3SD7A

1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
215
structure length
215
Chain Sequence
KKNYEIVLFDLDGTLTDPKEGITKSIQYSLNSFGIKEDLENLDQFIGPPLHDTFKEYYKFEDKKAKEAVEKYREYFADKGIFENKIYENMKEILEMLYKNGKILLVATSKPTVFAETILRYFDIDRYFKYIAGSNLDGTRVNKNEVIQYVLDLCNVKDKDKVIMVGDRKYDIIGAKKIGIDSIGVLYGYGSFEEISESEPTYIVENVESIKDILL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.7 Angstrom Resolution Crystal Structure of Putative Phosphatase from Clostridium difficile.
rcsb
source organism Clostridium difficile
molecule tags Hydrolase
molecule keywords Putative phosphatase
total genus 82
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3sd7A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3sd7A01
2EATA 3I76A 3U7HB 1IWOA 2ZBDA 2YMLA 4YGYA 3ET4A 3ZTWA 1N9KA 4UAUA 1XVIA 4BNDA 5ALQA 1Q91A 5ALWA 3E8MA 4OCZA 4O8CA 5AIBA 4AS2A 3FM9A 4HGRA 5A3RA 3IB6A 3RF6A 5AW8A 4ZEXA 1MH9A 3A1CA 5AKGA 4Y2XA 4BX0A 2HI0A 3WK7A 5AW3A 3ET5A 2B1QA 1Z4PX 4AP9A 3BWVA 4CF3A 1O03A 1ZD5A 2C4NA 3L5KA 4DCCA 5ALXA 1ZOLA 3ZVLA 5AI4A 3MN1A 1Z5UA 3WKCA 3WK4A 4CF5A 1WVIA 2WF5A 3S6JA 3BA6A 4J03A 3K1ZA 1X42A 3QGMA 2G09A 4DFDA 2B82A 2I34A 2YJ4A 3TLMA 5AW7A 2D2VA 2PR7A 3AR8A 5AKLA 1U7PA 4G63A 3OCYA 3KOOA 3WKBA 1EK1A 2O9JA 3NANA 5ALZA 4C4TA 3L7YA 4L6AA 4BNDB 1YS9A 3SKYA 4DWOA 5ALHA 1SWWA 2YJ6A 3PDWA 3SD7A 2OA0A 2RAVA 4OD0A 4BX2A 2JAOA 2GMWA 2JGAA 3QX7A 3W5CA 3M1YA 2FPRA 3NRJA 2C9MA 3ZW7A 1YNSA 3ZVNA 2FPWA 2B8EA 2G06A 2GFHA 1J97A 2CFTA 1RDFA 4J2TA 3I1YA 3P96A 4HGOA 2YY6A 4OFZA 2P27A 1TJ4A 2ZBEA 3WKEA 2FUEA 2OYCA 5IT0A 3NAMA 2IA5A 4EENA 5IT4A 3UM9A 4QQFA 2ODAA 4GIBA 3FVVA 1Z5GA 2I55A 2RB5A 3DDHA 4CF4A 4NV0A 3L8EA 5ALMA 1QH9A 5AW6A 2RARA 2C8KA 3N5KA 3WGUA 3B8EA 3NUQA 2YMPA 4KN8A 3A1EA 1TJ3A 5IS2A 4HGQA 4F71A 2I54A 1ZS9A 4EELA 3WK9A 4UMEA 4XE5A 4BEVA 1T5TA 2HOQA 5AKIA 5ALDA 4YCLA 2YMQA 1U02A 3I28A 2HX1A 3SHQA 4UARA 4I9GA 1YMQA 3ONNA 4Y2VA 3OPXA 1T9ZA 1TJ5A 4EX6A 5AVSA 3CNHA 3WK8A 3AR7A 3KDPA 3WGVA 2Q4RA 3QUQA 2AMYA 4KNWA 2G80A 5JJBA 2WF8A 4BBJA 5AVYA 5AHXA 4YIHA 3UMBA 5AVVA 4B6JA 3FGOA 3ZUPA 1Z4KA 2WHEA 5ALEA 5AM5A 1SU4A 5AW0A 2ZXEA 2I6XA 3DNPA 3KC2A 1NF2A 3R4CA 2DQSA 3VAYA 5ALOA 1L7MA 1U2TA 