3SD7A

1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
KKNYEIVLFDLDGTLTDPKEGITKSIQYSLNSFGIKEDLENLDQFIGPPLHDTFKEYYKFEDKKAKEAVEKYREYFADKGIFENKIYENMKEILEMLYKNGKILLVATSKPTVFAETILRYFDIDRYFKYIAGSNLDGTRVNKNEVIQYVLDLCNVKDKDKVIMVGDRKYDIIGAKKIGIDSIGVLYGYGSFEEISESEPTYIVENVESIKDILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
molecule keywords Putative phosphatase
total genus 82
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3sd7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sd7A01
2ZBEA 5AKHA 2HF2A 2VKQA 4ZEXA 3L8GA 4KNVA 2D2VA 1IWOA 1VFPA 3L1VA 3B9BA 3DAOA 4E88A 2I7DA 5ALZA 5AM4A 2HI0A 2HX1A 1T5TA 5AKYA 3U7HB 1ZS9A 4UMVA 2G0AA 3WK8A 4EEKA 1QH9A 5AI6A 3MMZA 1L7MA 5AM1A 2I55A 1QQ5A 3N8GA 2FPXA 2ODAA 5ALKA 3KC2A 5FP0A 1WVIA 3ZW7A 3W5BA 2BDUA 5ALFA 3N5KA 5AVWA 4G9BA 3NASA 5AW6A 5AI5A 5ALOA 3WGUA 4YCLA 3ZVNA 4KX5A 1K1EA 3QUBA 4UM5A 2G09A 4QJBA 3ZUPA 1O08A 5AVSA 1Z4LA 3N28A 3L0CA 1Z4IA 3ZI4A 4BX3A 2EATA 4I9FA 2C9MA 3DV9A 2Q5EA 2MU2A 1L6RA 2QYHA 2WF8A 3U7FB 1QQ7A 2YFYA 2FUCA 3ESQA 1RMYA 5AVYA 4DFDA 2B8EA 3PDWA 5AVVA 5A3SA 4Y2YA 2CN1A 3L0BA 3PGVA 3CZ4A 5AW0A 2FPRA 3QGMA 1YV9A 4O8CA 2NO4A 2NYVA 2AMYA 3L8EA 4UU1A 3KDPA 2O2XA 1F5SA 2B82A 4AP9A 1S8OA 4IG4A 3S6JA 2BY4A 4MWOA 1Z4JA 2MSNA 1FEZA 5AKZA 5AK6A 4F72A 4J2TA 5A3RA 5AKIA 3A1EA 3ZU6A 2HHLA 1Q91A 2P69A 4KN8A 3KBBA 1YS9A 2G1AA 3FGOA 1Z5UA 1RKQA 2JAOA 2PR7A 4UM7A 4EZEA 3QNMA 4XOUA 4ZEWA 3KZXA 2C88A 2IA5A 3IB6A 2GO7A 3QXGA 5AW9A 5AVZA 1LVHA 3AR2A 4NAVA 2JARA 3KOOA 5ALSA 2HCFA 4UMEA 5AW1A 4BYGA 5AM5A 5ALWA 4HGPA 3MN1A 4AS2A 2HOQA 4Y2QA 5E0OA 2OA0A 5AICA 3UM9A 5AM2A 3R09A 5A3QA 2GHTA 4Y2UA 3E58A 4UASA 1L7NA 4BEVA 1L8OA 3NAMA 2WHEA 5ALIA 3QUQA 3L7YA 2I34A 2CFTA 3WKAA 2HDOA 4CE6A 1SU4A 3PCTA 4NABA 2HF7A 4UATA 4OFZA 3U19A 1YDFA 3FPBA 1RLMA 3I1YA 1RRCA 4F71A 1WZCA 3AR8A 2PQ0A 3U13A 1L7OA 1VJRA 3AR3A 3VAYA 3OCVA 3WKBA 4Y2VA 1TJ3A 2B0CA 1U02A 4YIHA 3ZVLA 1RQNA 3QU5A 3ONNA 3NRJA 4L57A 2IYEA 3EPRA 4H1WA 3W5CA 5AIAA 5AW8A 1SWVA 2WM8A 3OCXA 4YH1A 4KYTA 1CQZA 1EK1A 1LTQA 2C8KA 4XQ0A 3QU9A 4PNHA 3AR7A 2FPSA 1ZRMA 3QU7A 1ZD3A 3E81A 4YCMA 3ZVMA 1QYIA 3ESRA 4I9GA 2CFRA 3FZQA 4L6CA 2G08A 5ALTA 1TE2A 2R8XA 3AR9A 5IS2A 5ALMA 4NWIA 1ZD4A 3WK5A 2RBKA 3QLEA 4HGOA 1NNLA 4EELA 2YY6A 3WGVA 5IT0A 3I6BA 2RAVA 2YMQA 2YN4A 2YJ6A 1U7PA 4FE3A 3BA6A 1WR8A 1L7PA 1TJ4A 5AW4A 2WF9A 5AKEA 3WK7A 3ZTYA 1J8DA 4HAIA 1Y8AA 2AUTA 4YIKA 2Q4RA 4UU0A 4BNDA 2GHQA 4J03A 4Y2PA 4OD0A 5IT4A 5AIBA 4Y3UA 2P27A 2B1RA 3UMCA 3SLRA 2YJ4A 3DNPA 2ZOSA 4B6JA 4Y2RA 1ZOLA 4YGYA 2B1QA 3U7EB 5AI8A 1PW5A 2B8JA 3U7GA 2I33A 5ALEA 2IOFK 2C4NA 2DQSA 1RKVA 5AW7A 2P11A 5ALGA 2P9JA 2WF5A 4BX2A 2G06A 1NRWA 3AR4A 2FPWA 3U26A 2HSZA 1NF2A 2R8EA 1RMQA 1Z4KA 1X42A 5ALHA 1SWWA 4CF5A 1RLTA 4RESA 3NANA 3ZTWA 3TLMA 3ZWDA 3WK9A 4HGRA 5ALQA 4BX0A 1VJ5A 2WF7A 5AESA 5AM3A 3EF1A 4UMFA 1Z4QA 1Z4PX 5ALUA 3L1UA 3EWIA 2CFSA 3E8MA 5AM0A 1RC8A 3SHQA 2G07A 1TJ5A 2JAUA 2R8ZA 4DW8A 5AK4A 3W5DA 2W43A 5AKLA 1RLOA 4DWOA 3QUTA 2EAUA 3D6JA 3P96A 3RFUA 4EENA 2ZBGA 3FVVA 5AVUA 1Z4MA 2RB5A 2ZBFA 4FFDA 2C8LA 4EX6A 1Z5GA 4ZEVA 2OBBA 3SKXA 2R8YA 3A3YA 1CR6A 1Q92A 2O9JA 5ALPA 3UMBA 4OCZA 2AH5A 3WKDA 4YCNA 2YMPA 5AHXA 3E84A 5AKXA 3ED5A 3M9LA 3OPXA 1N9KA 5AKJA 3NIWA 1RDFA 2JGAA 3PGLA 4Y2TA 5ALXA 1ZJJA 3L8HA 5ALYA 3HLTA 1ZD2P 2YMLA 3L8FA 4AS3A 1RMTA 1QQ6A 3WKEA 1L8LA 1YJ5A 3EF0A 4G63A 4NFLA 2AGVA 1U2TA 5AW2A 3I28A 3N1UA 4GXTA 3ZWKA 2W4MA 2FUEA 2Q4TA 3WK6A 3MC1A 5ALRA 3BWVA 4JB3A 2IOHA 2OYCA 3QX7A 2ZG6A 3I76A 4DCCA 3HYCA 1XPJA 1S2OA 2RARA 3WKCA 3QUCA 3MPOA 3W5AA 2WFAA 4GIBA 5ALVA 5T41A 2FI1A 4L6AA 4FYPA 4BNDB 4CF4A 1Z88A 5AK3A 2GFHA 5AW3A 4JDPA 4HYTA 1ZD5A 4UW9A 3ZX5A 1XP5A 2PKEA 4KNWA 3L5KA 1T5SA 3CNHA 2GMWA 4XPZA 5ALLA 2QLTA 3OTQA 2YJ5A 3SKYA 5AK5A 4KX3A 4Y2SA 4UMDA 2WF6A 2EARA 1Z4NA 3KD3A 1JUDA 3QU4A 1RPZA 3J7TA 2FEAA 5ALDA 3R9KA 1J97A 3B8EA 1Z4OA 2FPUA 3RF6A 3QU2A 3F9RA 3NUQA 3FPSA 3IRUA 3IJ5A 4Y2JA 4NV0A 5AW5A 1RQLA 1EK2A 2IOFA 2YJ3A 5AI9A 3OCWA 5ALNA 2ZXEA 1KYTA 4HGNA 3OCYA 4QQFA 3ZX4A 5AKKA 2I54A 4EX7A 1U2SA 3SD7A 2MU1A 1YNSA 2G80A 2W11A 3AR6A 3K1ZA 1XVIA 5AI0A 2OM6A 4RETA 4CNQA 4HGQA 3DDHA 3OCZA 4UAVA 3UMGA 2B30A 5AI4A 4BKMA 4C4SA 1O03A 1TA0A 4UARA 1RKUA 2FDRA 1WPGA 3L0YA 2X4DA 4C4RA 2NO5A 3B9RA 4BEWA 5AVTA 5AKGA 1U7OA 5AVQA 1MH9A 3WK4A 4BBJA 1T9ZA 2ZBDA 3R4CA 1AQ6A 3SMVA 3A1DA 2BDEA 4CF3A 2HO4A 4MUMA 4XE5A 5AVRA 3OCUA 4UAUA 4Y2XA 3FM9A 2JAWA 3GYGA 3AR5A 4OHFA 2YBDA 2HEGA 4C4TA 3A1CA 1N8NA 4IFTA 1YMQA 5JJBA 3NALA 5ALJA 2YMMA 3QYPA 3SF0A 3ET4A 3N07A 3ET5A 5AVXA 3M1YA 1ZRNA 2I6XA
chains in the Genus database with same CATH superfamily
