3SD7A

1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
KKNYEIVLFDLDGTLTDPKEGITKSIQYSLNSFGIKEDLENLDQFIGPPLHDTFKEYYKFEDKKAKEAVEKYREYFADKGIFENKIYENMKEILEMLYKNGKILLVATSKPTVFAETILRYFDIDRYFKYIAGSNLDGTRVNKNEVIQYVLDLCNVKDKDKVIMVGDRKYDIIGAKKIGIDSIGVLYGYGSFEEISESEPTYIVENVESIKDILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
molecule keywords Putative phosphatase
total genus 82
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3sd7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sd7A01
1WR8A 5AW1A 1CQZA 3KC2A 2RARA 1NF2A 2NO4A 3WKBA 3WGUA 1T5TA 5AKYA 2OYCA 1F5SA 2NYVA 2HHLA 2YJ4A 3I28A 2C4NA 3SMVA 1RKVA 5ALFA 2O2XA 5ALWA 5AVWA 3N1UA 2FEAA 1Z4LA 2B0CA 3R09A 4NFLA 4JDPA 4KN8A 3AR9A 1LVHA 4DCCA 4YCLA 2OBBA 2VKQA 1YS9A 3AR7A 3NALA 4NABA 5AVUA 5AW7A 3L0YA 2P27A 2I7DA 1WZCA 4HGOA 5AW0A 2P9JA 3QU7A 2HDOA 3R4CA 5AK6A 5AK3A 3BWVA 2B8EA 4YCNA 4Y2SA 1LTQA 3ET4A 5ALEA 2ZBFA 5ALSA 2MSNA 3WK8A 1WPGA 4Y3UA 2YMPA 4UM7A 1N9KA 2PKEA 3R9KA 5E0OA 5AKLA 3A1CA 3NAMA 5IT0A 3L1UA 5AW2A 2YMLA 2CN1A 1U2SA 1U7OA 2YY6A 1NNLA 4UW9A 3PDWA 5AIAA 3PGVA 5AVQA 3EF1A 3M1YA 2IOHA 1VJ5A 5ALZA 3TLMA 1IWOA 1L7MA 3DDHA 4BYGA 3W5BA 1O03A 1CR6A 5AVZA 1RRCA 3W5AA 3FGOA 2CFSA 3ZX4A 1RQNA 2B30A 3FM9A 5ALUA 2IA5A 1NRWA 3UMGA 3I1YA 1Z4QA 2C9MA 3U13A 2ZXEA 5AVTA 4OD0A 5AI5A 1ZRNA 5ALMA 1RC8A 4BNDB 3QU9A 3N07A 4C4SA 5AHXA 4Y2UA 3ZWKA 3NANA 5AM5A 1U02A 2RB5A 3EWIA 5AIBA 3FZQA 5AK5A 4G63A 3PCTA 3QXGA 3DNPA 1RLMA 1N8NA 5A3SA 3L7YA 3ESRA 2FPUA 3L8EA 5AESA 3WK5A 4C4RA 1Q92A 1QQ6A 4PNHA 4IG4A 5ALYA 1SWVA 2I34A 3M9LA 4UMFA 3FVVA 4EX6A 2C8LA 3L0CA 1ZD2P 4GXTA 2X4DA 2W43A 4CNQA 1T9ZA 4J03A 2RAVA 1ZS9A 4EZEA 4KX3A 3ZWDA 3E8MA 2I6XA 4Y2QA 5A3QA 1JUDA 3WKAA 2YJ5A 3A3YA 3WGVA 4YIHA 5ALTA 4MWOA 4HAIA 3MMZA 2G07A 3CZ4A 3N28A 1YMQA 3WKCA 2ZG6A 2HF2A 5A3RA 1SWWA 5ALPA 1RDFA 4JB3A 3MPOA 4BEVA 1YV9A 5AKGA 3OCWA 3WKDA 3QUCA 5ALGA 4UAVA 3KOOA 3ED5A 4UARA 2OM6A 2W4MA 4HGQA 2JGAA 4BX2A 3I6BA 1J8DA 1WVIA 5AVXA 2WM8A 3E84A 5ALDA 4OHFA 2JAUA 3QUQA 5AM2A 3ZU6A 3OPXA 2P69A 3VAYA 1L6RA 2YFYA 2I33A 3EPRA 2GHQA 3UM9A 5FP0A 3NUQA 1ZD3A 5AICA 3ET5A 3OCXA 3OCYA 2WF6A 2GO7A 4UU1A 1Z4OA 3HYCA 3U19A 5AW4A 2ZBDA 1K1EA 4Y2TA 2FDRA 3SHQA 5AI8A 2IYEA 4DFDA 3BA6A 2G0AA 2FPSA 3OCZA 3QU5A 4YH1A 4CF5A 4QJBA 3U7HB 4KNVA 2IOFA 1SU4A 4BEWA 5ALIA 2WHEA 2HCFA 3L8HA 5AI9A 5AKZA 1X42A 2O9JA 3ZTYA 3KZXA 2ODAA 5AKIA 1Z5UA 3KBBA 1XPJA 2C88A 2GFHA 2GHTA 5AKEA 2WF7A 2IOFK 2CFTA 3SKYA 2Q4RA 4EEKA 3ZVLA 3I76A 4XOUA 1RKQA 3K1ZA 3OCUA 4IFTA 4L6CA 3D6JA 1Z4NA 2HX1A 3ESQA 5AM4A 4XPZA 4AS2A 5AM1A 1L8OA 3L5KA 5ALRA 2YBDA 4E88A 3U7EB 4ZEXA 2MU2A 2QYHA 3MN1A 1PW5A 3IJ5A 4OFZA 3SKXA 4Y2JA 2R8EA 4CE6A 4CF4A 3L0BA 2D2VA 5AVRA 3ZUPA 5ALNA 1ZD5A 2G08A 4DW8A 4YIKA 3RF6A 3L1VA 4CF3A 2HEGA 2MU1A 5AW8A 1RKUA 5T41A 2B82A 3QNMA 1RMYA 1L7OA 2R8ZA 3F9RA 4Y2VA 2FPRA 3J7TA 4UASA 2AH5A 1TA0A 3AR4A 4HYTA 3B8EA 4ZEVA 1U7PA 3ZI4A 3SLRA 4C4TA 4UAUA 2GMWA 2HF7A 3OCVA 4BX0A 1RMTA 3W5DA 1RLTA 4FFDA 4YCMA 3SD7A 3UMCA 3B9BA 3E58A 2WFAA 1EK2A 4YGYA 2JARA 3ZW7A 4NV0A 1Z4MA 3OTQA 1VFPA 5ALVA 1FEZA 5AKJA 2I55A 1EK1A 2WF9A 4Y2XA 2BDUA 2HI0A 1QYIA 3ZX5A 4BNDA 2AUTA 2G1AA 1O08A 4HGRA 2C8KA 1RPZA 1L8LA 3WKEA 1Z4IA 1ZRMA 3CNHA 3RFUA 3N5KA 2G06A 2YN4A 5IS2A 5AI6A 4BBJA 2B8JA 2Q5EA 3A1DA 1Q91A 3IRUA 2WF5A 3QU4A 3QX7A 4O8CA 3MC1A 3WK4A 5ALHA 3PGLA 4UM5A 2AGVA 2YJ6A 1ZOLA 2P11A 2FPXA 1QQ7A 2I54A 3W5CA 1S8OA 2R8XA 5AW5A 3AR6A 4FYPA 4I9FA 2BDEA 3NIWA 3ONNA 2HOQA 2EAUA 3DV9A 3L8GA 5ALKA 2R8YA 4F72A 3QLEA 3QUTA 1L7PA 3WK9A 4FE3A 1YJ5A 5JJBA 5AI4A 2RBKA 4BX3A 1QQ5A 2BY4A 3WK7A 2EARA 2FI1A 5IT4A 4ZEWA 2G09A 5ALJA 2WF8A 3AR3A 1ZD4A 3QU2A 2QLTA 2DQSA 4EENA 3AR8A 3IB6A 3P96A 1ZJJA 4QQFA 5ALOA 4UMEA 4EX7A 1TE2A 3SF0A 5AW3A 5AVYA 4BKMA 1RMQA 4L57A 3UMBA 3FPSA 3ZTWA 2YMQA 3L8FA 5AKXA 4OCZA 3GYGA 1QH9A 1RQLA 5ALLA 4B6JA 2ZBEA 2HSZA 1KYTA 3QGMA 1Z4PX 1Z4KA 2YMMA 2HO4A 5AVSA 2YJ3A 3WK6A 5ALXA 4G9BA 3QUBA 4L6AA 4XE5A 5AVVA 4I9GA 2FPWA 4GIBA 5AW6A 3QYPA 1J97A 3FPBA 1Y8AA 1VJRA 5AKHA 4AS3A 4UU0A 1S2OA 3ZVNA 2FUEA 1U2TA 1T5SA 3E81A 3B9RA 4Y2RA 4HGPA 1L7NA 4KX5A 3A1EA 3U26A 2B1QA 1TJ5A 2PR7A 1Z5GA 3KD3A 2B1RA 2AMYA 2ZOSA 2FUCA 4KNWA 4MUMA 3U7FB 4AP9A 4J2TA 3KDPA 5AI0A 4UMVA 4F71A 1MH9A 3ZVMA 3AR2A 3N8GA 4DWOA 2Q4TA 2PQ0A 2ZBGA 3NRJA 3HLTA 2G80A 1YNSA 3NASA 4Y2PA 1XP5A 4RETA 5AW9A 5AM0A 4Y2YA 3U7GA 4UATA 4XQ0A 3S6JA 2JAOA 1Z88A 1AQ6A 2W11A 2CFRA 1RLOA 4NAVA 2NO5A 5AKKA 4RESA 1YDFA 5AM3A 3EF0A 1XVIA 4H1WA 1TJ4A 1Z4JA 2EATA 4KYTA 5AK4A 4EELA 1TJ3A 4NWIA 3DAOA 2OA0A 4UMDA 5ALQA 2JAWA 4HGNA 3AR5A
chains in the Genus database with same CATH superfamily
