKA 2W7PA 4XKJA 1I2ZA 1KJQA 3I73A 1OAAA 1UBSB 4F4KA 1WPQA 2NZ2A 2R2GA 3AB7A 1HLPA 3EZFA 1I4EB 3DXFA 1XJ5A 2OAQ1 1D2CA 4IVQA 3JPTA 2PTHA 4LJ4A 3L5OA 5FUQA 3GT7A 4XD7A 3RJJA 3NXKA 2PIDA 1PU2A 4G3IA 2C9YA 3AI3A 4FBMA 1G21E 2XCIA 1IHXA 2DPGA 1PK9A 4W1PA 1C8VB 1ND5A 3FMGA 1U2PA 4FW9A 5TQJA 4ZJPA 5L7WA 2VLBA 3ZD6A 1EDOA 3QVGB 5TQ2B 3ASYA 2QMOA 1JIJA 4RJIA 1KEKA 2I3AA 4Y2TA 4YJ3B 1DAGA 1Y8QB 2GLUA 2EZXA 1WF3A 1Z18A 3T4UA 2F8KA 4I0WB 1H4QA 5JDIC 4HNQA 1E4EA 1HTWA 2W6CX 1CUBA 4RF4A 5C8YA 3QGMA 4DDKA 2IY8A 3Q9UA 5CFRA 1TTPB 1RWOA 1ZIOA 5KNCA 4L0DA 1Z1BA 3VUFA 2X0IA 2ZXHA 4YCMA 1ZCBA 3BQ7A 2EKLA 1LBHA 1CWUA 2WE7A 3P94A 5EP4A 1F0YA 1S9DA 1UFRA 1NJWA 3OGUA 1HC7A 1G8FA 2C94A 4MGIR 1NUQA 1WPRA 2A33A 2X9GA 1POWA 2Y6UA 4UDNA 1ZUIA 3ED1A 4Z3KA 4Z4CA 3D7LA 5AW8A 3GMSA 4I7EA 1AQ6A 1PD0A 5L3SB 2VR1A 2I4MA 3ZOKA 3MJVA 1WZEA 4A1OA 3G5UA 4OAOA 5JSUA 1YRHA 4R9UC 3D4BA 2ZYGA 2EYUA 3MTAA 4UJ3A 4J43A 3ZHVA 4BFZA 3W9SA 1IN8A 3P2EA 4YMSA 4KODA 1OWMA 2OHGA 4W8OA 5IDWA 4D02A 1GSHA 2DWPA 3KSAC 1FJXA 4CCYA 1Q95A 2D3WA 2QBYB 1X0XA 2OY0A 1II8B 1ZQPA 4BLWA 5DRYA 4D9GA 4W5RA 2UYOA 1L5YA 3G68A 1SUIA 2IHYA 5ALDA 2XUIA 1DIHA 2D00A 3NP7A 4BX0A 1K7XB 3H40A 1FTYA 1OTHA 3I5AA 5DBHX 2PNJA 3T15A 4GIBA 4I5DA 1BZYA 5H02A 1GGKA 2GBLA 4HH3C 4D56A 5JAQA 2IUEA 2YV2A 1KPGA 2O8CB 1EFRA 1N2ZA 5U4XA 3TEFA 2QMHA 5LP6C 5KINB 5D00A 1V7PC 3RSSA 4BQNA 5FI3A 2C7OA 2OGZA 4BBPA 3AI1A 3OM0A 2XPCA 5ED4A 4OXIA 4KRXA 4NH4A 3WJ1A 2H9IA 3TKAA 3VOAA 4RK0A 2ACWA 3FWZA 3PPIA 4COOA 1FL9A 3VZSA 1XTSA 2KVSA 3PZRA 3KLBA 2OMEA 4C6TA 1DAIA 4HN9A 1V8PA 1YQ9A 4G4SO 4EHNA 1VIMA 2XICA 4MQLA 3QU7A 5DLYA 1OH8A 2GSWA 1E18A 3G9ZA 1DKLA 3OQMA 1O4WA 1PGOA 2C88A 4X0EA 5AKXA 5KU1A 1JRPA 2WD7B 2JGRA 1SKWA 3VO1A 2EFGA 3T1QA 1V95A 1UMDA 1J1ZA 5F1PA 1SPBS 2I78A 3RVDA 4DJJA 3LU1A 2R7MA 3ABIA 4MOWA 5JS1A 5CW2A 3GJ5A 4GZLA 1SC6A 3A1VA 3S44A 3PKIA 4FYKA 1T1GA 1ZEMA 1FUIA 3KZCA 3ME5A 2C00A 4GKBA 4YRQA 5FA8A 3ZLUA 4BLRA 1QP0A 2GCOB 4J9PA 2MHCA 1KBOA 3K35A 2LM1A 4BO3A 2I67A 1AH2A 3RAQA 2BPCA 1TTHA 1RFLA 3EDRA 2W3RA 1E2KA 2EXXA 5KU7A 1IATA 3QIAA 3DXZA 3C15C 5C1DA 1W4LA 2QN1A 2N0SA 3L8DA 3OE7A 4H35A 5FTNA 1C2YA 2FOXA 3F7NA 3ZE6A 2HQSA 2H7VA 2VSXA 4B76A 3R7WB 2ZIXA 2P3SA 1GGMA 4BZWA 4TLAA 2FW6A 1P9LA 2KSOB 2ZTEA 2FW1A 3ZWOA 3NDJA 3LFUA 2BM8A 3DE2X 2A0YA 3K6KA 5H2FU 1US8A 3PD1A 4MV5A 2HMUA 3KBBA 5K3CA 4UM9B 2SBTA 3D3NA 2BCJQ 3EARA 1JHAA 1H2BA 3DAOA 4W7IA 2ST1A 4G89A 1U02A 2ZR9A 3D4NA 3R5FA 4IL6U 3D4LA 4G8DA 1GU7A 4EL0A 4RHTA 4IFIA 2LM4A 2R8PA 3OI7A 1MA0A 4EUEA 1SHZA 4X6YA 4ZRMA 5BV1A 3S1SA 1PVQA 3I6BA 