4OAQA 5TY0A 4QO8A 4ECXA 2ZBEA 4JAVC 2QU8A 2QLLA 2VO1A 5JALA 1AXRA 1NJ8A 5LXTF 5FYDA 1SFRA 1OXKB 1T0BA 2H8KA 3DAPA 4HG2A 5EHNA 3RTEA 1KWGA 1RT9A 2FE9A 4R84A 4MRMB 2BVNA 2QT1A 3DHYA 4IYJA 2B4QA 4MYCA 4V3CA 3UK1A 4J1TA 2OG1A 1YQQA 1KC3A 3DOJA 3LLSA 2QV0A 3K16A 2C2XA 3F1KA 4RKEA 3AVPA 3ID6C 2NP7A 1N78A 3SBDA 2LGJA 2QDXA 2PWYA 3QEMA 1EFCA 4LCEA 4UMVA 4NZNA 3G9UA 4UZFA 5KFYA 2DFDA 1E1NA 3PLRA 3G2JA 4KQ1A 1CFZA 2GPBA 3N2KA 3ROKA 1X2BA 5KJFA 2ZRPA 3UW1A 1FMCA 3R8FA 3DMTA 3KPUA 3I3OA 3V6KA 2J4CA 1OC4A 1N56A 2FFQA 3TQSA 2CYCA 3EYZA 2EFYA 3EVGA 3WL8A 1V8DA 1QTNA 1ZESA 3I9KA 3RVPA 2E5FA 5A1TA 3BORA 4DMHA 1MV8A 1SU6A 4M9UA 4BMZA 4CIDA 5EINA 2UU9B 2W2LD 3SDZA 3WJ2A 1SG6A 4JQZA 4D3YA 4BNYA 2BGRA 3B2EA 4IXTA 4LJ8A 3UA3A 3VOBA 4QTYA 4YAWA 5CPFA 1S10A 2QORA 5CEJA 1XC9A 3BWXA 5JNWA 1Z4LA 2I7CA 4NICA 2GCEA 1RE1A 2DJ5A 4NJOA 3SI7A 1KO7A 1CEYA 3GLSA 2C9MA 3CZ5A 2WB1F 4ZI3A 3GF4A 4GZ6A 1U2DC 3U6KA 3VMFA 1VGRA 1ZQZA 1CDDA 1YB7A 4RQ2A 2OHGA 2VHJA 1HWYA 2WG0A 3PFCA 3REQB 5IKMA 4IUCS 2CLKB 1JSRA 1E32A 2IY8A 5HR7A 3K0SA 1M34E 3BT7A 1IY2A 1CU1A 5BQ3A 2F55A 4B9UA 3IKLA 1E8MA 4QEZA 4TMYA 2WHPA 2FX2A 3L1HA 5CTAA 1B43A 5ITZA 2WQ6A 5FOSA 4CZ2A 4O8CA 5HJEA 2PKXA 1KWKA 3LCMA 2Q5QA 5CAEA 3ZXIA 1C7EA 5DG7A 1FXUA 2REBA 4TYPA 4KRXA 2FUKA 2A33A 5A5EA 4D26A 5TNXA 3LO5A 2HJVA 4FMCB 3Q7QA 4BFYA 1SUWA 3ZQJA 2FKAA 5MFPA 4QJFB 1AQJA 2ZRNA 4MV6A 1F5SA 1G3QA 1EUZA 1PJ3A 1QBGA 1SOWA 2C2HA 2FMHA 3RRMA 4UCQA 1YB6A 4Q8EA 1GTJ1 2WIFA 1U7TA 4A8HA 4GC7A 3CS3A 2QXYA 2Y71A 1O87A 2BY4A 2AOWA 2NU8A 5IDWA 2QP9X 1VCOA 4MR7B 4GLXA 5CDSA 3QFFA 1DKNA 1HKUA 5KI6A 4MCAA 1QRUA 4RF5A 1CUVA 1N9ZA 1U8UA 2C2RA 4J2TA 2JFWA 4P35A 2CMFA 3RKSA 5A3RA 2WZDA 3GEDA 5J2CA 4IEEA 3R6DA 5EUBA 3BCHA 3SN6A 1BCRA 4INOA 4FWBA 1J70A 1JEQA 4I27A 1MRNA 1UPTA 2W9BA 1ODIA 1PWEA 2UYOA 1OTYA 2OCXA 3ZDCA 4Q3AA 4Q4LA 1Z5PA 1JTFA 3K9FC 2HHAA 3HJAA 3WSWA 1DEHA 4UHBA 1O6CA 1V38A 1GPUA 3DQPA 3PR5B 3HZHA 4M0UA 4MV8A 1NYRA 5JMWA 4NCKA 2ZT7A 4L75A 2P40A 3O75A 1P80A 5BSMA 1ECPA 1KH1A 4MQUA 2GA8A 3OZGA 2HBKA 2BI7A 2IX9A 2JARA 2PM8A 4TN5A 1N2JA 4Q1FA 3TG2A 3DF7A 4KAXA 3VPXA 3EODA 4H6WA 1T8WA 2I4TA 1M7BA 2DCUA 3MN1A 2RONA 1P2VA 3AIIA 4QPPA 4B73A 1KL7A 4Q3EA 2BGNA 1DO0A 1HQCA 2HFJA 2ORYA 4MUEA 4WJKB 5FOXA 2X15A 3WBJA 4BDTA 3ETLA 3EY9A 5TISU 3DAYA 4FTWA 1OZFA 4BTEA 3DB2A 4XDYA 1F0KA 5SYNA 4FDAA 5HMLA 4PY2A 1HE2A 5JZBA 3EAFA 3DCYA 1E4YA 2HT6A 4OHWA 1MQAA 4V0SA 3PWTA 3H4IA 1KMQA 5CHYA 2GNAA 4RY9A 4CMAA 5IFKA 2PUCA 3DAFA 5LJLA 4ZQEA 2JH3A 2YCBA 1MMFB 4NLGA 1KSPA 4LOKA 1P7CA 2IVZA 5HW0A 1DRGA 2IXFA 4CV1A 2IEGA 3V3KA 2QN8A 4MIEA 5T8KA 1MO2A 2OVFA 1RBYA 4XQGA 3DFMA 4PX2A 1CE8A 4I55B 5CW2A 3CH6A 3ESXA 5AOVA 4YUVA 3STTA 3ADKA 2O8CA 3D5TA 3AR3A 5EZQA 1RYHA 2FEPA 2LCIA 4NHEA 3OCVA 4I2GA 3ENQA 4BO0A 1YR6A 5A4KA 2B0CA 4TYQA 4Q24A 1YKFA 4R1UA 3AO0B 1VYVA 3LQYA 1NP3A 3HRIA 3GGCA 4I9HA 5D3ZA 4OXRA 1H8HD 4TSKA 3RVRA 3UMSA 1BX0A 2XY7A 4B35A 5C52B 2ZR0A 3N8DA 2E48A 1A8PA 2CVQA 2YOFA 5HJ2A 4V2IA 3B0YA 3VOAA 4AAYA 4DJFC 1EAYA 1CY8A 4DREA 3J80A 2NO9A 2ZIUA 3QMPA 3UBMA 1EJ0A 3RUPA 1BCSA 4QZGA 1VDZA 2GYVA 3ZZ0A 2HLDD 4JC5A 3W1VA 3ZDFA 4EJFA 1NUQA 1HGXA 3LHIA 1RZUA 2J59A 4IJKA 5BNIA 3AYZB 3BJZA 4WNAB 4Z1OA 4YCMA 2F3TA 2HQ1A 4XM2A 2EDUA 1TL7C 2VG8A 2VHTA 4RWZA 4ZVLA 4QUJA 3OP4A 4MHVA 3N6XA 5F4BA 2J6IA 1RRGA 1APBA 4YJHB 3HP4A 4J0HA 5H4GA 3TFOA 3I45A 4FJ2A 1U0NA 3LT2A 4NHOA 2NU7A 2HLNA 4ECTA 4O3SA 1SCAA 3OU6A 3LNTA 5KCZA 1IPFA 1W88B 1GQ2A 1XJCA 5HS4A 1U7DA 4C7OB 2A9RA 4KWCA 5K99A 5LQSA 2VN8A 1NNLA 2BMVA 2C3YA 2WJZB 3HZOA 4I8DA 1ZOSA 4MULA 4J0DA 4Q9LA 4X92A 4F9FA 5JY1A 1VPLA 3MUFA 3BXXA 4JVSB 2Q1SA 3T1HB 4LY9A 2KP7A 3TFRA 2YJ6A 1UBRS 3HDVA 4PLZA 5FAXA 5IW8A 4PU0A 3M6ZA 2WIKA 3U3KA 3GNQA 4F50A 3MOGA 2NZ2A 4GLBA 1ZK0A 2PGNA 1GP2A 3LBYA 2WD8A 4LFAB 4QIWC 3PKJA 4O25A 3J7AC 4RK0A 1TAQA 4A0SA 3I5UA 1P31A 3CSSA 4OP3A 1MGOA 1YRLA 4WZBE 2P27A 1N48A 2I2BA 2GI4A 1XIVA 4W99A 2PU5A 3A1WA 3LVFO 2P3LA 2XSZA 4HEQA 3RIXA 2F3SA 3MB5A 3BMNA 2AJCA 4JP1A 1K7CA 2R9VA 3TE6A 3A6DA 3CLHA 1RYZA 2DPIA 4RQBA 3ZE0B 2WYHA 3GGGA 3P2EA 4IRMA 3ZU3A 1WKVA 3BWBA 1PW5A 4GMDA 1KZHA 4QICA 2I2AA 3OJEA 3V8NA 5LP1A 3D3JA 5GM2A 2NYRA 1T13A 1X8KA 3TRIA 4RLSA 4WXRA 1BS2A 1XP8A 2WRZA 3RRGA 1P5ZB 1MOZA 2RKOA 4FT2A 4CIBA 3N74A 5LDGA 5K03A 4TYYA 4UBNA 2CLLB 5DOZA 1YMVA 3ZIUA 2P9JA 4L5IA 3I9NA 2O7VA 2XWPA 2A5LA 2ZUSA 3LPNA 3EPGA 4QDZA 3TD2A 3U0VA 3QXXA 4QM7A 3KHSA 3G2IA 4G01B 4RIFA 3U26A 1NATA 4U9UA 4CG3A 4HI0E 4F4HA 9LDBA 3VO8A 2J6BA 3H19A 4JX8A 4R16A 2XZOA 1P1BA 3CRNA 8ICMA 4KMMA 5IT5A 4EY7A 1EXMA 3C3BA 4ZH4A 3RJJA 1BN7A 3X44A 1KBQA 2VYVD 1YZKA 4M1OA 4ZVTA 7ICQA 1MOSA 3KBOA 1IQUA 1IN1A 3DCNA 1NBME 4A6DA 5AM3A 1CHNA 4YCCA 5FNVA 4LC0A 3UHAA 2UZIR 3VKUA 2NSYA 3NT2A 2IZOA 3OG9A 1MAAA 4C6TA 1L4NA 1HDYA 4DL3A 1Q11A 2EHDA 4FW8A 5SY9A 3IMEA 1NIPA 4UXJA 2QRGA 3T3HA 1ZWKA 3FYSA 5CFNA 4K9RA 2IE8A 3VV2A 3PT9A 2EAUA 3H9CA 5IIOA 2HMAA 3HW8A 3D9QX 4KDRA 2Y9PB 4BDSA 4Q39A 1MABB 1CUCA 1CG6A 1F2TA 5IN5A 3DONA 3QPCA 2RB5A 5C1IA 1O94D 1BIFA 3Q0IA 3GLUA 3M49A 4QWCA 1HLGA 3IRVA 2AGOA 2JEYA 2JFYA 1CR6A 2WAQC 3V00A 1Z38A 1U7XA 1GO3F 5LDDC 5FA8A 3SJ7A 3SKVA 3RR8A 4O29A 3TINA 4OX9Y 1VKOA 4LMPA 1DBSA 5L3QA 2A57A 3OFJA 4HAXA 3DWEX 2C2ZA 1TZMA 3MDCA 1VL8A 2BUAA 2XKBA 3TADC 2XUJA 4JR2A 1BYIA 1ZQHA 4A0GA 1BROA 1GDDA 3K20A 2XUAA 3QKRA 1SV4A 4IHJF 1WLSA 1WVGA 2O05A 3L8HA 3LKZA 1UM8A 4N03A 4RJIA 4TRRA 2W9CB 2QW8A 1FUEA 3QVGB 4XPIA 1XZQA 4RZUA 2YMLA 1D1QA 2NX2A 3FLAA 5HS6A 3WLSA 2SBTA 1M75A 2W48A 4QXAA 3V2GA 7AT1A 1N2SA 5KFLA 5JXIA 4DR6B 1G3UA 1UAYA 1COKA 2SHKA 4KKVA 2C2YA 3E5MA 