4L2IB 5K0CA 4QW8A 1SQ6A 4J0EA 2W8LA 7ICQA 2WG0A 3KJXA 1N0IA 4XJSA 3KZMA 3NPAA 5EXEA 3U7IA 1YDWA 2CDRA 1P74A 1JG4A 4BUGA 3WIVA 2HWWA 1A7JA 4N40A 1VE9A 1G8HA 3U0VA 4RHEA 4HF7A 1MIHA 1WKCA 5LQAA 3WLOA 2YJ4A 1ONNA 1N78A 2ZSBA 3VR6H 4KIGA 4R1TA 1QGDA 4Z3KA 1GZ3A 1PFYA 4NYMQ 3SAFA 2O2XA 3GELA 1V8ZA 2JVKA 2P1DA 3QXCA 2XYQA 3X44A 2H3EA 3GVIA 4QRIA 3M6UA 2Y93A 2C7OA 3PMNA 4ZAVA 3F53A 4I5GA 2GK6A 3QWBA 3FDZA 1EVJA 3HBAA 4LC0A 2IIBA 3ICCA 5EUBA 1PUJA 5EE9A 3FMPB 1JU9A 3IEKA 1F8GA 3NLLA 4ZCQA 3VPAA 3WHIA 4A92A 5KAFU 2NYAA 1DTEA 3L4JA 3EGEA 2J6BA 2CKMA 2V4RA 1PIWA 3HCOA 2K2QB 4R41A 2HVHA 2HOFA 1OYYA 1L4MA 2YBEA 2ZTLA 2O2CA 4JJ8A 1W1WA 1XK7A 5EA2A 1SCKA 1P2UA 2CWWA 2I6QA 8ICRA 4I4TF 3TRKA 4ZZ3A 2XB2A 3BMCB 1RHJA 3BULA 1X9MA 2B4YA 3HV2A 4RD0A 2CNOA 1X0XA 3E7WA 3TWOA 3DLTA 1LLDA 4LDRA 4XVHA 4PXSA 2EJCA 4UOEA 2NT4A 5FI1B 5K3CA 3EWAA 5H3LA 2V4ZA 4WOBA 4EUNA 2Z04A 3AVYA 4LGMA 1MAVA 4Y1FA 4XLZA 4XSHA 2W6IA 3OLVA 3VR2D 4BKQA 4C7VA 3ZVKA 3VSCA 2QY6A 1F2VA 3JTMA 3MS4A 1WMDA 3PUJA 2C98A 5E0OA 4ERNA 1J2RA 1U98A 3D0OA 5CT9A 4EYGA 4H18A 1OFIA 1UXKA 2G67A 1OTHA 4WECA 4X66B 1ZLYA 4MYCA 5EIEA 4UW9A 4BP9A 3E82A 3UAGA 4NBVA 1UK8A 1KR2A 1M7HA 4P4GA 2QRGA 3T9EA 5KQRA 3Q0EA 3AQIA 2FJPA 3PY8A 4DWJA 2ZULA 4MKFA 1FS5A 2V9PA 4B6OA 4EW3A 3DB2A 3NDRA 3LVRE 1P75A 1G63A 4MQLA 4XTRA 4ENWA 4DG8A 5FIUA 3WYAA 4DOBA 5C34B 1GP2A 4LYDA 2BI4A 1T6NA 1WWKA 3WLRA 2L19A 4B3JA 4YRKA 3M7DA 7ICEA 1ZNZA 1Z4QA 2V7GA 4O4JF 1FRQA 2JVJA 3EVNA 3O1HB 4J1TA 4JI6B 4L5YA 5AI5A 2VF7A 3B2QA 2K4IA 3MCVA 3X2FA 4LCBA 2YNMA 3ROGA 2F1KA 4NY1A 3VR4D 4DRYA 4GKVA 2Q29A 3EXFA 4QDXA 5L7TA 2CHFA 1Q0PA 3A04A 4FDAA 2GF2A 5ADWA 3DAGA 2C82A 2CCJA 4GOLD 1RTTA 3D4IA 2E8NA 2D2XA 3HH8A 1U02A 4EVSA 4EHDA 1BFUA 3HCWA 1SXJB 4HO1X 4K0KB 4FGUA 2AU0A 4V24A 2YYSA 1VKJA 2YS6A 4GPTA 4PHTA 5BOMA 1Z6GA 5H80A 3L02A 3R77A 3GQBB 2CSUA 5F23A 1YB4A 4J9VA 2UXBB 3AMVA 5IT5A 2WDPA 4NOJA 3E22B 3TQ1A 2QTCA 1GQOA 3OLWA 5EIFA 1GKUB 1VJ0A 3BB4A 4AULA 1I3MA 3L7YA 2HQRA 1SZCA 1GTL1 4HGYA 4MR8B 4P82A 4RGVA 3ZQJA 4OHUA 2OQVA 1EFUA 2QNRA 4A7PA 3NQ41 1LVGA 4JELA 3ASUA 2PXXA 5JNSA 2HDNB 3FSRA 4S05A 3PNMA 2I34A 2ZIGA 5TXGA 3DZJA 3O38A 4JI3B 3LYSA 2HW3A 2DE0X 4UNNA 2FSGA 3AXSA 4YECA 5FBVB 4AMYA 5DTRA 2QTWB 4ICIA 4YR3A 1R27A 4AURA 2F1HA 4H6PA 1F7VA 2QQ5A 2PZAA 1U6IA 1SHKA 5EEGA 4FPXA 3OZAA 3TMAA 1X7XB 2AL7A 4PTYA 1AA6A 2VXBA 3I9FA 1QIFA 4JJ4A 3M6AA 2VSOA 5C5JA 1JDBC 1RYBA 1C3XA 3D7MA 1D07A 1LX6A 1B0XA 3U3MA 1IRXA 4XD7D 2XKBA 2V1UA 4NL4H 1YZ6A 5JD4A 3J7AC 4S04A 3ZV4A 2JLQA 2QE7A 1FVHA 4LRTB 4MF2A 5BNWA 1LBSA 2FZVA 4PTZA 2XE6A 4RTPA 4OJLA 2XAAA 2G9UA 3LC1O 5FTMA 2XICA 1BRMA 2DF8A 3GVPA 3DMGA 3ED5A 3BD6A 4B4KA 2XMGA 4BNKA 5GIPE 3MHTA 4EB8A 2CKDA 2FK8A 3AZQA 2IYNA 4DCGA 2JV3A 2OGUA 4YYEA 4AAYA 1WY7A 2D74A 3GAZA 4JZKA 4N1AA 1X9HA 1WW8A 5KT5A 3IVGA 2IDMA 5HFJA 4C7OB 3AQEA 1ADCA 2HBYA 3DMPA 3V8BA 1CI4A 1PP4A 4UZEA 1VPEA 4WEQA 5GM2A 3JQRA 2DFLA 2OV2A 3WQBA 3GRUA 2HA2A 3R9XB 3ADPA 4YACA 5CLIA 2OVFA 5F2OA 5JU6A 3IKTA 2HRBA 4PNZA 3ZHSA 1NQXA 5KFIA 3MTAA 3R2JA 5I4KA 1JI3A 3ER6A 2WHYA 1N56A 1DRUA 1BYIA 1QM5A 4KGZA 4WFIA 3UJHA 1E3MA 2FF7A 5BOVA 3OIYA 3VQTA 2C5FA 2WF6A 4N0MA 1K97A 2OPHA 5JARA 1US8B 3IOMA 4LVCA 1X9SA 4KQFA 4WY2A 5EXSA 3TFOA 1RYFA 4RTSA 2WEKA 3KOZA 3QE2A 5I5GA 2W0SA 2ZI9A 3C3EA 1GWNA 4MVJI 4HMPA 1SUWA 4YH1A 5M29A 2FPSA 1JSZA 2QU7A 2X40A 1U1CA 3AKYA 4K6GA 4QJBA 4UJ3A 4XJTA 5TMBA 3ZDQA 1T2DA 4DT1A 5KTQA 3B82A 1JLKA 2DT8A 4GAEA 1H2YA 4KHZA 2ZUDA 1DNPA 2PCJA 1R0CA 4HNAA 4G65A 3QW2A 3OOHA 4JI8B 4EI8A 5EQDA 5F1OA 4HWSA 1XP8A 3VZPA 4M6WB 4C4OA 2Q7DA 4QTYA 2GJAA 3KAPA 1OSNA 1WXDA 3EC7A 3JZFA 3UMRA 5AKIA 4BFVA 1T3LA 3KBBA 2FB9A 2XJ9A 3HPOA 3JAWB 3KYCA 4L0MA 5FPHA 3P9RA 4JBLA 4PYQA 3EMDA 5CHEA 5GTIU 3GV0A 2G8NA 4CLEA 5I7SA 5K6AC 3V4RA 1UBMS 2QKQA 1KI2A 2C4TA 1XO1A 1GZ6A 3NHMA 2VH5R 4QPNA 5ESRA 1CUKA 2EX4A 4R6XA 3H8MA 1L7BA 3QVWA 3EZ7A 2XR1A 2DH6A 3FFBA 3RO7A 5JO0A 2A67A 8ICMA 2K5UA 3EUFA 1QYXA 4I6JA 2WSLA 4C7YA 2JGRA 1KQFA 3N2GB 2LMRA 4G36A 2JHGA 2KVSA 4K2HA 4PCUA 3L5KA 1U63A 4WK6A 3VPDA 4C7OA 3WB2A 3OHAA 1U0TA 3UFXA 5IINA 2VOJA 4KLMA 4AJNA 4BLTA 4B3SB 1DRKA 2C7GA 1IEWA 2O7RA 4WIAA 5G4KB 1JKFA 5K7SA 4NU0A 1YZ3A 4CR7A 4ZJUA 4XEUA 5JS7A 2Q0ZX 4MW9A 3RJJA 4RAOA 1GCAA 1UANA 3QEMB 1HO3A 2PCLA 4XGRA 4MA5A 3RS2A 3BHNA 1XVUA 2OZVA 5ALNA 1FP4B 4MP8A 2VYFA 2ZRDA 2G08A 1UXOA 3GARA 1SNYA 4DL3A 3BGWA 3MAJA 1QCKA 4JUCA 3V1YA 2EGGA 1H3NA 2MU1A 2AFIB 2JKYA 4M7OA 4WXPA 3HKZC 4Q1VA 3P32A 4ZOQI 4LOJA 1XU4A 1IHXA 2BMWA 4P3KA 5AD1A 2ONKA 4NLCA 1EA5A 2YOFA 4EQZA 3EPPA 1R6BX 2CZGA 2VYNA 2FPRA 3D7KA 4LV8B 3PZBA 4GFJA 3OQVA 1PJRA 2GFQA 2OFXA 3MQ4A 3NOOA 4R68A 3VR6D 4E5DA 5KTRA 5JSYA 3PPIA 2HGZA 4JBIA 3QHPA 2EP5A 1J2YA 1KFKB 3MQFA 3GF4A 4DPKA 4X97A 2J45A 1YT3A 1YD7A 1OWLA 2P66A 4FEGA 4RA6B 1XQVA 3HCFA 4LMRA 4PZLA 4IDAA 1CEEA 2HQSA 2O59A 4CU2A 4COOA 4RT3A 2E37A 2VP4A 4EF4A 1KZ7B 1KS2A 5KT4A 1U80A 1ZGJA 3B5IA 1G1MA 3I4LA 5EWLA 4BVJA 2L69A 5C4IA 3VNBA 2PGDA 3FUWA 4K1XA 5I8ZA 1RSZA 4Q4DA 3WGMA 4DDWA 5KFDA 5IU6A 1ZNWA 4JJEA 4REQA 4B6SA 1T3QA 2FOLA 2C9OA 2P9ZA 3H5VA 3O8DA 1IHPA 2WSMA 5D1HA 5B6JA 4W5RA 3HJAA 2ORVA 2QS9A 4XIGS 2H1OA 5AKJA 2QUIA 2VK4A 1VYTA 1A9PA 3MILA 4GPZA 4I1OA 2PT9A 5DK4A 3H17A 3LT0A 4TMVA 5D8DA 3U7JA 1NXOA 2WIDA 3WQSB 3O4VA 3RAPR 3ZWCA 4DLYA 3IPAA 4DLKA 2R11A 4EYSA 2NSLA 2WT8A 2GYWA 2FMFA 2QTFA 2VAXA 3DS8A 3N2KB 1C1DA 4JSTA 4BNDA 2H3VA 4CEJA 2K4PA 1JHUA 4NU8X 1J06A 2IXDA 4CQMD 1I0ZA 3NG1A 2UVRA 1C7IA 5F9LA 5GINE 2VYQA 3EWNA 2YFQA 4HQFA 4BNIA 1TC2A 2PFSA 4HEHA 3DOJA 2DLNA 3FNHA 4M0PA 1ONOA 1U8YA 2W4IA 4D9KA 