3PEYA 1YCHA 2H4YA 2BKAA 2Z2ZA 3KUCA 1UDRA 2H5JA 1YR1A 3FF1A 5KVAA 1ECBA 1XP8A 3ND9A 4DSUA 1ZVVA 3ROXA 4IKPA 1EVKA 1YS2X 1L4FA 4WTOA 1ZK1A 3UAOA 3URMA 4ZZ0A 4J3NA 4OM7A 1J0BA 2QL7A 4ZOQI 1YR8A 4XM0A 3TPZA 1WXIA 2CVPA 5G4KB 3WFJA 3QPCA 4JI0B 2H9AA 1VL1A 3U3XA 4A03A 5A3QA 3QP9A 2VCEA 4AUMA 1JB9A 3GIKA 2CXRA 5T6BA 1QPZA 1TCCA 3R9XB 4HHEA 2I7CA 3L6RA 1LPBB 2IH4A 5EE0A 1AHNA 1I0IA 3GN2A 2XTNA 4GE0A 1VQ1A 4GOND 1H9BA 4GRIA 2CPRA 2ADMA 2DPIA 4DANA 1EFCA 1NE7A 3IEIA 1U8FO 4WLVA 1K6EA 3Q7EA 1SCIA 3R3SA 4MVJP 3L7NA 3HK2A 1Z08A 1ZVJA 2GSDA 4B3TB 1J09A 5FEUA 2Y8EA 4RVGA 3DWIA 1CS0A 1PFWA 4LBZA 2WHPA 4GM4A 2GHRA 4DRYA 2P2ZA 4KNYA 4RWZA 4AKSA 3ZN2A 1KZ4A 2HV8A 3NWEA 4LOJA 1J8FA 1WY7A 1UFQA 3KVNA 7ICJA 4WZAA 3LK9A 1SL0A 1EVEA 3CH5A 3ND5A 4QL3A 4R1MA 2PL1A 2PGDA 1JMYA 4DG8A 3RSFA 1BVUA 3VC8A 1D09A 2AMLA 3OLCX 2WA2A 4KQHA 1EG7A 1P4RA 1QKKA 2ERYA 2JIOA 3HNRA 2JCGA 3TQCA 5DTEA 3ZCXA 3QVXA 1JJAA 3ZOZA 1KOGA 4O63O 2HY7A 2X7JA 3N39C 4XGIA 4AK9A 4DYHA 1B15A 3ELUA 4L6IA 2J59A 3PA6A 4V3BA 3SKVA 4ARAA 3VR4H 2FR8A 2I8AA 3WJ2A 4E6PA 4DNOA 1ZY2A 3OPYI 3PICA 3BMOA 1LZKA 3G5TA 4JEUA 4F5DA 4GS5A 5JANA 3JVVA 4QEDA 4K4IA 1A5AB 2QZ4A 1FFVA 1RQXA 2GKSA 2O7RA 2ZUVA 2DKZA 3FMFA 4GECA 5KVQA 3R74A 2JZBA 2JVIA 3RKRA 3IRUA 4EARA 4F4CA 2KBFA 1MAVA 4YQFA 1Y82A 3OQBA 5IXJA 4D26A 3FSGA 3O38A 5BVGA 3MMZA 3P9IA 1BOOA 1CDOA 5EWGA 1TYCA 1ZM7A 4F92B 1M34A 3GLKA 3QHQA 4FKMA 2F59A 4YRIA 1WD5A 4BLQA 3LXRA 3CZRA 1U0NA 3KVYA 3GAZA 2DBQA 4B0PA 1QB7A 4IXTA 5LQMA 1WNTA 3A9WA 2FSGA 2VJNA 1NASA 4PZCA 1V8FA 1K8YB 3L7OA 4HDMB 2O2ZA 3K70D 1Z2EA 5CVUA 1NNEA 1C8BA 4Q9HA 2G5IB 1SXJC 3QA3E 3WLMA 4J9OA 1LBEA 4PO8A 4S1PA 3EA5A 2OE2A 2QV7A 4HD8A 2BR3A 1EI9A 3DW3X 1JE1A 3Q8PB 2W6OA 1Y4SA 2EAUA 2R6JA 4JWTA 3W4KA 4M1YA 1L8AA 1UM9B 3UV3A 4AF6A 4DR7B 2DLCX 3TLGB 2J48A 4F4YA 1GPBA 1OY1A 2IVFA 2GHQA 4G23A 3H4TA 1G8AA 1KY2A 4EEKA 1XDGA 1Q50A 4YP7A 3QKTA 4I1VA 4L9SA 4S12A 5GIOE 1Q3TA 1NJ2A 1KDRA 1ZL2A 5JZSA 2IEAA 2N42A 1CEZA 4TS4A 3WGYA 2K4EA 1EX7A 5D3MB 1KAGA 1W25A 4RJJA 4Y9SA 4ENUA 4AZ3A 4CKEA 1Z7YA 3WA7A 4XA5A 3BB3A 3FVRA 4R16A 1NI4A 3JR7A 3LIPA 4JUCA 2N1RA 3IURA 1ZZEA 4ZPJA 2VQEB 2QTNA 1BXGB 3JV7A 2PH1A 3RDPA 4LCJA 1L5UA 4QKQA 1Q19A 1W1UA 4UEJA 5K3FB 3SN6A 4CF7A 5EZQA 3G0DA 5C81A 3C14C 1CU1A 1N57A 1PK1A 3MR6A 1H2AS 2ZB3A 2NUTB 2JJQA 3FVWA 3N6RA 4ED0A 2C2YA 2QR3A 3ANSA 4Y18A 2FX2A 3N7PD 4P0PA 4UMEA 5G0VA 4EUHA 4LXHA 7ICQA 1K97A 4YJ3A 4GYKA 2KM1A 1KL7A 1KO4A 2ZJ7A 1SXGA 3KSDO 2JAOA 1XVUA 4F50A 4IIYA 2WAQC 4U2EA 3SJBA 1Y8RB 4EJSC 5A9SA 1DKNA 3SEFA 4FQ5A 4P2HA 4ND8A 1ZXIA 