1Q0RA 2WSYB 4CTMA 1NVVQ 2PSFA 4PZAA 1T2AA 1Z07A 4TLDA 5THKA 3OT5A 2LBOA 3NKFA 1K0UA 2WJ4A 4GQAA 1ISHA 1HYGA 6PFKA 1F3OA 4TRMA 3B78A 1SOUA 1UWLA 1VMEA 1GU0A 4EIWA 3H1AA 2VYNA 3LUGA 2ZTSA 4MUIA 4AUEA 1G60A 3MHTA 3T1OA 5HR5A 3TIVA 4RFSB 2ZUEA 5KFUA 3FPGA 2BFFB 3UK0A 3JAWB 4ZN6A 1WDMA 3LJKA 2I66A 1SXJA 1XA3A 1Y4UA 5KVCA 1XRPA 5T41A 1R18A 3IDZA 2DH5A 4MB2A 4NH0A 1C8VB 5DIFA 3TSZA 3RGWS 3O1IC 4CF4A 4Y18A 3M4JA 3E9ZA 3HUEA 2Z6QA 3JSXA 4TS4A 3FAKA 3P9ZA 3TEJA 2JFXA 1VTKA 2E18A 2R11A 4MIOA 2Z2XA 3H0MB 2P2SA 3R75A 5EP2A 1S3FA 1I3CA 1EDBA 1YDEA 3ACDA 4NMXB 1SBYA 1EXWA 1PJ8A 2AMFA 2PKEA 3ENKA 1UJ2A 1N3IA 2V6BA 2Z4SA 4L1KA 4P84A 3RAGA 2YZGA 2BWJA 2QM0A 4Z6EA 3TLYA 3AEYA 5LYJB 4YBRA 2QAJA 2LV8A 1ZQCA 4IH1A 2I4NA 4RQNA 3K92A 3M8KA 4OY3A 1G9SA 2JIZD 5DRYA 3THRA 1Z4NA 3ZHVA 3TRFA 1F60A 4I55F 1T36A 4ENSA 1G64A 4CEJA 1OJLA 4QUGA 1VB3A 1QCDA 2O2CA 3EAGA 1RXCA 4PG6A 3I6ZA 1DXQA 1YOBA 1NMQA 4ROTA 3HCEA 1TD1A 2QLFA 3BMOA 3KRTA 1GNVA 4JODA 3KVOA 4I1IA 3PNMA 2AN4A 9ICNA 2EQAA 3P7MA 3LYLA 3C2QA 3EIQA 2EKLA 3F9RA 1BA3A 2WYVA 2GTIA 3PD1A 3LDAA 3DMTC 3NX4A 4ND6A 4UDXX 4ZFNA 1OHHA 2JRLA 3AWDA 4MI3A 2D0DA 3ZW8A 4X90A 1SBIA 3V72A 1D04A 1N4DA 2KLHA 1AURA 2TMDA 4YCAA 3PXGA 3WJ1A 2GBCA 1T5HX 1SPBS 3PPIA 4ED2A 4PV7A 1KKUA 2QTNA 2V1XA 1PG2A 2PS3A 3P71T 3NBUA 4QYTA 1KYTA 4HGNA 1H5QA 4X5OA 1KKMA 1P4GA 5JH7B 2RBGA 3K32A 1R6AA 3ZDXB 1JEYB 1REQB 1AKMA 4C22A 1Y5RA 5JT1A 1W36D 2AJBA 2D3DA 2I71A 1PUXA 2HK7A 2QR5A 4MPJA 5FPSA 2YUIA 1GRNA 5LBTA 3UK2A 3DNFA 4TYNA 4A8JA 3EARA 1J9GA 3OCZA 1RYRA 4CM1A 4BKMA 1UADA 3DDUA 1JIHA 3RU9A 1KSHA 2V7WA 4N40A 2ZIVA 4BNIA 4D1YA 3GLIB 2A9KA 4KP7A 2IF2A 2EF1A 3BE6A 3C8DA 4Z9XA 2QD5A 3U4DA 1RKUA 3JQRA 2OAP1 1NF3A 4O2AF 3STUA 1JIIA 4D9JA 2AW3A 3KDAA 5FO1A 2GKSA 1UXGA 4B6RA 1Z8FA 3L0YA 4YYEA 1IBRA 3AKYA 2VOEA 5A9SA 5KFJA 1ZAKA 2RDJA 1WCV1 5KFAA 1LBEA 2WWIA 1BEUB 1H1TA 4FYJA 1KI8A 4HZUA 1ZVMA 2BBOA 1KO4A 7ICGA 4K6KA 1VJCA 2VRBA 4XDHA 4C7MA 2V7TA 3SEAA 4RADA 2P6NA 2GZSA 2OZLB 1M2FA 1P3Y1 4D0GA 4LRXA 4TMTA 4V0ME 1R88A 3A9CA 4R2IA 4LUCA 4PLFA 3UPUA 3QZUA 5C9ZA 1E64A 5IT9A 1E63A 3I73A 3ORYA 2HBJA 3TJRA 3C7TA 4NPCA 4GHWA 3WQSB 3ORHA 5H83A 3ET5A 3DBVO 2E49A 2PSHA 3IXMA 2ZYTX 5JJBA 4DL9A 4GPEA 1SXIA 1X7YA 2ZAIA 2PZMA 3IR7A 4O4LB 4CMKA 2CBGA 5EOVA 5IEJA 1U49A 2XUFA 3T54A 1HO3A 2IZ0A 2RJ3A 4J16A 2I6XA 1JR3E 4FKBA 5DXFA 1PL6A 1C9YA 3R7WA 1QQBA 4GG1A 3W3AH 5HP4A 4PCVA 4ZEXA 4LDPA 4PICA 3W90A 1EYZA 3MT7A 5KHAA 2BTQB 2DRIA 3N8IA 4A82A 2GCPA 1T0UA 4BGDA 1TEZA 4N3CA 4NEQA 1QS0A 3CLTD 3ENZA 2TSYB 3AFHA 5JSKA 3BZWA 5ADVA 3K0FA 3IEPA 4OYRA 3T3FA 1PL0A 1E5QA 3O3MB 1U0LA 1NA5A 2XUZA 5DXJA 3VSEA 2KFZA 2Q8NA 1A9XB 3SAHA 5E6UB 4EG8A 1PR9A 1ZQ9A 3DV0A 1PR2A 4RJ2A 5AWFC 5D7NA 3EMVA 1R0ZA 721PA 3BWEA 3FUWA 4F9TA 1ZS9A 5DB7A 1YZ7A 3GJ8A 1AUQA 3OVMA 5C0OE 4K9SA 3NFYA 4EEKA 4LDZA 4B3BA 2IHZA 1W19A 2QM7A 1Y33E 5YASA 1QQ5A 4OXYA 1EVJA 2CCJA 2FMPA 4BC0A 4CFYA 1Z1BA 4C08A 1V5FA 2FPXA 2K8AA 1ZJ5A 3IJRA 3MINB 4URVR 3ZHUA 4A2WA 4U6QA 3ZQUA 3VYUB 3Q7RA 1Y5MA 3G68A 4IOMA 5F23A 1XNRB 3EFEA 3L06A 4NJMA 1Z5OA 1QZTA 4DQVA 4G9BA 1OFVA 2O3SA 4J7UA 2VNIA 9ICCA 1NY5A 4DIEA 5ALOA 4YN4A 3G6XA 3WLTA 1VPVA 2FX5A 4WCVA 3SC4A 1OPXA 2ZI5A 1G4HA 4XSGA 1ZNZA 5FIUA 4R8RA 4P98A 4RVGA 2AZDA 2Q8QA 4RUCA 2VDVE 4G56A 1M3SA 4B4VA 4BO3A 3KTAA 1GPYA 1DJOA 1ESZA 1N5JA 3QMVA 1E60A 4FINA 2WJHA 1GPH1 5D01A 1BD4A 1IXSB 2QYHA 5SZJA 2RGGA 2BTEA 3QKUA 1ZHFA 3D8TA 1XBTA 5B6PA 2BGKA 1XZKA 1MKYA 2GM3A 1KETA 4R0VA 4QVGA 4QUDA 5CK4A 4ZAYA 1DC7A 1EBUA 4Y2YA 4YJDA 3M1AA 1LBSA 3AP2A 4RVHA 5DHFA 2XJ4A 1FFYA 2ZJZA 4ZCQA 5KWIA 1R1DA 1IL0A 3B3AA 3KTDA 3TW6A 4CDMA 3NTXA 3RRBA 5EUMA 2A0YA 3MQFA 4ZD6A 4QNMA 1YE5A 1NKBA 4PLGA 2RGAA 3R76A 1W5AA 5EG5A 3GCXA 1V97A 2HNKA 3IQDB 4FR2A 2F00A 4X6YA 2A9FA 4C5CA 1FP2A 1P7PA 4YG2A 5I7HA 4W5TA 3L8EA 2OZLA 4O3FA 3NJ8A 3Q8WA 4WFJA 1JRPA 1L7AA 1NOIA 1SCUB 1F4VA 4EOGA 1US8B 1CR2A 5DBHX 1XCMA 3UMVA 4EFLA 1LPMA 1VC2A 3WBFA 1UJNA 4HRXA 3O4FA 3L6CA 3ZU5A 4CL2A 2R7LA 3I6YA 2P9TA 3E1KA 1FEZA 2AA3A 4E11A 2WLSA 2OCLA 1O54A 3LZDA 5HWSA 5THQA 1EWTA 4ARBA 2XI9A 3BJRA 5IM4A 2WY2D 4DV7B 3FF4A 2J3LA 2FHSA 3EGEA 1RPAA 2ZXFA 1FDUA 3KU1A 1ORRA 2GTPA 4A0HA 3DH0A 5K20A 3FCOA 5K0BA 2Q9AA 3INRA 1SCIA 3M1LA 3DS8A 2B61A 3GFFA 4ZDIA 2X0DA 1I4EB 4HDNA 3KBBA 5LZ4A 3D5EA 2WTBA 2AQ0A 3EGIA 3ETGA 2HIHA 3HG7A 1O57A 3OPYB 2X2EA 4WJZA 4M87A 2NUPB 1RAGA 4OK6A 5HX7A 3ZWVA 3IQEA 2IS2A 2GO7A 2JH7A 2IXAA 1NJWA 2Y99A 1RQ7A 4HQ0A 1FNNA 1FZTA 5UKDA 4P1ZA 1NJZA 1Y34E 3TR5A 3U9LA 2FG6C 2NPIA 3I2GA 4ZVVA 1WCLA 3QEBZ 4F3OA 1Z47A 1ZITA 1XA0A 1ZGZA 5K6AA 1OH5A 2QMQA 4J9UE 2QQFA 1GOTA 1ZD1A 4FBMA 4JU8A 4HDOB 5GGYA 3RVQA 5IUKC 3K9HA 4CJXA 1L4KA 4PG5A 5DX0A 5A3QA 4OVKA 3A1UA 2G8LA 3E35A 2OAGA 4XVHA 2PMZF 5IHPA 2J08A 3G8CA 4HH0A 3P19A 4YRNA 1DFIA 2AXTU 1CS4C 9LDTA 4O2BF 3CN7A 4CDNA 2R6AA 3EZ2A 1X1AA 3KHLA 3MQ4A 1JHXA 2PEYA 4HVAA 4IUDS 3OGUA 4NFSA 1ZGAA 1E4OA 5DGHA 5F9MA 1V3UA 4R8SA 2FQYA 4XIIA 1ZY2A 4ZQBA 2H8GA 1ZPDA 1OHHD 3L6UA 2X0RA 4QUIA 4MJ7A 4OQFA 1W5FA 3A2KA 4QFDA 1CW2B 2OG2A 2BQRA 3QM1A 2I62A 5IT0A 3DZ8A 1Z6GA 4DLAA 2VH2A 1RRCA 2GZMA 