3SD7A

1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
KKNYEIVLFDLDGTLTDPKEGITKSIQYSLNSFGIKEDLENLDQFIGPPLHDTFKEYYKFEDKKAKEAVEKYREYFADKGIFENKIYENMKEILEMLYKNGKILLVATSKPTVFAETILRYFDIDRYFKYIAGSNLDGTRVNKNEVIQYVLDLCNVKDKDKVIMVGDRKYDIIGAKKIGIDSIGVLYGYGSFEEISESEPTYIVENVESIKDILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphatase
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
total genus 82
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3sd7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sd7A01
3VAYA 3FGOA 3PCTA 3ZWDA 1CQZA 4EX6A 4CF3A 1ZD2P 2IYEA 3QLEA 1TA0A 2CFSA 5ALJA 4UM7A 2W11A 2B82A 1K1EA 1RLOA 3QYPA 4KX3A 3J7TA 1ZD5A 2W4MA 4BNDA 1RDFA 3N1UA 1NNLA 2G09A 2G0AA 2I33A 2AGVA 3ZX5A 3U7GA 1Z4KA 1VJ5A 3SF0A 4PNHA 2RBKA 3KC2A 1YNSA 4ZEWA 3N8GA 3WKAA 4EELA 2JARA 2AMYA 2G1AA 2I34A 3SKYA 2O2XA 2NYVA 4ZEVA 1Z5GA 3WK9A 5AW4A 5E0OA 3AR6A 3OCZA 5AW0A 4YH1A 5AHXA 2YJ3A 1RPZA 3NALA 4OFZA 1QQ5A 3P96A 4DW8A 2ZBFA 3IRUA 4DFDA 2I7DA 2HF7A 3WK5A 4L6CA 1ZJJA 4UMFA 3U26A 1AQ6A 3E8MA 4IG4A 1LVHA 3N07A 4Y3UA 3SHQA 3WGVA 3M9LA 2NO5A 5ALLA 3AR4A 4UATA 4J03A 1L7PA 1TJ5A 2Q4TA 1TE2A 2CFRA 3QU5A 2R8YA 5ALSA 2I6XA 3WKCA 1VJRA 4B6JA 4KX5A 3ESQA 5AM2A 1L7NA 5AICA 1RLTA 5AK6A 2HOQA 2B8EA 1ZS9A 2HI0A 1Z88A 5ALUA 3M1YA 1NRWA 4OCZA 4CE6A 2YFYA 2HEGA 1WVIA 1L6RA 2OBBA 5AKKA 1RQNA 5JJBA 2CFTA 5AVQA 2WF5A 4UMVA 5AM4A 3SMVA 3NIWA 2ZXEA 3ZUPA 1SWVA 3E58A 2G08A 4BEVA 4YCLA 4H1WA 3EF1A 2HF2A 1RKUA 2YJ5A 4Y2JA 3D6JA 3SKXA 3I1YA 2P11A 2FPWA 1X42A 3A1DA 2EARA 3F9RA 4FE3A 5ALDA 4G9BA 4OD0A 3DV9A 3ED5A 1O03A 3PGVA 1Z4QA 2BDEA 3I76A 3NANA 2FUCA 2P9JA 4YIKA 4YCMA 5AVZA 3WK6A 2YMLA 2EAUA 2ZG6A 2B1QA 5AK4A 5AKZA 1O08A 4E88A 3L8GA 4C4SA 1KYTA 2C88A 2G06A 3AR8A 5AW3A 4CNQA 5ALVA 4XPZA 4AP9A 5AVVA 3OCYA 4J2TA 2FUEA 4BX0A 3PGLA 2OYCA 5FP0A 5AM5A 2R8XA 1YJ5A 2Q5EA 3KD3A 2WFAA 2AH5A 3ESRA 4F71A 3RFUA 2FI1A 3DAOA 1L7MA 2FEAA 3QUCA 5AW9A 3QGMA 2QYHA 4EZEA 3AR7A 4AS3A 3WK7A 2RB5A 3EF0A 1FEZA 2YMMA 1Z4JA 2DQSA 4NWIA 3S6JA 3EWIA 1T5SA 3WKBA 3I6BA 2WHEA 5ALKA 4KYTA 5AKIA 3N28A 3FVVA 1S8OA 3MC1A 2ZBGA 3FM9A 4KNVA 4BEWA 2IOFA 1Z5UA 4UMEA 2HDOA 3WKEA 3SD7A 4Y2QA 1Z4LA 5AVYA 2IOHA 5ALGA 3U19A 5AM1A 5T41A 2R8EA 4BNDB 3OPXA 3R9KA 3OCWA 4L57A 3MMZA 5AVUA 4UASA 2MU2A 3KDPA 4Y2SA 2Q4RA 1L8OA 3NUQA 1XP5A 1N8NA 3WK8A 4C4TA 1T9ZA 2ODAA 5AI9A 4Y2RA 2MU1A 3ZI4A 5AVSA 3W5AA 3DNPA 4HYTA 1QQ6A 3WKDA 3ZTYA 2RAVA 5AKLA 3L8HA 4G63A 1Y8AA 2JAOA 5AKXA 2GO7A 3U13A 3CNHA 1SWWA 3QU7A 1WR8A 3KBBA 4GXTA 4Y2TA 3A1CA 1S2OA 5A3SA 2HX1A 5IT4A 4BBJA 2GHQA 3AR9A 2WM8A 4QJBA 5ALNA 2YBDA 2C9MA 2AUTA 2YN4A 5AW1A 1QYIA 5ALPA 1XVIA 2HO4A 3B9RA 5IT0A 4L6AA 4BX3A 1L8LA 3UMCA 2VKQA 5AKGA 5AW8A 3HLTA 5AIBA 2FDRA 4UAUA 2ZBEA 4HGQA 4NABA 2OA0A 1RMQA 5AK3A 5IS2A 3ZVLA 5ALYA 5AVWA 2WF9A 4YIHA 3OCXA 5AI8A 3IJ5A 2FPUA 3SLRA 3AR5A 4JB3A 3QXGA 2QLTA 4FFDA 2OM6A 4ZEXA 5ALFA 4I9FA 4UMDA 4HGRA 2C8LA 1RKQA 3PDWA 2W43A 5AM3A 3L0BA 3QU9A 2PQ0A 4Y2PA 5AKJA 2B8JA 4DCCA 4HAIA 3U7FB 4Y2YA 2C4NA 1XPJA 3UM9A 5ALRA 3TLMA 5ALOA 5AI5A 3ET4A 3WK4A 1J97A 4BKMA 3W5DA 2NO4A 3MPOA 3ONNA 2WF6A 2C8KA 5AW6A 2YJ4A 3QU2A 3E81A 4NAVA 2EATA 1VFPA 1U7PA 1N9KA 3RF6A 3R4CA 4NV0A 3FPBA 4KNWA 1YMQA 1Z4NA 5AK5A 2IOFK 3QU4A 1JUDA 2YMPA 1PW5A 1RLMA 4XE5A 3CZ4A 1IWOA 4F72A 4Y2VA 3L0CA 2HCFA 3ZVNA 1TJ3A 2B0CA 1RKVA 3QX7A 1RRCA 5ALXA 5ALWA 5AIAA 1LTQA 3L1UA 1EK2A 1ZRNA 2WF8A 3QUTA 1J8DA 2BY4A 4AS2A 4EENA 3I28A 1ZD4A 4YCNA 3ZU6A 3KOOA 1RMTA 1U2SA 2YJ6A 3A3YA 5AVRA 5AI4A 2WF7A 5ALIA 5ALQA 3B9BA 1WPGA 1ZD3A 3HYCA 3ET5A 3L0YA 5ALTA 5AI6A 1L7OA 3R09A 5AKHA 2MSNA 2FPSA 1NF2A 2R8ZA 1WZCA 4MWOA 3QUQA 1T5TA 3GYGA 2X4DA 4UU1A 2YY6A 3ZX4A 3L8EA 2I54A 5AW5A 3DDHA 1QH9A 5AVTA 3L7YA 4MUMA 4OHFA 5A3RA 1YDFA 4UU0A 1U2TA 2JGAA 3OCVA 4C4RA 3ZW7A 3W5BA 1Z4MA 2PKEA 3FPSA 3L8FA 4EX7A 2GHTA 2BDUA 3A1EA 1CR6A 3ZTWA 3FZQA 4RETA 4FYPA 4BX2A 3ZWKA 1Z4OA 2P27A 1U02A 3BWVA 4Y2UA 5AKYA 3U7EB 5AI0A 2FPRA 5AW2A 1YV9A 1RQLA 2HHLA 2GMWA 2IA5A 3EPRA 1Q92A 4HGOA 3WGUA 2P69A 3OTQA 4Y2XA 1ZOLA 3QUBA 4XOUA 1Z4IA 4RESA 2FPXA 5AW7A 5AM0A 1Q91A 5AVXA 3UMBA 3OCUA 1TJ4A 1YS9A 3IB6A 3NRJA 4NFLA 5ALEA 2CN1A 4UARA 3NASA 1SU4A 4HGNA 3QNMA 2G80A 2GFHA 2ZBDA 3KZXA 2YMQA 2HSZA 4KN8A 2I55A 5ALHA 1RC8A 2RARA 3B8EA 4UW9A 4O8CA 5AKEA 2D2VA 2O9JA 2B1RA 4DWOA 2JAWA 3NAMA 2ZOSA 2G07A 4BYGA 3L1VA 4EEKA 1U7OA 1RMYA 4CF5A 4HGPA 1QQ7A 1MH9A 3U7HB 1Z4PX 3BA6A 3AR2A 4I9GA 3N5KA 5AESA 4CF4A 3ZVMA 4UAVA 2B30A 3E84A 4QQFA 1F5SA 4UM5A 4IFTA 4YGYA 3W5CA 5ALMA 1EK1A 5A3QA 3AR3A 5ALZA 3UMGA 3L5KA 2JAUA 3K1ZA 3MN1A 1ZRMA 2PR7A 4XQ0A 4JDPA 4GIBA
chains in the Genus database with same CATH superfamily