5F1YA 3REGA 5KT3A 2FKNA 4MQFA 2FPMA 1ZW1A 1D9ZA 2GLXA 3KSRA 1OV4A 3KSBC 3G7SA 2EDCA 3F3SA 1P5RA 2I1WA 5J2DA 2RB5A 4QNRA 3WRXC 2EW1A 3KSMA 1SWWA 3L1KA 4EFMA 4FHDA 1B43A 1RWKA 1XD9A 2YXPX 3RRZA 3Q7TA 3KB8A 3ZWNA 3QQPA 3TLZA 2E5LB 4PQFA 2W2XA 1DQZA 1WTCA 3IJRA 4BNHA 3H5TA 5A06A 3H75A 4DCPA 3O6VA 3PE4A 3URKA 4CL0A 3FM9A 3C5WP 4OGGA 1YO6A 3L1JA 1Z73A 1GUFA 3PXCX 2O8FA 4TMKA 3PGXA 3RKSA 2XIJA 2EKDA 2X2OA 1NVWQ 3GLHA 5K20A 4GW3A 6NULA 1P9NA 3LA8A 3LVRE 3D2QA 2OYSA 3EEIA 4KXYA 4M99A 4G01B 4XB1A 5A3SA 3QKUA 3AG6A 5FB3A 4KQIA 2OZKA 5HIAA 121PA 3MERA 3BIOA 3T0FA 1SUDA 3KPWA 5ELXA 4OK3A 3AU6A 2VHXA 3MTIA 1XCPA 3OE4A 4KE6A 4PC3A 1U31A 2H2GA 1UWLA 5KYVA 2NVBA 4M83A 1OWLA 3SBXA 4DA8A 1X7ZA 4EJSB 1B14A 2Y3IA 2YH2A 3HZRA 4I14A 1QGUB 1EHCA 2JB9A 3GHHA 3IMKA 1XHFA 1MDFA 4JUFA 1G21B 3HB5X 3Q88A 4OH1A 1BPYA 2AR7A 2O0LA 4X66B 2EKBA 3J7AC 3SICE 2XKBA 1PFKA 2DH5A 2HSEA 2PZMA 4RTRA 4OAPA 2C3UA 3PNBA 4OI2A 2NXNA 5BT9A 2PCJA 3WRYA 3N58A 3EYZA 2AJTA 3O21A 4K1LA 2FFHA 5CBKA 1HNWB 9ICGA 5CFZA 1UC9A 4FFBB 4ND7A 4H0NA 2OHHA 1XCJA 2UVRA 3U39A 1RYBA 2K8CB 2UVVA 5C2JB 5DB6A 2VRWA 4YQWA 3X1JA 1WMEA 1I3LA 4MMXB 4K87A 2C5FA 3B60A 5G5GA 4CT5A 2F55A 8ADHA 5FULA 4URYR 3QIVA 1MQAA 2WLSA 1KDTA 2EQAA 1JE0A 1EZ4A 1JEQA 1LJLA 1VYUA 2II6A 2PK3A 2ZIFA 2C3YA 1QO9A 4EFLA 4NLNA 2VAWA 4PZ0A 1S97A 3D8RA 2AF3C 5LZ4A 1HFEL 5E6UA 4PR0A 3BMNA 4HH0A 1TCBA 2D8CA 2PZBA 4HJXA 3Q7PA 4B0OA 3AEYA 4IXWA 1RXEA 1XNHA 3NTUA 1VECA 1I30A 1BXRB 4PC2A 4NG4A 1DKPA 1FZTA 1IDN1 4MUJA 4E08A 4EG8A 1MABA 1V11B 3HSKA 3JVUA 1AU9A 3MD9A 5FDFA 1HQKA 2J3HA 3HNOA 3NWJA 5KVSA 4J2OA 3WWCA 4IKEA 3N0XA 4BAZA 3V9PA 3VGPA 5EJ8A 4XPIB 1HR0B 3DLHA 2F64A 2R97A 3BIFA 5K8IA 4N3CA 4PFKA 2HUNA 4JY7A 4WNAA 3CM0A 1D04A 1NONA 4IOJA 1EGAA 1HOXA 1N0VC 3NETA 4V2IA 4QHSA 2QVYX 3GAFA 4TTVA 3T3DA 3WIUA 1G4HA 1T3LA 2VJMA 5J2HA 4F5PA 2ZK7A 4OO3A 3T7CA 2CGEA 1TQ4A 1ZFNA 1NMQA 2C0PA 2NUAB 4I55A 2N1BA 4RPZA 4AMGA 4OP1A 2NWQA 1O8BA 2O6LA 4Q4HB 3ZXSA 4AJ9A 2PJRA 2PL9A 4MICA 3ZZ1A 2QMEA 4XOIA 1G8HA 1QLHA 1WHTA 2BY4A 2WINI 1JHOA 1CS4C 4URFA 4RUAA 2O3SA 3ZWCA 1XQ6A 2QB0B 1TK2A 1DP4A 1KY3A 2NMVA 2H1RA 1YB5A 4P0TA 4ZQFA 1JROA 3FLEA 4M76B 2P11A 5JS8A 1VBFA 4HVLA 5C1BA 4HDRB 2NO1A 3PNKA 2DJ5A 3EDYA 2FG7C 2G7MC 5EEGA 2BFFA 1TJPB 4BP1A 1D2HA 2DECA 5ENVA 2YJ4A 3RUAA 4DEVA 2KHVA 2GBPA 1X3SA 4BDSA 1G9TA 2ESRA 4PAWA 1LD3A 2V5VA 4IHJA 5JCXA 4DV0B 5CVEA 1W44A 2AD5A 2VG8A 1ORVA 4WI1A 4JJIA 4YJGB 4ZQGA 3TPFA 2X0KA 1NN0A 1R6TA 2H2FA 4FHCA 4L22A 3FYUB 1RE0A 3UUEA 2ODAA 4GC5A 5A0TA 1UBHS 2Z08A 5KNBD 4FFOA 2O14A 4JDPA 4LRWA 1VBMA 