1WBBA 2ZJAA 3B1KA 2X0EA 3WFIA 1QH1B 1YB5A 3ELYA 3H86A 1UBJS 3A3NA 3CLRD 3U13A 3GQBB 5ISMA 3CLSD 1DV1A 1IM2A 4EPXA 5LMNB 3KJIA 2CXQA 2VZEA 2J0QA 3OHPA 1RXYA 1LDGA 2SKCA 3LZ6A 1AXGA 1JBKA 3TMAA 4EUKA 3RYHA 3T1YB 1XMQB 1K8ZB 2EW2A 2QUZA 1JXEA 2CLHB 3IMFA 1OLXA 1FK8A 1P6UA 2NO1A 3ESDA 3AVYA 5DNVA 3R1IA 1A8IA 3EG5A 3M7IA 1C9KA 5AXCA 2VP5A 1L5NA 4UTRA 4FSHA 4BX9C 1VKHA 3MIZA 1GIAA 4AULA 1S7CA 3A2MA 3KD2A 2WKQA 3ETRA 3JAWA 4INPA 4OIFA 1I6MA 2WT8A 2RJNA 5DF1A 4JB8A 4LKOA 1JHQA 2GN9A 5A2QA 3JPRA 3NWEA 1TU0A 5K6TA 1A4UA 1PYDA 2IK8A 4IDOA 4UM9B 3IAM1 1RJ9A 1EDOA 3MCUA 3EB9A 5D4BA 2Q9UA 4QEDA 4UVGA 4F1WA 3QBVA 5KNCD 1KZGB 2FPSA 1X94A 3LHDA 1JAZA 1MB2A 2JZCA 2Q1WA 2GPAA 4QFCA 1KYXA 4UE2A 5DOVA 2PG3A 1E59A 2CD7A 2WDPA 2YHSA 3UWOA 4N82A 4F7DA 1KR2A 4YCJA 4YRLA 4KFRA 1DUSA 1SHKA 5EZ5A 1E77A 3O7MA 1NOMA 4LVOA 2EEZA 1WWUA 3KXKA 3LPDA 4L6CA 4XW2A 3C24A 3UGQA 4FYVA 1KI9A 3AR9A 3VHRA 3EFOB 2C5BA 3U3MA 3UICA 5KJ6A 1E3IA 1NDHA 2HHQA 4EVIA 2BONA 4D56A 4TRNA 2ZVJA 4ZZ0A 3HO6A 2PH3A 5JC1A 3H5NA 2RAVA 1R27A 2DFKB 4MGKR 3PW5A 3QPVA 4DR3B 1K8RA 1WXQA 7ICMA 2DQYA 2Q2OA 2WYIA 1NKSA 3A27A 3BA6A 3QOWA 3SM9A 5KOJB 2WF9A 3OX1A 4QGHA 1QQAA 2DPLA 1TD9A 3V8EA 4G89A 3C8ZA 2J6SA 1GUAA 4G5XA 3VFDA 5CDFE 2AX4A 2N3ZA 5DM4A 1VCHA 3IJPA 4TROA 1T1SA 4LBYA 3OAAD 3MW8A 2BRUC 2NZ8A 2XDQA 4OSPA 4LBVA 2DX7A 3RF7A 1NXTA 1Y1SA 1Z0ZA 4KUHA 5L7WA 3OQPA 3CCBA 1GNPA 3KSMA 3TLJA 2CUNA 2BEWB 2OGSA 2D8CA 1G8PA 4JUFA 4ZT7A 3IQGX 1IM8A 1A8QA 1XXHB 2QMEA 5FLKA 7ICFA 2J9GA 1OF1A 5KYWA 1J0EA 2B8JA 2O52A 5B1IA 3BGIA 1U9JA 4H35A 2I3AA 2KLBA 1HFEL 4Q9DA 1J2YA 2HPZA 2C4NA 2PZFA 2ES6A 2ARKA 4K3VA 3KYDA 1NKTA 5TX7A 2P11A 1YFJA 4P4UA 3H1GA 1F0PA 1LPSA 3JS5A 4MWZA 3O2JA 1BMFA 1FQKA 4BO7A 2FPWA 2HQSA 2ODWA 3FCAA 3OY7A 1UJCA 1NI5A 4KI0A 3QY0A 3W5SA 3WGNA 5KG3A 3G0GA 1L5MA 2F44A 4F4KA 2BW0A 3H9GA 3J81A 4KB5A 4ARCA 3O21A 1ZQGA 5C4GB 5IIMA 5IF9A 4BTVA 4NQRA 3FWYA 5LLTA 1M8GA 3T5LA 1EFDN 3MUOA 1M6EX 3OZIA 4WGGA 1QJ4A 3AW8A 1TF2A 3EY4A 5LQKA 3DULA 2HSJA 4DV4B 2UYQA 4WZAE 3D8BA 2BM1A 2CYAA 3EXG2 4D4LA 2LHTA 4DUPA 2O8FB 3WMFA 1ESNA 3GFQA 2B94A 2QI9F 2UDPA 1OGIA 3JYOA 1MQSA 5J4YA 5KUTA 1N2ZA 1JG4A 4F5RA 2E4YA 4DWJA 1SU7A 3K9GA 3SHQA 3BTSA 4D4KA 4EG1A 5DEOA 3O03A 4BRWA 4DW8A 4H1VA 4IGKA 3MSCA 1M1YA 1LRJA 3ZHTA 3NG1A 4ZYXA 4A92A 2W2TA 1ZQAA 5HKKA 4U7HA 3SQOA 1Z5GA 1UF9A 2CNWD 1XU9A 1LI5A 1SZCA 1NJYA 4S2UA 3COZA 4ILEA 2I99A 2ZTVA 1Y3BE 4G5OA 2FZLA 3SVTA 3SAFA 4OMDA 1L8QA 1X6JA 1S77D 5AHOA 2AQ4A 2DSNA 3DOCA 3SEFA 1V16A 1WEHA 2W6PA 7ICOA 4RW0A 3M9LA 1X2EA 2PUVA 3OPXA 4BBAA 4Q3NA 2IV7A 3Q8RB 4J0EA 2PUWA 1BPYA 3CU5A 3G0OA 4N9QA 4TRJA 2YUTA 3HEAA 3EVAA 3GPBA 3MBYA 3RJKA 5DBCA 1MO4A 5TARA 5JRZA 4R2KA 3S2IA 2JFFA 2H3FA 1JJAA 4LWQA 1IDN1 3BHIA 3DLCA 4RNOA 1BD3A 1CDOA 4HSEA 4QOHA 4BN0A 4E2ZA 4E5VA 5JSZB 1F4LA 5LYJF 4IRKA 1KFKB 1TK0A 4TM7A 3TPZA 5JANA 3SJAA 3PPVA 3L43A 3TJZA 4AICA 5JMTA 4WFKA 4NY8A 5L53A 1IBKB 2BDTA 2OXEA 1VB5A 2PAAA 3A6GA 3H97A 1OCEA 4DMKA 2PZKA 2K8CB 3RUDA 4XFJA 4MQLA 2JFUA 3M7DA 1K3TA 5IHXA 2HV8A 4YJKA 4V0MA 4YO8A 3KKAC 2PWPA 5EZYF 1TKRA 2QARB 2ERYA 1HE4A 1E1QA 5K3EA 2XGOA 4QOGA 4RH1A 1T5OA 3TGLA 4W7IA 1JJIA 1G8MA 1IUKA 1YGPA 1H6CA 3G9QA 4J1QA 5EZ6B 4HT3B 1B41A 5LQNA 2E3JA 3PY8A 2HHJA 3LLCA 1YL7A 4KBFA 3WKCA 5G0SA 3T12A 1TNDA 3IAS6 1L1FA 4GIBA 4J3JA 2RB4A 4IILA 5GJWC 1HYBA 1FDRA 5FR1A 1FP4B 4L6AA 1SIUA 1HMYA 2NXWA 3VVMA 1OFUA 1QZ3A 1KARA 3RTVA 1CY2A 3QYJA 2Y0SC 4QIHA 2DTXA 2HMYB 2P5YA 2NO0A 3C6XA 4OGGA 3IVAA 4BS9A 3BSYA 4MWTA 5J0QA 4RNNA 1SBHA 2HWUA 5KWJA 4DIFA 2PGOA 5F3XB 5BN1A 3F5QA 2JI9A 1F7UA 4MVXA 5E1MA 3C1OA 1K97A 4M38A 5EGNA 5A0FA 5KFVA 1W5TA 4HFRA 2L82A 4MVJF 4IIDA 4UQPA 5IDVA 1U0TA 4Y2SA 2NLOA 1TPZA 3P9SA 4KO1S 5JAPA 4DOAA 2QVZX 1DWPA 1X77A 3DE3X 1E9CA 4MVCA 1PD1A 1YACA 3PYXA 4CCAA 1G5QA 1EZZA 4I46A 1UZMA 4DCGA 3VPGA 1NJXA 1X8JA 5BN5B 1YJXA 2B5WA 2N1BA 3A3KA 1DKUA 3I2FA 5KYYA 4YMMA 1GN9A 3D0QA 3I4LA 3RTDA 3W34A 3KPYA 3OURA 1MAVA 3FHOA 3ZD8A 1JW9B 2VBIA 4KW7A 1I5OA 2RGEA 3BL6A 5BPHA 1I2CA 1J2RA 2PYZA 3UGKA 5CYFA 3KQKA 5FR2A 4J9QA 4V0KA 3I9FA 4ZO6A 5DQHA 5LJIA 3P0EA 3OO1A 4R0NA 3ZHCA 2E55A 3NBXX 1U0GA 4R69A 1Q57A 1SVKA 2RGRA 4EMSA 1I4WA 2OBMA 3B60A 1THTA 1XPRA 2ZUWA 3LT4A 1P9WA 5KG2A 3GPDG 4BWYA 1LX7A 2IXGA 4DA9A 2J4DA 4TZ6A 1HRDA 3IFSA 4Q3LA 1XE3A 4O3RA 4I28A 1GQRA 4B7CA 2G80A 2W11A 1XAHA 2AIRA 5HIMA 5IJ9A 4EHLA 5AI0A 2BEVA 4JV0A 2QRLA 1WOYA 2W93A 3L49A 3LYHA 1HE8B 2V98A 4V0RA 2DERA 3PA8A 1QDEA 2P9GA 5D5PA 1JQKA 1OV4A 4Q1VA 4RMGA 2C31A 2BJHA 5J2TF 4OHZA 3E27A 2Z2IA 3N2ZB 5A2GA 4UARA 1RRMA 1V96A 3BGSA 4LF7B 3FPAA 4Q9KA 1BWQA 3KVVA 2QPTA 2G3YA 3N7SC 5I8ZA 4RZ3A 2NQTA 1JDPA 4AJOA 5GGXA 2B6GA 1YHNA 2Y0EA 2E6KA 3LZCA 4YYZA 3E70C 2FMTA 2WJVA 5KKAA 3B9RA 4IS7A 4M60A 2A94A 4LE0A 4UPVA 5JG7A 5JSZA 3L7KA 1I7QB 2HRZA 5F1OA 3GLFA 3AEKB 1FIUA 1LBHA 2GRJA 4MJXA 4RY2A 3IT0A 5EPEA 5EXTA 4JL6A 1TRKA 5DHQA 5TPZD 3V33A 5LWQA 1T9ZA 2OUKA 3LXRA 4HRAA 2IHNA 3WB9A 4DTIA 4QYWA 3ZHBA 1PVDA 1T8UA 4DAOA 1CD5A 2RC5A 1Z06A 2HO4A 2H29A 2QAGB 2YS7A 3MQ2A 4MV7A 3V1UA 3KKQA 2HTEA 1N32B 1M5UA 3QENA 1UDXA 4OFBA 4PONA 3AUAA 