1PJTA 4K9KA 1MO4A 1VGRA 3OPMA 4UHCA 1Y5MA 2PUDA 4CTNA 3QA3E 6ABPA 3AJDA 2JLUA 3N0RA 3N97B 3S8MA 4I7EA 1NYRA 5DGCA 4KLFA 1JBQA 1V1JA 3EQ6A 2PR2A 1WV1A 3N8GA 4HDOB 5HA5A 3A8TA 5CDFA 1C3LA 2HF8A 3KHSA 2VYQA 1NBMA 2H4XA 4FYKA 3DG9A 1IVYA 1TECE 2WU8A 2I7DA 1UOEA 3NC1C 3KZIU 2BJHA 4USAA 5BNZA 3OLZA 3CVUA 3O8LA 4DEVA 1SD1A 2C4KA 5A4DA 1X80A 4GU5A 4BEJA 4LZWA 3LOUA 4M46A 3CF2A 3Q2IA 3TRKA 4ZTZB 3LQYA 3I1YA 2C1EA 1BA3A 4FHEA 1GG8A 2IXBA 4R2WA 3SE7A 4XWAA 5BVHB 4L22A 4P2BA 1E3SA 4KJXA 3O92A 4PC6A 1UBCA 3C3DA 5I7VA 2GAAA 3VKFA 4US0R 5AJUA 1R0XA 4JEHA 1ACMA 3U49A 1MAHA 4PRLA 1NUHA 1NXPA 1SBNE 2B2CA 2J0UB 2W2KA 4OK3A 2ZUWA 4B3SB 5KREA 1RAAA 5JCXA 1IJEA 4QJ5A 5CFMA 1E1QD 4H1HA 3OX1A 2PSHA 4Y30A 3MGBA 1QGUB 4BNDB 2HLPA 2JIRA 4BPRA 1D03A 5JLJA 1IM2A 1XO0A 4OLHA 3AF6A 1PLKA 5TX7A 1R0SA 3I9JA 3TGPA 1PVVA 2OFWA 1AGXA 2FWRA 3MNFA 2FWJA 3DV2A 1BU5A 1SWWA 4MR8A 1W93A 1DJLA 2Z3WA 3QWFA 4MQ5A 1A4UA 1I2AA 3MSCA 1TJYA 4CZ2A 2BDPA 5LM3A 5HF9A 3B9RA 3F6SA 4P7BA 1UXJA 3DFIA 2H6EA 2OHVA 4S35A 1ADBA 3NDRA 1CYDA 1JEQB 1NVVQ 1NGSA 1GPDG 5GAJA 4IIDA 3KQMA 4JC4A 4R41A 4UMDA 1QSLA 5DQHA 4FMCB 3H2GA 3G0DA 5K4LA 1XZJA 4WY8A 4YV0A 5HF5A 4PWZA 4TMTA 1C3VA 3ICOA 3FTCA 5G0UA 3TI0A 1N9KA 4NV0A 2CLCX 4Q0MA 2XUHA 5TRTA 5DHPA 4OQDA 3GDXA 5FA5A 2PRJA 2E4YA 3T1OA 2C4MA 2BGUA 2KOBA 2X7HA 4P0TA 3T5AA 3GFQA 1FQOA 4JB2A 4HB3A 5CEJA 4BLQA 4OAPA 1ENOA 1MIHA 3QY0A 3WQQA 2Z5LA 1XQXA 1KQFA 3TGWA 1XEAA 2YNMD 3AJRA 3JAKA 3M2PA 3A11A 2HW8A 3LBNA 4GXJA 3NKVA 4WW0A 4RANA 3FYDA 1YRHA 3HKEA 5FV4A 2JGKA 4O0LA 1UQTA 4REMA 3TXXA 4JT4A 2YQ4A 3GD7A 2R47A 1EPUA 5CB0A 2Z4SA 3HYNA 2FSUA 3ZWKA 2PYDA 1C1XB 4MHSA 2Q9BA 3KR9A 1VYHA 4U6QA 3AK4A 4Y6GB 2NXJA 1EXDA 1Y9ZA 2O5CA 1ZOLA 4W99A 3RJKA 2HIHA 2IHYA 1H2EA 3LC2O 4TUYA 2HF9A 1IL0A 2ATVA 4ESOA 1KTVA 4XZ3A 4XPIA 2OCDA 1M1UA 3RH0A 2IBTA 3QG5A 4RAOA 3U62A 2I03A 2VAWA 1A98A 2PQ6A 3Q3EA 1XRNA 4XA8A 3OE4A 3JD1A 5BWMA 2WLSA 4P33A 1T26A 1XHEA 1X7YA 1V1RB 1B3RA 3FZGA 2WZQA 3OF5A 1VL8A 1FK8A 2B30A 2R7NA 3EXHC 1Z2EA 3T61A 3WLFA 4IHQA 1F9AA 2ZRMA 4F8YA 3KXPA 2PTHA 5B36A 4TMXA 1FRVA 2JVIA 4ZODA 1ABBA 3C48A 2XB8A 3T4UA 1X1RA 2B82A 2ZBPA 2WKSA 3H5OA 1AZSC 3EPIA 2ODEA 2OCIA 2I3DA 1HT1E 1JLRA 4ZEWA 3F3KA 2YQEA 3R6LA 3LZCA 2EQ5A 3GR6A 2XT6A 2V8BA 4GX5A 3OLVA 1W9MA 4OJOA 4MVCA 3WJAA 5EP1A 1GRCA 4DIEA 3D4NA 1EP9A 2GESA 1VB3A 1B16A 4M2LA 2RIRA 4LTNA 1YBVA 3OTOB 3T95A 3ASYA 2QJFA 4M0LA 4CUKA 1NTOA 1DWOA 4M98A 3ELDA 1WZIA 1XJQA 4FFSA 4JI2B 4AUEA 4BMXA 5AM2A 4RSMA 3UMFA 1PVDA 4IXWA 5K51A 5KYKA 5DDIP 5E79U 3PF9A 4B48A 5K3BA 4IV8A 2WJGA 1T94A 1QRRA 5J2TA 2YVKA 5JJLA 5IIKA 3F46A 1J06A 3L6UA 4P92A 1N8SA 4FPXA 1U9JA 5F3XB 5AVZA 3NNDA 4FHFA 3KJIA 1WE2A 3PCXA 1PK3A 4N9WA 4N3CA 5I5GA 5D7NA 4CQLB 3M6KA 1P4AA 3KSBC 2FUEA 1DWUA 3MAGA 1C7ZA 3WQSB 1KO7A 4NTZA 3WDSA 4P4LA 3RS4A 3ZLTA 1L7BA 4AJEA 1Z00A 1JVBA 1S2DA 4M89A 2IYUA 1OWLA 3ZD9A 1UM9A 3E9EA 3ISVA 5MN4A 2F8TA 2UV8A 3CIFA 1F2UA 1DO2A 2JFGA 1YKGA 1JAXA 3A2KA 4WGGA 3PX4A 2H7VA 2OQVA 4URHA 3X1JA 3AEXA 1JU4A 2H2AA 2RAPA 3CG4A 4NCXA 2QN1A 3Q41A 3P71T 4WOKA 4R8UA 1NJSA 3GOQA 3R6DA 3VSBA 3KELA 1I0IA 4B35A 3C3AA 2RG7A 2VUTA 3DO8A 4YO7A 4EJMA 3C5HA 16PKA 4GGPA 4PFSA 3JPOA 3H5WA 4M8IA 3HLTA 3MOGA 4C01A 1E7MA 2H16A 3GLGA 2K87A 3ERCA 1T9DA 4KQCA 5BUSA 5KFIA 3EC7A 3WLJA 3JPNA 4PBRA 1ZCFA 1K88A 1Q7BA 4RF3A 621PA 1KOFA 2QSJA 4BRZA 3TYXA 4G2TA 2GKOA 1WW8A 2IOQA 3KHUA 4MW0A 5FWXB 4DSUA 5KG1A 4BKOA 5A06A 5FBKA 3IUBA 5EWLA 1TIKA 2OQ2A 1Y8CA 4DAOA 4MVJH 1ZNXA 5FBWB 4JP2A 4LYJA 1ICEA 3TZ6A 5JAQA 3ZLVA 1HO3A 1Y98A 3GVHA 1ETHA 1X1EA 2FFRA 1O4VA 3ASVA 1CUHA 3LY8A 1CP2A 3R0VA 1A77A 3A4LA 4XIJA 4AY6A 3ML1A 5D3QA 2ZPTX 2FR1A 3VBEA 2HJWA 2CK3A 4EMSA 4HLDA 5C0OE 2PRYA 4BNMA 4US8A 2RGXA 4OATA 1HE1C 2JGAA 3F4BA 3GEHA 3OCVA 1NNSA 1V5GA 4AZ3B 4W9NA 4DVJA 3L9WA 1ULBA 5BSTA 1OFHA 3QVJA 3PC8C 1LB1B 3PNLA 1S0UA 5F9LA 2VP6A 3ND6A 1P73A 1Z4IA 4OH7A 2QQGA 5C46F 2P1DA 5EVCA 2OHIA 5FPTA 4D45A 4QWWA 3HCCA 2X4IA 1PWEA 1QF6A 4CT0A 4PC3A 3E70C 5BVHA 4N0DA 2HU5A 4DWWA 3AUFA 4GOKA 3DL2A 5EIAA 4RTLA 4KLJA 1W35A 4O8CA 2PMCA 1EMDA 3FVRA 2AOTA 3V8PA 3VVMA 5C4IA 1UC5B 4QUAA 2FPPA 3LLCA 1U1CA 1US8A 2QSUA 2GZAA 3CX7A 4F56A 3WFJA 3B1WA 2QN3A 2J0UA 3MGHA 4H59A 3RBEA 3RHSA 3L9XA 3U48A 3P4UA 1ZD8A 4DCVA 5DBHX 1Z8DA 4BLOA 1R0BA 2GN4A 1DKQA 1LBSA 3L46A 3RRNA 1XEWX 4EEYA 4NESA 4BZXA 3FCAA 4KQGA 3ZWDA 2A59A 5CM2Z 1NC1A 2V4UA 1SCIA 4KX3A 4BNDA 3L7OA 4L1KA 4JOCA 1H94A 5IBPA 4YAUA 5D01A 1DBWA 2DM6A 5CRIA 2A14A 4ZI7A 3VR2D 2GI4A 3DPUA 3RNOA 2ZRFA 4UTNA 4ZWNA 5HYVA 1U0EA 5F64A 3CF4G 1VMDA 3PHLA 5A0TA 1YZFA 4EF4A 2Q5QA 4K40A 3E2PA 3JYPA 3CZQA 3WLAA 4EG7A 1T5DX 2J3LA 5B1HA 2DBYA 1SB9A 1AS0A 4UCWA 1JEQA 1UPHA 3GIKA 1P77A 2W5UA 1U7UA 1BJKA 1DC4A 2ZIAA 1V41E 4DYHA 1N5KA 3RH4A 9ICFA 2NAPA 3ANMA 4M21A 3D7RA 5JYCA 2E48A 1VP9A 1DE0A 2XB6A 4X1KB 3NC0C 4JGIA 4X71A 3IAM6 4GMKA 2CDNA 1Y1RA 2BFCB 1RC0A 1RM4A 1ZGJA 1L3UA 3FH0A 1WMAA 1E59A 3RSZA 1W0KD 1WCIB 3HZOA 3OPYB 3BKXA 2GN6A 1FP4B 2IH5A 2F62A 1IONA 2O19A 4CJXA 1JG6A 2I67A 4HXEB 4GOLD 3CV3A 2NUPB 2HNKA 4BX0A 3KFLA 4DTCA 3T3DA 3NEAA 4UOZA 1Z0FA 2XMPA 3Q2OA 2C95A 3MCTA 3C8UA 4DY6A 2C2WA 4DVGA 4OP1A 1SG9A 3DPSA 1GZ4A 3OP4A 4AJ4A 1FIQA 2X0JA 3K8YA 1ZCBA 4GT1A 1I5OA 4F93B 1F14A 3P32A 3WZMA 1GRQA 3A06A 3L1IA 4DCGA 3DM5A 3E0FA 3MR6A 3JAMA 1UFVA 4JT2A 1C1XA 2VT6A 1S8FA 1G8KA 4ZTUB 3WKDA 1IRIA 3L8HA 3PE3A 3TVYA 4A2WA 1QO0A 4GWKA 2H1HA 4KR3A 5BW5A 3L4BA 4HWTA 1MBZA 3PFHA 1XLTA 5A5DA 2IYYA 5KOHB 3MJVA 1VBMA 4DSKA 3TLCA 1H8HA 1E8MA 4OVKA 1MN8A 1D2NA 4TS4A 1O3YA 3ZVLA 4IJMA 3D0RA 5DM0A 5KBYA 