1VFPA 3ZWDA 2MU2A 5ALSA 2MSNA 2FPXA 3W5BA 2Q4TA 4H1WA 5ALIA 1NNLA 5AM2A 1Z4LA 3L8HA 2FEAA 2EAUA 1WPGA 5ALKA 1QQ6A 4YCNA 3QU2A 3MC1A 3PGLA 4YIKA 1Z4NA 5AI9A 3L8FA 1QQ7A 5ALNA 2WFAA 3IRUA 5AKHA 1CQZA 1YJ5A 4L6CA 5AKYA 2I33A 4NWIA 2YJ5A 3AR3A 2G07A 2HDOA 4NABA 1L8OA 3N07A 5ALUA 4EX7A 2HO4A 2B30A 3OCUA 3QLEA 5AW1A 5AESA 1QYIA 2R8ZA 4Y2YA 2GHQA 2NO5A 4BYGA 3UMCA 2W11A 2AGVA 4ZEVA 4FFDA 2ZG6A 3R09A 1RC8A 2B0CA 1U2SA 2OBBA 3ZWKA 4AS3A 2JARA 3HLTA 4Y2RA 1KYTA 5AKXA 3B9RA 1ZRNA 5AK6A 1VJRA 1PW5A 4KX3A 5AKJA 3N28A 2CFSA 1RPZA 3QU7A 1FEZA 1TE2A 4UMDA 4L57A 1YDFA 2X4DA 2ZOSA 1Z4MA 4UM5A 4XQ0A 3IJ5A 5AW9A 4JDPA 2IOFA 3FPSA 3OCVA 2AUTA 1L8LA 3U7EB 5AVWA 3OTQA 1L7NA 3ESQA 3E84A 5ALJA 3ESRA 3QXGA 3NIWA 5FP0A 2EARA 2P69A 1QQ5A 4MUMA 3L1VA 2IOFK 4UATA 3U26A 3ZX5A 4FE3A 3PGVA 4KNVA 2NYVA 1JUDA 2G1AA 4NFLA 5E0OA 2HSZA 2G0AA 1XPJA 5A3SA 3EWIA 3SKXA 4UM7A 5ALRA 3HYCA 1RLOA 3SF0A 1ZD4A 2Q5EA 5AW2A 5AVZA 3CZ4A 3QNMA 1RMTA 3OCXA 5A3QA 5ALTA 2G08A 3QU4A 3QYPA 1J8DA 1K1EA 1WZCA 3NALA 1CR6A 2JAUA 2JAWA 1RQLA 5ALVA 4I9FA 1VJ5A 4HGNA 4EZEA 5AVQA 3KZXA 3N8GA 2AH5A 3AR2A 1Z4OA 3QUBA 2WF9A 3WKAA 3AR4A 4QJBA 2FDRA 1RMYA 2B1RA 1U7OA 3DV9A 5AVRA 1Z88A 2B8JA 2CFRA 1S2OA 5AM3A 2R8XA 3KD3A 4PNHA 4Y2UA 1LTQA 4F72A 3U7GA 4IFTA 4C4RA 3J7TA 4HYTA 1T5SA 2O2XA 4UASA 3OCZA 4BX3A 2W4MA 2ZBGA 4HAIA 2IOHA 3L0YA 1EK2A 3QUTA 3WKDA 4BEWA 3B9BA 2YN4A 2YFYA 2HEGA 4UU1A 5AKEA 2NO4A 1RMQA 4Y2TA 2FUCA 4JB3A 3E58A 2GHTA 1YV9A 5AK4A 3U7FB 5AK5A 4Y2SA 2BY4A 3QUCA 4CE6A 2OM6A 3A3YA 3ZI4A 5ALLA 4C4SA 4MWOA 3U13A 2YMMA 2FPUA 3EPRA 3MMZA 1N8NA 4BKMA 5AVUA 3EF0A 3QU5A 4UMVA 2PQ0A 3I6BA 3M9LA 3L0BA 1NRWA 2RBKA 1Z4JA 5T41A 2WF6A 2HCFA 4XOUA 4ZEWA 3W5DA 2ZBFA 4IG4A 1L6RA 2P11A 1WR8A 2GO7A 2R8YA 3WK6A 2QLTA 3SLRA 5AI8A 5AI5A 2C8LA 2HF2A 1SWVA 1O08A 3NASA 1XP5A 3UMGA 3E81A 3ZX4A 3U19A 2BDUA 1TA0A 3KBBA 3OCWA 1ZJJA 3MPOA 3W5AA 4RETA 4Y2PA 3L0CA 1Z4QA 5ALFA 5AW5A 1RRCA 2C88A 1RKUA 2FI1A 5AIAA 4YCMA 5AVXA 5AVTA 1AQ6A 3WK5A 2VKQA 3F9RA 4CNQA 1LVHA 4Y2QA 2IYEA 1S8OA 3QU9A 2HF7A 4FYPA 5AICA 3A1DA 5AI6A 1L7PA 5AM4A 4HGPA 4UMFA 3AR5A 3L1UA 4UW9A 3R9KA 2YBDA 3FPBA 3L8GA 2CN1A 3ED5A 4RESA 2PKEA 5AKKA 3FZQA 2WM8A 5ALPA 1F5SA 