4JI6B 2PX6A 1NLYA 3FZNA 1NM5A 3ANXA 4OOEA 3NVVA 2DP4E 2G82A 4XCQA 2PMFA 3R3UA 2YBDA 5GONF 1XTRA 4DLZA 1H2RS 3G85A 4QFMA 4DMRA 3G8YA 3UMYA 1J2EA 2QENA 4EL0A 1KC1A 1JG7A 2GJAA 2Q1UA 4QU8A 4I2BA 3IURA 5IH7A 2NTJA 4ND8A 1H2EA 1STOA 4N18A 1BHJA 1XGKA 4R83A 1JNXX 5A4FS 5AKHA 5HQTA 4UCWA 1P19A 4QGSA 1VIYA 3TAUA 5K8CA 4PC1A 3PDIB 3SQXA 3O84A 3F4KA 5DBIA 2OC9A 4PR0A 1E4EB 2IHVA 1EG2A 1QTRA 2OYRA 5C46F 4OI0A 4TSRA 2ZREA 3DKIA 1JU3A 4RCVA 5B1DA 4RH3A 2O8FA 4AZ3B 4CM9D 1LSSA 4IMPA 4Q43A 2ADFA 3A31A 4FYWA 3RBZA 4LSWA 4L0QA 5ELMA 5EEGA 2VEDA 4NXMB 5J2HA 1C2TA 2W8BA 4GKAA 2D7JA 4KE8A 5CLFA 4MW1A 3HRKA 4M0CA 5JI3E 3U7HB 2HHUA 4ZYUA 2GWRA 4R01A 5AI6A 3ZGYA 4FX5A 4HDMB 2P9QA 4UZSA 3F7TA 1OBCA 2P68A 3TYXA 1Y7IA 1KQNA 2EEPA 4R66A 3LQ2A 4LYYA 3CLKA 3F9CA 2BCGY 2EKBA 3DL2A 4X65B 4QOSA 3QXJA 1JJFA 3LOUA 1SQ5A 4MUJA 4BYMA 1K2VN 5ES4B 1RLIA 1YZFA 3TVTA 3UVEA 1CIJA 4YCLA 1BX1A 1SKAA 2C8JA 3Q88A 3DC2A 4MRSA 4OJNA 1P7YA 2H17A 2XKKA 1ZCBA 1WETA 3D4PA 3O73A 1R6UA 1YQDA 2Y9TA 3HCWA 1DX6A 3RT7A 2WD9A 2OB1A 4ZALA 3OPYI 3UAVA 1C80A 1IC6A 2PVSA 3LO8A 4MDEA 2QW0X 2R8RA 1OXSC 2ZBPA 3BS7A 2SKEA 4LDAA 4Q7LA 1JAHA 2OORA 1U0HC 3PXDA 4LXIA 2X41A 1EA7A 2CN1A 5EE5B 2DR2A 1N6HA 2PX8A 4PIVA 1XU7A 4U00A 5JVDF 3H18A 1ACLA 5KFPA 5B3LA 3QGMA 1CRWG 1E3LA 3O8LA 3HPQA 3JD2A 4QJ4A 3ZGLA 4ED7A 4H0FA 1II0A 3ZYZA 1V9CA 1YDHA 2PL9A 3F6CA 3MILA 4Q9HA 5DB4A 1KVTA 4IIEA 5CVUA 1V47A 1DTWB 3UC9A 4B3JA 4TL7A 3HM9A 5BR4A 2D6FC 1OXTA 3Q3VA 5M29A 5L1IA 3RRJA 4R1TA 3TFSA 1WXFA 5KJCA 3HDTA 4BGVA 3JQPA 4MWOA 2Q41A 1UC4B 3EFOA 4B0OA 2WTAA 3H4DA 1K6MA 5GZ6A 3DDWA 1YUMA 3VOSA 2CXTA 4D2IA 1N5RA 4JT2A 4PHGA 2ACWA 1X9HA 3RVJA 1XZCA 4EFKA 1Y8QB 2HU7A 1GGEA 3D31A 3L05A 4F46A 4GM4A 3TLCA 1Q15A 4XB2A 2FQ1A 3MTEA 3DYBA 4K9DA 1SR8A 4NU5A 2ZATA 2OV3A 4IJMA 4M47A 1WB9A 4CLEA 4O4HB 4OGFA 4JDUA 2BC9A 3I5XA 3O4VA 3SC2A 4MVJM 2J3JA 3TB6A 5DG9A 1ULUA 2F4NA 1GPAA 2IA5A 4O1IA 2AMLA 1XZ8A 4MS3B 2CT8A 4F5QA 2NUTB 1X15A 4FFNA 1XTVA 4EI2A 1VA5A 2QZ4A 3GILA 1D9FA 4GOXA 2H6EA 4MICA 5FBHA 4YMOA 3L9WA 1NYTA 3F8SA 1ZG3A 3OECA 1OA1A 4IFBA 1J25A 4R5HA 5I01A 1RI1A 3TN7A 3OCCA 5KT4A 2NOAA 1KH3A 3LCVB 5I7RA 2OESA 1MOQA 1JFTA 4NR0A 4ZYZA 2YQEA 4M0FA 4N0MA 4MUXA 1RAIA 3SNKA 1I2MA 1GNTA 3WLFA 1IV8A 1ODJA 1WJGA 3LGAA 5EIWA 5B37A 3OZVA 4AMGA 5I9IA 1AMNA 4OQYA 3U62A 1Q50A 3RS2A 1M2JA 1IIRA 1L7DA 1TUGA 4KPYA 1V25A 3H6HA 4LTDA 2XYQA 3FJYA 4Q4JA 2RI1A 1CEZA 1B0UA 1EK0A 1XX6A 5J4HA 3DQZA 3AY7A 4DF4A 4ILKA 1QH1A 1O58A 3HTXA 2G1JA 3TNDA 2XUQA 4AK9A 1RCFA 3KR9A 1PX2A 5FF9A 3GV0A 2ZRQA 1T6ZA 2O5VA 2I6TA 4PXAA 5F76A 1CUHA 1TCBA 2QXTA 4X6XA 2HZ7A 4S1NA 4V0LA 1SU4A 5DCWA 5E7QA 4PS0A 3UW3A 3W8FA 4J9NA 1QLHA 1ONPA 2HF7A 3PXUA 4HPWA 5BVGB 2GARA 1QHGA 1UIMA 2O2SA 1U81A 1UWCA 2OWDA 3B5EA 3PFFA 4Q1BA 4CL3A 3A4VA 1JWAB 3FPBA 3DBLB 3VYRB 4ZK6A 3PRJA 1DIRA 5EL0A 5HG0A 5CDYA 5IJ0B 1ISIA 1M33A 4V0OA 5I9NA 1T9AA 3GEIA 2V7QA 2DFPA 1ILEA 3CC8A 1L4EA 2BM9A 3CX6A 3QWIA 4W5JA 3WZLA 4CMGA 4Z54A 1DCTA 4LQCA 3UCEA 2B37A 1UOPA 4GOND 3VR1A 1TI7A 1C5KA 2HREA 3EVEA 2VNKA 4L57A 2IYEA 2F9LA 5K45A 2D6FA 1PV2A 4Y0VA 4BNVA 1AK1A 1PFYA 1N6PA 1V8OA 4GVXA 5DTQA 3ESYA 4QWEA 4HLQB 4KFTA 2OP0A 4G8CA 2F3PA 4D9FA 5KTPA 1SWVA 3VH4A 1OYOA 4FONA 4YH1A 2K4EA 4YT8A 2QLMA 3EXHA 3F1LA 4PM4A 4QZDA 3TLXA 5JPDA 2FEXA 4XVCA 4DNOA 2XNCA 1RD4A 3KZMA 2VTBA 3OT1A 3RQSA 4BPRA 1SUIA 2GVZC 2KZMA 3BFVA 2HMVA 4E30A 4X97A 4L8FA 4URYR 4C4ZA 4FCCA 3NIGB 3F53A 2CHUA 2YL2A 3TR0A 1HOTA 2I8CA 2H1CA 2JRCA 2EOAA 2QMYA 3C23A 1KHTA 2AN1A 2XGMA 2XVXA 3GDOA 4Q47A 2JIQA 1H6AA 3C7KA 3CO0S 2QTTA 3OU2A 4U2BA 5LYYA 3HKBA 4DLYA 4TWBA 4OXXA 2RHCA 1L0BA 2KPOA 4ETIA 4WDRA 5IS2A 2IH4A 3ZS9A 5K05A 4XGQA 1XDWA 1AUXA 1CF9A 5I45A 1R4ZA 1U3WA 2P4HX 2WTNA 1Y1PA 3TECE 3QUSA 4EJSA 5J0RA 2ZWIA 1N62A 4G1MB 1SVUA 2CLSA 2G9VA 1QIKA 1XUOA 4XX0B 1H42A 1Y88A 1ISPA 3O47A 5FB3A 5JE8A 7MDHA 3PV8A 5HKKD 4RTPA 2D62A 2FJUA 1A9ZA 1SGWA 3TIXB 1Y8AA 3DPSA 5ELLA 1H5UA 1E79D 2EV9A 4DQUA 5L3SA 3IHTA 3KV3O 3MNFA 4ZIRB 2E3TA 3M34A 3LPLA 2GHQA 2XYGA 4K9PA 1IOWA 3ND9A 4CGYA 4K88A 2BPCA 2VH1A 2WQ7A 4B82A 1QFMA 5FTMA 4J9PA 1NK9A 2BR4A 5KJEA 4JXJA 3ROTA 5IUJC 1ULTA 2A2ZA 1P2FA 1KEKA 5KYGA 1A2KC 4C14A 2UYCA 4DOBA 2HNBA 2EYUA 4EABA 2O4CA 5TMBA 4XIFA 3O4HA 9ICBA 1E2MA 4PAGA 4GX0A 3QP9A 2PX4A 4GP7A 4QOFA 2BZ0A 1UH5A 2F6RA 3QXCA 4L3VA 3TTTA 1KKLA 2QRVB 4PL2A 1WMEA 3SXPA 1HR0B 1G291 2VSXA 1ZQIA 2XWJI 3OI7A 2I6UA 4GWGA 1R4NA 5AJZA 5JSUA 1UT8A 4E0DA 2O7SA 4Z6DA 4A8TA 2Y9UA 4M21A 1OB5A 3OLYA 1H4QA 1I5RA 3Q6MA 4DCUA 4DCMA 5IBCA 1NJ1A 3RIGA 2GZ3A 4CM4B 1YQGA 1Y9ZA 5B12A 1T5BA 3X2SA 3B52X 3G2HA 3PGA1 1XCGB 4PC7A 4I50A 1T2FA 1MB9A 5DGBA 2EBUA 4UM8B 4WLFA 3AUKA 4CIXA 4CDRA 4DC1A 1HX7A 2PCLA 3HU5A 1F2UA 5CNIA 1MJHA 3G2KA 2A1AA 4I2JA 1U4SA 1SKWA 3KQWA 3Q9SA 2JH9A 1QX3A 2ANBA 2YQZA 4RPLA 3RNOA 5A1JA 1FX1A 2GF9A 1OIXA 5L6MB 3GDWA 5HKLA 3G2MA 5D6OA 1C8BA 4AJ9A 1X42A 1LTKA 2WTMA 4RHEA 2DECA 3IP6A 3M3PA 1HZJA 2WSSD 1C81A 4KRGA 3WSVA 3ZJTA 4XD7A 3TQCA 2A30A 4J76A 5T64A 2ETVA 3JSAA 4BV8A 5B3JC 1A9XA 1CQIB 2VP0A 5ALQA 3BRWD 3HY6A 3AFNA 2HJ9A 5JJIA 3ZJYA 4AN0A 3NAGA 5ALUA 2W54A 1I3LA 