2AI1A 5K01A 1AN9A 3NH6A 2CBXA 2WAMA 1TU4A 1VMKA 2OB1A 1PG5A 3A1DA 3DXXA 1WXFA 4ECSA 1G9SA 1PVDA 2IF2A 3EG9A 4WN9B 3QX7A 2KWIA 4E31A 3O9ZA 2Y1IA 1QWOA 5MGBA 4Q37A 4HRXA 4UM5A 1A8PA 5HGJA 3PSAA 4Z4CA 4GXIA 5AHOA 3GEMA 4MSUA 1P44A 5LP6B 1B2LA 1IZ9A 1OCEA 1XDBA 3SEFA 1Q8KA 2W54A 5CGQB 4IIGA 5I51A 1Z6TA 2H2IA 4B75A 3W5CA 4OSPA 2R5WA 4UEQA 4WKCA 5AW5A 5KYWA 3BJIC 5IAOA 3K71B 3SVLA 4NXNB 1Y7PA 5LN1A 4JA0A 4K6CA 2JW5A 3ZDZB 1ODCA 2VJNA 4LK2A 5A3VA 3AX6A 3SNHA 2IXEA 3BJMA 4V3CA 3QUTA 1QNLA 1K8QA 4XLTA 4AB1A 4DBLC 4BQFA 3DO5A 4YV2A 3O0DA 5IVKA 4BX3A 2Z4RA 3LL4A 1HF3A 1QS0A 2P3QA 4IP0A 1SV0A 4R9NA 1XWIA 2PS1A 4YVFA 4DEZA 1RQGA 2O7NA 4GM0A 5I7OA 3NNSA 5F33A 1YA6A 2POQX 5EFZA 3HUDA 5AOVA 4JIMA 3T15A 3QYFA 4PLGA 2CNKA 3OOSA 1JR3D 2X3YA 4MWSA 4YNBA 5CT8A 1N60A 1IM5A 1G66A 2Q6IA 4R3UC 2LM1A 1ZIPA 4G24A 1GRVA 1UJ4A 4AP5A 5BMVB 2VSYA 1TFRA 2OE2A 3Q9SA 2ZS7A 3T1OA 3ZHBA 1COWA 4EMBA 3ZGOA 4QBFA 4OXNA 2A1TR 3NVAA 4GZMA 4F5EA 1XXLA 4B43A 1CJBA 3OZIA 4K26A 4Q4LA 4X3PA 4EW2A 3I53A 1JYFA 1BVHA 4HWGA 1UJNA 1TD1A 9ATCA 4CKCB 2ZTCA 2GCPA 5ENZA 1ZO8A 1YZUA 3E1KA 1FVXA 2GCIA 3A1TA 4CW7A 3LP8A 3TCXB 3HFGA 5CK5A 1XN1A 4BN0A 3AY0A 1MOPA 1QHYA 1NVWQ 4N65A 1DTWA 1CS0A 1XZCA 3TUIC 4D3FA 2JJ2A 5C1BA 1SN7A 4PZNA 2RIPA 1GR1A 3QUAA 3VSAA 4KFCA 1ZYQA 4AD8A 3OTIA 5JJCA 1FMCA 2VSFA 4BV2A 1HFKA 3TACB 5A6SB 3A9RA 5KFBA 1P45A 3ZGZA 4MP3A 1C7FA 5LDDC 1YCDA 4AJ9A 3CVVA 3TFSA 3ONWA 1COKA 3VVLA 1FSZA 1YQWA 3EA0A 2G5IB 3OY2A 4NJEA 5FFMA 3WGLA 2JLVA 1GV1A 3GILA 1T2NA 3GLTA 3WVNA 5KNDH 4ESEA 4USAA 3QWAA 2AHRA 1VPDA 1XMIA 2E4UA 4CMIB 2A92A 4CR6A 5FWYB 1VE7A 4ASUA 1KAGA 2NSYA 5A5GA 3C2KA 4GC7A 3CE6A 3NRCA 3MAAC 5IAAA 2ZJAA 2FQ1A 3SNKA 3RC7A 2JJ1A 4KMSA 1C0EA 3NHLA 4BRZA 1RZUA 2PG3A 3NPMA 2EVWX 1MQ2A 3MD9A 2QZ4A 4H31A 3M8KA 4KMMA 3CX6A 4NZNA 2W03A 3K0HA 4O3MA 1W19A 4FSXA 4ZOCA 5EZQA 2ZJ2A 2AMYA 1DUVG 3FZNA 3L0PA 1G8MA 4PXAA 2II6A 3DFFA 1F8UA 1EDBA 1PJBA 2R60A 3KL2A 3OY7A 1CJVC 4Z4HA 3ZGVA 1M1XB 2VTDA 4MPJA 2QLFA 3ZE7A 2IT1A 4A1FA 3H11B 3GU3A 5LMZA 5JZMA 2AX3A 3GR6A 4NV1A 1V9PA 2XTJA 4L6IA 3EXFB 1YUMA 3UAYA 2F43A 1WA5A 4V0MA 1B1CA 1V71A 1AXRA 3RU7A 3BK1A 4EW6A 2EDUA 2J5QA 2PGOA 2VI5A 5EJ8A 1UFQA 3MB5A 4LPSA 1IEVA 1UFVA 3MWEB 2FPLA 6CHYA 4AY6A 3A32A 3IBTA 4UXJA 4WCFA 2C29D 4Y2YA 4HZUB 3U7GA 1YGPA 2E1RA 1NU6A 3S70A 3GRYA 4X65B 1J5XA 4WI1A 1BPBA 3MF4A 3U0BA 4HZIA 3FWPA 3MG9A 2WKRA 4TXLA 2PAAA 2JIZD 4YAWA 5DM0A 4B76A 4KG7A 1E0SA 1FNBA 1Z0SA 2HNAA 1JWLA 3Q40A 4MAMA 4UHJA 1Z9BA 2A7XA 3H3FA 3VHXB 5IULC 4XUSA 5ES3A 3SZLA 4PC7A 4NBLA 2J4DA 3HCRA 3OFNA 4EELA 1H4TA 1V1RA 3N2YA 4NE9A 3KCQA 4DB2A 1KH1A 2QP4A 3A4VA 3GEBA 4O1HA 1XOIA 2ZRPA 3ZK9A 4BFUA 5JBNA 2JR5A 2IHNA 1D7AA 2CJWA 1USIA 3D81A 3HU5A 3VC2A 1M34E 2ATVA 3NBAA 3ZD7A 2Y0EA 2HWUA 3NT2A 5LB4A 2PMEA 1P80A 5I8PA 1HT3A 1U0HC 2D3DA 1R4MB 4B9NA 1M2KA 1FK8A 1R6DA 3I32A 3LT2A 4FYXA 4YJ3B 1X14A 5EKTA 3SC6A 3TKLA 2PZGA 3SYNA 1M1YB 4QUAA 5ERYA 4NCAA 1CBUA 5K9ZA 3TR5A 3MTDA 1SCUB 4OX9Y 3G23A 2VQEB 2OYCA 1F5SA 2X6QA 1JHRA 2IYZA 2Q50A 3EBPA 1JDSA 1ZM4A 2OGTA 3JQ8B 4LYAA 2WY2D 3VPBA 1N6NA 1ODSA 5CMLA 1IB0A 3USZA 4QJ3A 1L4NA 1LLUA 5H8WA 3CSUA 3O26A 1T1SA 3HJGA 4B85A 3ZGXA 1BH2A 5DQHA 4ZPXA 1C4WA 1XI2A 2BT4A 3LXRA 4M1SA 4NTZA 1NX6A 1Q5PA 4ZHQF 2BQ3A 2B8TA 4I8XA 4QYWA 2BGGA 3QEMA 4Q9IA 3LXXA 3FHLA 3P9SA 3VSEA 3WDMA 3AR7A 4YP6A 4E51A 2ZPAA 221PA 3THSA 3O31A 4EEYA 4DBLE 3KSAC 4A8HA 1GFIA 1YHYA 4JB0A 4B3GA 4JY7A 1J8YF 1RAFA 3D31A 3O8BA 4D46A 3D3WB 3P8ZA 3IEXA 2NYUA 5TARA 1S6YA 1MIOB 1NURA 2DTEA 9ICSA 3PXGA 5EJ9A 4NENB 1L3IA 4LZLA 3CP8A 4H7JA 1KO4A 3HR7A 3RJ5A 1LTQA 1X39A 5M3BA 1UZMA 2JD0A 1PEKE 1U9JA 1OREA 1X94A 4P0QA 1ZK1A 5HGXA 1H94A 3A1NA 4BJ5A 1W581 2Q8NA 3JD0A 1E0DA 1O3YA 3KFVA 4JLSA 3F98A 4LBVA 4P6VF 5CM8B 4BLOA 3I83A 3PSIA 4LF5B 2YWJA 5IJWA 1FXWA 5K3BA 1YCFA 1DPGA 3WLFA 1WP9A 4P31A 1HH4A 3OZVA 1LI5A 1B16A 4HS9A 3SVTA 1PWYE 1NI4B 1PQUA 2JFXA 4JFRA 1ZHFA 4OK6A 4YREA 5CVUA 4C5AA 3WHPA 5ALZA 3B12A 1K6XA 5KL8B 4WBSA 5FBZA 2QD1A 2P6UA 4DE5A 3U6BA 3KQKA 4B6EA 2W2OA 3OOJA 5K0FA 1JFTA 3E23A 3WBJA 1ZJNA 4P22A 4YP9A 1IFXA 1YFZA 3G89A 1UC8A 2FGJA 3QBJA 4YA6A 4JU8A 4RD4A 3CGGA 5FRDA 3C5VA 4PGXA 4R2JA 1BEZA 4PHEA 2C9MA 2EDAA 4TZTA 3VR3D 4B40A 4PN7A 1GUZA 5EXPA 3VVCA 3QXXA 5SZHB 1C1DB 4BNDB 4MGZR 3UXYA 1RIIA 4OGGA 2QXUA 3EZ6A 3RTBA 2DR2A 3H2JA 1GRRA 1QIHA 1E5DA 4DUYB 3B3QA 4MGKR 4CKEB 3CB4A 3CEMA 3NM6B 5C1IA 3SR0A 3B6IA 4C1NA 4MITA 2I6TA 1PK1A 3HVUA 5IVHA 1WYGA 2WYVA 2B9EA 2JI4A 5AIBA 3GAMA 5A9SA 3DVSX 3PCTA 4MI3A 3SHVA 1LKZA 3EZ9A 1SUSA 4MAAA 4WKNA 4KR9A 3V4PB 3F5DA 1NHWA 1Z73A 4GL4A 4N5IX 4AUKA 4UBCA 4ER0A 1XYYA 3VPGA 1VPTA 1O57A 1NMQA 2GOYA 1KJ9A 3KT0A 5KG3A 4FGZA 1W59A 4A3SA 1G4UR 3GL9A 3PNBA 4RCZA 3BZUA 4ZP1A 1VIVA 1B74A 2QSJA 6AT1A 2BH9A 1E8DA 1C1XB 1Z45A 1MJ5A 2OAQ1 1L7QA 4JYBA 5EPOA 5DTMA 1MR3F 3GWGA 1H4QA 1NLZA 2V7QD 1O97C 5HIKA 2WUDA 3PXXA 2NAPA 4GXTA 1ZU4A 3HADA 3PXEA 4IOMA 4C3UA 1X1TA 1K7CA 4LRQA 4QFBA 3ZWDA 2DHCA 2E48A 4YRJA 2IE8A 1NG9A 4EY4A 3SQXA 4URVR 2NAFA 4JKYA 5COBA 5ALTA 4EARA 2MJLA 1Q7BA 1TVKB 3WRXA 1HMYA 2XOKA 3RFCA 3D54D 2H2DA 3N28A 2Y1JA 