3N1UA 4UU0A 3RFUA 4KYTA 5AKZA 5AK3A 4Y3UA 4EEKA 2P9JA 3GYGA 3D6JA 1Y8AA 4E88A 3EF1A 5AI0A 1ZD3A 4NAVA 2HHLA 4Y2JA 1L7OA 4YH1A 5AM1A 1RKQA 2BDEA 3ZTYA 2WF7A 2W43A 1RLMA 1Z4IA 3AR6A 1RLTA 1Q92A 1ZD2P 3ZVMA 2QYHA 3AR9A 4UAVA 4OHFA 4XPZA 2MU1A 5ALGA 1ZRMA 5ALYA 2I7DA 1RQNA 4G9BA 2R8EA 3ZU6A 5AM0A 1RKVA 3DAOA 2YJ3A 4GXTA 2FPSA 3SMVA 3PCTA 4DW8A 5AW4A 4KX5A
chains in the Genus database with same CATH superfamily
4ARSA 3UXEA 2OAGA 3WA6A 5HDQA 5TVGA 2QTHA 1RLUA 4URWR 4P4LA 4BCDA 1ZSVA 2EIXA 4IQ8A 4GLXA 4AX4A 3Q8PB 4YAEA 3SM9A 1F2TA 3H6KA 3P19A 2JKZA 1NLMA 4L3OA 1A5BB 4L4XA 5IDXA 3U5ZB 3OSUA 1WB9A 3K5HA 4W5NA 1FNMA 1MNQA 2YOGA 3PQCA 4A26A 3OFSA 5KKNB 3H97A 5FNVA 4LDQA 5JSQA 3TLGA 2ES4A 1GTRA 1UKBA 3CU5A 3ZWPA 1PBTA 3A6HA 2P1RA 2B20A 2DUWA 3QNWA 1YS6A 1T8RA 3GGOA 2BUCA 4MF2A 1LDYA 2DKFA 2OOSA 4IW3B 2RBEA 4E30A 4DYHA 4EMSA 2LYBA 5EWEA 4DF8A 5BN4A 4Q9AA 3IP6A 3FZEA 2ZJZA 4PNEA 1JDUA 3QLUA 1QYWA 3QH4A 1TTQB 1WETA 4RFSA 6Q21A 4MV1A 1FQJA 3DWEX 3ALRA 3DC7A 4LF8B 2HWKA 3AF5A 4OHRA 1MB3A 4YMWA 1OVMA 3CMCO 5KVSA 2GBLC 3DV2A 1GL9B 1M2WA 1UFRA 1XZQA 2CD9A 2OLJA 2Q6IA 1JI7A 3WKCA 1A69A 1I6LA 1Q0PA 1ENOA 1YE3A 1WVIA 3I0MA 1E63A 2IEBA 3KCQA 5COBA 1Q17A 4I9NA 3W1WA 2A1TR 4GGOA 2KV2A 4E4TA 1KMQA 1JI3A 1KYXA 1ZJ5A 2P2ZA 3DF9A 3P4UA 3NIBA 4NEHB 4O2LA 4B3JA 1RHUA 4JNKA 7REQB 2Y9MB 1E58A 2PUJA 1ZL0A 5LZ5A 1LDNA 2JHGA 3Q8QB 4NHOA 2I2WA 4L75A 4AKGA 2YUIA 1FB5A 3CWQA 3GBSA 3KPVA 3FKQA 2WJGA 2VZ9A 3V8QA 1WPQA 3WLQA 4B6PA 1SWWA 1RYZA 2OCDA 2VPYA 3PDWA 4OA8A 2C2EA 1WKBA 4W63A 3DQPA 3UQZA 1K3FA 2Q1WA 3UQ0A 1SIBE 2G6TA 3BGOS 3U48A 1GKIA 2FJ0A 4CDMA 4IV5A 4KPUA 1FVOA 4MYHA 4D81A 4DJ5X 5IDWA 2GLXA 4MPDA 3O4FA 2XTNA 1DKMA 1VKJA 1M6HA 3D59A 3HZHA 2B4TO 2ZXIA 3GJSA 4CTOA 4ELUA 4EZIA 2G63A 4KRFA 3BL5A 1I2MA 3PC8C 4CL8A 2DT8A 1T2VA 2P9BA 3UB2A 3X2FA 2KX7A 1TCCA 1PUIA 4C9BA 2DT5A 4JQOA 3IAFA 3HB0A 4JQYA 5DNDA 3HXKA 1Z6GA 5SYMA 1K5PA 4WMLA 3TGPA 2JFHA 3BXEA 1SU7A 3GFTA 3I8XA 1U9IC 3QUSA 2NUAB 3RJZA 4B35A 3U6BA 4O5KA 4YT2A 4C0HA 4TS4A 2V6MA 4JI0B 4F4IA 3EC7A 3FIJA 1MA0A 1ZIOA 2QKYA 3KYCB 4Q45A 2WJHA 4UXJA 4AJIA 2QW8A 4YMGA 3AFHA 4JT2A 1C81A 8ICSA 1AGRA 1UKZA 4MJ7A 1X8LA 9ICNA 1XTVA 1HQKA 