5AP9A 2O3QA 3UVEA 5BNFA 1XWLA 2ZJ6A 1PG5A 1USGA 3PFKA 4MK4A 1V1RA 2PQ0A 2MCFA 7ICHA 2GZDA 2O8VA 4RX1A 1M2JA 1AKVA 4Z7JA 3PNSA 4WRRA 4XWKA 5JMTA 1VPVA 2Q6IA 2HN9A 1BDMA 2FN8A 1LTQA 3KAJA 1F1JA 3ZCVA 1DKMA 3WLRA 4XUGB 3WDMA 2JIZA 1WP4A 5BT8A 1CNMA 3Q5EA 4CMAA 2CV2A 3RAQA 1VYTA 1WJGA 1Y89A 1AV7A 3U3JA 4KXNA 4JP8A 2PMZF 2ZWVA 1RXIA 3ZGVA 4GKBA 4EYSA 5I5EA 3LX6A 2EKZA 4FE4A 3ZK9A 2IMWP 2OAEA 4DL5A 4ZU3A 5GTDA 2JEJA 5L3ZA 2JFOA 4K1LA 4X41A 4BOYA 1YOBA 3U7EB 4INOA 4JWNA 3IT0A 3V33A 3KTFA 3GLIB 4X8MA 1XA3A 3Q98A 3HBFA 3RASA 3W8EA 4COOA 3Q6MA 2WTXA 1A9XB 3CMCO 1JJIA 4QUGA 2X15A 4KH1A 3OIGA 3G0OA 2FLVA 2QN9A 5F5XA 4Q7QA 2V74B 4F5YA 5ANRB 3OEEA 1T6ZA 4LMPA 1VHDA 2QTBA 2F64A 3UQYS 3LYUA 2PWZA 4LHYA 3U4QB 1O95D 2GH1A 1PNVA 4GVPA 3W2TA 3CR8A 1I6WA 5CEEA 2FSIA 3OFSA 2H7CA 3WS7A 2XSZA 1M1ZA 4BNXA 4ZT6A 4LSGA 5A4MS 1E7WA 3X2EA 2DHCA 1K7XB 1JECA 5JI2E 1T43A 3H1BA 1YZHA 1IHPA 3HACA 2UXCB 5IYZF 1KU0A 1F12A 5I9NA 5IAKA 3N5CA 1GNTA 2PWAA 3COZA 4YH1A 1XNJA 3EWNA 4P38A 5THXA 3CRNA 2JFYA 2PRSA 2NZYA 5FB3A 3WA7A 3OJ0A 3FNFA 4EO9A 3R23A 4CV3A 2XTNA 4UHEA 2QTGA 2DHDA 4OHWA 3OTHA 4KAXA 3HPQA 2LCIA 1JRPA 4D57A 8LDHA 1ZM7A 2A3VA 2EF1A 4MWBA 4X90A 4H7JA 4CE6A 4EKNB 1GIAA 3T5PA 1NX9A 3GZTB 3TQHA 4ZYXA 3SMVA 1VKNA 2ZUTA 2G08A 4FFBB 3OZUA 3KRTA 5FWXA 4PZLA 4HVLA 1FP6A 4JB8A 1A7JA 1XTKA 3FTDA 3FDZA 1FQJA 4Q4JB 5LUAA 6CHYA 1G5FA 4XXHA 5LQRA 4PX9A 4I55F 4ZVSA 4EQZA 1LNSA 3UY4A 5KQLA 3SOPA 2VK4A 3QFFA 4TLLB 4B73A 1BVUA 3SAFA 1CHNA 3VNSA 3RWBA 2X4GA 2QA5A 3T5HA 1I7LA 3A6GA 3ICWA 1WQ1R 1G3UA 1HRKA 4CIWA 1M75A 2Q7XA 3KCQA 2YY5A 3ND8A 2D6FC 4LUCA 1PLLA 3KHTA 2VF5X 4D0LB 3RB8A 1ZR2A 4L5YA 3BHIA 1B6GA 2HCBA 1JDSA 1I3KA 4AZ3A 2OZPA 1G63A 4ON9A 3TG8A 4DMHA 4NPCA 5A7FA 3PHGA 2FZKA 2MU1A 3WFZA 4KGZA 4CDMA 1Q83A 4DNXA 2W2XA 1A8SA 1Q7RA 3DFFA 2HLHA 1WXHA 3H5NA 4QGAA 4QRIA 4O0MA 4KV7A 1W1IA 5TDHA 3V4VB 3NORA 5KFLA 4Q3CA 4GOOD 4RENA 4HGQA 1RZVA 3I8XA 1TRKA 1ZQNA 1WVMA 4BBAA 1IMJA 2KIWA 5A4JA 3PC3A 1OILA 4YCBA 2BUBA 2JCYA 2WAQF 1Y5IA 2P7IA 5TGTA 1LY1A 4KLQA 1ZQJA 4B79A 5TS3A 3AUTA 2WJ6A 2O0MA 5IKEA 4J76A 3W5DA 5IG2A 4RULA 3HA3A 5IU6A 1P1CA 1W2WB 1XOIA 4I08A 1N8KA 3KT0A 4H1TA 4L4RA 1ORHA 2PD4A 1ZMBA 2CCKA 3HA5A 2IY8A 4O5CA 2NRZA 4QYSA 3UCXA 4BMVA 4N5LA 5JSFA 2WPDD 2XIQA 3BCSA 3O3OB 2ZZMA 1OYVA 2AXQA 2L19A 3KUKA 5H80A 4HAYA 1A9ZA 1MC5A 1SXIA 5EHXA 1B8OA 2NT3A 2NYAA 4JGGA 4X84A 4BVGA 1HE2A 5T8KC 3DWIA 4MHTA 2LTAA 4EUSA 3L8FA 5DYTA 5IJZA 2I62A 1KFTA 3UANA 4DLWA 4X1KA 5JAIA 3LSYA 4DRYA 4YQYA 1Z22A 4OHOA 2QB0A 2BFCA 4H0FA 4RIHA 1M0TA 1S8NA 5K2MA 2R751 1UBJS 3TQSA 2I6UA 4GXKA 1WCIA 3OPYA 2B34A 1SHTX 2XMCA 5AKEA 4HSEA 4EG3A 1FP4A 3DMFA 1FBTA 5F52A 2NUPA 4EJSA 2YZMA 5FUVA 1UIRA 1G5HA 2DKFA 5AESA 5F2NA 4HTFA 4JR1A 2AGOA 3C1UA 2VRCD 3A27A 5CFNA 3JD2A 2DPYA 1E5DA 2YCBA 3GZ4A 4LZDA 4NF2A 1T4MA 2CZGA 1SC9A 3K92A 5TQ2B 4X6XA 2CVOA 4HNAB 1JPUA 4GM4A 4FC7A 5DDYA 2QX7A 4BATA 2JARA 2OO3A 5HK8A 4X6UA 2LP4Y 4HGZA 3HP4A 2FPLA 2FLWA 1FTWA 1JA1A 1DIBA 1JSRA 1ZONA 1ZFNA 2D0PB 3BAFA 5I7HA 4JBIA 5AJZA 3V6LA 2W0MA 2ZRKA 3IFSA 1C3OB 3IOEA 3AR4A 1SC6A 2CEKA 3MG9A 5CB4B 2B37A 1M1NB 1VJRA 5GIOE 5JH7B 2ZWMA 2JLYA 2ZE6A 4PSCA 3E3NA 3SV3A 5FTWA 1XAHA 1VBNA 3AKYA 4NZMA 4IDNA 2WB1C 2ALJA 5TISU 4LHVA 2HHSA 3HJBA 5FJIA 3I2IA 1LB2B 4E7PA 4PZCA 3FJYA 4MFAA 4FE3A 1Z37A 2UZAA 1XO1A 1YFJA 2J41A 1XI2A 4JBWA 4GYJA 3FF4A 1FFGA 2BOVA 3UJDA 3RF9A 2G06A 4W9MC 1U45A 4FZJA 1R16A 4JSTA 2JGNA 3IX7A 4DR6B 3VH2A 3TL3A 4EY5A 3QGMA 3E9YA 3BRWD 2PL9A 1JHZA 3MUEA 1D0IA 3RFAA 3HG7A 5E38A 5DGBA 2CLEB 1Q3TA 2AZDA 1G6Q1 1SZJG 2B7BA 4UBJA 3G88A 4DQUA 3LWBA 4BMCA 1HYHA 4CN8A 1CY6A 1TPZA 4FCTA 2PS9A 3SZMA 3FPHA 1FYWA 1GD1O 2EZUA 3K2EA 2UZ4A 1C4XA 1XP5A 3H2KA 3CP8A 3MCAA 4ZVTA 3T9FA 4N76A 2VCEA 3KKQA 4MQMA 2GOYA 4EAAA 5IEBA 1IH8A 4ZI5A 5IK2A 4QJBA 5CLQA 4D74A 5IARA 3LUHA 1XC7A 5A9SB 3FUXA 1NBWB 4JCOA 1EIZA 5IIOA 4N9QA 4MQ6A 1UT5A 4MW1A 1AA9A 3DBLB 5DTMA 1ZEJA 3GV5B 2XYRA 2OORA 4UHKA 3CUVA 1DWPA 4OMFG 3GHHA 3W8DA 1WXIA 2Z57A 5DYIA 2JEFA 5EJ6A 4OY3A 3NO4A 1U94A 3CNNA 2PPLA 1WLSA 4DMRA 2QMHA 3YASA 2EAPA 4JR0A 3AEZA 2O5RA 1NSYA 1RYDA 3BYZA 3I04M 3TCXB 4TRRA 2ZBQA 3N4MB 4ZV4A 4GLXA 2DFKB 2QGNA 3KO8A 3HV0A 3KCNA 5EUCA 5KQSA 3SHVA 2PZKA 2FFBA 1GO3F 1EK2A 4ND7A 1GCOA 4DC9A 2A9QA 3QUTA 3LIPA 4ZYTA 5HX7A 1ISSA 3BIOA 4XEUA 1J56A 2OMKA 5IXSA 3PGXA 3TW8B 5I4BA 3OE1A 4NAUA 1BWSA 4Q7EA 4WACA 3H9CA 5KWJA 4OQXA 1UFKA 5KVSA 4YQWA 1II0A 3SJZA 3STVA 1UP7A 1UQUA 4GLBA 5D3KA 4OHYA 3HCPA 4W82A 2IZ1A 1IPEA 2JJ1D 3OWHA 1GJRA 4EPXA 5EHGA 4FFBA 4BO4A 2O3SA 2HPHA 1UBHS 2QENA 1XLWA 2IYTA 2YJGA 4D8YA 4PHDA 1DHTA 1TADA 2YMQA 5HJ5A 4O6VA 4GRIA 3X1DA 4JJEA 3H4TA 3MCUA 4EUFA 4NJMA 3AB7A 1ZVQA 2VDJA 4N54A 4QPPA 1QE5A 1E9DA 2IP1A 3I9V6 5AOCA 1FU7A 1L5RA 5I7AA 4DKXA 4YLGA 1U3GA 3DLCA 1GNSA 4QLAA 4UAVA 3OAAD 2RE8A 1ZQUA 5DW0A 2Z0MA 1L7QA 2FUG1 3H3FA 3PXBA 4X95A 5BYAA 3S3TA 1G0NA 3BB1A 1IG6A 3RAGA 1N3LA 1K5OA 3UTCA 1QPGA 1TU3A 2KJ9A 2J9GA 3G5LA 3EGVA 4PYQA 3CIOA 3IILA 4Z3KA 3WWCA 1IVSA 2Q6TA 2H2GA 3DMTC 1J0CA 3H0MB 4RD4A 2M6RA 1GKIA 4HLUA 1Z56C 1UBEA 5JRDS 2ZYUX 1TLLA 1U9IC 4EARA 1NW5A 