3D7LA 3OZUA 4AUNA 1CY7A 2AMVA 1E2PA 2HF2A 2DPJA 5FNVB 1AD2A 3JYOA 4IDOA 1JWBB 2EGHA 1LY1A 1QSSA 1JSLA 4F9EA 1DWPA 1OWOA 3WLHA 3IHQB 2PUCA 1RQPA 5AT1A 3WKDA 3MWYW 1U4OA 3LCVB 1SG6A 3M1IA 4C0WA 2A35A 5J4KA 1O4VA 1A9OA 1INLA 4ZO8A 4CHTA 5BWCA 4GPIB 1E9SA 2VQDA 2RI1A 2P9HA 4KOAA 2ZRQA 5KFJA 5DI3A 4ED0A 1N9GA 2BBSA 1WVMA 1OT3A 1CR2A 5TZVA 1K66A 3ERCA 3HZOA 2V9CA 4G0ZA 3EYZA 3FYCA 1HRDA 3CYMA 1GGMA 3NEPX 4F96A 2I6GA 3SF8A 4WN3A 5I7HA 4QEKA 1G59A 3AETA 3EDCA 2Z2IA 5G53C 3BH6A 4MKRA 2I62A 4U5XA 5TEWA 5JRTA 4KN6A 3TR0A 5IH3A 1F6DA 1Q0ZA 3B38A 2P2GA 1YR9A 1FP1D 3D4BA 2QTHA 3WLNA 4YG2A 1ZUNB 5LU9A 3RJIA 3TVDA 5IC4A 1KKLA 1UINA 5NULA 3V1UA 2YIDA 2YV5A 3FBTA 4PG6A 4X9XA 2ZJ6A 3T9CA 3NHYA 1CIJA 1JIKA 4P8RA 2NO1A 3U17A 1U2DC 2ASDA 1CB0A 1YK0A 1P60A 2O2GA 4MWZA 1AXEA 1QGUA 3IHLA 2C2KA 2VFAA 1ZJZA 1MPTA 4DOCA 3IC5A 1VJ1A 2IPLA 4WJLA 4GP6A 3WAGA 3AK4A 3WLKX 2ADMA 3OUZA 5B36A 5KFPA 3IELA 4PLWA 1ULSA 3WZ2A 5KYUA 3WWDA 5FOVA 2X9LA 3QHQA 1QHFA 1KTIA 1K5DA 3COPA 3ND8A 5B2ZA 1BAPA 2ZI7A 5SZJA 3L84A 3OWOA 3AM1A 1DEXA 2H1LA 3M33A 2P4UA 3BFXA 4N0DA 3ZUGA 2OHFA 1JQLB 4J4HA 5A03A 2XVZA 4ARZB 4OIFA 3EB9A 4RHUA 5ICSA 3JRXA 3UY4A 1LWNA 1G8AA 1T1JA 1Y3BE 4REMA 2KP7A 1M66A 3C5CA 3K1YA 1JXEA 4R9UC 4Z8YA 1NKVA 4E33A 2B83A 3JD2A 2QSYA 5AKEA 2O0KA 3C3WA 3PFKA 2WICA 1C3OA 3ZVLA 2AR9A 1KWGA 3OQOA 1KMQA 5DCYA 1L4BA 3W6ZA 5IKEA 1SG9A 1WJGA 3K1ZA 2WKWA 2JGMA 3KZKA 1LNZA 5ED0A 1IN7A 3M9XA 4XVCA 3OHPA 5KFAA 1IG6A 1DOAA 2O48X 4F5ZA 2V7WA 4IIDA 5CA1B 3N7PD 1IAVA 3EG5A 4MLPA 3LFHA 1KDRA 3P0EA 4AQ7A 3C3PA 4RK5A 2W6MA 4YMOA 1NXPA 3B1WA 4QEDA 2YBDA 4BP8A 3KSUA 1P0PA 3PQ4A 4IW3B 1V45E 1DAMA 1Y1SA 2J6TA 4B4DA 4EB6A 2HZBA 5C1DA 3OQMA 1TZJA 1DFIA 1YA4A 4JODA 5KAPA 2RHGB 4CVNA 1W4LA 3AYXB 1I2MA 3GLHB 4CJXA 3GZNA 3CR7A 1ECFA 2G6TA 2X76A 1ZAKA 4XGKA 4HNHA 3TW8A 4DJFC 4RHCA 1PEAA 3DJYA 4QTTB 3ZUPA 4KR7A 4HCJA 4NPHA 5IANA 1BMTA 2Z2JA 4HVTA 5DCWA 1G4HA 3KOWA 5H9WA 1SJ9A 5JD6A 4QRDA 2BKAA 3BEOA 4RH3A 5ERXA 4TTQA 3W8RA 1O95C 1QHHB 5EHGA 1YCGA 1HDCA 2L82A 3FTDA 2XXJA 3VOTA 3OEED 4RKWA 3IUNA 4Z49A 1G19A 3TG8A 3AH8A 5C5CA 1H66A 1OGYA 3OM0A 4S3MA 3Q8QB 3JPOA 1MGPA 1Y48E 4KBFA 3ETRA 1EZ1A 5CNMA 1ZVJA 2AN3A 3ZHZA 1R7RA 4LHWA 1GZUA 4PPGA 4QQ8A 3U44B 1BO6A 3BOSA 4RK4A 2HZ7A 1MSWD 1O7JA 4HX9A 5KFTA 2JLBA 2XUAA 1XCJA 1VE6A 5DN6A 4DOAA 4KLJA 2I2DA 1T5DX 2ZIWB 4DNQA 1YQ9A 1RLTA 1K08A 3R9IA 1DEHA 5IKPA 2V0GA 3Q8MA 2W6ZA 1L4GA 3I04A 4Y67A 5FNVF 1P4JA 3F6EX 1ZH4A 3SD7A 1JDPA 3EBOA 2B6HA 2HLDD 3DAPA 1I4DD 3C3YA 4G5XA 1E6UA 3GDXA 2PUEA 3UQ2A 3V4VB 5AJHA 2ZS9A 2DECA 2VTBA 4JA2A 3SSNA 3ISBA 1UJBA 1EXNA 1XTTA 1QK4A 3NXKA 4LGYA 3ASVA 3G0IA 2PS9A 4KV7A 4LBYA 2R84A 3E5MA 1H0SA 4D0RA 4PIMA 1Q17A 1XCLA 3ELYA 1ILWA 5EJ4A 2AHOB 1HEIA 2LTAA 2WMOB 4IUBS 1RWPA 5EIXA 1WZ2A 2AJTA 5FOWA 3N7TA 1KYYA 1KAHA 1JR4A 3JQGB 3DEIA 3TADA 2KV2A 4D0LB 5LP6A 1NW7A 2JGDA 3ZQUA 2J5BA 4O8ZA 4KLCA 5IZCA 1WCIA 4QDKA 2IBTA 1PJ3A 1A0OA 4JV2A 3ICXA 5FULA 3EPGA 1ELOA 3IDZA 2IH2A 4Z4IA 3N8NA 3CKYA 3BHIA 3HDJA 4ID9A 4JASB 3JPNA 2FU5C 1OI2A 4WAUA 2VDWB 2XMZA 3ZWOA 3T7TA 3MXTA 3MC1A 2Q3MA 4G07A 3WK4A 2O8BB 3PGLA 4PQGA 4XB2A 4ZVKA 4DPLA 4OMCA 1G5PA 2GYVA 3LD9A 1P5FA 5FORA 1PNTA 1PCXA 4Q6BA 4TYMA 1KS9A 5TSDA 4MDHA 2HPVA 1S8OA 3JPQA 1K1QA 4EY7A 4H3KB 5ABPA 2ERXA 4QVIA 1ZOOA 4V0ME 2QZJA 4EHHA 1RWXA 3ONNA 1IONA 4QYIB 3LLVA 4X1KA 5K8CA 3C3AA 1HPLA 1SOAA 4BNUA 4ZHSA 2D2IA 1PG0A 4I4NA 3M6LA 3NS7A 3L0DA 2NPIA 3QX3A 4WNAB 3T5MA 2G4CA 5FBWB 1P61B 4J0CA 1OB2A 4RY2A 4ARSA 1WB5A 5FADA 5JI2E 2KM1A 4CMBA 2ZDQA 4IDEA 4EKYA 3I92A 3BK2A 2GF0A 3I2YX 4QASA 4EI7A 3EXIA 4R8SA 3WIUA 3JVIA 4RVHA 2Q6TA 4WBNB 1A5SB 5TE9A 5JC1A 1K98A 2A19A 1WV0A 2Q5OA 2JFFA 4X54A 2IOYA 1KE2A 1TUBB 4Y0VA 4F86A 2C5HA 3F3SA 1IN1A 4L2IA 3P1JA 2Q2WA 1ZX1A 1B8VA 1YNOA 4LJSA 4B3IA 3UJNA 3PW5A 2EAOA 7MHTA 5EXXA 3R3ZA 2VHJA 1T8PA 3UNXA 3FKSA 3GT7A 2VRNA 3DXFA 4OYHA 2NV0A 4X60A 4RGYA 3TNYA 3Q7IA 3OSPA 1K5HA 5FOXA 2C5BA 3ZI7A 3OIGA 3RK4A 3U4HA 1NZPA 3OMWA 3KALA 3KKZA 1U7HA 1TI7A 3P9IA 3VC7A 2DPIA 1DKMA 1SELA 4MYDA 1RMQA 3HA7A 1Y42X 3KZCA 3RJ9A 1JNXX 5B7QA 5JSZA 5KTTA 2HA4A 1ZBDA 4YMHA 1KFSA 1ZM9A 1U49A 5LSAA 4AZSA 1MGOA 4CMAA 1SMKA 5L53A 4OCZA 1VHWA 2Y9UA 1MA7A 2ZJ4A 3SSAA 3TX6A 4O4IA 2BP7B 1P33A 3IJEB 4KUHA 4L8FA 5B2FA 2AT1A 3OE7D 3VTAA 5HZHA 3BXEA 2P9YA 5SY6A 2VWGA 1F3LA 1XRMA 2FSIA 3K73O 3ROPA 3WQRA 1SVMA 1M2HA 1LJLA 2OAGA 3M34A 4TRRA 4AWBA 3KRTA 4R2MA 1G55A 4C0BA 4DFMA 4DUZB 5CEHA 4UDOA 2BFWA 4XIYA 2D7JA 5J2CA 3ZGLA 5EJ7A 2O8CB 3DC7A 1OASA 1QKJA 3RAXA 5EC8A 1EFVB 1FPQA 1YK1A 4CM5A 4D9BA 1AGXA 2VWPA 1E4OA 4G1VA 3UMJA 2CUNA 3C6QA 1Z00B 3JRNA 1F8XA 3DOCA 4MYRA 1H0HA 3TEJA 1J0CA 2FPGB 2QUAA 3WWZA 1V0JA 1WW3A 4FUQA 5E6UB 4WJKB 2OQRA 1U2TA 2W4QA 5CA1F 2PKQO 3B9RA 1SL1A 1B23P 5HYVA 4N5HX 2JEIA 2A9JA 3G88A 5CYGA 3U26A 1JN0A 4NCHA 3R7DA 2VSNA 4TVSA 2F8KA 3GROA 4GVPA 3OI7A 1QQTA 5CD1A 2OEHA 1GNSA 1SQFA 3I37X 3U7FB 4OJTA 1V97A 3DZGA 5DBBA 3D8HA 2ZI3A 5DVZA 2H1WA 4IXMA 1ANKA 1NRXA 1PI3A 2Z5FA 5BORA 2AQKA 5EEHA 2OXCA 4JDUA 4PG5A 1L5MA 4F4FA 4DWOA 2YJGA 3MFHA 4MINA 2N75A 3GUUA 4JLMA 3AM9A 4F5PA 1T9HA 2GR9A 