1VE9A 2I55A 2JJQA 4O4LB 2WT9A 3U56A 5BMVA 1KTQA 4CF4A 3MS4A 3ZHSA 1QH9A 4IWYA 2VTDA 3STXA 3UJ8A 4ACBA 3FMGA 2GUWA 1L5NA 1FBTA 1AUXA 3L8ZA 5G3ZA 4RJ2A 2XCQA 3MD9A 1IBCA 5C8YF 5E1DA 1G3UA 3K8ZA 2FSSA 3AY0A 3RLFA 1KPHA 3RAEC 3HKBB 1DQZA 1L9KA 1UH5A 1H42A 2LZ0A 4O0MA 4KK4A 5HILA 1EVYA 4FEGA 5DLYA 2DOKA 5GV7A 4CODB 2Y9TA 5LQMA 3TLEA 3JQ8B 3TKAA 5DP1A 1SURA 1YA6A 2IYWA 1B1CA 1KPIA 2VYVA 4WT7A 2ZYWX 4A7PA 1ZIXA 1CDDA 5CNJA 3V4RA 3M6AA 3NQ41 3K6RA 4DSAA 4J9VA 5A4DA 3WK8A 3LQYA 3M2TA 4B2IA 2ISQA 3B1XA 4HWRA 5KO2A 2QIOA 1QH8B 3A28A 1N34B 1Y8QB 4A03A 5INTA 2J45A 2BV3A 3DTVB 5HUHA 2W90A 1V7ZA 3T7IA 4TTTS 3ST7A 2QGNA 4DA9A 2EZZA 3IKTA 5DQGA 1TCUA 3MT9A 1OZFA 3BFKA 4UBLA 5E2BA 5FTJA 1X1QA 4E11A 1JHXA 1YVEI 5JFOA 1BGVA 4RKWA 3I58A 3DMNA 5BSFA 3O4IA 1JJVA 1UC8A 3B3GA 2ZIUA 3TIFA 1SN7A 2WHEA 2R6DA 1BWPA 3AHEA 3RC8A 5F9MA 3DMDA 2R84A 2KBEA 2Z2ZA 4HWSA 4UB8U 2ETXA 3GN1A 3RBVA 2YCBA 2WV7A 4HNHA 4BO5A 2EG9A 2GYYA 4QUEA 1BVSA 1U2TA 1UJCA 4ZVTA 4URVR 4YCCA 3FRJA 1Q3UA 4Y9TA 1VRWA 4MNTA 4CR7A 1F0NA 4CLRB 3C7DB 1N48A 4P6VF 1AK9A 4MW0A 3N7UA 1JTEA 2WHQA 5DHFA 2HIHA 4PL2A 5KG7A 1DRKA 2Q46A 5BY2A 5LIRA 3U0VA 4UFPA 4G56A 2ZAGA 2H4WA 2PUCA 3B20A 4YJKA 1DT3A 2XCPA 3PE6A 4JCOA 3UMJA 3ZDCA 3GLIB 2HXYA 4HDKA 5AM2A 1L5FA 1EG2A 1VP9A 3F78A 1Z75A 1VHJA 3D7SA 4LRUA 5EGNA 3O4VA 3GIKA 2WFMA 3SS7X 2XBLA 2JLCA 5HBGA 2ZRBA 4G84A 2B21A 3FG9A 1T6NA 1X9XA 3F6YA 4YN3A 4ZOHC 1OI7A 1PR4A 5BR1A 2XKBA 4XA8A 5BMVF 4JC0A 4F7WA 3CRXA 1ZNYA 1S3GA 2V7EA 2QAIA 4MICA 2IS4A 2FZVA 1OXXK 1QHNA 1A9RA 3CNBA 3D1LA 5EMHA 3RI3A 3I9FA 2EDUA 4NABA 4URUR 3PYMA 3UMSA 3ZHTA 3AVTA 2VPPA 3P9YA 1QX3A 1GCUA 1Z9BA 2FWJA 3GMSA 3DTVD 4L28A 4KPEC 4UUQA 1NP6A 4ISBA 3VVBA 2QW1A 4ECZA 3ZU5A 1BN7A 4Q3EA 2BEVB 5AOAA 1KDVA 1K4MA 2HMXA 2Z8ZA 4G3XA 1UDCA 1V2GA 2WJAA 1G291 6ADHA 2PFOA 5GTIU 3NOQA 5HHTA 2VA8A 1U2ZA 4HC4A 1Z6XA 3M6IA 1Y0BA 2XGMA 1A8IA 3TH5A 3OJ0A 3SV4A 2OP0A 4I2VA 2QBYA 4US0R 2BIFA 1TUGA 1F0PA 5CYGA 1EBFA 3V6JA 1G4UR 1L3IA 1LQTA 1ZGCA 1ZH4A 2RHHA 3KQOA 4HCJA 1ORRA 4JDUA 4LX0A 2WKQA 2Y0CA 3RGWS 3PDUA 2LUOA 4P93A 4A3SA 2IDZA 5C1OA 5JCJD 4DA4A 2OEPA 2VG8A 4IQTA 1E2KA 4C8KA 1JFRA 2XMRA 1TIPA 2JGKA 4YCJA 4ED9A 2Q0SA 2G9UA 