4I50B 3E8MA 4G5RA 2JH8A 1FYDA 1K63A 4EEXA 4HAUA 2D3TA 1SQ6A 3GUZA 1NUTA 2WWTA 3IHKA 4PHFA 3YASA 4C0QC 4ZGGA 5KX5A 2VJCA 2QB0B 5KG7A 2RIPA 2W43A 3BB1A 3TQTA 2AUNA 3ZHRA 1HNZB 3R7WB 1K6EA 5CRXA 2DFTA 4NH4A 5CDHA 2BP7B 5H8WA 3SBOA 1RQPA 3P96A 4MW4A 1P91A 2QRVA 1R66A 1CNEA 1DKOA 3HP1A 5EC8A 3U4MA 2QM8A 1Z3EB 4O4LA 4TT3D 4KLDA 3UPTA 3DJYA 4Q3BA 2CK3A 2FEOA 4KLAA 2XICA 4QUHA 1NBMA 5E8RA 5FX2A 5L7TA 2CLOB 4C1BA 4LDJA 5JS1A 1WUHS 3KKPA 3WMRA 1S5PA 4DMCA 1XT6A 1PVOA 3DTYA 1MAWA 3FAHA 3B8HA 3DZCA 2ZWAA 2VJNA 2W55A 3DVQX 3LKVA 3CTMA 2XNDA 4NOJA 5BP7A 1R00A 2GEJA 3OM8A 1B74A 3TTVA 4DJJA 3HJGA 1UP6A 5FQNA 1RP1A 1XTTA 4ZIRA 1OBVA 5L3SB 1HDRA 2VDMB 5DLFA 2WAYA 4FHGA 4P5EA 4KLMA 2P7IA 2W70A 1NZFA 1YC5A 2O2GA 2QRJA 2SNIE 2XGSA 3EUFA 3AL0B 3GD7A 1JR4A 4JEIA 2YX8A 2OEPA 4EQ6A 3KKLA 3RRYA 3S7ZA 3ZN2A 3H8JA 3AV0B 4UEJA 1NN3A 1GLNA 2ZJ7A 1SC9A 3BERA 3CVUA 2DPHA 4BV9A 1J90A 3VX3A 5CT8A 3RVKA 1ICIA 1WS6A 2V0CA 3QJYA 4QSHA 4NFLA 4M9ZA 2Q5LA 2QZJA 3LF2A 3RF9A 1Z62A 4JVLA 4BMPB 5DQIA 3D8SA 5H3LA 4FOLA 4B4KA 3ICEA 5TT0A 1FNCA 1KK2A 3BK1A 4WKOA 1MHTA 1A5BB 5F35A 1PP4A 2HW3A 2EKQA 2H51A 5B57C 2MWMA 4QPJC 5K0TA 4JV5B 1RM6C 3ZWKA 1P1FA 4YREA 3AMZA 4N6NA 5MN4A 5BSVA 1ODTC 2J0EA 3FRIA 1HEUA 3M6XA 2JFBA 5TQJA 4ZMRA 4BE7B 1TYEB 4V3BA 1N6OA 3RBXA 1SXQA 2P0YA 1WXWA 1X1SA 3EXHB 3OUTA 4Z0TA 1T6YA 2I9PA 4B8ZA 1G6KA 5DT2A 4EP1A 4F9EA 1E2GA 2RARA 3KQQA 3QYFA 4C7YA 1EP2B 2P9FA 3UYLA 3WSTA 4RQ4A 2O2DA 4UUNA 1QV6A 5CIQA 3WGLA 4B34A 2CUKA 1NG1A 1XTUA 4PSDA 1HE3A 1UDRA 2HDHA 1RWBA 3F3MA 1Z9BA 3MJFA 4FD3A 4JP5A 3U39A 1XKLA 1EZ4A 4ENPA 5AK3A 1A7UA 1TVKA 1ZMBA 3HKCB 1A95A 3S2UA 2ANCA 1BTOA 2AKAB 5AW3A 1K89A 1PZFA 2YDYA 3DP7A 3GH3A 5KDLA 2V03A 2CNWA 1W9HA 2O0KA 4G6ZA 4HRVA 3K0KA 1QP0A 5GQSA 1DOHA 4UB4A 4XYGA 4ZI7F 3DBLA 2QLTA 2YJ5A 3M2PA 5TMEA 1W0CA 2B98A 2OFFA 2X7JA 1JFSA 4RKRA 1AGNA 4CCHA 3TI0A 4KV7A 1K06A 4B83A 2WHXA 1N36B 1NN0A 3FDIA 2I2WA 4AYTA 4BDPA 3WL5A 2CKMA 4PPQA 3SJBA 4LZOA 2XLCA 1RJWA 5FI5A 3C48A 1A88A 3NI2A 4ALMA 4FZRA 4ECEA 3WL6A 3TDMA 2WOOA 5EPUA 2PI4A 2A1TR 3I1FA 3Q3IA 4HC4A 1ZK1A 1CUUA 4RUKA 2PMBA 1KQFA 5FNZA 1ONSA 1THZA 5FEUA 3OM1A 5CU7A 1L7BA 3H3XA 3I01A 4KQJA 2E2WA 1W35A 4PFKA 4D92A 5LIRA 2PX5A 1SXEA 4N7MA 3LUPA 4H3SA 1TK5A 1AROP 2GUWA 4MIKA 2V65A 5DFAA 4ALJA 3DL7A 2Y05A 3H1PA 4BLRA 1QCYA 2H4JA 4JLJA 3D1VA 4OXIA 4MI6A 3F5FA 2REXB 2NUTA 4FZJA 2G28A 5BYBA 4IKPA 3SR3A 1RYDA 3SD7A 1U2SA 5F21A 5FWXA 4Q1DA 1U9LA 3NR2A 1M2VA 4JV1A 4F91B 2IHJA 3DDZX 5HIJA 3H8WA 4WVLA 4O4HA 4DHEA 2SKDA 3DDHA 5LUBA 1FDSA 1HL3A 2YZKA 3UPDA 3ZV6A 1H2AS 1AKRA 3QLUA 4JQSA 1YAJA 1GNLA 3KSAC 2BM8A 1ZQTA 1K27A 4ZPJA 4ZJYA 4A4DA 1SCBA 1OYWA 3QK7A 2FMIA 3HC7A 4QLAA 2Y6VA 2JZBB 3UOGA 5JSHA 4CMCA 5TV2A 3V8MA 4EYOA 4S04A 1TTHA 4XVRA 4YO7A 5JYCA 1E7RA 1EFLA 2AHOA 2P2YA 4F2GA 4I36A 4PNZA 3WGQA 5GIOE 5KFDA 2SCUB 3QV1A 4JB0A 3DZFA 1QWSA 2C0PA 1UQRA 3JYHA 4OFWA 3BA1A 3CZCA 4FP9A 1NX9A 4TYMA 4BUJA 1XSEA 1DTWA 4ELUA 3AF5A 4MXDA 3FYUA 3WNVA 1I13A 1QHSA 3IPYA 3LC1O 4ZO8A 4DSZA 4YUYA 1O89A 1XVTA 4RO0A 2AOVA 5B3KA 1G42A 1VSVA 2Z2YA 2X8LA 3I30X 4M0KA 3QA9A 2Q8PA 1IRXA 4PAMA 5J47A 3VJLA 3IP3A 4KXYA 4RDXA 4BQIA 4NCJA 3BTUA 3WZ2A 1U80A 4JUIA 1K92A 3H2YA 2KKVA 3CWZA 4O6VA 4BUCA 3A1CA 2VA3A 4MYDA 3RC9A 4ON9A 3LT0A 3ADPA 2Y92A 4B31A 4UB5A 1DCMA 1EFHA 2VPPA 3LSYA 3I4CA 3L7IA 3VR5A 1GJRA 1S9HA 1F2TB 4OHMA 2W2XA 3JV7A 1NW6A 3AM5A 1EJ6A 2GFIA 4WOPA 3IV6A 2HU5A 1M1UA 2QD4A 4GMGA 1ORIA 3RVBA 4C8NA 1G7TA 5A6SB 1M9NA 3FTNA 1Y7TA 4CU5A 3IKTA 4ZMBA 1QK3A 4NCNA 1BH6A 2COUA 2PFKA 2RK4A 4KN9S 1ENYA 7ICIA 1UDWA 3LMKA 2E1PA 4J1NA 3U37A 5CWRA 4CLOA 5FNVB 5ADWA 4LE2A 1YU9A 1VHLA 3WS7A 4DKJA 1JA0A 3H2IA 1MEEA 5ALZA 2EFJA 1SZHA 9ICVA 2OR3A 4J29A 4U7DA 3IE0A 3EQZA 4EGSA 5KVAA 1DCFA 2J3MA 2P5UA 1FP7A 3W5VA 1W2WB 2M2IA 2O5CA 3PC7A 4NE2A 1X7XA 1SQGA 3PEFA 4M6WB 4OAOA 2OYYA 4GXJA 4MR8A 4RPGA 3TCKA 1ONNA 3CNOA 4ARVA 3SSMA 1DIAA 1MJGM 2I67A 2Z08A 3C1TA 4RTQA 4PHPA 3DL4A 3GROA 3FKQA 5K7SA 2LXNA 3WBKA 2ODAA 3I9OA 1KFBB 3RS8A 1ZVKA 3ABZA 3IMGA 3RBEA 1XKTA 4KCGA 2XB8A 4X63A 3UV6A 3W5BA 2PO5A 4DM3A 4DQRA 5I7VA 1YRBA 9ICMA 1U04A 1L4UA 2H11A 4Q3DA 4MV3A 1QGZA 3HUTA 1ZJMA 2OHFA 1OX6A 1K1QA 2E85A 3AKCA 4IV5A 1H3NA 3B5IA 4C21A 3HXPA 1UPCA 4L4SA 2HWKA 4NQZA 3H4VA 2OAQ1 3FXAA 2A0FA 4CLHA 4M9HA 3TBKA 1AC5A 3GV5B 4I1RA 3N28A 4TTSA 1L3IA 5HGJA 1Z4IA 2Z1DA 5KAPA 5C7OO 2A5DA 1Q14A 4FSDA 1NVMB 5J0WA 2Q07A 2WA2A 3EVTA 4E07A 2WF8A 1EP9A 2YFYA 5G1PA 5D5QA 4AYWA 5IZ4A 1T2NA 4DFDA 2KW5A 4JGBA 3A6FA 3I53A 2ZAOA 3A4TA 3L6RA 4KR6A 2WV9A 3F6EX 4NNJA 3IG5A 2AOXA 1X66A 2HMXA 4KLSA 1QLWA 3ACCA 3CZ4A 3DTNA 3HCNA 5BQOA 2APJA 4PAWA 3ANMA 1I8TA 1NVWQ 4LQLA 1WQ4A 4AY4A 3GBSA 5I8WA 3IUEA 2CPRA 3FIJA 4BQFA 3KAQA 1HEYA 1T91A 5IJZA 4GT1A 5KFZA 1U8ZA 1TKDA 1L5QA 1JVBA 2I3ZA 4ADSG 1Y6GA 3AHHA 1YRAA 4KH0A 2YWHA 5MF6A 2AG8A 1VI6A 2AI3A 1FFDA 1MUUA 2BFAA 5GP1A 2O2XA 2ZUTA 3FFXA 4AF6A 4HGYA 4EQZA 3TLBA 4M0AA 4WKGA 5FFMA 4WSOA 1JFRA 1DO8A 2CF6A 1EEXB 1YKSA 5DM1A 4N1AA 4C7KA 4DLXA 2A3VA 1T1RA 1ZKMA 4YQYA 5KFCA 1G5IA 4LC9A 4IOKA 2A3NA 3H6GA 3V46A 1LF5A 3DZKA 4AKEA 4UNRA 3V2IA 3PUIA 