3IODA 3KPJA 5LBTA 2CYBA 3DULA 3HLTA 3PPWA 3R5FA 4AROA 4RSRA 4U0JA 5DGIA 3GLFA 4ZV9A 3L8YA 3ZIAA 1GRQA 1YJAA 1HLDA 2RKWA 2X9QA 1Q74A 4XGIA 1AT1A 3BF7A 4ZI2A 1QDUA 3F6PA 3RRYA 3UKOA 3MK31 3QIAA 4XQ0A 3FYUB 3L04A 4ZO4A 2W71A 4JVOA 1I1NA 4MQUA 5LXTB 3B3AA 1OXJA 3FE2A 3NJ4A 2W11A 3WBFA 2ZK7A 2W22A 5D86A 3L2OB 4YLYA 3HO1A 2W9BB 1JDNA 2X8LA 1ZOSA 2YUTA 1SCUA 4HUTA 4ACOA 1DBRA 2C2MA 5KNBH 2V3CC 1AIPA 4TXMA 2GHRA 2VA3A 2X7XA 4H1WA 5ANRB 3W5UA 4KYVA 1EK5A 1P31A 3HJFA 3GRFA 1J07A 3QF4A 3TKAA 1J21A 4UDYX 2VNAA 5LZ7A 3OD1A 4LGCA 1RXVA 2Z4TA 1Y4SA 4YD2A 4PC3A 2ZBUA 4AJPA 1EGMB 1WR8A 3B36A 4DLVA 5DG7A 2GGSA 3BJRA 2HRCA 4JXKA 4FVTA 3O8QB 4ZO7A 4F3CA 1TK2A 3EXIB 3K9LA 2ZFUA 1N2IA 2KPOA 3MJDA 4FHZA 3FSJX 1RU3A 4EABA 3CBGA 4D3XA 4MROA 4F56A 1AKQA 3FNIA 3O74A 3AVVA 4Q9DA 4JBHA 5IN4A 1ZMTA 3HHPA 3KL4A 4D81A 4BB6A 4EHLA 2O8EB 5IX8A 4X5VA 2EJWA 1F0MA 3PFGA 2P7HA 3PQFA 3NIDB 5E1OA 2YICA 1QIIA 4US2R 3I0MA 5DB6A 4H59A 3BDAA 4ZYVA 1AO0A 3P27A 2TRSB 4JITA 1EFTA 3RVLA 4A6PA 4R8MA 5JY1A 2NZ8A 1ZH6A 2WB4A 3NEYA 4KQHA 1W5SA 3GZ4A 3GZNB 3DH0A 4D4KA 1Z74A 4C80A 1N2CE 2DUYA 3FLMA 4GVLA 3GT3A 3PC2A 1H9AA 1WUKS 2DULA 2OHOA 2RG1A 2ZEJA 4IYJA 4MARA 4O1IA 2BM0A 3OJSA 1X9XA 5A06A 5F76A 3L0YA 2D1TA 3N87A 4PLFA 4OLBA 5DWDA 2I7DA 2TECE 3PUXA 1OLXB 3O8NA 5JUMA 3KUUA 1ORRA 2YWFA 1JIIA 1T4DA 1WQ1R 3A6HA 3AM3A 4TSKA 4UDNA 2I4LA 4UE3S 4B3FX 3FTFA 4A91A 3S3TA 1F0PA 2G8LA 2PEZA 3S2IA 3THYA 1URJA 4Z3OA 1AGPA 2PMKA 3JD3A 1VA4A 2FPMA 2KZ3A 1NK7A 1GAEO 1Q2UA 4M87A 2ZBFA 4D44A 4EG6A 3EAGA 4QM7A 3DMFA 4PGAA 1FTSA 4UCXA 5CCBA 1BDHA 5DG9A 3CKKA 5B1HA 3RGGA 2ENUA 4AY4A 1GAQA 1XAIA 4C1BA 5ISMA 2JJQA 2OKGA 3IAM6 3K4HA 2D1FA 4HDAA 4NC9A 4HPWA 2ZDHA 4F97A 5DYGA 1DARA 3OX2A 1ESEA 2JIZA 4X6UA 5IT0A 2J3IA 3NFYA 3EXEA 1R5NA 4FOOA 4RZSA 4B2PA 2AG0A 1SUFA 5B12A 1H3EA 3ZBPA 4OQZA 1RWWA 2EIXA 1O6ZA 2H1HA 3DAHA 2GNPA 3GJRA 3BUSA 3IRVA 2LDXA 2DQNB 3D6MA 3W5BA 121PA 1JQJC 4ED3A 3A6FA 4QJ5A 4O5AA 4UNQA 5T3UA 4TT3D 5TGDA 3TVYA 1QONA 2N1MA 2XRMA 4RKEA 1JX4A 1AHIA 4E15A 2MYUA 5SY4A 1B76A 3PZRA 4RIEA 4AKIA 4MUEA 1DX6A 2OXRA 3FCAA 3GH3A 1U8CB 2R66A 2WZQA 4XQGA 4U6SA 3ZNNA 4EDHA 3TQCA 2HHHB 4KN9S 4OD0A 3O1LA 3PD1A 1C9JA 2O8NA 1UXGA 3GIMA 1DQYA 1A77A 1OE0A 2P77A 2YIJA 3OQHA 3ZU4A 4BWMA 5LKRA 4IH1A 3FNFA 3CJTA 4XFJA 1S5LU 1I01A 1D09A 1PEYA 5C5EA 1HK7A 2V3WA 5A0FA 3ZWKA 3OTHA 3TL6A 4C2UA 5AM5A 2A5DA 3FPEA 1WLYA 4RGQA 2HK8A 5K0EA 5JDCC 4KL8S 4ND3A 4M0CA 2SBTA 2BVNA 3AHFA 1L3SA 4JYMA 2EANA 1FMTA 3VH1A 4XRGA 3HXQA 5EQTA 3TZEA 1KZ1A 1D3AA 3LMKA 2XY7A 4OHPA 1B93A 2W0MA 4K9RA 4G0NA 1GQ2A 4WL0A 5I3ZA 5JNVA 2VBFA 3BL6A 4WACA 5I47A 2COKA 4CT4B 5EOZA 1E2MA 1DFHA 5KFQA 2JI9A 3H3XA 3L7NA 4O4HA 2NTJA 3LWZA 3TH5A 2ECOA 3PKJA 4J1QA 5IWAB 4QZVA 3JQCA 4IIVA 4YJDA 3A6PC 3KUCA 1UBNA 3LCJA 2XUGA 4L0DA 3HPQA 1TZKA 3ZE1B 4EG7A 1SXJD 2AKAB 4F2SA 2W43A 5EPUA 3E9MA 2QDXA 3QSGA 2ATIA 4MR8A 3B6KA 4DQSA 1ECBA 2VUIB 2FLPA 3WGVA 1AURA 2NPFA 3UK6A 1BPXA 5JNTA 4MRSA 2Y1KA 4NZYA 3I8SA 4DV6B 4F2HA 5DGBA 3HXPA 3WWPA 3A1FA 1L5KA 4TRJA 2ET6A 4LDAA 4TYPA 2QJFA 3CGWA 3VU1A 3NTRA 4LV5B 5A3RA 3UWOA 1SBZA 3WIEA 4Y1RA 4YP0A 1DK3A 3DD1A 3RS9A 3SBDA 5I9IA 3ORSA 5HKKD 5J2TF 3TB6A 2O2EA 5CIYA 2FZKA 5KAIU 1J25A 4Z1OA 1L8AA 1W44A 4X8LA 1ZCJA 2RONA 4FC7A 5ARBA 2NTEA 1DJOA 3HR4A 4E2YA 5K51A 2H3ZA 3LUCA 4G0XA 4Q01A 6ABPA 5E3IA 2YZNA 1B41A 5DKWA 4KXLA 3W3ZB 4DMCA 1K5PA 3JD1A 5HTOA 1TW3A 1U1FA 3H42B 4OKNA 2PMBA 2Q0SA 3ZE6A 2X1HA 2NT3A 1G2OA 1X1EA 4YMUA 4D9HA 2C4UA 1X86B 1JIHA 3HKZF 1ZU5A 2RC6A 4FYWA 4I08A 4PF1A 3SDSA 4S12A 4KAXA 4KNYA 2UU9B 4XARA 5G0VA 3NUQA 4FX2A 4DIUA 1EWTA 1XAJA 3QNWA 1LPNA 1XU9A 2H9AA 1U3TA 3FSGD 3D1VA 5DNUA 5AICA 3OT5A 1V26A 3T5HA 1YZGA 1DJQA 1BYUA 4L4UA 3K09C 3WIOA 3IO3A 2GXQA 3FOFC 1W1UA 3UATA 3NBUA 1MORA 5K3FA 8ICCA 1I2ZA 2ONYA 3F9IA 4DSTA 5BRAA 4GZ3A 5AJYA 3NKLA 1P39A 4OJ5A 4ZK2A 1B14A 5HM6A 2XXBA 4ZQEA 1WMEA 4PX3A 3E9RA 2H07A 4XTCS 5BSTA 1L5ZA 4XPIA 4MO2A 2V8BA 3NHRA 4OA8A 10MHA 3PG5A 1W85A 3BREA 3T5DA 4DLRA 5IKXA 1BA2A 3OU2A 4YPVA 3QPVA 5BSUA 2VJAA 5KDOA 4NXZA 3G7NA 3ZWBA 1JZSA 3VPCA 4RZIA 2QM0A 5AKZA 2PYIA 2RP5A 3HP1A 1MHTA 3ITEA 8ABPA 2ZJ5A 1I6KA 3GCXA 1ND5A 1U3FA 3RSZA 1OYOA 2O5RA 5JH7B 2XSZA 4QNLA 3B6MA 2NUAB 4QLAA 2IOFK 4JHLA 4R8RA 4BBPA 4PAQA 3PRKE 4G0VA 1WCV1 4YFYA 5BR8B 1RKQA 2EBUA 2Y1EA 1TJPB 1AKNA 2QYSA 2VDUE 3GLHA 4GI5A 3IERA 3UJ9A 1ZQWA 1SVNA 3W2IA 3H5RA 1C20A 4QTXA 1COWD 2WZDA 1O77A 4TXHA 3SX4A 3EEFA 2F3SA 1N9GB 2WG1A 3H2IA 4MCJA 2RHOA 3EGIA 4RW0A 5B30A 5CX1B 5F7XA 4XDZA 1HURA 1ZQAA 3R5XA 1UDCA 5ALRA 2Q5JA 2O8DB 2KSOB 3EMVA 3FPAA 3AVOA 3AHGA 3L7CA 3SXJA 4BP1A 2X4IA 2FVXA 2G1KA 1JVBA 2EZUA 4MWCA 3RVMA 1PK9A 2DY1A 4OH1A 1ZJWA 1ZHOA 1C3EA 2VHUA 1OX4B 4CE6A 2WD9A 3C2LA 1MB0A 1BEEA 3QYAA 3LQ2A 4J7XA 4O4IF 4JI7B 4LE0A 1Y3DE 3PQ2A 4EGQA 2R68A 4MXDA 2FLNA 2J41A 3UO8B 4GBJA 2IMWP 2YXBA 4DIDA 4QHYA 1CNEA 2RH8A 3Q9NA 2GEFA 2H65A 3L1VA 3OWXA 4E6EA 3MR2A 1HLPA 2BGWA 4BUZA 1USVA 4R65A 3D43A 5CEEA 2NMVA 4WZAB 5CYFA 2B82A 1RYRA 3CRZA 4L02A 2P5SA 3MB8A 3R5SA 1MB2A 4FZJA 4Y2HA 1XMVA 2Y76A 3FYSA 4N6OA 1RLIA 1OIVA 3IQZA 5F2KA 4TRNA 2BKXA 1RYSA 