2VJ5A 5I01A 1U0SY 2PBFA 4DA4A 4FEGA 3BHMA 1OW3B 3LDAA 4S1OA 5FPYA 5D84A 1N5RA 2H5XA 5DCUA 3S2YA 3TBFA 4QWEA 1MHPA 2JLQA 3P0JA 2UKDA 1KYZA 3F47A 1ECCA 1MP0A 4UEQA 5H16A 3D6AA 1X80B 4MKXA 2JMGA 4S24A 4B43A 4V1CB 2WD8A 2QQ0A 2FPWA 1H4QA 2UVRA 3TIIA 2X0EA 4HDRB 2N47A 3PXCX 5I9LA 4KGDA 1CEQA 4ZIRB 1YQQA 4F3TA 1CG6A 3HNRA 4YAWA 5DB6A 1YR6A 1MNAA 2R44A 4C0JA 1YHZA 4ZVOA 4CETA 2YC4C 1FMFA 2Q4OA 4P7JA 4OXRA 2Y3IA 2UUOA 3H4DA 2CF5A 1K7SN 3WO1A 5BQ3A 4RFLA 3S6JA 2NO0A 4Z0PA 3WLKX 1NDHA 3GFTA 5KS2A 4MW7A 2AMFA 2RHGB 4E1BA 3PJDA 5EAIA 1PYDA 2HJHA 2X7XA 1E6CA 1RXUA 1M6NA 4NEQA 4MS1B 2H1LA 1N2IA 4X92A 1Q44A 4B71A 3HXQA 2HSDA 3ZI4A 1XMVA 3RRBA 4KCGA 2HIMA 4PO1A 1FNNA 1OXXK 1RHKA 1VRCA 2QD2A 3OX4A 4NCKA 4CM3A 3ID6C 5TIIA 3L79A 3VR1A 3OFKA 1HXHA 2ISOA 3O21A 2CNLA 1RADA 3KXIA 1HEIA 4KIJA 3A9WA 1UFRA 2RGDA 2GRJA 4KVAA 2OA0A 4V0RA 3PIIA 2Y0SF 2VJYA 2VPZA 3NBQA 3ISJA 3UXNA 3IDWA 3OQOA 1JR3D 2XY4A 4ZEXA 1OXKB 1R4ZA 2B35A 1OVGA 4M1WA 1VPLA 2K60A 5FBRB 3GLTA 4LHSA 3W79A 2FHPA 3WNDA 4R5MA 2OR3A 3AHFA 3WLPA 3X1KA 9ICUA 4KAFA 5IW8A 3TWOA 3WB0A 5BR8B 3F1KA 3C5GA 4E5PA 4HNAA 4PIVA 4FGZA 1JHUA 4QZAA 3GUUA 3U31A 1D2GA 4FB4A 3QYAA 5DQIA 1ADYA 5K2OA 2B4RO 2NO6A 2AI3A 1I33A 2WF7A 2BMDA 5E8RA 4F1WA 1MVNA 5AI6A 3TAXA 5HM8A 4DOMA 3SOZA 5ER6A 4Q9DA 4UU1A 1C3OA 3O74A 7ICOA 5CB4A 1ZISA 4WEOA 1M1NA 5JH7A 2TRSB 3W5BA 2HT1A 1B23P 2VAVA 4LV5B 4KIWA 1J2RA 5A04A 3JAKB 4ZYLA 3CRQA 4G5RA 3V1LA 1JIQA 1EBBA 4LJXA 1KOJA 3BS5B 2UYOA 1XHFA 4K9LA 3PSHA 4NS1A 4PLPA 1XDZA 3MOSA 4YCJA 4TWZA 1CS0B 3FPLA 4NBTA 4AMGA 2AX4A 1NVMB 1U2ZA 1TZCA 3WGHA 3BTSA 2HSZA 3K32A 4ZOLF 2RI6A 1NRXA 3PPIA 1VPTA 1QVZA 4E2YA 4Z6DA 4M9RA 3G7NA 3BJZA 3G2NA 3AF1A 3UT5B 3C45A 4GP6A 5BSVA 4M54A 3PW2A 3DCIA 3ITDA 1G8SA 3JVDA 5IANA 5IM4F 4ZVRA 3U3RA 4B6RA 3GPCA 4NJ8A 1KYVA 3VAYA 2V7XA 4EX6A 4GZMA 4ZT3A 1FYVA 4WOBA 1BVSA 3DGFC 4D41A 4JC8A 3A1FA 4I66A 3ZU4A 2OH2A 3CSUA 1Y7PA 2JB9A 4RLFA 3UMMA 3UHPA 1K86A 5EGNA 1JHYA 2B4YA 1SOMA 3B6IA 4NATA 1PD1A 3G49A 4N0PA 1MA0A 3TQCA 3ZGOA 3UB2A 4RJKA 4HAXA 1Z3IX 4UMFA 2V6BA 2LI6A 1UJ4A 4MYRA 5CDYA 5ALLA 3TAHA 5T4FA 1N5DA 4ENSA 4UZSA 1Z33A 3PUWA 1FNMA 2OXRA 2F59A 4JV0A 2WG0A 4IXDA 3S2ZA 4HNGA 3D8BA 2A0KA 3Q7PA 2ZXHA 4W5QA 2JD0A 3UMRA 3VYTB 3LYSA 2R0QC 3DEEA 4L85A 4QT4A 3MMPA 4JSRA 2V8OA 2DFPA 4PCUA 1DCMA 2EARA 3ZYZA 2R6GA 4LXXA 9ICTA 4UTVA 1ZDMA 4P81A 5CEFA 3PWZA 2XR1A 2ZM6B 1J8VA 4C88A 2F44A 1UEXC 3E1SA 1PVRA 3LVWA 1E9EA 2ICAA 3TB6A 3G1TA 1V43A 4M55A 4JX8A 3RVJA 4LE2A 4OXYA 3P4YA 3T0FA 2Y1EA 4Z6FA 3Q7SA 4W5NA 3QQ5A 1H4SA 2AMJA 2E1EA 2ZULA 1YR7A 5DYNA 3FZYA 5ALKA 1SCDA 4O1HA 1GPJA 3JQFC 5LA6F 1XTJA 3GB9A 1Z39A 4Q12A 1CQWA 3KQUA 5HJ2A 3UYLA 4D02A 4TM7A 1JS1X 2VTDA 4N7MA 4XUEA 1E4EB 1EINA 4IJQA 1LGYA 1H0KA 2HB6A 2MIIA 4FBUA 1TGVA 2HC9A 3UV6A 3G2KA 4OIFA 3JALB 3C5FA 3M3PA 1GLGA 1GCUA 1DQZA 3LQ1A 4TSFA 4BFWA 2ZRQA 4KTVE 1Q19A 5DHRA 3V7NA 2ZBEA 1NVAA 2I4TA 4JLPA 1EFDN 5ED4A 4CCYB 4RU9A 1S97A 2GZ2A 3EW7A 2VANA 1N6LA 3INTA 1VPDA 4E2XA 3CG0A 3RIHA 4ZEMA 4RZQA 4BNJA 3TTXA 3K8ZA 1QBGA 1VLZA 1XVVA 2O07A 1NW4A 4BFLA 4U02A 1E96A 2ISSD 3W90A 2FFJA 3E81A 4X3OA 2WPNA 3RJGA 2C7RA 1R0LA 3ZZ0A 5JAOA 1P60A 1S7CA 1R8QA 1RVDA 4LSZA 1E62A 2BGGA 5JRTA 3F78A 5IC6A 1PQYA 3Q6IA 3LI2A 4TTAA 5IVPA 4G81A 5EWLB 4RFSA 5EIBD 1I2BA 5EWEA 3EPKA 2E8NA 1JW9B 1IZYA 1EUZA 1ISHA 1JFFB 4PW0A 1UT8A 4KREA 4S12A 5JSQA 3A9RA 2FNAA 2YWJA 1XSPA 1R1DA 1D0VA 5J2CA 4F9TA 10MHA 1KWGA 3ZWVA 1QFSA 5IT9A 1NUUA 3CNBA 1AQJA 4J3FA 1G1AA 3QBJA 4EX7A 1PBNA 1HDZA 3KUCA 2QD3A 4Y8VA 2DFTA 1KY4A 3R8FA 1MQSA 1RQ7A 4ASUA 1E2HA 3E0XA 1JEAA 2RK3A 2GUGA 2PV7A 4ENRA 3T3FA 1GA1A 5BNIA 2PGAA 4V1CA 3D6NB 1P19A 1ULZA 1M8PA 4LY9A 3HXTA 4RK0A 4HDRA 3SI7A 3LT0A 1KP3A 2QVXX 3KVVA 2O9JA 4ZIRA 1IUNA 5EZ5A 4GE0A 3MZ0A 2F3NA 1X74A 3OU7A 3KV3O 2EGUA 1GTG1 4JLNA 3NH6A 1L5GB 9ICLA 4PX5A 4ARVA 2AOTB 3Q15C 4JSYA 4B3HA 5A3QA 4R3WA 3GFFA 2FPPB 1PV1A 2XIJA 1US8B 4BQRA 1MT3A 4I6EA 1VHWA 4M37A 1UKBA 3PX2A 3QE4A 1B26A 2CXHA 3E53A 2OILA 3SR3A 1HORA 5IFKA 1XX6A 1MRNA 3KSUA 2ID8A 2ZJOA 5CFOA 1MB3A 4MS1A 4C0KA 5ECDA 1AY0A 3H5RA 3HDTA 2PZJA 2C77A 4R8LA 4LYEA 3VXKA 1SVIA 1NVTA 1RHQA 1AA6A 2OFXA 1UXKA 3DZKA 1P1KA 3U60B 2PUAA 3OOYA 4O1MA 4QEDA 2KYRA 3MT9A 4ZI7B 3MTEA 3IE2A 3WIEA 5K0SA 4QUIA 3U56A 2GPWA 2R8KA 2VXYA 4WLUA 3ND7A 2PUCA 3AW8A 2ZETA 3L7BA 1SZDA 1IN4A 1KBZA 4BWGA 4Q18A 3I6ZA 5B3KA 3TFWA 2VZ9A 4OB8A 1WCWA 2OGWA 1RWVA 3R7NA 2J67A 3QVXA 2BTQB 2GS9A 4XFKA 4UTPA 4US9A 2RGNA 2B1QA 4OHCA 4TYNA 2H54A 1P72A 3L4EA 2JIMA 1QVWA 1ZJ5A 3O1LA 3DW3X 1BC5A 1V3UA 4NL9C 4URXR 4IYJA 5CAEB 1Q0PA 4YAGA 2VPIA 1ODSA 2QMEA 3T5KA 2I2CA 3CNLA 1QGAA 1DQPA 1IY9A 3AUKA 5HFAA 5LN1A 3B1YA 3QJYA 2G77B 4TVKA 5LQCA 4IQ4A 2RGBA 2BDTA 3G13A 4G1EB 1DC8A 3HP7A 4LCEA 4GXNA 3FKSA 3BS5A 4M0AA 2ABWA 2XPCA 2JGJA 3EMVA 3GK3A 5IVDA 4DNOA 3ZV5A 1T9GR 3BJMA 1OVMA 3VR3D 2FFHA 1CS0A 3EIWA 5HJ7A 1HDEA 3M6ZA 4AY2A 3CLTC 2JLXA 1FSZA 1X2BA 5AHWA 2PUVA 1ECFA 5IS2A 4MHVA 1Q2UA 5DNDA 1H1LB 2WC1A 2A5FA 3TECE 2C99A 3B1ZA 3F7OA 4KR9A 4KDEA 2HR1A 1HV8A 2XDAA 2C8LA 1YBAA 2EJVA 4YHBA 3UT5A 3TQFA 2CKDA 5J0SA 4PGQA 3WK4A 3IHTA 2NUTB 