2OCKA 4H1WA 4RTNA 3DQZA 4KX3A 1HSOA 1XUOA 4GGMX 4MPPA 2NU8A 1FEZA 2XMQA 2ZSJA 1TE2A 4GOXA 1ML4A 3R5KA 4C3OB 2NZJA 3F46A 5CT5A 2BFOA 2FVYA 1HY3A 3V7JA 1T3HA 3C2KA 2DPHA 4UM5A 1R18A 4R9VA 4I4TB 3OGUA 2GH1A 2H57A 3LPNA 2AUTA 3HZZA 2O8EA 1YK0A 1Y42X 1ESZA 3KQKA 4OJTA 1GAWA 2D0PB 4YO7A 1FNSA 3L8YA 3JXEA 4L6IA 4E2ZA 1DAOA 2XNDD 1BXGB 3HP7A 5KCMA 3BMQB 4DGQA 2PGNA 1V6AA 3S7TA 2B0JA 2W6ZA 2R87A 3MOIA 3DP9A 4UATA 1TVAA 3U26A 1AKUA 1U99A 2Z1NA 2JBAB 1XCMA 4GDFA 3RTCA 2JZBB 2HCTA 1TCVA 5TT0A 3FOEC 4NFLA 1TIKA 1QHHA 1QH0A 2G0AA 1DMRA 3I53A 4KDEA 3SSAA 4F9EA 4LBWA 2DFNA 3TR6A 2IDKA 1X15A 1UBJS 5G4LA 1IXKA 1TW3A 2AE1A 1ECLA 3HA2A 4OO3A 5LBUA 4H7DA 4RVUA 2M6LA 2IV2X 2QPLA 1TYZA 3ISDA 3EHDA 4MV9A 2W8LA 1PLLA 4F5DA 1ENZA 2X76A 5E9JA 3EZ7A 4INOA 1EIWA 2YFQA 4JL5A 2BR0A 4A8PA 5IBRA 3D7MA 2WJVA 4WSOA 3OZFA 3W8FA 5U9CA 3IOEA 3BS5A 1LSSA 5J5AA 3UT0A 4O9MA 3TR0A 1EWTA 1PUXA 3RNLA 5K3DA 4HR7A 3FUTA 3OFVA 1NNI1 3BH7A 5GMOA 1CE8A 2FDRA 1H8HA 5K20A 1WP4A 2IH4A 3CONA 3EFHA 3R41A 2AE2A 3URMA 3A6KA 1WS6A 2XVYA 1KDYA 3RS0A 1MP0A 3RB3A 1OGIA 2P90A 3TBFA 5TQVA 1P9LA 3LMKA 4C0XA 3E9MA 1JB1A 3PQ6A 4PAQA 3ZIAD 3M0EA 4M2LA 5C5IA 1MW8X 4RFLA 2WSYB 2JW5A 2PYDA 3WLOA 1DO2A 2W6QA 3L5OA 3IMCA 2WIFA 4A92A 1T2UA 2FR0A 1X80B 1TJPB 3GMDA 3LS2A 3CX8A 4OHXA 4OAPA 4C5AA 4ZZ0A 4EG0A 3D2BA 4NH4A 5A06A 1JR4A 1KI3A 3H75A 4IS7A 2RRDA 1C8KA 4G5FA 4Y1EA 4Y6GB 1G4HA 5CX1B 1PS0A 4YJ3F 3R7SA 3G89A 3U9TA 5AVXA 4G8BA 4BTVA 1FVFA 2PX5A 2Y6UA 4ZZ2A 1KR5A 3NP7A 3A3PA 3ZOKA 1CP3A 4PCUA 5I45A 1H2RS 3IIJA 2JH8A 1AGNA 3PIRA 1KZ7B 3A7DA 4YX9A 5CVVA 3EIXA 3UV7A 5CTJA 5IJAA 2VDRB 4L7VA 4IVNA 3ZZ0A 2MYNA 1E9FA 2R1VA 4JITA 3FYUA 5FXMA 3AF6A 4LI0A 1SXEA 4TSKA 2D2XA 2ID4A 1J90A 1RABA 2CUNA 2YWDA 1OZAA 2B5WA 5CB4F 2JHFA 2HQSA 1JPNA 2VJBA 4ALMA 2J59A 4R8KA 4D45A 4D80A 5CNMA 3EXHA 2ESRA 3RCBA 5CFMA 4LSWA 2QTZA 2VHXA 4ZQCB 1L7RA 3V8BA 3TUJC 3QBJA 1UBRS 4H2DA 4D8YA 5KTSA 4FFBB 2WJZB 2FZCA 1SGWA 1O6FA 3QFHA 2GDJA 4S1OA 4EI7A 5KYXB 2PL1A 3EF0A 4INJA 5CXXA 5D49A 2PR2A 3VKFA 2CHGA 2J6IA 2EYQA 1EWKA 4MKXA 4KH0A 1RWPA 2MT9A 3GEBA 3KT6A 4HEA1 1DZ3A 2YH2A 3RVLA 3WB0A 5SY6A 3AQFA 4F4FA 1AQJA 4G85A 1CR2A 2IEGA 3KHLA 2W2LA 1KMHB 