5KYUB 4CQLA 3OQ1A 1RADA 2Z56A 1QV9A 4EF5A 1M6WA 4N41A 3UMVA 1AA9A 4DLEA 4FD2A 1RRVA 4EJSA 1SBHA 1ZKMA 4ON9A 3T7DA 3CLTD 3VPHA 4Q7LA 1MKYA 4L73A 1BRTA 1Z3IX 5ER6A 1B15A 1U0OC 2BEWB 2EKBA 2WAAA 4IIJF 4QXRA 4E5UA 4FKZA 3FW1A 4UEOA 4EGCB 4YMVA 3H1EA 1ZL2A 2NVUB 2HN9A 2HMTA 1I51A 1DGQA 1Y9JA 4KQJA 2MUTB 4XQ8A 1ARZA 1KF0A 1U9ZA 2F9LA 3DZBA 4NBTA 3S2UA 2VP2A 1J0XO 4GG1A 1E8MA 1BCRA 3BSSA 4IDBA 3WADA 2A0YA 1I5RA 1ORWA 1FQJA 1SIJA 1MD9A 3HCAA 2XRZA 1CDEA 1LEHA 2MIIA 4GYJA 3MGIA 3UPQA 3TTSA 1E1CA 5FLXA 2EHDA 1BWPA 1ED1A 2CUTA 8ICJA 4B9SA 2VIIA 4DR6B 1IIBA 1D2CA 3KYDA 2QTGA 3X3HA 5K0ZA 3JQPA 1U2PA 2OO5C 3ANNA 1G21B 4D8TA 1VLMA 3LGXA 3KSMA 2CBGA 4JV5B 2J9FB 1FIQA 1U9LA 1TTPB 2CF5A 1NZFA 2PFOA 2NRWA 4NICA 1UQUA 1MQ8B 1XLTA 4OOEA 3BMOB 3M6WA 4ZVPA 4DANA 3TG2A 2VYCA 3V32A 1O08A 1GNVA 1H42A 3TW6A 2BZGA 2H4WA 1UK7A 1P7YA 1C9EA 1IY2A 1VI5A 2GK7A 2Q62A 4M1WA 4MRMA 2Q5QA 2PSFA 3QVJA 3W9YA 1OC2A 2IEYA 3GFVA 4ZZ0A 2ZCUA 1IPFA 3ONFA 1E9VA 4G26A 4RIHA 4ZZIA 2GTPA 2NPOA 3I0NA 4HDKA 2B8JA 4K5QA 4WADA 4ZVOA 3CM0A 3HJBA 3ZHYA 3L4KA 4R2IA 1Q91A 3HDQA 3OLZA 2M1ZA 2A4KA 4K40A 4CTNA 1NKBA 1UPFA 4MYTA 3WRYC 5BV7A 4MUYA 2WSYB 1TC1A 1QE5A 4F91B 2BAGA 4DCVA 2QMYA 2DLCX 5E0KB 4Z54A 5IDXA 2O5VA 1I33A 4DSUA 3ICQB 1J7JA 2W6CX 1B8PA 2BM9A 2WFLB 3LC0A 2EAUA 1Y88A 1KTQA 3DV9A 1GZDA 3M89A 3PX4A 3PHCA 4ILKA 4QGFA 5DNVA 4F84A 1VLJA 2XCTB 2EZYA 4MGHA 1T0HB 3VO8A 3WK9A 4JR2A 3ZDAA 3PK0A 1TYZA 1UFOA 1ZINA 1ZVQA 2IPOA 3AERB 1NI3A 2XUOA 4M0MA 3D9QX 2G4LA 4FIZA 4CI9A 3FUVA 4ECQA 1E7MA 4GT1A 4ZV4A 1M10A 5IT4A 1T35A 4ZEWA 5BWBA 3WMEA 1CV2A 1G7CA 4IOLA 3GUZA 4D9FA 5KHAA 1CF9A 4JZYA 3CNQS 1WY5A 5CLGA 3GG9A 3C2MA 2VDLB 2YV3A 1YVRA 2ZB7A 2FHSA 3SC2B 4HV4A 1P2GA 1A76A 3NW9A 3PXCX 2CDAA 2PWAA 3IB6A 5GY7A 5K0JA 1EUQA 4B8WA 2XUIA 4PO8A 3NHSA 3N7UA 2Z4SA 3H84A 1QVWA 2BMVA 2QU8A 1N2CB 1PE0A 3RS7A 2IXTA 3LVQE 1GEGA 4RQ3A 2FN8A 4YC7A 5CURA 3FMIA 3T8YA 3PGKA 3AL0B 4PEVA 3SJCA 5LWHA 2VDPB 1SCNE 1GNRA 2VS1A 1CP3A 3CRRA 4ZVSA 2H29A 2P9QA 2FRDC 1C30A 3R0VA 2XMBA 4NFSA 1MOQA 1OXUA 5K0NA 1M75A 2GJSA 3DZDA 1EHCA 2JFBA 2X19A 4OP1A 1UXIA 3BWYA 1QH9A 4D8WA 1FUUA 5K3DA 4HLUC 4P4UA 1AHNA 4S24A 2W6JD 2QV0A 1ZQDA 3MCUA 2IVFA 4BJ6A 1L3TA 5DRYA 1F60A 3PW7A 2WTFA 1NW3A 2R87A 4DABA 4HQOA 5JALA 1NPTO 3N7AA 4OIMA 3UJBA 4TMTA 4KVZA 4ZT3A 2AZXA 2DKZA 1YASA 4TYYA 1N6RA 1NBHA 2XQJA 1DC8A 4DLUA 2KNJA 3CVOA 4UU7A 4HSEA 4MUAA 5EMKA 3EZLA 4QOSA 1AKWA 1ZMBA 3UG6A 2EC5A 3KHUA 4OXKA 4YDHB 1E1RD 1FU4A 1K4MA 1ZH8A 2IDJA 3FF4A 5LYYA 1CY8A 2AD5A 1RZRA 4MB0A 4LCJA 3SSOA 4GOXA 4INZA 3OQNA 4NV3A 3OQ6A 1AV6A 2NQ8A 3AVQA 3TKYA 3H2SA 3PRJA 3PSPA 2YVAA 4Z6FA 1THTA 1TMGE 3QOYA 1GCIA 2DRIA 3S99A 3MIZA 1QP7A 5IHXA 4F6LA 3LRPA 1KP9A 5DULA 4L15A 2QA5A 1TJ5A 2UYGA 2VYVA 4MMZB 3WWOA 1W9MA 2FE1A 1ORTA 1KJ8A 1VDMA 3NBQA 3UJAA 1HLGA 2VDOB 1HJPA 3L7BA 5MN6A 2J0EA 2PKCA 2WD7A 3CX7A 1KO8A 4HQ0A 5D3MB 4D8UA 4CR8A 3UAZA 2WAXA 3D8BA 3FLEA 1YVDA 1CW2B 3FCCA 4JX9A 1KGSA 4TS1A 4YWJA 3V7UA 4HDRB 1X13A 3L8ZA 1KQQA 4PYNA 2IF0A 1NK0A 1M72A 2Y6UA 3P0JA 1GA1A 5IJ0B 5I4BA 1D7OA 2RH9B 4RXUA 4YCAA 4DILA 5CITA 1DKPA 3E8SA 1VL0A 4DCJA 4UNSA 3OT1A 5FFNA 4D79A 4EECA 2JFYA 4H7EA 1VMAA 2WAQF 2AFRA 2WHXA 2Z5LA 4M0EA 1O5IA 4N5MA 1I4OA 3WGJA 4D2IA 1HGXA 2C92A 1XHFA 2ZKIA 1JJVA 1KK0A 3L7AA 1RRKA 5K5EA 4OGFA 3S6JA 3CH6A 4PRZA 4FBMA 4Q39A 4B4VA 2ZXUA 4DCUA 3WL3A 4QUHA 4DXDA 1N5MA 1RLOA 1E3WA 1NVAA 2G4VA 3A1UA 2X2EA 3AP1A 3OFSA 3H9UA 1VHTA 3FIJA 3OE7A 4HHEA 5HE8A 3K4GA 5J0TA 1M2GA 1WETA 2XGGA 1OZ0A 3C3JA 5B6PA 2HL6A 2YFHA 4PLCA 5FH9A 2EATA 1J5PA 2JFGA 4YP1A 3JALB 4HB0A 4EHJA 2ZZNA 1PK7A 2ZIUB 3LPMA 3OA2A 4I5IA 4TV8A 2DKOA 1UDWA 1DXYA 1JLLB 1TYAE 2H52A 3CLKA 2FMIA 2WTNA 4MMYB 3QVKA 3A11A 2QT9A 1UKVY 3T94A 3S8EA 1E96A 1YOVB 4KBGA 3EUB2 1RAGA 5CJ7A 1NF2A 3PL1A 4CODB 1T5TA 3MDCA 4QZ9A 3RTAA 4D1YA 3FSGA 1P1FA 3OJFA 4LZPA 4BO0A 1IBCA 2J67A 2NP6A 1D1SA 3N2LA 4TLDA 3T0FA 2CB0A 1VG9B 3HJNA 2QP9X 2RK4A 1B8NA 4K4GA 8ICFA 1WB6A 2J9YB 5H1YA 4D97A 4UQLA 5KVCA 1Y8ZA 2XTNA 2FN9A 2NRTA 3BMQA 1BC5A 1F06A 4G56A 3UB3A 4GEGA 3AUYA 1WVGA 1KC1A 1YU9A 3P9CA 4INOA 1K7YA 3TW0A 4DLAA 4BWVA 2YXPX 1DRGA 3JSXA 1K5GA 1KO1A 3K6JA 5CA0F 4AN1A 1QXSA 4ZT5A 5IXJA 3O9MA 3L06A 3FHCB 1PJQA 1OAKA 5IDYA 3OJXA 1SZHA 1G8JA 3QLVC 1YS9A 3VUEA 3NVVA 4L9WA 1MO4A 2GBLC 2VT6A 1RZTA 3PDIB 4G23A 1SL0A 3RM3A 3W5IA 1ZH0A 1C9MA 3TLYA 4BN4A 2ISOA 3INYA 5HUJA 5LNK6 3QU7A 3R4CA 2D0OB 1CUFA 1F4LA 1P73A 4PAMA 1O5TA 1YQTA 4PG8A 7REQB 3KVRA 1XTRA 4YXFA 4HX5A 1CF4A 4HC4A 3RJKA 1P5RA 1BG6A 2XSZD 1IZ7A 2BFPA 3F4BA 2GM5A 1QB7A 1M8PA 1WOYA 2Y0CA 4ROSA 3FMOB 4ER7A 1Z00A 1Q7TA 3R7FA 4MHTA 1KL9A 1V5IA 1WF3A 3QIVA 4KREA 1EVYA 5E6UA 1XD2B 2FEMA 3A10A 3AHHA 4H7HA 2YMPA 1YR7A 1R37A 2BZ0A 1C3LA 5H5JA 3TQOA 5EWFA 4IR1A 2BISA 3LDFA 5F2NA 5J2TB 1ZIDA 2A9RA 1Z2DA 4KPFC 3VDQA 1MIOA 4TZ6A 1NW9B 5LU8A 2G40A 3FFAA 2YMLA 1QX4A 4PN3A 1IBLB 3EF3A 4CQMA 1R0KA 5IABA 1QO9A 3EXG2 5J58A 2OXOA 1FJHA 2XITA 3KKLA 4F3OA 3NP7A 4WLNA 4AUEA 3J81j 4HWPA 1JAXA 3INNA 1NG1A 4BYGA 3AQ4A 1QJ4A 2NW6A 1LNQA 3BQ9A 3HMQA 2PI4A 2IWRA 4N48A 4NZ9A 3REQB 2WKPA 4G8BA 4W99A 3F4KA 