4XVHA 2JGIA 4BUGA 4C4PA 1O9BA 4ZQCB 5TVKA 4J9PA 1MW9X 4OYYA 4HS9A 2HHTA 2H63A 2VPXA 4BMSA 2F17A 3DGEC 3WAJA 2FMFA 4JVLA 1QGED 2YCLA 3T7CA 3Q8XB 4FZ3A 3MAJA 4GZ6A 1ZQMA 4NLKA 5GPBA 3AVPA 1V97A 3RRXA 4OMCA 1AK2A 3HKCA 1J8DA 4ZFNA 2OM2A 3Q12A 5ALIA 3OQNA 2VN8A 3BQ1A 2MSNA 5F76A 1BSVA 3R5TA 2TECE 2EHDA 1JA9A 2PSEA 2FSFA 1IUPA 5LQNA 1ZKMA 3FPKA 4PLGA 4IS2A 1AXGA 4H60A 2AXPA 1UEJA 4H9GA 1SKQA 3JX9A 5FNZA 3FDXA 4LC9A 4E03A 3M9WA 3II6X 2YV4A 1N9ZA 5KFFA 2CB9A 2HHJA 1YUNA 1NK8A 1Q17A 3FMVA 2XE4A 5HKAA 3ZWXA 4PPGA 4INAA 3K9QO 4YRDA 2XAUA 1LSJA 2ACEA 4FQ7A 3NU1A 3TPCA 5LKAA 2UYCA 3L0OA 2HWYA 3GN1A 2FKNA 5G1OA 3RYFA 1DEOA 1CRLA 5ALMA 1DEKA 4ZA2A 1HOXA 2M1ZA 2V7BA 3AUYA 8ICJA 3NYRA 4B3IA 3EB9A 1OH7A 1P8JA 1K0FA 3OMXA 2MSEB 3S7ZA 1RXEA 3PWSA 1DDIA 1J22A 2IIBA 1E4EA 3CJQA 3C8MA 1HTTA 3ZCXA 2EH9A 4RLHA 3AM9A 1MJNA 2BFOA 4MW6A 4JV2A 3JALA 4RV5A 2P2LA 3MIIA 5KFWA 3M5PA 3U37A 4BNVA 1J21A 1PT5A 1S1MA 4UE2A 1FXWA 3WNVA 2FQQA 1FP7A 3NVVA 1ZP6A 1I3LA 3ECCA 1PJSA 2DEUA 1QWOA 5CNIA 2WYIA 2YFYA 4CCYA 1Z28A 3CF0A 5EKDA 3T8YA 4IQ8A 1UBLS 3VYSB 1NQVA 2A4KA 2IE8A 1KRWA 1FFXB 1N6OA 3IEUA 2PEZA 1L3TA 3LP8A 1ADGA 1GT91 2PX6A 4I1UA 4QZ8A 4RDXA 4FNAA 2X13A 3VOTA 1D9ZA 1U31A 1I24A 3KL4A 1CP3A 4RIGA 4MVJD 5EZYF 3ZD6A 3NANA 1TEVA 1W581 4EATA 5IN4A 4I4TF 3U9TA 2E1PA 4Q7JB 1VE3A 4ITRC 2GZ3A 4A0RA 1ZQWA 3FDZB 3HB4X 3ZLUA 3EIFA 2XZDA 3FMIA 3TX2A 4HWRA 4M9XA 2EHJA 4LQDA 1IB0A 4EZEA 5KFBA 3VHQA 5KOIA 1VPEA 3P2YA 2PMBA 5BRNA 1JFFA 4HMOA 5J1TB 1DO0A 3BXZA 2OD9A 3IEKA 4BRWA 3TXAA 1FXSA 1N7JA 5TPWA 4D0RA 5A2GA 3NNSA 3R7DA 4MLPA 3U7IA 4DFMA 2V0GA 4GHWA 2QX4A 5DX8A 3WWYA 2Q6VA 3I1IA 2C2XA 5J2EA 1KJ8A 3MJFA 5ALPA 4WVFA 5I9MA 4KXFB 3VR5H 3KT3A 3V9PA 1LPPA 4Z4FA 1ZNYA 1FQKA 5JCJD 4IMRA 4Q02A 4ND3A 5FI3A 3EUWA 2Z5FA 4RVUA 1HYBA 1SK8A 4DCPA 1T8UA 5SICE 4X85A 3ON5A 2IHJA 4FBGA 4UBBA 1VLMA 4Y2YA 5BUQA 4B3RB 4AXBA 3E3OA 3BIJA 2XLBA 3H7AA 3U16A 4KL8S 3RS0A 5KVCA 4BO8A 5K99A 1XRLA 2DPJA 1UBGA 1XF9A 1U7PA 2YXNA 5JBQA 5KFNA 4PZZA 1BS1A 2OCLA 3LW8A 1P0PA 2DJIA 2HDNB 2NACA 3NAQA 1AROP 1OAKA 1JV2B 4HR7A 2CD7A 4F0JA 5JYBA 1V5EA 4OOFA 5H82A 2WA1A 3KQHA 5IJ9B 4M0CA 1RWNA 1BDIA 2FPSA 2JFZA 4AX8A 5JRJA 5TEVA 1U4NA 4HN4B 2Z09A 5KCZA 2PL5A 1X0XA 1FFWA 1CR0A 3IH5A 2E21A 4ED0A 3KSDO 3TIXB 2DY1A 2P9HA 3G5TA 2HBZA 4GBED 5IJAA 4MV7A 4N3BA 5AW2A 4XSGA 4S1TA 4WA8A 1FSSA 3QK7A 2HMTA 1JFRA 4DLLA 4EHBA 2P2SA 4BFSA 4DUPA 3JZFA 2CDCA 4FZVA 2BTQA 5F77A 4KWTA 2ZYDA 1KI8A 4IDOA 1POWA 3HNPA 2OGUA 2QB0B 8ICLA 1DXHA 1RRMA 1IM8A 3CCBA 2YN2A 5KOYA 2GEKA 1XT6A 1F38A 5CAEA 1I9GA 1AG9A 4DG5A 2GXUA 3N74A 5H02A 1JE0A 4EJSB 4Q39A 1EP1B 3MTDA 1KGSA 1GPKA 3EG5A 5JSZA 4KLAA 5KT6A 2XWBF 4D9JA 2DBVO 4HTFB 4IWYA 1UPTA 2G36A 3WQHA 2P8JA 3AFIA 3V00A 4FGLA 4TLCA 4MO2A 2AN5A 2WEKA 3N39C 2GXSA 2O2XA 3JTMA 4QKQA 1ZGCA 1S9HA 2ASJA 1GLNA 1KMIY 2VQ6A 3RSLA 4UNIA 1HQYE 3M34A 3DAYA 1I8TA 3RAJA 3EF3A 1UXOA 4QGFA 3PC8A 2H5LA 1YA8A 1PGOA 1H1LA 1NRWA 3T12A 5KFCA 5C9ZA 4EY4A 4WNYA 3IBCA 4JNCA 4DYVA 5AOVA 3ME5A 3M9XA 3JR3A 3C1AA 5CIWA 4WLFA 1R3UA 5CCXA 3CM0A 1U5AA 2NUTA 1SCNE 1S8AA 2QUJA 1AURA 1WM1A 2ZRBA 2F48A 4BWVA 1JSCA 2BZ1A 4V0OA 4DPMA 2AIRA 3LO8A 1YFZA 1DBIA 2WOJA 3BGVA 1Z2CA 1JGTA 4D82A 1PX0A 1H0RA 2BMEA 2CW5A 2Z8XA 4A6XA 4MTCA 1IN1A 1P5FA 3SZ2A 1YB4A 5M5BA 3VJKA 5I7UA 3R0JA 3GG9A 5C5EA 5B6PA 1A88A 4HPJB 1GARA 3OHBA 2GD6A 1AT1A 1F0NA 1M73E 1G55A 5IBRA 1K1SA 7ICUA 1MQ8B 3EDRA 4ZT2A 4IIUA 1BDJA 4RSRA 4HATA 1V25A 2ZSAA 2O1EA 4D4LA 3PX7A 1EFKA 2GQ0A 5DYGA 2Q0SA 2BI7A 1OBCA 2CUNA 1YIAA 1K6IA 3ETCA 4R1TA 4DQLA 2XE7A 4MUEA 3B13B 1U28C 2RH9B 4F8EA 4RQ6A 1QYIA 4RVOA 5BXQC 1QIDA 4KO2S 1A9QA 2PS0A 3G0HA 4HQLA 2DLDA 3R0QA 1HBJA 2JI8A 3VZRA 3HM9A 5CIQA 1VCIA 3UXEA 4RQUA 4IIGA 4ZCTA 1Z07A 4FFDA 5CH5A 3TPZA 3PR4A 3N76A 3NXSA 1EGMB 1GUBA 3L0BA 1NYTA 1ZJZA 1KAGA 2HY7A 2EBFX 2XDYA 2FE9A 2QGFA 4MKIA 3K09C 1FDSA 4LRQA 4JXZA 2W6IA 2Z2ZA 4H2DA 3W3ZB 1UR5A 2P0YA 2FZWA 1K2VN 1SOWA 1G291 4JWMA 4X8OA 2ZTHA 1YDHA 4JC0A 4JQYA 4R2KA 2IOFK 1PR3A 2WWRA 3G6YA 4CQJA 3AG6A 4YFYA 3DMRA 4S3MA 4JJIA 2GAFA 4P35A 1FOEB 5JPDA 2KKPA 3L3FX 4R0MA 2Q1TA 4GF5A 2HWWA 3RSFA 2OBMA 4HVCA 1O77A 4XGNA 4E0DA 2REOA 1ZI6A 4Q24A 4PSKA 4LX8A 4P84A 1U8YA 5HUJA 2VLIA 2YX8A 4IL6U 2YWBA 3BZBA 3GJQA 4GSLA 4LJ8A 2GN0A 5CH3A 4BY9E 2C3MA 2XECA 1GDHA 1YL7A 2O1SA 2DGZA 2GHTA 3H5VA 2KMDA 4K6FA 4DXDA 1FFXA 3PFCA 3JQGA 4GMGA 3GJXC 3T4XA 3E0QA 1Q91A 2RG1A 3BD7A 1L4FA 2C2KA 4IUBS 5L1KA 1USVA 4YUVA 5C35A 3ROEA 4X00A 1HETA 4XM2A 1NC3A 5JDCC 4K9RA 1N2ZA 1SKSA 5J2KA 4MVJG 2JAWA 3H1TA 3HR4A 1BQEA 4EEKA 2PFGA 2I4NA 3ADDA 5A5GA 3AZPA 3QPWA 3OFJA 3W77A 3MINB 3TMKA 3G5MA 4LZPA 4QQKA 4NJMB 1E1MA 5CJ7A 1M0SA 4PTZA 2FQWA 1VDMA 2Q6KA 1XTQA 421PA 5KG2A 4IEIA 2EXXA 1PG0A 2PI4A 3BTVA 4NEHB 3KDAA 4WXPA 1P62B 3IJPA 1BG6A 4NZZA 3RO7A 4J0QA 4M9NA 4R84A 3DA8A 1QC5A 1L3IA 1Z5PA 1NF3A 2Z43A 4YAEA 4FYXA 4DSIA 3I9LA 2OXIA 4E11A 4UPEA 3PF8A 3EZ7A 1PGPA 4W5TA 4AJ2A 4IC9A 5THKA 3DO6A 3K9LA 4RJLA 1YCFA 5KJCA 3W9BA 4LWPA 3GA0A 3BFJA 1L7PA 2B83A 2P4HX 5DLYA 5LQDA 4BQSA 2D74A 4A6EA 4DQXA 1NQAO 4KC0A 4Y67A 3EYAA 2BCRA 4GI3A 4KG7A 3C87A 