5BQOA 1L6RA 1FTGA 2P11A 4HB4A 2Q9BA 3A9RA 4UM9D 2ZJ6A 3SYKA 3G8BA 1CY4A 1D9ZA 2O1XA 3H7AA 4FFBA 1LX6A 4II3A 5AI8A 5AI5A 1V8PA 2PV7A 3BL6A 4FC7A 3UZUA 2CK3D 3UN1A 4E6PA 1JHDA 2E7ZA 2VWHA 3PDHA 4JAVC 2HF2A 3ZW8A 4F86A 5JZOA 2F44A 2LI6A 1XA4A 2RAFA 3H9CA 2F64A 1GFIA 4IOLA 4DREA 3INTA 3L7CA 4FPXA 4MO2A 4PC1A 4DV1B 1QX4A 1W2HA 1XC9A 2D8AA 1GRRA 2YNMD 5TPZD 4RETA 3ROQA 3DW3X 4POOA 4XUSA 4BDPA 4MWZA 3TBHA 4O4JF 4I2BA 2IYRA 4ZGGA 1WW2A 4DMFA 4FMPA 1CBUA 5JH7F 1YJCA 1XNRB 3N2KA 3LQFA 2I6SA 1HL3A 1HL7A 5HIIA 2MCFA 3R75A 2YYZA 3T7SA 3K71B 1KWGA 2Q1TA 4K46A 5TV2A 1SL0A 3ISJA 9ICEA 1FDOA 3LL7A 4KBGA 5H5JA 3VZRA 3PUJA 4HADA 5HRCA 1W93A 2W6NA 5REQB 4IYJA 2O07A 3BWBA 4YRKA 1US8A 2D6FC 4GF5A 3RODA 4F46A 2Q07A 3T34A 3FCOA 3IAXA 1ARZA 1GA6A 4YQEA 4YY3B 2IBSA 4ZOCA 2RFLA 3QF4A 4K3UA 3VZBA 5BPCA 1GXSB 3PW4A 1F5NA 1L5ZA 1XTIA 3HVJA 1X39A 2ALJA 2XCTB 3R9XB 2C3YA 4WNYA 3N2KB 4ITUA 3LXRA 3TZ6A 2PZBA 3AJ8A 2SKCA 3MSXA 4YI3A 4D5EA 3M6FA 3FPBA 3SR3A 2QY6A 4KLQA 2FGJA 4DEVA 2HSJA 3EUAA 3EVGA 4NBSA 4P0PB 4UQPA 5E4TA 3ZG6A 3MERA 3MBKA 5FUQA 1QAMA 3MFQA 4YAFA 1RAIA 1U8CB 2LMRA 5AK3A 4BNTA 4E0BA 2E4UA 4JVNA 4DF3A 3M4NA 3CVVA 2FSVA 3NGMA 4HTFA 1I24A 3E18A 4MQFB 4O4JB 1NOKA 1NW9B 1HUZA 2ZYUX 3DHVA 3QEBZ 5EXSA 3TPFA 5C18A 2HCRA 3F5AA 3G9ZA 4GPZA 5H3LA 3HU5A 4J0HA 3TX6A 1T1GA 2ZIZA 2BJHA 1V48A 1KFBB 4Q03A 5HE8A 1UMKA 3WB2A 4I55A 1PZMA 1V7PC 5KEIA 1UOOA 4YP6A 4FO6A 4ZVLA 3K2BA 4B3IA 2CB9A 1TMOA 3K0BA 1JSRA 1YQQA 2WWXA 5BO5A 4MGKR 2A2ZA 4UAVA 1EFKA 1GG5A 1YULA 5K3AA 3HKDB 5KHOC 3A58B 3VHXB 3O4RA 3B6JA 4WXPA 3UTCA 2P6PA 1SXHA 2Y8EA 8ICGA 4R2XA 1FDWA 1I7LA 5AM0A 5JRTA 2L19A 2ZYAA 4NFYA 3DAOA 3OHAA 4D3FA 1P4GA 5CHYA 1NT2A 2GZ2A 4DR3B 1Z12A 3WRXC 1PJRA 1SUIA 3NBKA 2C77A 5AW4A 1UAYA 2IYFA 3CNEA 3FCCA 4MARA 1Y1QA 3BYZA 1I1OA 4UBOA 1QSYA 5EZ5A 3IE0A 1HQYE 2OENG 1FW6A 1ZQ1A 5H16A 4JUBA 4TGLA 3DWIA 4LNHA 1X92A 4WCDA 4Y9RA 2VDOB 3GFFA 3SQIA 4DT1A 1Z18A 5DXJA 1N4AA 1G1MA 1EE9A 2CDCA 2PFQA 1TU3A 2GBGA 2NTYC 3DEAA 4FLEA 4KQMA 4Q34A 4QYIA 4B4WA 1U4SA 1UFQA 3H2GA 2QVYX 3H99A 4HGRA 2M6KA 1TV9A 2I8LA 2ZWVA 1A96A 4FS1A 3DFKA 4B2YA 1RPAA 2AF4C 1U8AA 3O8LA 3TSAA 1RWMA 4HKTA 1N7HA 2H7XA 2NIPA 2RBGA 3PGA1 