1QRDA 5F4BA 7ICTA 2ZYUX 4QWWA 3NVZA 3WB0A 3U5TA 2ADFA 1UBSB 2AOWA 4RVFA 2ZUUA 1ECGA 3R7BA 2WHPB 2KFNA 2VT7A 3PQ7A 5COQA 4EDFA 3JQ6A 1ST2A 3VYRB 3WV5A 2O8EA 5AVTA 4WTOA 2UYHA 2BBOA 3H86A 4AYBF 1NZBA 2BV3A 1SCQA 2IC5A 2J8ZA 2Q9CA 3TLKA 4EG8A 2K4MA 1YS1X 2KG5A 3F49S 1E66A 1JEOA 3SP1A 3AUUA 5L95A 4CF7A 1E9DA 4P7JA 4HXYA 4Q3LA 6Q21A 4Y2UA 2NSJA 3S8YA 3PHJA 1SD2A 2DKNA 3STTA 1ORIA 3TQQA 1M6VB 3UH1A 2Z6UA 2E87A 4DYHA 2WB1F 5GV8A 2CHGA 2IYAA 2VDWA 2GRAA 1Q95A 5CYPA 3QFHA 5A3SA 5C35A 3WIBA 1XTVA 5HKKA 1F3OA 1VJCA 2PD6A 4WFKA 3S1LA 4ER5A 2G76A 2KB0A 2PX8A 4ZALA 4OXIA 4C4RA 1F4PA 1XB2A 4I2HA 3PXAA 1QQ6A 2CW5A 3PQ6A 4MVXA 3WL4A 5J2UF 1SWVA 1SV0C 2ZJ8A 3PFHA 3ZY6A 1FDUA 1CUSA 2O1XA 2PXAA 4MUHA 5D1NA 4Y9RA 3K0CC 4URYR 1NNUA 1L8QA 1LTKA 2J7PA 1SC3A 2VJQA 3DHEA 3HEMA 3IXQA 2WM9B 2QHXA 3O1JC 2H1VA 1ADFA 1N2EA 1NNEA 1EM6A 3V7YA 1EJ2A 2HMWA 3ZIUA 4AECA 5FFFA 3WU2U 3SQMA 1ZPDA 5J2GA 4FHGA 4E5MA 1J33A 2OO7A 4JJKA 4A8JB 2PVSA 4N03A 3R7SA 4TTJA 2ZT5A 4C8LA 1SB3C 4L5JA 1IE3A 1O5OA 2A9PA 2QPAA 1UBCA 2Y2UA 2Z58A 1M0WA 2R4TA 4ZQFA 1Z2PX 4FEEA 4PR0A 4HAIA 3MMZA 4QO8A 4Y0AA 9ICIA 1AS3A 2GSDA 1ZK3A 2CGEA 3CZ4A 3CW2A 3DWFA 3WKCA 4RPZA 3LDHA 2EFEB 4PR3A 5HP4A 1L5WA 4TTSA 1U11A 3KKNA 4A27A 1V43A 1U0BB 4BEVA 3FRJA 3ZOZA 4JENA 2IE0A 2BEWA 2WJWA 4PHCA 2DWQA 4W7IA 1ZK4A 4XDYA 5HF5A 3TTUA 4TKVA 3N74A 3W7BA 3QLTA 4H08A 1C81A 4TT3A 4V03A 2OHHA 3SAJA 5H82A 1XT6A 3OQJA 2F1IA 3QE0A 3AU8A 1RBMA 4RWZA 2E49A 1VZ2A 1M5RA 2HJRA 4HFMA 4KXQA 1TUEA 4RH1A 1X1AA 1PQPA 4QO7A 5MFZA 4J75A 3IAS1 4ND4A 2GJKA 4JOCA 4LXQA 3S5UA 4FM9A 2PUAA 1AUVA 2INGX 1RBZA 3DGEC 4ZI5A 2G36A 4DMKA 2XKAA 4IDCA 4CEHB 4ATNA 2WBLC 2LZ0A 2GEUA 4KMUA 3P5SA 5BWNA 1T9KA 1M0TA 1RPJA 1T9BA 4WGGA 4AKTA 4ED6A 1X19A 2F48A 2C2EA 2A58A 2ORED 3I12A 3MWDB 3V2HA 2JKZA 2XD4A 3ACDA 5EUCA 5TPWA 2XADA 4U2KA 1P17A 4A6DA 4S2EA 4ZARA 3H97A 3COJA 1C9YA 4OQLA 3I9V1 3QVSA 1AGYA 2V74B 3MCZA 4DQDA 4CM8B 3CT4A 2ZBDA 1D6JA 1GDHA 1OX5A 2V54A 3QZ7A 4Q7KA 4X1IB 5J2HA 3ZOKA 4X5OA 3IXMA 2B2NA 2HJHA 3MERA 4IUCS 4LOKA 3TGWA 3U7HB 2QG4A 4JI5B 3STWA 3GGSA 2EQYA 2IHZA 3HKDB 5KHOC 1FXUA 1YJ8A 1ZUNA 3SYTA 2HJWA 2Q46A 4QJFB 2YQZA 1D0IA 2FF5A 3KZVA 4RE5A 4TLBA 5J5AA 1TO6A 4W7HA 4G0UA 1AK9A 4KAAA 3WY9A 4NCNA 5FOUA 4FHFA 1PK8A 4ZGWA 4ANFA 4QM6A 2O0JA 5CVEA 4I8IA 2DEUA 3GEPA 3CG0A 5ECYA 2C88A 5HILA 3TSOA 4RCYA 3DZ8A 3KQHA 3DHWC 2YWCA 2PIDA 3FJ1A 4HYKA 3B5JA 4YJ2F 2VT3A 1OX4A 1NX9A 1J7KA 1R12A 1VG8A 2PV7A 3HKDA 3C21A 2RGWA 4X95A 3TINA 3ZZUA 2OBYA 2X5JO 2VK2A 2R7NA 5KB3A 1V47A 5TEVA 1QS0B 5JD5A 1MPXA 4CLHA 3WGGA 3TLEA 3UAOA 4ROTA 4GYWA 3KE9A 1J00A 1V37A 1PVRA 5H59A 4LA4A 1PVOA 4W1QA 2XYPA 3TAXA 3AG5A 3HXKA 3WA7A 1ABFA 4HB2A 4MGYR 3VR5H 1BNPA 5D7NA 2QTMA 1SVUA 3C16C 2H54A 2AXPA 5CX4A 5FBLB 3PW4A 5FWAA 4LYFA 4X45A 4N54A 3IT3A 3TRHA 5B53A 4RLFA 4DIOA 4EZBA 1QSGA 4IV8A 5IAGA 3TCKA 4M9UA 4Q7JB 2XI4A 4UUNA 4YJGA 4R0NA 3DDNA 3KLNA 5DHPA 2JZBB 3HJTA 1PTKA 1Z3EB 4S1PA 4X92A 1U7TA 1HOXA 2QXYA 3LW7A 4ND1A 3URKA 3UV3A 3RF6A 4BKPA 1UEXC 3MGKA 4F3KA 5JQGB 1EXVA 2JGJA 5FR1A 5H81A 3KZ1E 1TYEB 3RYCB 1RKUA 5EIHA 5T41A 4K8OA 1GUYA 4OBEA 1OXMA 3TTWA 5EKXA 3LHDA 5G4KA 3G8BA 4R1QA 5HF8A 2VIXA 1X8JA 3J7TA 4GOND 1AKTA 5JATA 3W2TA 1TA0A 2C8JA 1JQEA 4XPIB 4Z5XA 1OQAA 3RR8A 5KQPA 3HRKA 3RIXA 3LHFA 1A1VA 1Y81A 1I5EA 3VRHA 4KO3S 4LVSA 3I6ZA 3LQRA 4M98A 1IDN1 1V96A 2IEDA 1R0BA 4U2CA 1JQDA 2X0EA 3S1SA 4XWWA 1W5BA 2GMWA 1H8ED 4ZTUB 2AYYA 1POWA 1QC5A 3LFTA 1IK6A 1RMTA 4BX0A 4PGQA 2CFCA 2R4QA 4DJDC 3PPVA 1QDLB 2G9NA 1JIQA 1JTEA 2W5UA 4EYEA 1Z3CA 2AF4C 5HCUA 4LMAA 3INGA 1CUYA 5DNWA 4EYKA 4OHYA 3QY0A 1N36B 2XWSA 3NDBB 3R3JA 3G2JA 4OHKA 4NLGA 1YFKA 2QN3A 1EIWA 1T8WA 1GQRA 2V6JA 4DLXA 4W1RA 2XDQB 3Q7RA 4OK5A 2SKCA 2OG2A 1PZXA 2W6QA 3RS5A 4NV0A 4KR6A 4UBJA 1NRIA 1EE1A 3RQIA 1IHOA 1NJSA 2VATA 4W5WA 4F93B 2CXHA 4FGSA 1LSSA 2CE7A 1IY8A 3IHKA 4CWAA 3KYIB 3H0MB 3KHSA 2BDUA 2B9VA 5KOHA 1KPHA 2CVPA 2NZYA 2XCQA 2XJ4A 3BWDD 4Z9XA 5ILQA 2HC9A 3U6KA 4X24A 4QNNA 3BFKA 1OI7A 4TQGA 2RDMA 3AM5A 4YXWD 4R69A 2ST1A 3BTOA 4GR9A 3SYZA 5E7QA 2TMYA 1WEHA 2PRYA 3PT9A 2WFLA 3PHHA 4A2QA 4DDKA 2HTEA 1IM4A 3KHKA 3N7SC 4DJTA 4QZDA 2ZAIA 5L3QB 1E5LA 1JDBB 3AY7A 2EJUA 2Q5EA 5HUQA 1N48A 3GUVA 1VCOA 3ECCA 4ZN6A 4JBNA 1R66A 2KK0A 1U1DA 1SIWA 3EGWA 1E99A 4PCAA 4Q4HB 1YS6A 4LGVA 4RC9A 5KCZA 4CUJA 1XFAA 2OPBA 1E9EA 4ADSG 1A6SA 1S10A 1OAOA 2IYOA 1NYLA 5BN3A 4KE9A 4M99A 4ENVA 1TIKA 1WHSA 4UUOA 3P4XA 4O4HB 2QRMA 3SZGA 8ICSA 3AR6A 3O47A 4TLMB 5ITVA 1Z8NA 1NQ5A 2WHRA 3QJGA 4J2OA 5ARCA 3W5SA 4CFYA 4FMDF 4QLBA 2ZZMA 2WUVA 4OQ4A 3T54A 4B4OA 2DFKB 5T4FA 4FE3A 3EDYA 4QDJA 9ICLA 4RT2A 1OA0A 1YS7A 4O3FA 5F1KA 1ONPA 5FTKA 5KU1A 2I4OA 5HJ7A 1MEOA 4G67A 5KKAA 2MT9A 3QV2A 1NN0A 1UBTS 1II9A 3B70A 2X0RA 3FMVA 4H2DA 4N3NA 4OBXA 3PVCA 4KLRA 4RVNA 4TKMA 2IX9A 5B55A 5FDFA 1VTKA 4GGMX 5AHRA 4TKLA 4BJ3A 3BC1A 4UNPA 2XDQA 4YMNA 1NBAA 5AK0A 2VEDA 1VRWA 2FPPA 4NG5A 2WA2A 5DOVA 3RU9A 3QU2A 1QR2A 1C1YA 4GKBA 2QLTA 2VH1A 9LDBA 2XH8A 3JYNA 4DVGA 3JPYA 3SEQA 4G2NA 4UVEA 5A4JA 2PMZF 3ZNOA 1J1ZA 1PBTA 3CEPB 1QIDA 1ZJJA 2M98A 1BOFA 4AJJA 3CW8X 4IHAA 5TT1A 