3KXLA 3CMCO 3QVOA 4M1ZA 4OMFG 2HXGA 4DOCA 1QVRA 1WUJS 2E82A 2G6BA 1BPBA 2XUKA 3OZGA 4WSOA 5JPIA 3TL3A 1N2BA 3K6RA 3DOCA 2HBLA 4AZWA 4B6QA 2E4UA 2IPXA 3K5PA 4MX8A 4X8HA 3I8OA 5D7NA 3K53A 1PRYA 3BXXA 4TYPA 2GJ4A 3DMNA 2N3ZA 5HKLA 2W03A 3G8DA 4PPGA 2OD7A 1EFVA 4I2FA 1UJCA 3BHIA 1NVTA 1F0MA 1UJ6A 2GZ3A 3DC2A 2IIBA 3MFYA 1QHGA 1NYLA 4NL4H 4XFDA 5IBPA 4IWXA 4B71A 5C35A 5HSGA 1XNRB 4B3RB 2ENUA 1MPTA 2NAFA 4JBNA 3UK0A 4DL6A 1K7EB 2XGJA 1FLAA 5AJVB 3IPLA 3NM4A 3N8GA 1RP1A 2DL0A 5K0GA 3RYCA 4KE9A 4TUPA 2BF4A 2DQZA 1M74A 8ICYA 5DLEA 5DXAA 2W2KA 2CFCA 3WAGA 2J33A 4DLXA 2HVHA 1BG6A 3SI8A 3AHGA 5L1JA 1E6WA 3JWGA 4QGBA 2JFUA 3X43A 4UUMA 5REQA 3W4IA 3DDNA 2XW6A 1XAHA 3OIDA 3MYRA 2B37A 4ITVA 4R1NA 3WG9A 5FWNA 4HGRA 1QYXA 2CL6X 4R2LA 3L06A 4P4PA 3P52A 3KOWA 1DC6A 1YU6A 4EITA 4B9UA 1IJKA 2IL1A 3PQ5A 5A71A 3EVTA 3WQRA 3ZE1B 2W6IA 4Z6CA 4Q02A 1OTYA 1FW6A 1SKQA 5AI0A 3D6MA 4IDGA 3H5WA 4CETA 3BORA 1QG6A 4MEXA 4PZPA 3TG8A 1E77A 2X6TA 1GQOA 2UXBB 1JPUA 5DG9A 1AQJA 4CMGA 4EI2A 3VXKA 2P4UA 2R8YA 1ORDA 4H3VA 1UMCB 3GJRA 1KMHA 4IDQA 2MUTB 1A5ZA 4FFNA 1M2OA 2YWJA 1AQLA 1SZCA 4H15A 3VYRB 4A5SA 4ME6A 4DWJA 2QP9X 4IINA 5ECWA 1L6NA 2FWJA 3TOSA 4F91B 4O4LA 1GO2A 2OV3A 5C1OA 5KEIA 1C9DB 1TC2A 2QQFA 2DWQA 4QDZA 3ZYZA 3EJ6A 1S02A 5TQ2A 2JHPA 1FLVA 1D9FA 4Q1CA 3JARB 5J0UA 1DC3A 4F04A 3DDOA 3C39A 3DFIA 1GY8A 2WC1A 2NVOA 2X5XA 4M46A 3OG9A 4MCIA 3O4IA 5B3AA 3L41A 4X8OA 5TEVA 4Y6SA 4H1HA 1QJ4A 1MIOA 2KE5A 1COWD 3BH7A 1G42A 4LXXA 4UHDA 5IEBA 1QPBA 5SV2A 2IIQA 3P9SA 2P0YA 4GVLA 4XM2A 3F71A 4YJGA 1KVUA 3TLGA 4HNUA 1E2UA 4ZXFA 5A4KA 2TMGA 4NU5A 2PR2A 3QNWA 2O3UA 2QRGA 2WWGA 3QUCA 4LHYA 4Y2XA 4CIAA 4RU9A 3F9CA 1NG9A 3NRJA 1AF4A 1CJTC 1NQUA 4FSXA 3T4EA 2RI1A 4CNBA 4MEAA 3M2TA 4XWTA 3B7PA 2DP4E 2AZMA 3NVAA 5CB4A 4XOUA 3PUZA 3Q7RA 4O5CA 3MTJA 2GDZA 3IIMA 4FXPA 2PTGA 2XYRA 4MF2A 2WYIA 3NJ4A 4XRHA 3V7JA 2CV2A 3T94A 1XQ1A 2IXGA 4A8PA 2BFEB 1RXYA 1ULUA 4DLYA 1WCLA 2JASA 5LUAA 1CF9A 5BN3B 1WD7A 4TKMA 1EFDN 3NVZA 3PW4A 4PNHA 3BK2A 3SHQA 3VKUA 1JIKA 1KOJA 1P6QA 3DFZA 4XVCA 3F5QA 4C0BA 3IDAA 3M81A 4NS4A 4IXMA 4RQ2A 1ZA2A 4YMNA 3NIDB 1CVLA 3PRJA 5A05A 1GRQA 3TR0A 5B3KA 3AZQA 5ITSA 1KZ1A 2GCIA 3K9HA 3TRHA 4FB5A 1IUPA 1MRNA 2V9PA 3L0SA 2B1JA 5DNAA 1R15A 4KYVA 4ZZ1A 4OD0A 3LVWA 2EG9A 4WESA 2V59A 3K8YA 4DVGA 3HYSA 4ENPA 1YGYA 4JYMA 3W6NA 2AFHA 4MAFA 1T8YA 1J99A 2E1FA 1RZVA 2FWMX 4UTOA 4PFSA 4X00A 5GONB 4DSJA 2W70A 2R8EA 1UMKA 2JEIA 4FEEA 4MR8B 4RELA 4QATA 4DV1B 2F1KA 2HQRA 3EVCA 4H3SA 4KKXB 4N03A 5T4HA 3UK7A 5CCXA 2G5CA 3NONA 3QEOA 3QLEA 4FOTA 2COEA 4OVKA 