4G4SO 4GMDA 2Q3BA 3OU7A 3WLEA 3OURA 4AFNA 2DPJA 4O3NA 2X6RA 2C99A 4DJDC 2ZR8A 5CITA 1VRVA 5J0YA 1P6XA 3G5UA 4KMUA 4H7JA 4Q02A 5ILGA 3NEJA 4MEJA 3VNRA 3CLVA 4HDMA 1NUTA 4JGBA 5JZMA 1SEVA 1MG5A 3T3FA 1P5FA 1PLJA 3KR9A 4IGAA 4XEHA 5SICE 3ZVRA 4CFYA 4XRGA 3AVVA 3CX7A 2HJWA 1QGOA 4PGMA 5IAOA 1OUMA 4JEMA 5CLIA 4X64B 5AI4A 2WAMA 3QV1A 1FRQA 3HADA 3RTEA 5K0FA 3IBSA 1YK1A 1P1CA 3QPUA 4ZEOA 1YOVB 4QJFB 1KMIY 4NZMA 4O1IA 1REQA 3S6JA 2WNSA 2JS7A 1PEDA 1X42A 1SG0A 3BA6A 5G0VA 2ZE8A 2B82A 3PZRA 4HDMB 3UWOA 1M2NA 1O5TA 3QXCA 2VH1A 3OC0A 3PWZA 3JQQA 4MKRA 3WG9A 2D2EA 2J6SA 3JVIA 2IEZA 1C3LA 2VC2B 4XRRA 3EASA 1EK1A 3N58A 1A77A 3FLAA 5EXTA 1SCJA 2G04A 4FD3A 4II2A 3UJPA 4N5DA 1E2UA 3WLNA 1DIAA 4KBYA 4IOKA 1TCAA 2BZGA 1GAQA 1QO9A 1VSBA 3C98A 3EGEA 4YA6A 2KP7A 4KMOB 4DWOA 4G2TA 4M60A 2CMFA 1G55A 3H2BA 4AIRA 5HW0A 4RSGA 7GPBA 2YX8A 4NV1A 2GPJA 1N1MA 2SCUA 5FNVB 1FF9A 1JR6A 4BV9A 3NAQA 4GKJB 4OD0A 4Z4FA 3H2KA 4PGHA 1P17A 3ZZNA 1G1AA 2GMWA 4KHZA 1DCKA 4XLTA 1JHZA 4RHYA 2I4TA 3RUDA 4O4HF 2CCJA 2I6TA 2D00A 2IHVA 4O6VA 5C0OE 4X3CA 4J9OA 2YVQA 3AMZA 4YEDA 5F98A 5BSUA 3S2FA 3ZVNA 3ZCUA 4D96A 2HLDA 4XQCA 2KJ8A 3DMGA 4B76A 4RDHA 2W00A 5F7OA 4J2TA 1JWBB 4IZOA 5HQ3A 4M0DA 3SSMA 3X2SA 1BHQ1 1TEVA 5L3QA 2OMKA 3LBNA 3QNUA 1SV4A 2GKSA 3VNAA 3IAS6 1DAEA 1RZRA 3DOOA 2O0HA 4P83A 3TKYA 3MCUA 2E8NA 5FBLB 1PN3A 5L3RA 4BWVA 3J80A 2Q5IA 2RHJA 4CQMB 2YN2A 1E7QA 3L04A 4I4TF 5L4NA 1QG4A 3GEIA 5DHTA 3K2QA 3GRVA 1X2BA 1ZWLA 3HCBA 3ZDXB 4C04A 4B83A 3GDHA 5KFCA 1UXGA 3PQ3A 5J0TA 1GZ7A 1XZAA 1U7UA 1X1SA 3KFVA 3K0CA 4CVNA 5CB8A 3C3BA 1P1IA 1E7YA 1BMQA 1UQVA 1YR8A 3LA6A 3N5KA 5K8TA 1J0XO 3IBGA 2JG3A 1UIMA 1NYLA 5BN4B 2IEAA 2OXEA 4RHFA 2HBMA 4UFOA 1XEFA 2R8BA 1CCWA 2AOWA 4LZZA 4XD7A 2OQVA 1M74A 1P7ZA 4BUZA 3F6PA 4HWKA 2AB0A 4U0JA 2XOXA 2WD9A 1KQFA 2ATLA 3M1LA 1RSZA 3ZZUA 2QMYA 4OYRA 4EJSA 1NYTA 2CNWA 4F4JA 2AXQA 4FTWA 5IMSA 1I4WA 3R3JA 2KNJA 3KYIB 1OROA 3Q4GA 4OYLA 3EGOA 5AQEA 4ND4A 2IV7A 5KNBA 1Z2EA 2EQ5A 1YDHA 3G0OA 3U49A 4JLWA 4LRYA 1WPXA 4RLQA 2G4LA 2BSQA 3I92A 4JYAB 2W2KB 2EWMA 3D2AA 3OJCA 1TEHA 4M89A 4D9KA 3OAAA 4Q3NA 1OT5A 1TKDA 3RSQA 2BGTA 3TFSA 1TVMA 2CF6A 3TECE 2DEUA 2X3YA 4KUEA 3NUZA 