1FSGA 3O4GA 4MI6A 3OAAD 4J9PA 5J2AA 4EPWA 3NM4A 4BIMA 2QVZX 1H1LA 5AVYA 5JISA 3O93A 4G25A 2H6EA 4G5RA 4I5FA 3QVTA 3VZSA 4EJSB 4XSGA 1FUIA 2RMKA 4UFNA 4OI0A 2DUMA 4R6WA 1SCBA 1WMSA 4Z99A 4C0LA 2R00A 4RHYA 1I4WA 2MR6A 3C6KA 4V0SA 4BLUA 3WBBA 2K7FA 3RUDA 3F3YA 5DBOA 1JIVA 4BY9E 1BNCA 1PQYA 2A57A 2FDXA 3O5AA 2YMMA 1QMGA 1J2TA 2J08A 1GD1O 4M1MA 4MPPA 4CLRA 4FWIB 3IDQA 5AVVA 1ORDA 4RZ2A 3EMKA 1ODIA 3KXLA 1FBTA 1NNSA 1RLUA 4MUJA 3ZD6A 2P8JA 1JECA 4AJ4A 1RPTA 3L7OA 1O94D 1RWNA 3FCYA 3LS2A 4US8A 3CMCO 3KJEA 2O1WA 1FVOA 2ETXA 3EN0A 1ENPA 2H00A 4U7FA 4D0NA 1TUIA 2ZAMA 1P3JA 3SQOA 5JRZA 4OO1J 5D2CA 3ZVNA 1KBZA 3BT7A 1QVVA 1F2TA 3RWBA 3CUKA 2ZITA 3SC4A 3HYNA 5B3KA 2XHEA 5IH7A 2CRXA 4RXTA 1R88A 2GI4A 4JC5A 4DY4A 4EKDA 2RJOA 2BWJA 5KTSA 3FAKA 4CYMA 2JD1A 1LPOA 3CWCA 4I5EA 4PLHA 4WBXC 2VK8A 4ALLA 5DX1A 4UNRA 4I14A 3MGAA 1CQJB 8ICIA 1AZWA 3UXEA 5A7GA 1I7DA 1Q77A 1DO0A 5KFXA 4YAJA 3OLQA 4W8HA 3D1JA 2I8AA 3IILA 3M4XA 3OZSA 1H1DA 2HYIC 4LE1A 3TRIA 2CJXA 4L85A 4J16C 4EGJA 1MH9A 2DPYA 1EGQA 3OEHD 1YTUA 3SWWA 2PT6A 3PNOA 3NRJA 3PX7A 2SCUB 2ALJA 2J4FA 1H8HD 3KVNA 4B9VA 3Q88A 4FCVA 4FI3F 4OMUA 1RZVA 1EB9A 4WY5A 1NRJB 2H51A 2ZBQA 4YRFA 4CV3A 1NR5A 2WJ3A 2Q6KA 2XCOA 2BHTA 4UPEA 3QVVA 2PE5A 1JXAA 3T35A 4XB6B 2UZ1A 5DK6A 1J2EA 4UATA 3O03A 1X7HA 1XPRA 2X15A 4PANA 3KT3A 4JHXA 2W7OA 4HWTA 3WTBA 4P84A 1DAHA 2O1EA 5JS2A 5JAHA 3RAJA 3OHMA 2GZ3A 4HNRA 3SY8A 4PYJA 5JNUA 5IC6A 1XWWA 5JXWA 3VVMA 4H0NA 4F4ZA 3ROZA 2XECA 2XWJI 1MP0A 1NT4A 1V3UA 1GNLA 2ZR8A 3BXZA 1QG4A 1TAQA 3RJHA 1DL5A 1FP7A 2DX7A 3LHKA 4Y6LA 3TR6A 4WBNA 2YRWA 4K6OA 5CXXA 3IHTA 3H9EO 4E5PA 4DNOA 1UAYA 4D82A 4HRYA 4IIFA 4ZOEA 4MB2A 1GQSA 1ZGAA 1UZLA 4YV0A 2AEEA 2IBSA 1CQZA 4G0OA 2RARA 4BNMA 2CHUA 2H18A 2KN7A 5C1OA 2KX7A 1K5OA 4DL4A 5DMHA 1B6TA 2BMDA 3ALRA 4ZIRB 3O0FA 3QMMA 5G4LA 4KI0A 1P2TA 2C4NA 4YT5A 3N2GA 4KGDA 1OI4A 2PQ2A 1RKVA 2P2YA 4J94A 4KXUA 2IHKA 5DX8A 4UC0A 1H93A 1DAKA 3I6YA 5AJZA 1GXSB 5IVDA 7REQA 4ZRNA 2B0CA 5FUVA 1R6TA 4FFMA 2PH1A 2YDYA 3V8RA 1OC4A 1NVXQ 1SQGA 1TQ2A 4ISCA 4E7OA 1QUEA 2VJ5A 2IKSA 3BSYA 1LVHA 3G5LA 3OKFA 4KFSA 1UAAA 3GDOA 1ZJMA 4DCCA 2HU2A 7ICPA 5HQ3B 3A37A 1SBYA 1NMSA 3IJPA 4LPKA 1E20A 1RWVA 1LFAA 3KM0A 4NMHA 5AW7A 1UC4B 3RDPA 5J2TA 1X1DA 3EH2A 4TLCA 2LNDA 1JNYA 8ICBA 4O4IB 3RKUA 4DL5A 3GJXC 3DT9A 3BDVA 3C8MA 4QZIA 4QWBA 5HNKA 1K88A 2WVGA 5A6SA 1PZHA 1J2UA 3BWVA 4FFBB 4HXFB 5CAEB 3WBKA 4C0AC 1KHTA 2BMEA 1M6EX 3V8NA 4JSRA 5IBCA 2E5LB 4CEJB 3GT4A 3PIDA 3ET4A 1NHGA 5FL7D 4XWOA 2BR3A 3CS3A 1KYQA 3JXEA 4RANA 3RJMA 1OV6A 5G2OA 2FV8A 1N1MA 1TQHA 1OFUA 1VCIA 1N9KA 2XTZA 4I2NA 3GO4A 4LDNA 4YJ3F 1VMDA 2XWBF 1R18A 4MWTA 3W9BA 1X2EA 2UVWA 4IHJA 3ZBTA 4GLBA 3ZDBA 1NUPA 4HQ6A 4PC1A 4YK7A 4AF6A 2ZSEA 4RSHA 2MMCA 3GJZA 4YLEA 4BVFA 4CDRA 1MENA 1Z8HA 4D3ZA 3KQQA 2RE8A 1WL8A 4KRYA 1D0SA 3EZ2A 3TEFA 5EWLB 2JAHA 3DCNA 1P9NA 3OAAA 1R10A 2R7LA 2XVTA 5AUNB 1L7MA 5EYPB 1BKSB 1CR6A 3Q11A 4P38A 2JIBA 3WO1A 3ZV3A 1WXGA 3GDWA 3MFQA 2V4MA 4HDNA 5C3UA 4CIVA 4EFLA 4YFKA 2EWVA 2JHPA 3UYKA 4JQZA 1RJEA 2GCOB 3NOQA 4M8KA 5JE8A 3K94A 1XZGA 2R7MA 5I6DA 1FO4A 3JQ8A 4RKRA 4F8EA 3SG0A 1FXSA 2UZ3A 3QEAZ 4AIIA 4EA6A 2XZTA 3K16A 5B37A 4QWEA 1AUQA 1RXEA 4MULA 2GWSA 1FNCA 4KN5A 2Q7XA 5CA0A 5THKA 3RYIA 4B6FA 4YUXA 4KGVA 5H83A 2JAPA 5INTA 2QTTA 2Q4BA 1T0BA 3BA1A 2BHSA 4HAWA 1KBUA 2LIVA 2IYQA 1C1HA 2PM8A 3ECSA 4N3AA 4PV7A 3PFWO 1R0ZA 3U56A 1R64A 4FYYA 1XZAA 3UGQA 3EEYA 4CGYA 1LK7A 1DG3A 1L5FA 1LJUA 1WXWA 2KS6A 4BJQA 2OUKA 3FZEA 4WA8A 3K5IA 4WINA 1TUBA 3V7NA 1BXGA 2HCJB 4A5OA 4DR2B 5AK5A 1CKEA 4CKBB 3IPRA 3DNPA 4BVAA 3STVA 4YJFB 5DTJA 5ES4B 3WDLA 1Q57A 4LZDA 1THGA 5FUYA 1MZPA 4O1MA 1ZQGA 1UCVA 2O05A 4ENUA 1HYGA 2ZANA 4ESHA 3WK5A 4IM7A 4RPCA 1ZICA 4JWMA 1GR0A 4PE5B 2WWIA 3M3PA 3GPLA 1N6OA 4R9SA 2QUZA 3P9QA 3PV8A 1M0SA 2NO9A 5CLQA 4JWNA 3RV4A 1PV4A 1EIZA 2B69A 2JD2A 5GJCA 4DGSA 1D9FA 1TT5B 2XA9A 3RD5A 5K6TA 4CLDA 1KSJA 2WD8A 1RS0A 3H5IA 1PD1A 1E0KA 2W6JA 4UZSA 4A8PA 4DSIA 2W2VA 3C29A 3V97A 3OQIB 3WL8A 4BFYA 2UZAA 3VA7A 4JLAA 3DVAA 3E4CA 5L3SB 1JUDA 2O07A 2ZYDA 1SO8A 2XE8A 2XMDA 1AKEA 2YASA 5DZSA 4BLQA 4J9UE 1G3UA 1WBJB 4KQIA 4LRSB 2ACVA 3U4GA 5KNIA 3BB1A 2JCYA 3WOVA 4HUQB 1FFEA 2C3UA 2D00A 2JGDB 1YMQA 1MU0A 3GA0A 4BP3A 3SEIA 2HU7A 2M9NA 2Y05A 4L8LA 4ND7A 5SZIA 3V2IA 4AUMA 1R0RE 3LSTA 4ZOBA 3BILA 2IYWA 3CCBA 2D2FA 2FX3A 3GLSA 9ICVA 4EVIA 1TVMA 4OJ6A 1D9DA 4CV1A 4F5NA 4GLJA 2YINC 4C7KA 4G1MB 3W7VA 1YQQA 1L5LA 5JCXA 1RPLA 1QHGA 1WVIA 3WR5A 2BCQA 4Z8XA 5FUMA 3GN1A 1H1LB 3GZFA 5A2QA 3W1VA 1D1PA 2C84A 2OGSA 5J63A 5C0YA 4C7JA 3OC0A 2C1ZA 2JAUA 3VZBA 1A2BA 3M3HA 3QUQA 4PINA 1QGED 4H17A 3BZBA 3WMWA 5JVDA 2VTBB 4IJQA 4HDSA 3NV7A 4HB4A 5C0OE 3SX2A 1A9XB 2ZE6A 1NM5C 3VAYA 3DMTC 2XQGA 3CEJA 1QF7A 2W2NA 1SBNE 1JA1A 1XEWY 4M9XA 4MKGA 4WEOA 4DN6A 2IS4A 5KFUA 3M6IA 1SY7A 2WKSA 2PXCA 2YOGA 4GWLA 3VDRA 1I7PA 2A30A 3TMYA 1JFRA 4IL5A 3VR6A 1NXTA 1UK6A 3R3HA 4Q9AA 1TM3E 1LDBA 4Y9SA 4ELVA 2QTVB 3OCXA 2CLEB 2H11A 2FWAA 3QKTA 5E95A 4P7BA 1DWOA 3IJRA 1T36B 4M0LA 4I3HA 2ILTA 3TBKA 1T4GA 1E1DA 1L4FA 4JD5A 3NUZA 2JCGA 2J3JA 3O6VA 4G8JA 4NLZA 1PHRA 1W76A