1SHKA 2BELA 2D2EA 4A2CA 1SXPA 1NVVQ 4HMQA 1EU1A 3ENNA 4ZT7A 5AUNB 5JMOA 3N76A 4QZEA 1P0QA 2GR9A 2HIAA 2AD1A 1EE9A 2RGDA 4G0PA 4M22A 4C3OB 3P9XA 3CV3A 3TTVA 5L8VA 1D2AA 3EFEA 2RJ3A 2EATA 3N3AC 1WWKA 4KQKA 3VKGA 3PHBE 1R8YA 1WDMA 4K26A 9MHTA 3HRIA 4I8XA 5ICSA 4M0UA 4BTEA 4QOEA 3LCUA 3A4IA 4EJFA 3M6WA 3HMQA 4E51A 4JEHA 1Q0PA 1LF5A 1MTZA 2ERCA 3BEDA 4ID9A 5GM1A 5G4KA 2QPLA 3UHFA 3WGJA 1Z6TA 4LN1A 3R1IA 1KU6A 1XB2A 3DV0B 2CXUA 1T0PA 1RE1A 2CY0A 1QGED 2DPLA 2OCKA 3PHCA 5DBIA 1NUSA 4BUJA 1ULAA 3UM9A 4P3PA 3ZQ6A 2JA1A 1QFJA 3C8DA 1FC0A 4HQ0A 4JVMA 3D6FA 5EWJB 5AWFC 3Q85A 1N3LA 5A3RA 4KLQA 1ZK0A 3TG2A 4ZDKA 2IH2A 4WLOA 3A9RA 1A8QA 1WX1A 4D0RA 3NBQA 1F2UB 5C5DA 4YCAA 4BVEA 2C7QA 1EWVA 4AJLA 3MQ2A 5SYMA 4Q4LA 1GA1A 1NJ8A 2L69A 1LY1A 3FNEA 4EB6A 5KYYA 4EHKA 5BQPA 4DIUA 2W9CB 2EBFX 1NNUA 4MHOA 3ENVA 1L5HB 2FMFA 1ZH6A 1UMBB 1N9GA 2ZXEA 5JTIA 4BS9A 5KFIA 3G23A 1HE8B 1Q0LA 4UHJA 1XLVA 2WVJA 3ORHA 2WT9A 1P81A 4TYWA 4B7AA 1JR2A 2ZJFA 1JFVA 1DINA 5KT4A 3R7WA 1JJ7A 4IDCA 5FBRB 2H6EA 1N77A 1ZQUA 5IH7A 4I50A 4E2XA 4MVYA 1ZNXA 5D8DA 1RW4A 1RYYA 1WAMA 3SYRA 4FZ3A 2XAUA 1A1SA 1M72A 3RGGA 2RI6A 2NW6A 2V3WA 5J5CA 5KAIU 2KEYA 4JT4A 4OQYA 4EI9A 4IGEA 2SKCA 4S2UA 4V2UA 1ZXBA 2HSWA 1MQ9A 1NXQA 3FKSD 1YE5A 4PF1A 1Q0HA 5EMJA 2A9FA 2PRJA 3UJPA 1JECA 4BCCA 1GHTA 2B83A 2DBRA 2E1RA 1SIUA 3G5LA 1B00A 3N2ZB 1S96A 1UMDB 2HJHA 2NP6A 1GARA 3OIFA 4A8EA 3HSYA 3CTMA 3E4DA 4QOFA 4HY3A 4MEYA 1CJBA 5CM2Z 5HQJA 3TRDA 1BKDR 3T06B 4ZYUA 2B5VA 2NRTA 3NASA 3LWLA 5DI9A 4ZVSA 3X1DA 1ICIA 2C97A 3KOUA 4KFUA 3V5NA 1L7DA 1UKVY 2FEPA 1EFTA 2ORIA 2YIJA 4OBBA 4L51A 4RZIA 5EMNA 1N78A 4I2IA 4ENRA 5F5LA 2HK6A 1U0OC 3QOXA 5CYOA 4LK2A 3H8JA 1K0FA 4UVIA 2QORA 3ASVA 4QWWA 2ZR7A 3V2HA 2YR0A 5CTAA 2XCLA 3AYXB 2OVBA 4DOAA 1JYFA 3IB6A 1LB1B 3ET4A 2GN6A 3JQ8B 3NVMB 3I2GA 1QM5A 2H85A 4QC2A 1WCIB 4UD2A 4YROA 3KB2A 3UFBA 1WCV1 2Q0SA 3EGXB 1MEOA 2CZCA 3NT2A 1SKSA 3FCSB 4M38A 5J47A 1DJMA 3UVEA 2FWBA 2JI8A 2QGNA 4D25A 4F3KA 1L1RA 1VCNA 9ICPA 2ZAMA 5I7AA 5HA5A 2Q9UA 3D5EA 4B35A 4E4YA 1GR1A 3PX0A 2IW3A 4EYHB 3DOFA 3VR4A 2ES6A 2XVYA 4CTNA 1AS2A 3HEAA 2NYVA 3WKBA 4LI3X 4MQMA 4BNIA 5CDYA 2FWAA 3NALA 1YJBA 3RS5A 3RVJA 5KPDA 3WE7A 3NHBA 1AD2A 5AH0A 4YPOA 2PMKA 1KP2A 1DDIA 4NCBA 2B21A 4IRCA 1XN4A 3F78A 3WNVA 2DY1A 2X2FA 2GJSA 3DTNA 1TDJA 4LS3A 4YVFA 6ABPA 3IP9A 2YVUA 4HWSA 2OHXA 3MGHA 3QXCA 4EYOA 2R1UA 1CULC 2OYCA 4AN0A 3KYIB 2R2AA 1OWNA 5KG4A 1NF8A 3R6DA 4PX2A 2IV3A 4DLVA 3MBYA 1P1KA 3OVMA 1WIWA 3ISVA 1PJ8A 3S1LA 1U90A 4LV5B 4U1RA 4C0QC 3K0KA 4ZK2A 1CHNA 2RGNA 4MYSA 2EHJA 4UZFA 1E1RA 