4Y2JA 1T4BA 1A76A 2QRLA 2CVFA 1UM8A 4OD0A 3JQEA 1X9WA 3RTDA 4WLOA 1BQ4A 3K0EA 3BX1A 1ESCA 3H5LA 2XBMA 1IUOA 4TTSA 1M2OB 3DDWA 2HA2A 1KYTA 1N75A 5FP0A 1JJ7A 1U8AA 4WVLA 1PDOA 1QMPA 3RS5A 4BFCA 2FI1A 2PSDA 4L8WB 1B3BA 2FPKA 3CH7A 1GKYA 1Q0RA 3C6XA 1PIWA 4KXWA 3SS9X 4PBSA 5IJ9A 4RF5A 1KK2A 4LISA 4MCHA 4UDYX 4PZ9A 1L3CA 3NMUF 3THYA 4I14A 3ZNQA 5LPNA 1GL6A 1KMHB 4PHAA 2Y1KA 3GJTA 1A8UA 5CD1A 3BQMB 2PGDA 2HRCA 4HDAA 4H15A 3U2QA 3IVGA 5KYTA 1VZ2A 4R0NA 4U63A 4L9AA 4RDIA 2H92A 2ZIXB 1UCVA 2ZJ7A 3DE3X 4YXWA 4NX2A 5K9ZA 2BE7A 3NONA 3K75D 3B85A 1PJBA 4DSTA 5JDIC 2J3EA 4DSAA 3FCYA 1EG2A 3GDFA 4H0NA 3LMKA 4KJZA 2LW7A 2VJQA 5KTSA 1C20A 2XCTB 4TPKA 4Y9TA 3TTTA 4RKQA 2VDNB 2ZYVX 4G0PA 5EUQB 3SXUB 3RVBA 2QMQA 1IHOA 3TSCA 4J0GA 2JBHA 2X40A 1X9XA 1B42A 4QFBA 4Z1OA 1C9EA 3T79A 2EDUA 5G3YA 1X8XA 4X6LA 3V8EA 4O3MA 3AMVA 4P3PA 1WZEA 5JQGF 5IT5A 3GG2A 4PYIA 2W4QA 4IIVA 3AW9A 1IZ7A 3BQ0A 2AJLI 1P7ZA 4ENTA 3IUQA 2A0WA 3WOHA 2Y8EA 3KTAB 5HKBA 1XWWA 2NZJA 3M9NB 1DFHA 4Y0NA 1EBFA 3ZDXB 4YCNA 1RMTA 1LUAA 3TZLA 5EHQA 3FNBA 1WPGA 1ZD3A 5JS8A 4LZJA 3IBYA 3AHEA 1A8QA 2ZT5A 5K05A 1ESEA 1NBAA 1DV1A 4YP5A 3D8RA 3L41A 1NV9A 4EK9A 4KW7A 1JSXA 4GXRA 1JQDA 1C80A 3VNQA 1BH2A 1E58A 4LBYA 4MYUA 2JA2A 5DCWA 3MRTA 1CI4A 1NUPA 3UWMA 2VAMA 4BFTA 4IHJB 4YRKA 3T7KA 3LE8A 1NLMA 1N5MA 1BGWA 5CWRA 4FXPA 4BCBA 4RQAA 5H83A 2KZ3A 3KKPA 1Z3CA 2G88A 1LJLA 2ZJFA 5JS2A 2W2OA 2WJVA 1E32A 3NTVA 2PWPA 5DG7A 1QU3A 3TSOA 2A7XA 3O2JA 2FY8A 4FR0A 3UA4A 1LPAB 1E1RD 4JYAB 5IINA 1G4AE 1T8SA 2NW6A 5KU7A 8ABPA 4LXQA 1XJCA 1MENA 1N2GA 4OXXA 2O7QA 4ID9A 3RTEA 2P68A 3EVDA 1SEVA 4YGYA 2UVVA 3H1EA 2EIHA 2G3YA 3H0EA 2R68A 5CXUA 3ER6A 3HI6A 4II3A 3KQKA 1E89A 1OFIA 3TZQA 1JEYB 1GN9A 3WBFA 2B4QA 3CW8X 2P7HA 1NIPA 3N1UA 1XRQA 4EGQA 4PHCA 1J5EB 4DSJA 2AGVA 5ARCA 5HJEA 2GPSA 3CLKA 4RS3A 1EFCA 4UVDA 2FJ0A 1AN0A 1S76D 2BSAA 3DFUA 4TQUS 4WKGA 5KFGA 2VSFA 3DTTA 4HLNA 1LJ8A 2ORED 2XCSB 3I52A 1NY6A 3KNZA 1SEPA 5ALSA 4XKJA 4O1IA 5IUKC 3VSDA 1TQ2A 2WZDA 4AFNA 1QAQA 3LFUA 1OYYA 3HJAA 3P20A 1ZC4A 3VZPA 1XZMA 4DNFA 1X94A 3HY4A 3JTEA 4YR2A 4KQ1A 5AQ1A 2EDAA 4N03A 3G02A 4IQTA 2OHOA 4QUJA 2SECE 4QSMA 4L0DA 1JDTA 5JMPA 4QUHA 1XV5A 5A9TA 5B7GA 3UV3A 2I22A 1NVKA 5FV7A 2ZYWX 3KX2A 1P6XA 3F73A 5FEUA 2X2PA 2QM7A 2H0QA 5D3ZA 5ICGA 3EGOA 1HFKA 1A3CA 2YMMA 3KB8A 4F38A 3INYA 3C4JA 2BMAA 3VOBA 3AQEA 2R4UA 2BCQA 2CJWB 3OWOA 2C2OA 3BEOA 3THWB 1IK6A 1QRTA 4AULA 1KJWA 1CY4A 2VWGA 3B7PA 1PR4A 4EFNA 1B93A 2GAJA 1GLVA 5KJFA 2C5BA 4O5EA 1EUDB 2GZRA 2P9QA 4I50A 3UHAA 2HTFA 2ZUEA 1X1TA 4DR2B 1CWUA 2DSNA 1WTCA 3QU7A 2KVSA 2XT0A 2Q2WA 5SY4A 1E8NA 1NKTA 4BZPA 1O87A 3NHYA 4HJXA 3RS7A 1THMA 3E9RA 2JLRA 3BC1A 4M9ZA 5E1MA 2ZK7A 4HDQB 5E9JA 5DO9A 2ZJ0A 1VLQA 3G6XA 3ZWYA 3FOBA 1E7RA 3Q8MA 3CBQA 1U0BB 3E5MA 4JHXA 3IVCA 2GBLC 1EXNA 3AL0C 4U4AA 1PFQA 3MINA 4X65B 3BGOS 1ENZA 5B55A 2XGGA 3PGMA 3TTUA 2IYVA 4HX5A 2Q8PA 2IEZA 2QNIA 2HBKA 4G5QA 4HT3B 4KLDA 2A88A 2AFRA 5DB4A 5CM8B 1FRFS 2BM8A 3FOEC 5I45A 1BHJA 1CY8A 4MS3A 3A25A 1Y1PA 2DHRA 3PUIA 4DC1A 5FX2A 2D0OB 4OHRA 1PF7E 1WXXA 4MB0A 4EEXA 2Q8NA 3E5HA 4NDZA 3T94A 2CLMB 4DL3A 4L75A 3IHWA 4C5AA 4D4HA 2QKQA 3VO1A 4Y6RA 4RFSB 5AW5A 2CYCA 4YR9A 2RH8A 4OM8A 3IPAA 3F5MA 8ICSA 4ARUA 2AX3A 4JIGA 4G09A 3T1HB 5IBQA 4I9NA 5MN6A 5HHTA 4MGHA 1GM5A 4RY2A 1AQIA 3FWPA 2PEYA 4KWEA 3E7DA 5KG4A 2M9MA 4KR7A 2EX0A 3V6JA 1GZ7A 1X87A 3TOCA 2Y27A 3QNMA 4ZVQA 2NVUA 3ZBQA 2ORIA 1CT9A 1VL6A 1RHJA 5FULA 3I83A 4GFDA 4JLWA 1W6UA 1M2OA 2DFNA 2LZ0A 3C7TA 3ONWA 4CL0A 2QL5A 1RI3A 3EZXA 4IIHA 1KPIA 2AG6A 3GDHA 2NVWA 4MVJI 2HFKA 5FOXA 4OQZA 2FW6A 1HLFA 1VBKA 2A9JA 4ENVA 2NV3A 4IOMA 5JZSA 1EX6A 2J7KA 5K6AA 4IFTA 1MRZA 4EIWA 2FP4A 4BVEA 4GIBA 1KMHA 2C84A 4FZ5A 3WJ2A 1TCAA 4D8WA 2AWOA 4B84A 2DERA 1RDFA 3GFOA 2E85A 4JEUA 3PEEA 2FEWB 3HN2A 3UUEA 2OXEA 4I29A 4KB5A 2ZIXA 4DSEA 5FD8A 5HCUA 1XZEA 1DAEA 1A9SA 2ZFUA 2L42A 3RJMA 1C8BA 3ZIAA 2KJQA 4J4BA 2CLLB 3O91A 3WGZA 2FUNB 3BMQB 4Z9BA 2XE6A 3KJFA 3ROQA 4L8YA 3UGQA 4HN9A 4E5VA 1C5KA 4HRYA 3V7WA 4XVCA 1BMTA 4KX5A 1ZMOA 2HU8A 3HFGA 5AICA 5FTJA 1QDEA 5TT1A 4GP7A 3SXUA 2PPVA 1S2MA 1DUSA 2W3SA 2VAPA 3THSA 3QXJA 4TUQA 3KKAC 4QUDA 3O90A 5C8DA 1X70A 2PX5A 3DYIA 4AQDA 5J9FA 1LBQA 3FMFA 2O54A 4HAVA 1IG3A 2L2QA 5J0PA 1OI3A 3O0TA 3FNQA 3RRYA 2P9EA 1M8GA 5KNBH 4DR3B 1Z7GA 3OZCA 2BKEA 5EYPA 3JQAA 4GOND 4AO6A 5C4GB 2ZTUA 3FCEA 3UWDA 4RAQA 2V7VA 2HBQA 3KTAA 1XRSB 4AU1A 5AW9A 1QH1B 5IKMA 4LNAA 3GILA 3OHSX 3TTSA 3ANYB 2GCNA 5BXYA 3MJHA 5J2UA 4E22A 3T06B 3QE0A 3DMTA 3V80A 4KTTE 3NRZA 5AVUA 1C8LA 1KRHA 2WHQA 1QIFA 3EFBA 3NUQA 1BNCA 2WVAA 1JMVA 4IHJA 4V0QA 3DZFA 1U9IA 3LNCA 4I46A 2JI6A 2Z8ZA 5LXTF 3F6CA 3QYJA 3VKVA 2C9MA 2JLCA 1YB1A 3NVDA 2O8BB 2A33A 5E7QA 3Q8SB 2FDRA 3LP5A 5EWFA 1Z13A 1PSDA 4MI6A 1Y8RB 2J45A 1IPFA 1JQAA 4LVCA 3IULA 4C05A 1M2GA 4MEBA 3Q8WA 1LI7A 1K3UB 3CVVA 4NXZA 4ROSA 3KHKA 3Q8PB 7ICTA 2VWPA 4D8UA 4H18A 3R5FA 4C7MA 1JEYA 1GGJA 2JFBA 4ZREA 4WZBE 1NJGA 3ZHQA 3D2AA 4GI7A 4Z9FA 2ZJ8A 4L8GA 2BTOA 1ZRNA 4RZ3A 1WCLA 4X3PA 3TNYA 2FGKA 1ODIA 4IYRA 5CGQB 1HF3A 1B7GO 4F4HA 1HURA 5AKHA 1DRUA 1QX4A 3ETGA 2RGCA 4P9NA 2CVHA 