3EPIA 3TRKA 2E87A 3OQVA 4O08A 2GD1O 1E0SA 2UVPB 1G4UR 4GI3A 4LI0A 4J9SA 3Q8QB 1DKPA 4D3XA 4RD2A 3ZWXA 4W1PA 1FQJA 1J07A 3RADC 5BOLA 2OGWA 2EFEB 1IY1A 3LX8A 4QEKA 2DBYA 2QDKA 2PR7A 3GT0A 2UXBB 3MSXA 2JGIA 4W8OA 3RSSA 1GITA 4AD8A 4D0NA 4F5EA 2BEVB 2ZULA 3X3HA 5C35A 1G6Q1 2BH2A 4R1LA 4DHWA 2FFBA 2VPQA 1J5XA 3PI7A 4U3JA 3UMJA 5IVIA 2C97A 1NPYA 2VNAA 3DMFA 5JJCA 3L77A 3N86A 3M0EA 4QULA 1BVUA 2RHOA 4N39A 4LSGA 4UBKA 3RV3A 3EGDB 2GR9A 3AC0A 1FDOA 3TOCA 2GVDC 3EZ5A 1NYQA 2DSTA 2EJTA 1O9HA 1U48A 2Y9MB 1YB4A 3OJXA 3S2FA 3CM0A 4TZTA 5GTHU 4BP1A 2WK1A 4HLCA 4JY7A 2ZUFA 2VJPA 4P0QB 5IXJA 2H54A 2IY9A 1K5OA 4F93B 4HB4A 1DINA 2K6GA 4MIYA 2WVJA 4Y6LA 4ALLA 3L6DA 4NSNA 3FUXA 1LDYA 5JQGA 5FL7A 3GJ6A 3L7YA 2ZRIA 4RF2A 1U28C 1Z17A 5JMPA 1ODCA 3K8OE 4Q3OA 1N5KA 4QQ8A 3HLYA 1B26A 4UB6U 4EPRA 2ZCUA 2HM7A 4E5KA 1B93A 4TS3A 2XQJA 4EHIA 2ZDQA 4LXTA 3EC1A 3K0CA 4HS9A 4KJXA 1T15A 3NTRA 4I3FA 5KC8A 5KG5A 3B9QA 2DKOA 1PE0A 4GH5A 1ZDMA 4E5UA 1J8VA 1GRQA 1UM9B 1LW6E 1JI3A 2CEAA 3LC0A 1PYOA 4M0EA 4MKXA 4NPHA 4ED0A 5FBRB 5EUCA 2WJPA 2E37A 1OGJA 2UVVA 2JJ2A 3GFBA 1XRSB 4AUNA 1MQ9A 1L5HB 1T2DA 5J0PA 2Y8EA 3MZ0A 4DR5B 3HKZF 5H4HA 1WXDA 2WUVA 1E9EA 3B1VA 1WUKS 5HCUA 2XMCA 3SMQA 3NC0C 4ZQCB 2WSIA 1L8AA 3ZVLA 4J2OA 4NEGA 1E1RA 1SKSA 3NRJA 1NQ5A 1RHQA 5IIKA 2QX4A 3ZYCA 2QTAA 3C5EA 4FGZA 5K09A 2GGSA 3EVDA 2DWQA 4M37A 4F8RA 4ND2A 3WYGA 3G1UA 3P2KA 4P3KA 2EG9A 3CXRA 3IUJA 5ECWA 1EK1A 1LFAA 1QLJA 5FFFA 4AUKA 2C4KA 2W7OA 4EYSA 4Y1RA 3W9YA 5DI3B 5JNSA 3ZKWA 1ZQFA 1PGJA 4OA5A 5DGCA 1L5HA 2WWRA 3CX8A 3L7JA 3LXMA 3MIIA 3OTWA 4XARA 3WWPA 2QSUA 3WZMA 2REOA 2WJ6A 3TL6A 5KREA 4HY3A 2AK2A 1ZSNA 3UUGA 3HYNA 2PQ6A 2Q4DA 1S5LU 2R85A 4PFJA 3ZK7A 1D0SA 1C0IA 2AW5A 1BQ3A 2IXBA 2FW8A 2PI5A 2PA0A 2QX8A 2X4IA 3ETCA 4I9GA 5LA6F 1A72A 3G0DA 3FZQA 2YC4C 3OE4A 4X85A 5JI2E 3AOGA 1RM3A 4N54A 2BQ3A 3G02A 4CDGA 4HGOA 3FHCB 1AUOA 3T5CA 4BV3A 1AGPA 3HWX1 3O94A 4LK3A 4KLCA 1SEVA 2I2CA 4S12A 1TVMA 2OO7A 4COKA 3SAJA 4H4EA 3BB3A 3EOAI 3GLTA 5MFZA 4MA4A 2EH9A 1T3LA 4EZBA 3HU2A 4LC1A 4P7BA 3RU7A 4QARA 5G3YA 3O4IA 1T9KA 4LFBB 2J3EA 4X93A 3WDLA 4QPNA 3A2NA 2FOXA 2H48A 4RF3A 2IEDA 5BWBA 4H60A 1D4AA 1QIMA 2IYZA 4AJIA 3MUEA 4YJ3B 1E1LA 1A5ZA 4LPKA 1U8YA 5JDIA 3HB7A 1GARA 2CL5A 3UNXA 1LLDA 2YC2C 4B4UA 3MAGA 1AG9A 2A4KA 2DPYA 1DAHA 2VUIB 2Q6IA 3NATA 1G4AE 2GEBA 4KU4A 2KX7A 1T3GA 1QZXA 1G7CA 3JQ9A 1K4YA 4U3JB 1IVYA 4GMHA 1LSJA 5BWLA 2B1QA 4NCXA 3EIFA 3QG5A 2SECE 3ESAA 1IIPA 3NDPA 2ACVA 2OBLA 1U3FA 3R3YA 4N7RA 2C5EA 4TKVB 1KGDA 3F6YA 1U1GA 1XYGA 5HHTA 3R9WA 2GS9A 4G1EB 4QNLA 2GBLC 3FSEA 3KZIU 3TZEA 3DL0A 4OSEA 1NFFA 1UBGA 4GF5A 4OA8A 4EUFA 1ZQMA 3IG8A 1M10A 4HVCA 1MN6A 4DGSA 4C0ZA 1C7YA 1B1AA 2FZCA 4AIRA 5T57A 1DPFA 2FVYA 1I1HA 3BFJA 4OHUA 1A71A 4ZCSA 4BCBA 4BVFA 4WBNA 4E09A 5DULA 4XUCA 5EUQB 2R7KA 3WQRA 4C0JA 1KJNA 3WE7A 2EWMA 3EVBA 3W4JA 2GK6A 1IUOA 3EGOA 2BEJA 4Z6KA 4FGLA 3MWGA 3H84A 4KR0A 1SWWA 2QG4A 2IPLA 2VDJA 3R0IA 4OKSA 3T61A 2BKLA 2ZUBA 3TPCA 4CM9A 4TLBA 5JAHA 5EKTA 3W8NA 3WXMA 1KE2A 4X94A 4N0DA 2JATA 1V45E 3KAKA 3MJEA 1KAMA 4NV3A 4ZU1X 1D6NA 2CL6X 4KQHA 2PSEA 2HRCA 2WF7A 3PHLA 1ZMXA 3UUWA 3IEUA 4JC4A 2IH2A 1XL0A 4R65A 2L69A 1D8AA 2CFSA 3JD4A 5ESXA 221PA 4FYHA 4F3CA 3RYCA 3RTBA 1C9EA 3M1IA 3II6X 1Z8NA 4I50F 4KFUA 1K9SA 4PYIA 1L3BA 3PRKE 4QBKA 2HC9A 3RRZA 3W7BA 3ZXUB 5F5NA 2JKVA 2WPNA 4CQJA 1OXVA 4QBFA 5FJIA 4LY6A 5CHGA 4CQNA 3P97A 3V3TA 4P7KA 1V4NA 3MB8A 4B8YA 5FWNA 2Z8YM 3RFUA 4EENA 4B3MB 2ZBGA 1DXHA 3KSDO 1XZHA 1WW2A 4RD3A 1AKVA 2H5IA 2WWGA 5AVUA 2JLYA 4NYJR 1MC8A 2C8LA 3FMGA 1GPLA 3PP8A 5DYIA 16PKA 2VTVA 3GEMA 2EFDB 4H08A 5LWHA 2OBBA 1B14A 4KTVE 5DM60 5C8VA 1Y48E 5DYNA 3WL3A 3N53A 4QGGA 3OAAA 3QEOA 2AH5A 4QZ9A 1W73A 3VNUA 4QOEA 9ICGA 3G2NA 3T5DA 9ICTA 3FCCA 1Q5PA 1CQXA 1D09A 5AKJA 1NW8A 5BO5A 3NGLA 4V0NA 4KWIA 2FXVA 4HS4A 1N6RA 4HWKA 5IF3A 2ES4A 2O6LA 4M6WA 1O2DA 2IVFA 1UQTA 1FSSA 1G5TA 3LUHA 5F3DA 5FLEX 1K5DA 2RGDA 3I52A 2C3OA 2C3PA 4G07A 4M0DA 4G37A 4RVSA 3L8FA 4K46A 4PHTA 1SUPA 5EVCA 4GLFA 1E2BA 2WJ3A 3NRZA 3BGVA 3IBYA 4ZI7B 5L1JA 1A27A 2WYWA 1P1IA 2EYQA 3AHEA 1ZBQA 2EC5A 1N1GA 3I6QA 1N0IA 2FU5C 1TV9A 3AI2A 4U0KA 1GKLA 1XZIA 4NMHA 3NCTA 2XGQA 4EA8A 4R2HA 2JD2A 1R0SA 2A3RA 5JSYA 4KJZA 3RWBA 4UXIA 3USES 1UFRA 3MAAC 4RZ2A 1YGYA 5B58C 1V7CA 1W30A 2H1FA 3R2JA 4GSKA 2QNBA 3SLKA 1WTCA 1GY8A 3T3EA 1UFKA 1XS9D 3ORFA 2LMRA 2XWQA 3VJMA 4RTKA 3K31A 4DCCA 1IAQA 3HR8A 3KWLA 3A37A 2EAOA 2QXUA 5L3RA 2HPAA 4IDPA 4RZXA 1L5LA 1QG4A 2WFAA 4DFKA 3DT6A 3HWRA 2QQ5A 2RGCA 3LUFA 4DQPA 2FI1A 2C92A 3GMSA 3NRBA 4GECA 4HVTA 4UC0A 3WWDA 3ZE1B 4B40A 4EGCB 5BUSA 3ZGXA 3IDAA 2IIPA 2KWIA 2WU1A 4P81A 4RSGA 3UC5A 4Z4IA 1KRXA 4DWWA 3OKAA 5EIAA 3HHPA 3TLGA 2XMQA 2LPMA 3U61B 4L78A 1SJ9A 4JDPA 1ZQKA 4IZIA 3E2EA 1X70A 2GO1A 4DY4A 3GQBA 4MQMA 2BFEA 4OG2A 3WLNA 2PXHA 3UEOA 3GU3A 3L5KA 3ZU4A 3C0KA 1TXGA 3KUXA 3LDHA 4IDEA 3VR4H 1I0IA 3OTQA 1KZ1A 4NDNE 2FPPB 2Q3FA 1TO6A 2ZYGA 3JTMA 1CTQA 1QV7A 3FTQA 4NBLA 3D54D 1WD5A 4EKIA 1KOFA 3KIPA 5J3JA 1HT3A 5LA6A 1LDEA 1IU9A 1W0JD 4OU4A 1Z6YA 3EE6A 4QGAA 2GRAA 1EUYA 2I03A 2IS6A 3IGFA 1YS7A 3QU4A 4RULA 