5EAIA 2LRHA 3MWJA 1OC2A 4YAIA 1FF9A 1QO0D 1SVOA 3FPBA 2GM5A 1QE5A 3L0ZA 1HL7A 3P5SA 4IGAA 7ICEA 3MBKA 4IRXA 3QG1A 4MUFA 2UVDA 1AZSC 1YUBA 4JYZA 1GCUA 1Z7WA 3RUIA 2UZ1A 1N33B 3BWVA 4BJ6A 4BX9A 3LL7A 4E0BA 2K89A 1O6GA 2HOFA 4BWMA 1XSEA 3IBCA 3TEJA 3N8IA 4CHTA 1JDUA 1ESDA 2Q7DA 4YP3A 1ZIYA 2QYTA 1K7CA 1N4AA 2BBSA 3KJFA 4GT1A 4KH1A 3AEKA 3RLIA 4MWTA 1T9AA 4OXRA 5AVZA 1RJ9B 1K86A 1NJ5A 1AT1A 3MLAA 2PYDA 4IR9A 1J2EA 1SGWA 2GN8A 4L7VA 3ES9A 2XT9A 4MMYB 8GPBA 1UA0A 1GGFA 1L5RA 4BDPA 1YAJA 3BMOB 3HCAA 3NBUA 2PUFA 5H70A 3EWNA 1LPNA 4WECA 4ZI7B 4NZOA 2JA2A 5B1EA 4HQLA 4NXZA 2JG3A 4KMMA 2CCGA 4LXUA 4UAUA 2G6TA 2W2KB 2EGGA 2YFQA 3NPAA 4MVJG 4YASA 2XOXA 2KICA 3SIWA 5HG0A 3F9RA 3TMYA 3VR5D 3FB1A 2FSFA 4DARA 4DLBA 2XJ9A 1PBNA 5A3JA 5J4LA 4IQ0A 3H4BA 1OIWA 5CTJA 4PZOA 4MUXA 5EMMA 3OSUA 1NSFA 3ZV3A 1WXFA 2RBGA 3T7SA 1BWQA 3TSAA 3GDHA 2XGMA 4EH1A 3RRGA 3MMSA 3TJZA 3FYTA 5A7GA 4AMBA 5CU7A 2J41A 4GOJA 2WKQA 4CQLB 2HJSA 1LBTA 1RRMA 2HWXA 1DRWA 1FVFA 4F0JA 5BR1A 1WTAA 1EHYA 3M1IA 2RGAA 4M36A 2PN1A 2WY2D 5LQDA 3R9WA 1SV0C 3I2IA 1TK8A 3JRWA 2ZI3A 3VKFA 1NRJB 1YB4A 3CNNA 5CT4A 4PX5A 5DYGA 4AWBA 2HMTA 4RPIA 3N74A 5A2GA 4LY0A 3DDSA 3HNPA 4LSWA 3UXPA 2V4MA 3E22A 6Q21A 1MOZA 4X1KA 4ZC1A 3W7AA 5CB4F 2SKDA 3P0EA 1X9XA 2HDNB 5EKTA 4JP3A 2RFLA 1K1QA 1AUPA 7ICLA 1E5VA 1GPLA 1E1CA 1JEEA 3EZ2A 4PONA 4PLVA 5DHRA 2ONYA 1PTJC 4M9CA 4ZZ2A 3S28A 5B12A 4HDNA 1F0KA 3BD6A 5D5QA 2NUPB 1UEIA 3LLUA 4ECXA 4GMGA 4JODA 4Y8VA 5LUBA 3EPKA 2PPVA 3VVBA 1FS5A 2UZ4A 4O6VA 1VP9A 4I4NA 5AMXA 4JUZA 4QJFB 3THYA 1GEGA 1FMJA 3ILSA 1LPPA 1WSBA 2HBZA 1CUYA 5ICFA 1O57A 2AOXA 4K1XA 4CIVA 4DJAA 1WP4A 4I50B 3OFSA 4MW2A 4TWBA 1NW3A 2EBUA 3A1NA 4TQAA 3MIZA 5EINA 3TNLA 1X1CA 3G2NA 4U7CA 5AKGA 3K0BA 1KO5A 3PCTA 3NWOA 4PRZA 2BGLA 4MWSA 2BGIA 3D6TB 1KS9A 1FSZA 1CUKA 2AHOA 3DO5A 3MTEA 4CGZA 5BQOA 5LA6F 4AYBF 1QGAA 2R8ZA 3HBMA 3RJZA 3VU0A 5LOVB 3ZV5A 1SGGA 2FSHA 1XTPA 3ZGLA 5CLJA 2EHDA 4V38A 1JKMA 3LLSA 2BEWB 1W5TA 3S2GA 2IA5A 4HB3A 1FUKA 5E3JA 3K0CA 4WACA 3W1WA 1F2UA 3L92A 5J4YA 3GUVA 1EXDA 2QAIA 2R1ZA 2E9SA 1JHYA 5AKYA 4XDGA 1T9BA 2O8BA 4OOFA 2LUOA 4UTNA 5INTA 2AMJA 3WWEA 2AS0A 4MHSA 3RK0A 3BX1A 3E9ZA 4C07A 4MS3A 5KOJA 1MH1A 3AUSA 1XA3A 1S5LU 4S24A 9LDTA 1W7AA 2IP2A 3ZY4A 5JBIA 5AJXA 3S2ZA 4WCFB 2FDRA 1ZJMA 1NBIA 3JQ6A 4BVJA 4GBMA 5JASA 3RRFA 4A3SA 1N5KA 4RD0A 4PSCA 4R7GA 3R7AA 1O87A 3UMFA 3SK0A 3C3CA 3OU7A 2VT7A 4JUDX 1H0SA 4EPVA 4YT5A 2F48A 4WJKB 3LQFA 3F2VA 3OZSA 2Q0XA 5DM1A 2PX6A 2JBAA 2F4VB 1XTJA 2XBMA 5ALLA 2BJWA 1M5UA 5IIIA 3Q2IA 4LTDA 2BIFA 2V7GA 1DOAA 2BKXA 