1CLEA 2AYZA 1D9XA 3HKCB 1XKQA 5KJ1A 5JD3A 5JCOC 1UPFA 1UIMA 3LCJA 5IKPA 1YRAA 2AE2A 4RIEA 4F4DA 1NT2A 3K6SA 4S04A 4PPNA 2EAMA 2VXBA 2EQYA 1Z7EA 4QOSA 1NNEA 3QUBA 4XWYA 1EU1A 2YNMC 1R0KA 1WBJB 3R3HA 3CX8A 2CLFB 2QZZA 1QV6A 5ALEA 3OJFA 3V8NA 1IU9A 3O6VA 2ZJBA 1KK3A 3D7MA 1A8HA 5LR6A 1NOKA 3DEIA 4NV1A 1JXMA 4RPCA 3G9UA 4QXAA 3CVYA 3BUSA 2NPFA 4M83A 2ZTVA 3VTAA 1XRMA 3T3OA 4A5SA 2O5VA 5FHRA 4LYDA 1IOVA 1W96A 4FCWA 3MW8A 5DTRA 3TANA 2XMGA 3AIKA 5IUJC 2XCQA 3Q7TA 1GNRA 1UJ5A 2YDXA 1CEEA 2CJWA 1XMPA 3THWA 5KFVA 1XJ0A 3RYFB 3MR5A 2P0AA 1ZIOA 5EPOA 3L6OO 3OY2A 4UEKA 2HQ1A 4P3XA 4DDTA 1YJQA 1EUDA 1ADFA 4CF6A 3Q7EA 3MAAC 3CW2C 4R01A 3TZBA 2I34A 3RVLA 1XEXA 3NBXX 4ECVA 3K16A 1SRQA 3FW1A 1BMFA 1Q0TA 2JIDA 1Y7HA 5TZVA 4OI2A 2PG3A 4J6EA 3EVTA 3TZKA 3R7BA 4U6PA 1TKAA 1R66A 1FTNA 2B5VA 3EJWA 1HSZA 4PQYA 4NXNB 3URKA 3CS3A 2YS6A 4WCDA 3QU5A 1L4BA 1QTQA 4XJXA 2Y0CA 4BZQA 1HM5A 2IQ5A 4LECA 5J4LA 4O2AF 1B0XA 4YALA 3ABIA 2HL6A 4BTVA 5EJ8A 1XZBA 4D4MA 3EGWA 1ZBDA 3CF4A 5A05A 1IJKA 2BM0A 4EM6A 4FT4A 2B25A 4R54A 4JODA 4E4YA 1WMEA 5KAMA 1U7HA 3TIGA 1ONSA 2MOKA 1P2GA 2W6CX 3KM0A 1INLA 1KA9H 5JEEA 4MWZA 1Z2DA 2GD0A 5TVGA 1FC0A 3KLOA 1L7MA 4GR4A 1I1QB 3BK2A 3WK7A 1ORRA 1U6KA 4GMXA 2WIDA 5JO0A 2CMKA 3DOCA 3EXHB 5KYYA 4PXAA 3CZRA 3TZCA 4TWJA 1K7FB 2A9RA 3NUGA 2FE4A 4R2LA 4GYKA 4Y2SA 3G7UA 5MDHA 3ORSA 2FX5A 1DV2A 2VOJA 2C7QA 4WDQA 2RGGA 2G7MC 1WOYA 3ELYA 2P2ZA 3CNHA 4WOJA 1ULAA 2YFQA 5TPWB 3TOSA 4TL6A 2DGDA 4HNTA 3ZZMA 3AL2A 3BKWA 3GROA 4GBGA 3VDXA 5DDMA 1D4AA 4FYHA 3KEOA 2FMHA 3OZFA 2I5HA 1A2QA 1NATA 3U40A 1OLUB 1GPMA 5L6LB 3TRHA 2GF0A 4FDTA 4FOLA 1E94E 1AHPA 4C30A 1EGAA 4AY3A 2BKUA 4IRKA 2I4RA 4OP3A 4WBXC 1O94D 5A7HA 1SO8A 3ICCA 4ECEA 1UJBA 1LPOA 3A32A 7ICVA 1Z4NA 3A6DA 5DBFA 1Z36A 2DHQA 3NTLA 2C3YA 4GD3Q 2XWPA 3L0CA 1CXZA 1FFCA 2CLHB 4F1KA 3V4FA 4LDZA 3ND5A 3NIGB 1J42A 3JQFA 2QNBA 3CWCA 1KDZA 4DJDC 3ZQUA 2X76A 2A84A 4G0QA 2YHIA 4TQRA 3BMQA 5F3WB 5FOVA 1N32B 2VK1A 2D5LA 1ZETA 3IBFA 1WXEA 4IDEA 2SHKA 3A28A 2OYRA 3ZU5A 3T9CA 4RPIA 3TCKA 1Q6ZA 4C4YA 5I7OA 1C9JA 2QY9A 1J9EA 4LXGA 1ZVJA 3VUEA 4BP3A 3C7CB 1IAQA 1RM3A 1XQ9A 2F3SA 3EARA 5BSUA 2CXYA 4CIAA 2DKNA 5KKAA 2B6GA 1KO4A 3F67A 4KQEA 1MC8A 1TMKA 5J4YA 1XA0A 1JAZA 5I7FA 4LG1A 1UDWA 4CTMA 1MD9A 4IVPA 5JS1A 3RRMA 3MBIA 2PHZA 4HGYA 2NZ8A 4QPCA 1WIWA 4I1PA 1OLOA 5KX5A 1RBYA 4O4HF 1QH1A 4UHJA 3AZOA 2EIXA 2KM1A 1W7AA 3ZTTA 1FP1D 2XGMA 4BVAA 2P5YA 2R85A 2YTUA 5FUWA 3SS7X 1UZMA 3EVFA 2UZIR 4WA7A 2EFCB 1OB5A 5HMLA 4DG8A 3EZ6A 3R5KA 4Q3AA 2XGJA 1W25A 3QF4B 3LKZA 1ED1A 2PXCA 3MJCA 3L77A 1JQ3A 2X2EA 5JSZB 5KC8A 4NENA 2HUPA 2C07A 4NLBA 2P40A 2NSLA 1Q95A 1ZMXA 3WJ7A 1LVHA 2O8BA 4XLTA 3PLNA 1RFLA 3IKLA 2V6GA 2R8YA 5JR3A 4DZZA 1YTLA 1Y8RA 5FA6A 3U3OA 2OL4A 2Q45A 2RB4A 2CFTA 1FSFA 4G24A 4DQSA 4GSYA 4RQ7A 1PR2A 2OB2A 3QF7A 1UOQA 4PVDA 5I7EA 1I7PA 3RB4A 1Q5PA 1NZFA 3RROA 3S68A 1JXLA 1LRJA 3GNLA 4RCYA 1Z4QA 1YZ3A 4OREX 2JAPA 4YCMA 3OESA 2YMLA 2KEYA 4RK5A 4MWSA 3WMRA 5LIRA 2GWHA 4CNQA 5JY1A 3WSTA 3VV2A 2IKSA 1N0VC 1JN0A 1P81A 1DJOA 2FEAA 5IZCC 2Q2NA 4YRRA 3N7SC 3AR7A 2C8VA 2J3JA 4HRXA 1IRXA 5MFPA 4MUIA 2YWHA 2UUAB 4UDXX 3N86A 2HDOA 4L95C 4B85A 2I78A 2F1IA 4PFJA 1F3LA 3V4ZA 5I8PA 1M72A 3K0AA 2XYQA 2QPTA 3DDOA 3KQSA 4J0HA 3VPHA 5H70A 4TRMA 5KHLB 3W5AA 3RFCA 1SUIA 4E33A 4GXTA 4H4DA 2IITA 4ID3A 4KR0A 4D5GA 2X2FA 3IN5A 3BJEA 9ICQA 2IPLA 3KZKA 4LI3X 3VNUA 2OMEA 3HABA 1P5ZB 3ETNA 4O02B 1NKVA 1OBHA 3AX6A 1QFMA 4B3GA 1OU4A 3N2IA 4C03A 4OH1A 2PSJA 3ROMA 1H6BA 1ZVKA 3Q85A 2E55A 2QP9X 1DLJA 1YJAA 4Q9JA 5AI5A 3FDIA 3PNBA 3EOAI 3Q0EA 2ZCJA 4WZZA 1CJSA 1OLXA 1Y37A 2X23A 4P6VF 4PHGA 2LPEA 4B82A 4W9RA 4NL9A 4I8IA 2QU7A 2ISQA 1JLMA 4IHAA 4LOIA 1OFUA 4HYQA 4KRGA 5B1SA 3SSMA 3O2NA 1AO0A 2JI9A 1RI4A 4BNTA 4YAKA 1TVMA 3UK6A 4K6MA 2KBEA 4ILEA 4FMBB 4D3YA 2DULA 4X63A 2CJPA 3U1VA 2X8AA 2C2EA 2XVAA 1B8PA 3KL2A 3PR3A 5CHEA 1R6VA 3BD9A 5FBVB 2H07A 1Q0LA 1QJCA 5SYAA 1R7RA 4NZ9A 3OLWA 1B0UA 1YE3A 4E5KA 1FJ2A 1UDXA 4C0AC 1ISRA 3DEZA 2ASDA 2PVPA 2CSXA 3PTAA 2ZWOA 4XOUA 3I2YX 3E2MA 4IPTA 3WIDA 1CJCA 4E15A 1U65A 4U6NA 2ZREA 3NHFA 1IBLB 4KBFA 5EVJA 3JQGB 5GGYA 4UDNA 5H2FU 1BRTA 1JJFA 5DASA 2FA9A 3AJ9A 1MLDA 1P9NA 4CCSA 2SCUA 4BYGA 5FFFA 5C53B 3JV7A 3N2NA 3QPDA 3NC4A 2ANCA 3F2CA 4B1FA 3AY7A 2P62A 1JDVA 5EESA 3Q7RA 4N5IX 1A9TA 1L5NA 2PMEA 3EXHA 2G72A 4E5UA 4AYBF 1MJGA 1PGQA 2AXNA 1OIVA 2EEPA 1VHQA 4DSNA 1A27A 3DH0A 4MOWA 3FNIA 3IKVA 3U7GA 1O95C 3ZWBA 3L92A 1J2MA 5K3SA 2IYAA 4I5DA 4YV7A 3MLEA 1KEEB 5E0OA 2GD1O 3F0TA 1RBZA 3S81A 4UHDA 3TR5A 4PG5A 1B4FA 2ATCA 1XBTA 1BD4A 3N9IA 5FWDA 4IX1A 3OEYA 5ENZA 2Y9UA 3VR5D 2BT4A 4FBMA 3ZGYA 1QC5B 2BHSA 4CXMA 3HEMA 3LUDA 4GWGA 2NPOA 2AJ8A 3JVIA 1JHPA 1JR3E 1E6KA 1ZKDA 1OLUA 1NQ5A 2G1JA 3ZQJA 1ACJA 5GVSA 4IQWA 2GFIA 4XEHA 2VIIA 2V7QA 3H8WA 1M67A 5H4GA 2HF2A 3WL5A 4OHKA 3T7DA 4XGQA 1OZGA 4IEFB 4OX9Y 2ZTCA 1DBPA 4ONEA 3LYLA 4J9OA 3ZHSA 4FS1A 1P2TA 1V8DA 3PXXA 4QZ9A 5GINE 3G7SA 4L3OA 5DP2A 4ER6A 1E0AA 1DDGA 4CI0B 4XPZA 2WUVA 4F11A 3NT2A 1P5RA 2R8XA 3H05A 1BD3A 3KD3A 4XX1A 1G38A 2JGFA 2QGZA 1N6KA 1E2PA 4YXMA 3QXSA 3HFRA 4JZYA 1HEYA 4XTCS 