2F8TA 1NQVA 4EMUA 1BFDA 4RQ6A 2FEAA 2NT3A 4OI2A 3VSDA 3WA7A 2E5LB 1UPFA 4JLNA 1BVYF 4Q8FA 1BXZA 3GVIA 1UA0A 4YP1A 4ZU6X 4EB0A 2XGJA 5JJLA 2NU9A 2D4HA 3ZPXA 1ZD9A 4ED6A 1RAAA 2QPOA 4J3FA 1K68A 5H59A 4B7AA 4YMGA 3GLFE 3DEHA 3SFTA 3PSFA 3FOWA 4OJKA 2A19A 2G25A 4TTQA 3PMNA 2OE2A 3WFJA 4EPTA 4PXYA 3FMIA 2J4FA 3HDJA 3U17A 2VP6A 2WG1A 4MKFA 4A5SA 4DUGA 1MTZA 3CMMA 2ZPUA 3E9EA 1KSJA 3L7CA 4JIMA 2D0IA 1QFSA 4LVSA 3ICOA 4EKGA 2OBYA 1JG3A 1EZ1A 5J4VA 2A1JA 2FW0A 2C5HA 1KYVA 1WXEA 4I9NA 2Q5IA 5I5GA 4CM8A 4DYHA 4DB2A 2I87A 2ZUCA 2RHRA 3EIEA 4TXLA 2RI6A 3TWOA 5U9CA 1XVIA 2FB9A 3WB2A 2NUPA 2GFQA 2FWRA 1LX6A 3LRPA 5HFJA 1V9SA 1WXHA 4MLCA 4ZKEA 1XPOA 2IZ5A 2LPEA 2ZIEA 2YBEA 3D81A 3EMDA 1NVGA 2IRWA 3RH6A 1NE7A 3EQ6A 4M53A 4HDNB 3ZY2A 3HUDA 4J0CA 4WTOA 3QY9A 3PFGA 2R62A 2I4RA 1FYVA 1Y80A 1TGVA 2H5JA 3C6KA 3WIDA 1ECWA 4EGQA 4EFDA 2HMTA 4DMLA 1Y9AA 1XCJA 3H1FA 4R1PA 3J81k 1GGKA 3FKSA 1EUDA 2JGRA 4KPUB 2IPNA 5CB8A 2JLBA 5BMOA 2RHTA 5AVQA 2YVLA 3H04A 3NUZA 4XLZA 4AY3A 2QROA 4QBHA 3GGDA 3U3ZA 5KKNB 2Y93A 1HZZC 3WLHA 5CA0B 1SCUA 2GOYA 1FTGA 3T7DA 1VLLA 3SYNA 3FYDA 2PS1A 4FN4A 4IZHA 4XE5A 3FHTA 4B79A 3J81j 2GSWA 1UBNA 3O8QB 5C7YA 3K96A 1VKRA 6GPBA 1SHJA 2I0FA 5A7GA 3C28A 5LQRA 4R0MA 2R68A 4Y2XA 3VYWA 3DXZA 4RQTA 2AVNA 2DQNB 2OBNA 1ADGA 1RVDA 2ATVA 1RWMA 5ARCA 3SIWA 5M7EA 3F8WA 5I3ZA 3OHSX 2YYZA 1PJZA 1Q0QA 1RI4A 4UKDA 4DQDA 1XXLA 4F45A 4MHTA 1VGQA 2G0TA 5JXGA 3D7NA 1CF4A 1YMQA 3T4UA 1KMMA 5IC5A 3IUQA 4QXMA 4ABTA 5BR8B 2ZE8A 4LXYA 3RWMB 2ZWPA 2I5HA 3BGDA 3EXFA 2W4IA 2WFZA 3N07A 1BYUA 3N2LA 4I6JA 3PHHA 1D2NA 3ZQ6A 1PVQA 1EFTA 4F7WA 1RWPA 3OT4A 3O8NA 4PEVA 2VKQA 4H4DA 5BR1A 1SPXA 3EIXA 2BKXA 1Z68A 2NXEA 4AYXA 2R8PA 3ICWA 4LTNA 2ET6A 4RIHA 4FEYA 4W4TA 4WKPA 5IKOA 4F6CA 4FB5A 5HXAA 2I8LA 2H63A 3KQTA 5J4LA 2O2ZA 1ZQBA 1V71A 8MHTA 2D06A 2IEAA 2NRVA 3OLVA 3V2UA 1AZLA 3JYQA 1ISFA 5AM4A 5BPCA 3TAXA 3Q6IA 3ZBPA 1O0CA 1JQ3A 3EGCA 4JQYA 2XQFA 4KMRA 1WHSB 4MV0A 4PWZA 4LJRA 5ILGA 1A7JA 4CQMD 4YMWA 1GYQA 1JEEA 2RHBA 4NL4H 2D1TA 3M4XA 2NUAA 4L0DA 4P4SB 1FY2A 4BQNA 4PFSA 1OFTA 1R10A 1XN1A 4HFMA 3BGOS 3SFZA 1U0FA 2XVZA 5KT7A 2JAQA 3LQRA 1U2QA 2WM9B 5CT5A 4JLMA 5JWRA 3GMDA 4BZQA 2IIBA 4UQOA 4M1SA 3R74A 3GXBA 4CQMB 5IJXA 3CYFA 4BNTA 1Q0PA 2FWBA 2O0JA 2XNSA 1QS0B 4LWPA 4MUKA 5BOSB 4OJQA 1H0SA 3V97A 2BTQA 2P2LA 5TRTA 4LZNA 5IYZF 4BLWA 3K72B 1A76A 5DYWA 2HWYA 4FZ3A 1T2UA 1WW8A 1R4NB 4WVFA 3QG1A 5HPYB 3QWAA 1KK1A 4D9CA 1J2TA 1DSSG 7ADHA 1P8AA 3D4IA 3DE5X 1ZIDA 3IOBA 1X7YB 3PMLA 3K1AA 5CBPA 2J5RA 5AVVA 1N1DA 2GK3A 2GPNA 4ARAA 4BMVA 2LYHA 3I32A 4C4PA 5DYGA 2UZ4A 5H9WA 1IHYA 1NVTA 3KQPA 1EE1A 1OZHA 2GF2A 3IODA 2BZFA 1XLTC 3D4OA 1FS6A 1WTAA 3X1XA 3F5EA 4JLBA 1QIJA 2H3EA 1L7VC 2OCDA 1V11B 4J7CA 3D7RA 3GEEA 4L07A 1OU0A 4TV8A 1JYFA 4KMOB 2G1KA 3QV2A 4N7JA 3K0AB 4ARZB 5FAKA 4EI7A 3NYWA 3OQIA 4J6EA 3PEUA 1BDBA 3WLLA 2DC1A 3QKWA 4BO6A 1IN4A 1PT5A 5KFTA 1P77A 4FI3C 4TMWA 5CFPA 1FXWA 4GM0A 2VTDA 1G9TA 2OMEA 4YV7A 1NBOA 1VL2A 3F96A 3NKLA 3RHZA 2CE2X 4MROA 4AN4A 3O38A 5G0UA 1YCHA 3H9JA 1G21A 1X1DA 4FDMA 1KA9H 1E2QA 2YZNA 4JQCA 4RX1A 5JCOA 3GLHB 4BNFA 4HUQA 2P0EA 4RDHA 1EK5A 2C3MA 2VYND 2C7BA 4KPFC 4UNIA 4DLGA 3UK7A 3OM0A 1F2VA 2FAXA 3RJMA 3QE9Y 3ZU6A 1Q91A 3JZDA 2BHTA 4D9KA 3GLIA 4JJFA 2QMUA 1BWSA 2NZXA 1C7ZA 4CKWA 5HHHA 1Y37A 1JTVA 1G0NA 1VBNA 5B30A 3OM9A 1S7GA 3NTOA 4GR4A 2ZVQX 3HWWA 3LHKA 4J07A 5K3BA 3X1DA 2DETA 3GFGA 2QRNA 1ZL2A 4K05A 3FUVA 4UM7A 2JLZA 2QW1A 1CY1A 1PK9A 3GBPA 3IB6A 3ANTA 3NGMA 3UTCA 5FA5A 2ZBUA 3CKMA 3V1YA 3E9YA 4M1EA 5AVZA 1KBOA 1LUAA 4ETNA 5K4LA 3GLVA 1AF7A 4BMXA 2X5JO 3DDNA 4PQRA 1CERA 5ALSA 4DMFA 1C1XB 1VBMA 2G36A 3R0JA 1O8CA 1YBMA 2FF7A 2ZRFA 3MRXA 2HA0A 3TDKA 2ZRHA 5DHTA 1KXJA 2GAIA 5K4AA 2NSDA 4PPXA 3AY3A 1L7NA 4MW7A 1H9BA 2JEJA 2ZZKA 3L4BC 2XRZA 3PJGA 5IJ0A 1E20A 1KOJA 1EFRA 1H65A 3BDPA 2CZGA 2LBPA 4Z51A 5HZMA 2CFTA 4HDSA 3V4SA 1T36B 1EUDB 2IUEA 1FFXA 2ZR7A 3TXYA 2MMGA 2C7RA 1C1HA 3H3JA 3I9V6 4YS6A 1FU4A 3DOEA 2Y1JA 3L0OA 4NABA 1Q3UA 2OEHA 4BNHA 3EWNA 3TAHA 1A8SA 4DZZA 2J0UB 3PR1A 1U1DA 2XOXA 5D86A 1FX0A 1WNTA 2NXJA 1CJUC 4MQEB 3WX0A 4D9EA 3RB3A 5F12A 4UD6A 4ER3A 2CJPA 1X74A 3DPUA 5CR0A 1GG9A 4FR5A 1P3JA 4YP6A 4O4HF 4TKUA 4I2HA 2JD1A 1NXQA 1KL9A 4JBWA 4BJ5A 1LQTA 4DB4A 1BEZA 1KLNA 1V1RA 5E9WA 4ZVNA 1T4DA 3EXEA 3KQVA 3O8RA 3PE4A 4NATA 5LNK6 2H7XA 2R6HA 2VJMB 1OAOA 3QU5A 2QMOA 4BJ3A 3LG2A 1G3RA 4GMKA 1QTQA 4CM6A 7ICPA 4KDCA 1E3EA 2P77A 5AIAA 4YDSA 2G9QA 3UATA 5IMSA 3KHGA 1IXRC 4EKYA 1KYQA 4MUBA 3OEHA 2DUYA 2C9YA 3FTEA 2KZ3A 3NEJA 3GFPA 4BHTA 5E7JA 1TAUA 1OUQA 2UYYA 4GMFA 4N01A 5EZSA 4CEIB 1LTQA 3SC2B 1GYRA 1XVAA 2WU8A 3GBVA 1XZNA 1B2LA 2YOGA 3AR7A 4ZV7A 4DOCA 4FVTA 5KT2A 1GO2A 2D2FA 1A4XA 3PJEA 5U4XA 3T41A 1B4DA 4ZCMA 5A5VA 3E05A 3M6UA 5TMDA 3UXMA 1XF1A 4M04A 1HETA 2LCFA 4I4IA 5EZYA 4LXHA 1GR1A 3E9NA 3V34A 4AJJA 5DWQA 4HNUA 1KE1A 5BXYA 4FGWA 3JQQA 2EBFX 2VI5A 5K51A 5C1BA 1E8DA 4X91A 3RS7A 4BQSA 3O8BA 1XTJA 2HU2A 2UUAB 5BVGA 4GBGA 2N9UA 4ALKA 4H0CA 2AEFA 1VSUA 1O95C 4HFJA 4IWYA 1C8KA 3MJSA 4Z0HO 1W0KA 5J23A 2WTEA 3C1AA 3O95A 2A59A 1L3SA 1KDPA 3IUMA 3LT1A 4R2JA 1U47A