1IONA 1DKUA 3PYXA 4NOKA 4OHFA 3DA8A 4Q9LA 3OSPA 1JHZA 2PEYA 1VZ2A 2W2NA 2WI8A 2AQ0A 2ORVA 2X76A 4GYJA 1HDEA 2WRZA 2GKOA 1ZSYA 4R1TA 3IOCA 2GCNA 4XVRA 3MTGA 5ARDA 1U65A 3DKPA 2RHGB 1G64A 3BN3A 5J58A 4OSPA 5DI3B 4GXIA 1T5LA 1SG9A 4IF6A 4ITRC 3GVCA 4IEIA 5TMPA 5KYXA 5CB6A 2H31A 1J33A 1AC5A 2FVXA 2QMZA 2QF7A 5DIZA 3IPCA 1ZP6A 5EZYB 4EVSA 5K03A 3QKRB 4B6JA 3T4XA 4LDJA 1OB2A 4NMWA 4PHTA 1LX7A 2I7DA 3IP1A 2H08A 4AXBA 1VIVA 2X8LA 1UXHA 5BSTA 1SB3C 4LWPA 1DRVA 4IRUB 1SCKA 2VJ5A 5EMHA 4ZN6A 1JFLA 1USIA 3G6YA 3VX3A 3X1YA 1B2RA 4DEYA 3TNJA 5TISU 1FPQA 5JBQA 4D0NA 1X7ZB 4EJSA 4FS1A 3AF0A 1DI0A 1HDYA 3L5KA 1GTMA 1NUUA 3E1KA 3AHJA 4OQQA 4R2WA 3B2QA 1T5HX 4TTAA 1GQ2A 5IWAB 3KLMX 1E69A 2NV3A 4ECQA 1PJZA 2GERA 4HEA6 1WU7A 2B0CA 4KVZA 2FQQA 2CHVA 1PR4A 3V1TC 4EGQA 2HTFA 1HZZA 5BPHA 3VU1A 4DV3B 3DOUA 4JWKA 2ADFA 4EA8A 1FEZA 1ZN8A 5AKKA 2PL5A 3RU3A 1HDZA 4EBBA 5DYYA 2B20A 3VAZA 3DZCA 1D1SA 1OUQA 3ANXA 1TTTA 5EWLB 4BE7B 2E87A 3U3OA 3WNCA 1WABA 3GNQA 1ML4A 1YE3A 2OCPA 5CBPA 1OI2A 3EXEA 1SXIA 2FAXA 4M1MA 3LF2A 1YDWA 1VHTA 7ICSA 1WSDA 2FDXA 1BA2A 1J4AA 3ETNA 3W8DA 1A97A 1UOQA 3WISA 2V5UA 4URZR 4KLFA 3CZAA 3PB3A 3JWEA 4FONA 4MQEA 4Y2HA 4D2IA 1KMNA 1WW8A 2OQIA 2VK4A 1IH8A 5IASA 1EH5A 1ZM3A 3BL6A 4YWJA 1T8UA 4YMGA 1I4TD 4EGFA 821PA 5AM3A 3NTOA 1IEQA 2IP1A 2Q1TA 5ALWA 3KDAA 4MROA 4NYMQ 5CP8A 2IDZA 3IO5A 1QG4A 3L8MA 1RRGA 2ALJA 2QX6A 4WXMA 4FYPA 4TYQA 5B58C 1AA9A 2QD4A 4PW0A 3WGUA 2AU0A 4U7TB 4BQSA 5LDHA 1FOEB 1OLUB 3DCNA 3ISJA 2FWIA 4UVHA 2BD0A 4RTLA 4UBJA 1XMXA 3BILA 2HF7A 1EZZA 1LDBA 1B1CA 1QX3A 7ICTA 1FRVA 2A9QA 4NX2A 3U9SA 2ZBDA 3ZTYA 1EK1A 3QITA 4WY2A 4AY3A 4F4HA 4LF8B 2J0UB 3LHFA 4ZCQA 1AKMA 1ZOPA 3GU3A 2BRUA 4IJKA 4PYIA 3RTCA 4BQIA 2Y0DA 8LDHA 5H83A 3GP3A 2ASJA 1OA0A 4KR3A 3U4QB 1WUHS 5B4UA 1FYXA 1FDUA 3OPVA 2M6LA 1KKLA 2QD2A 2HYDA 1L5LA 3RAGA 3TQTA 4B4OA 4BUCA 2SKEA 4ZV4A 4F71A 2PI5A 1DWQA 3D31A 1EGQA 4N8SA 3KQUA 2VJBA 1V7ZA 4FNGA 1UT5A 2JGDB 1SL1A 2O6KA 1FNDA 1MJNA 2OP1A 2QTFA 3NBYC 4J0FA 3C85A 4US1R 1EEHA 2GUGA 2MSDB 1XTTA 1M1UA 3KOZA 4FDTA 2O5RA 3FYUA 2I8LA 1JHUA 1A77A 5REQB 3I42A 3QKRA 4L76A 1F12A 1JYEA 3P4UA 3K71B 3FI9A 5C53B 3SWWA 1EIWA 1PJ4A 2YV5A 3T3GA 1T4CA 2E6KA 3IX7A 4M53A 1L9KA 3JRNA 4HCJA 1Z5ZA 2G4LA 1A7AA 2QD3A 5ADVA 3JQAB 1U8ZA 5KAMA 2R87A 1NJ6A 4BIIA 2V7TA 2QJRA 2HAEA 4BVAA 1SIOA 1M83A 2IU3A 2RAPA 3F6RA 2C4NA 3ZWPA 1Z39A 4DC1A 5C5IA 2QRKA 1ZX1A 4JVSB 1CUAA 4MSUA 3PT5A 1GCOA 4ZAZA 4EIWA 4EHIA 4EOGA 4O3FA 5ALGA 4UCQA 3OPMA 2Q0HA 3SJZA 4HYEA 4J0CA 1J2JA 2I5PO 3PCXA 5JQGB 4TRRA 4N40A 2BI4A 3GJXC 4IIVA 