4DLTA 3X3HA 4JI5B 3WL7A 3LC1O 1PRYA 4EITA 4B0PA 4L57A 2GSWA 4NKRA 5EKUA 1P7PA 2R86A 3THYB 4D5EA 2EWMA 4LRTB 2R65A 3AQ4A 4JH0A 4KTQA 4YUYA 3OHPA 2OTCA 3V7JA 4HVAA 4EKEA 4R8MA 3U6KA 4P4SB 3RV3A 2P90A 3MMSA 3T7RA 1QUEA 3CZCA 2DR2A 4P22A 3CZ9A 1W44A 5AKGA 3G89A 3LLUA 1NKCA 1MX9A 2TMKA 2NRWA 5TARA 3SBDA 4RK4A 1D0SA 5EIHA 1NM5C 4LE0A 5CNJA 5IHPA 3DMNA 1TXGA 4TV8B 1B41A 3C29A 4R16A 2ETVA 3W0LB 4N01A 2OCXA 5CK4A 3ZJTA 3HRIA 2X42A 3MFHA 1AO3A 5EZSA 4EQ6B 1LLCA 3EDCA 2P4SA 4AG6A 2DUWA 3FCCA 2OVFA 4EDFA 4KLTA 3H16A 4YQZA 1SXGA 3UUWA 5CIYA 1Z82A 3RF6A 3PGJA 4R6WA 3UJ3X 2BC9A 2PXIA 2OZKA 3MFIA 2G7ZA 3RIYA 2WMYA 3PVSA 2XY6A 1ZRSA 4Z4CA 5L3VA 3QF4A 3O4RA 4UNPA 3ZYCA 1RQPA 3FKJA 1PR0A 4RTQA 5F9NA 4BQEA 4R05A 3VSCA 1JHQA 1KZ6A 1VYUA 1TYDE 1G1MA 4RD2A 3FRIA 1F0KA 4CKYA 1KSHA 3G1UA 4MWOA 5GM1A 1BA2A 1O9HA 1BZYA 3WGQA 1UA1A 4JQCA 3BOSA 1SY7A 3TEJA 1JAHA 3VUFA 2DG2A 4RD3A 1VL0A 2XQJA 5JWOA 3ESAA 3RK4A 2IY9A 1DCTA 1W5TA 5IJ0A 3HX0A 3JD0A 4JLAA 1RWMA 1V1MB 3BGSA 2J30A 3URMA 1TEZA 5KT7A 2GN2A 3VSEA 1O1YA 1TUGA 1G19A 2D2XA 5AJHA 4V39A 3KVNA 2JFQA 3NGDA 2X1HA 2QDXA 1UMKA 1K8RA 4F2DA 1LLDA 4EPTA 5CD9A 3NR2A 4RMNA 2A3NA 3U5ZB 1U7OA 5BOSB 2EZ4A 3OKAA 4WFIA 4O4IA 2J0EA 4GR5A 1XDWA 1MABB 4KMUA 2FW8A 4WCFC 3BB3A 3GRAA 4YRPA 1HNNA 3Q1KA 3UOWA 5LZ9A 1RTTA 2VJBA 3OZEA 2ONYA 2CZQA 4H3SA 3JQ6A 1TA0A 5GZ6A 4CT5A 3RK0A 3V4OA 2IBKA 2F55A 2NYRA 2G0AA 4PX3A 1Y6FA 3GGSA 4HADA 6YASA 2ES4A 3VR6D 3P4XA 4OXQA 2ZUVA 1V38A 3WGTA 1OFVA 2IW3A 1ZJNA 5C18A 3IR6A 3PSFA 4MIKA 3IDFA 1KKLA 2G5TA 821PA 4YBZA 3DKIA 5TMDA 5JARA 2AQ8A 4ZZ3A 1J0EA 3VR6H 6AT1A 1T2UA 3AFMA 3K35A 1EZ4A 5AQEA 3ANXA 4F97A 3RT9A 5GY7A 3EMKA 2H08A 4XQCA 5DEIA 3COJA 3PMNA 4M1OA 3FSGA 4UE6A 2BUAA 2IX9A 4DL6A 8ICFA 2V55B 1RQXA 3AKDA 4ERNA 1HDIA 3JQ8B 2C4TA 3M7DA 4YNBA 3UW1A 3U09A 2H85A 5K8VA 3TVTA 3MTAA 2F00A 3AR8A 2X0DA 1O57A 2FUKA 5C37A 1G4HA 4PCAA 4D9CA 4QPDA 3V7KA 1P39A 1A7AA 1C1HA 4OYHA 5CEHA 1VGQA 2E87A 1OXSC 3A1SA 2GCGA 4EA8A 8ICPA 2DQSA 4F4ZA 3A1UA 1MQ2A 4NOLA 3TQIA 4QQNA 4MUXA 2WIBA 5DTQA 2VBGA 1WLYA 2PXXA 2LKDA 4IV0A 4EKGA 3HCWA 1WABA 3PRJA 5B1EA 1Z1BA 2CUTA 1FFSA 3N8HA 1GUDA 3LWMA 3KWJA 1QFYA 2GO7A 3QFRA 5DI9A 1XCOA 1DXSA 2HU2A 4XCVA 2DX7A 5C1PA 1VMKA 1OH5A 5FTLA 4I50B 3VH4A 1GTL1 3COSA 2OXFA 1QH0A 2VQSA 1QORA 5AVKA 2CDAA 4RQBA 2ZKLA 1FNBA 4BWJA 2R8RA 1SR8A 2C58A 1M7HA 3TK1A 4FI3F 4RK1A 4EJ0A 4BAUA 4AK9A 4ALIA 5C34B 3L2OB 4FMDF 2Y6UA 3VPGA 2TMYA 4HZGA 3VO2A 3I3OA 4BKMA 5CA1F 1W46A 1WG8A 4UJ5A 3FX2A 5TQ0B 4C20A 5LLDA 4NAVA 5L1MA 4L74A 1Q3HA 2VJMA 2G28A 3W6PA 3GFPA 4RNNA 2BRUC 3OQMA 3DR3A 1XNSA 1PZMA 5BR1A 3ETDA 4UHHA 1KEEA 4HB0A 2EWWA 4S1PA 2OCBA 4OHZA 1SG6A 3L0YA 2Z6AA 3M4YA 1J5XA 1TYEB 3HK2A 1C50A 3Q1LA 4MS3B 1M1YE 2Z9BA 3QRWA 2QUAA 2ZR0A 3RODA 4I5EA 3FPCA 1L5MA 3I5MA 4YJGB 3D31A 4ZDWA 2D7DA 3NATA 4UBLA 1ZEMA 3S5JA 4UAZA 7ABPA 4WNCA 2UUBB 3THXA 4BL5A 1TJ4A 4D8XA 3QZ8A 5KFJA 3SICE 4F5QA 4ZCMA 4HQ6A 2YZ7A 4MGEA 3B1XA 3QVUA 3D7NA 1GDTA 1RXSA 5EGSA 5E2AA 1RRKA 2I2AA 1RCTE 4M9JA 1I10A 2HK6A 4OG2A 3HJNA 2IV3A 4A16A 4J9MA 2GDJA 4KNYA 4RY0A 1CUIA 1RPNA 2NVUB 3EDOA 1BPEA 3K09A 3M0EA 3B3AA 2G0NA 1F2TB 3BFVA 2NUAB 4BP1A 2FF7A 2G9ZA 3DHVA 4PQGA 1RP1A 4Y6OA 3NJ4A 4CG3A 4M87A 2QSYA 3RVMA 1QLNA 4BO2A 5KNCA 2EFDB 4UU8A 1JPJA 3WOVA 4M0KA 2FP4B 4GVLA 3V2HA 4PYOA 3WYEA 3GLRA 4WX2B 3V4SA 1S6YA 1R50A 1ZIPA 3F8SA 5HKKA 1MAVA 3TLEA 4DG9A 2EJBA 4P4SA 5IDXA 4OLFA 5CDGA 1E7SA 2QM0A 3PV8A 3FUWA 1W0JA 4ECSA 3B2NA 4PFKA 3D3EA 2PS1A 2HEGA 1OREA 4TV8A 2VJLA 3RFVA 4KXYA 1QF9A 1Y1SA 2ZATA 3S40A 4OLAA 5K0CA 1P4SA 4EQ6A 2KE5A 3D6JA 3AEVA 3CNOA 1A2BA 4BAGA 1E0DA 4Q16A 4AQYB 1II8B 5ALDA 3EAFA 5JAHA 2ZIFA 1YIDA 5KFEA 1RBQA 4UBCA 4YIKA 5DNUA 4U2CA 5L1JA 3B6MA 4C4SA 3I34X 1H9BA 2XVZA 1ODFA 3KQVA 2IX3A 1FSGA 3PQ8A 3UAWA 2Y2VA 2PCLA 4HPWA 5DG9A 3CINA 5KDLA 4AF7A 5EYPB 4MW5A 3M4ZA 2PSSA 2AUMA 1W49A 3JQAB 3CNEA 2OD7A 1HUZA 5IX8A 4URVR 1Z12A 4C0HA 4GC6A 1N2OA 3S2FA 1DIOB 1WKCA 1OOEA 5HFNA 2PWBA 2D6FA 2JAXA 2HJGA 3UHFA 2GVNA 1RYUA 1G21E 1K7CA 3LXUX 4IGIA 3CJTA 4XVQA 2HZBA 5J2UB 3SAHA 4IP0A 3WLNA 3WQRA 2V1XA 4FYIA 4M9HA 4B81A 2G40A 2JZBA 1V1MA 1IBSA 1XR3A 5FUBA 4LTMA 3HN6A 3L0IB 4K9DA 2EJUA 5D3MB 4JLSA 1ZHOA 2Z95A 3GH3A 4D1YA 5C5IA 2PX8A 5KTOA 1UXHA 3EEOA 3P9PA 1PI3A 1SKWA 5JNTA 2VDPB 1RMQA 1G7CA 3GEIA 1O0SA 2FSSA 4N6GA 3DC2A 1Q6YA 4EF6A 2QTNA 1ACLA 3MUFA 5BOSA 3S8EA 2XVMA 1WQ4A 5A3VA 1O89A 1MABA 2O50A 2BEJA 1KH3A 5TGDA 3ONEA 2CXQA 3PQ3A 4NY1A 4NU5A 5KFOA 2PKQP 4WWHA 4ND4A 3Q4GA 4FN4A 3IUMA 2FPOA 1EVQA 2P3OA 1QZZA 1PW5A 3KSAC 4OFBA 1ONPA 4TZKA 1GY8A 4RH0A 4QC2A 3T5BA 1QIJA 4K86A 4BTLA 3A10A 2WDZA 1A97A 2C22A 3LPNA 4ZMSA 1MC1A 2PKCA 3UJ9A 3VHRA 4EKIA 1FCJA 2OK8A 3HU1A 3VH3A 3NZEA 5A0FA 3OA0A 4G37A 4BV9A 4E21A 1YH3A 2X4DA 3A3NA 4S05A 4BN5A 4LV8B 2JFWA 2YWFA 3L8MA 1ZQSA 1B15A 2HPZA 3LPLA 3FFXA 1V7PC 2DJ5A 3DXFA 4U7JA 4ETWA 4Y2UA 3PW0A 5T8KA 3SIPA 1XTIA 4RTRA 1PBTA 2AKYA 4D92A 3D7SA 3TI9A 2FPXA 1A0PA 5KFQA 5JDIA 1BS2A 2ILTA 3I01A 2JGLA 2NSJA 1L5WA 4MVJE 2CHGA 3JQ8A 4XIGS 3IS3A 1MB2A 4MGYR 4GNKA 3K6SB 4AKEA 4ZT7A 8ICVA 2GO1A 3PNMA 2IZ0A 4YJ3B 2AXEA 2E8MA