3PPYA 2HL6A 2O5VA 4L0QA 1XD2B 3UUGA 2HYIC 1QAOA 1X7WB 1YZ3A 2P6OA 4RIGA 2CZGA 4U6SA 3TLJA 4R31A 3H5VA 4Q9AA 1X9SA 3IV7A 7YASA 4UATA 3GLGA 1MT0A 2DPMA 3AVUA 4X3OA 5F51A 3I53A 1BTOA 2Y9PB 4EKNB 2R86A 5EJFA 5K8LA 3U16A 1AGNA 2VPTA 2HPVA 1NHWA 2HPAA 1U5BA 5EKSA 8ICOA 1ESEA 1GPWB 3V7FA 4YJ2F 2D54A 4KLAA 5JD6A 2LDBA 3RVSA 4ZAVA 3WP1B 3NTLA 1Z38A 2JATA 3U4AA 1P1BA 3C6BA 4GEKA 3UT6A 4MVJE 3PDWA 1PE0A 5JU6A 4M0AA 1SA0B 3BGVA 4HLUA 1LJ8A 1Q1AA 1XL0A 1R64A 2I62A 4Q1DA 2VFAA 4ND6A 3C5GA 1P3JA 4RNMA 4M9HA 2FW7A 1JXLA 2INGX 4W5JA 5G0WA 4G41A 3A6PC 2J6TA 3U3MA 1QZZA 4OI4A 5AVUA 4C7YA 2D3DA 8ICXA 1LLQA 3NDIA 2JHFA 4P86A 4PPNA 4TKVB 4RSHA 4TYNA 3HKCB 1JEYA 1IQ0A 3WS7A 4I1OA 4F2PA 2JI6A 3NYWA 4LJ6A 1U81A 9ICLA 3A06A 5F3RA 2G7ZA 3GVHA 1IY8A 3GBVA 1VRCA 1LJUA 2HJ9A 4CMCA 1J2UA 5IM5A 2A1JB 1BRMA 4J2HA 5E4TA 1WYGA 2CXOA 4NM2A 1D3AA 4J94A 4RACA 4B3XA 1ACJA 5EQDA 4ILKA 4MR8A 2PQ6A 4WD3A 3JQDA 2YJNA 3EQ7A 2R25B 3TX2A 5SZJA 2YHIA 3DPIA 3U7RA 2JZOA 1GXSB 1XRRA 1U7UA 2QSYA 3RS9A 1RPAA 4N5MA 4B40A 1IIRA 1TADA 1U2DA 4OQMA 5HR7A 3H13A 4MUKA 4NP6A 2WU3A 3WYNA 2H2AA 4B9EA 2BFDA 2P6RA 9ICIA 4WBNA 3ZE2B 1W4BA 3GJZA 3OZ7A 4K6OA 1HIWA 1VI5A 4LYFA 3KV3O 1XO0A 2K8AA 4Q8EA 4B6RA 1MQ3A 2POQX 4JOBA 2UVQA 4TZ6A 1H38A 1EX6A 4P33A 5ALEA 2PFQA 3EVFA 3SC4A 1C7YA 2QP3A 4MB0A 4OP2A 1FSFA 4YRLA 2DM6A 4CLRB 5K4HA 4QJBA 1IU9A 1YF3A 2QNIA 4MGHA 3LDFA 4FBLA 2H1OA 1UPAA 1HLGA 2GVZC 3HACA 5L6MB 2HMVA 4XWWA 3EQZA 2ZSBA 3ELBA 3M7DA 1TTQB 1J24A 1UCVA 3HE3A 3IHTA 3AWIA 1ZI9A 3JQ9A 5EERA 2HIGA 5IDYA 3PK0A 1YRBA 3BHJA 1PGQA 5AXBA 3D5TA 5DHAA 2NT3A 4JS0A 3ZDQA 3TE6A 4EMSA 3C2QA 1R1DA 5AOAA 2HSZA 2QG6A 4OHPA 1CY0A 3OX2A 3AVXA 3QLUA 4OI1A 4Q48A 3EVDA 4M0DA 4EO9A 4C7OB 4HAUA 5T7BA 2X15A 4DTCA 5JO9A 2CLEB 1C4WA 2X23A 2E3JA 3KYJB 5HHHA 1DXYA 5GAJA 4MW6A 1AS0A 4YV0A 4CQNA 3UMGA 1TIPA 2LYAA 1UOPA 2H3VA 2XOKD 3U7EB 3BMCA 5B4VA 3EEBA 2BZ0A 1R88A 5CR9A 3DH0A 5BSGA 3I72A 4CM7A 3GOHA 4Y2YA 1YXMA 5L4SA 3TZHA 5KFSA 1G38A 4HQ6A 5KG0A 3HVHA 2H2WA 3C8HA 4K05A 5L3SA 2IS1A 2Q2WA 1JTFA 4XIYA 5G1NA 2E89A 2HPZA 2Z04A 1ECJA 2WVAA 5AI5A 3T1TA 2C82A 2Z2YA 2ONJA 3DMPA 1OPRA 4P1ZA 5CDGA 2XQVA 4DWIA 3S2SA 5BWCA 4S2EA 4HWPA 1R7RA 4NBUA 4Q05A 5I7OA 4YAWA 1NM5C 4FC6A 1IQRA 5AIBA 1D4FA 3Q2KA 4IJUA 2PLFA 4EG7A 5K45A 4CMJA 1NT2A 1EFPA 1EZ1A 5G3ZA 3USZA 1KTVA 1Z47A 2O2JA 5KCMA 1NC1A 3VR5H 4J0EA 1E60A 2HDWA 3EIWA 4PNEA 5BN4A 1XT6A 3A4NA 3MWEA 1SUSA 3Q3EA 4BO6A 4ZVTA 4YRBA 4YPFA 4DNPA 4FNAA 3NVVA 4IZOA 1AA6A 2VJDA 1CFZA 3F7MA 2Z83A 3VR2D 3PEFA 3JQ9C 1W52X 2OCGA 4G37A 4URHA 4A10A 4DKXA 4FDLA 2C0QA