4EJSB 8MHTA 1QP8A 4V02A 4BCBA 1BDHA 1Z0ZA 3OLZA 4U7WA 3MJCA 3I2YX 2XYHA 5FQNA 3U4GA 3TLZA 4DA7A 2FWPA 5G02A 1VBMA 3LP6A 4UJ5A 1TAUA 4CV1A 3TZLA 3EISA 1B8PA 4ZXFA 3ZZ1A 4PGAA 1ZHHA 2JI6A 2KSOA 1R6DA 2R96A 1DX6A 2V7BA 4KLEA 2W2KA 2X5XA 3BIWA 3VXKA 3ZHBA 1IPEA 2CXUA 2RGNC 3ZKWB 2DULA 1U2PA 5ICMA 3CO5A 4Q7LA 2JIPA 5KFEA 1T43A 2VHQA 4AY5A 3FX2A 2FDCA 1VGVA 3KM0A 1UT6A 4KUGA 2NPFA 3RBAA 3S2GA 4F5EA 5KTKA 5BMVB 1D4ZA 2D74A 2WVGA 2WVHA 3AUUA 3GV8B 1J8VA 3SCZA 2BGJA 4CKCA 3G88A 5BRAA 4PAWA 4BVAA 2AN1A 1YASA 2BLLA 1U81A 3W5IA 4IVRA 3K6KA 2MSCB 4IX1A 2MU2A 2E8MA 4RK4A 3TDKA 1WVGA 2G28A 1QIEA 1C2YA 4L74A 3ZKWA 5KFZA 1PR2A 3CGWA 3DJFA 2Q7XA 3K09C 4FZ5A 4Q1DA 1WUDA 4F93B 2VXCA 2Q4TA 3M6UA 1OB2A 3G2HA 2R1UA 3IQFA 5HK8A 2BDTA 2K60A 5KSYA 3BHMA 5K51A 3PQDA 1R64A 4C7OB 4X90A 4Z3OA 1QR2A 1V4VA 4O5CA 4AECA 5ALKA 2YIJA 4YAUA 3UPTA 1Y6FA 3ORHA 3D1VA 2OBFA 2IUFA 3ZY4A 4WCFC 4ND3A 3PV0A 4RDIA 3HKZC 2C5GA 3JYHA 1YVPA 2YQEA 4ZYLA 3IL2A 3UPUA 2ONKA 2WKRA 4NNPA 3RTGA 3UK2A 1MT3A 3C8DA 2HSGA 3MT8A 3PUVA 2DUNA 2FU5C 2XUIA 3M89A 2NOAA 5TQ2B 3TRJA 1IDOA 1Y8QA 2AZTA 3E23A 5AKHA 4HYKA 4C2TA 1ZQPA 3C3DA 1AHIA 3GLQA 4CKZA 1UMDA 2AQ8A 3MJDA 4F9GA 3C3WA 2I9KA 3LA8A 8ICBA 4OHVA 1FNCA 1Y5NA 2QTFA 3E70C 5F73A 1AIPA 1UBNA 1QCKA 2ATVA 2G25A 2O20A 3KZMA 2E8PA 2GPTA 3DNFA 3OE7A 4KN5A 1V8ZA 4R2WA 4RO0A 2CMKA 4J9RA 1G18A 1RXEA 3MWEB 2QUKA 4FMBB 5TS3A 3O8DA 2Y0EA 4I8XA 4BQRA 2I2AA 4TKVA 3BPSA 2KN7A 1H4QA 1RXSA 2GEBA 1B0ZA 2I71A 1KI9A 2X5JO 5JAHA 1WNFA 2B25A 2XLBA 5DBFA 1E3JA 2B4KA 5EHXA 4EAQA 2E1RA 2UYQA 4QFBA 2QUJA 2XQVA 4BGEA 4OP2A 2XCAA 2M2IA 4NULA 1DKQA 3ZHVA 3LXMA 4C0AC 1PTJC 2B0CA 4YJDA 2XY7A 3CT6A 1X1AA 5IEJA 1WUKS 3RJHA 3IE2A 2J31A 3ASZA 1VFNA 5L8VA 1T2EA 4ZO6A 5DB8A 1JSZA 2QVLA 3COPA 2GK4A 3KDSE 5L53A 1QP0A 4FP9A 3N3BC 5DJ5A 1W76A 4LCEA 3WLIA 2VBIA 5F9LA 1R0XA 5L40A 2WNHA 4BGUA 5C8YB 2OPBA 3MNFA 3EZGA 5J2EA 4KR9A 5IKXA 3EQZA 1RPZA 1Y48E 4LPKA 1EE2A 5F7JA 4B09A 3MBIA 3NOXA 1JKJA 2L82A 3P2MA 1T26A 4EKGA 3ZNOA 2VPWA 2YWHA 1OPXA 3QXXA 2BFMA 1HYHA 4Q7JB 3IJ5A 2ZP1A 4XEUA 4ECSA 5LBTA 3K0EA 4ZCSA 4ETNA 5EHZA 1G7RA 3GV7B 3FR7A 4NNOA 2DBRA 2QM3A 2CBZA 3F7TA 2BFEB 2OH2A 1IVNA 4BMCA 1T9AA 1E59A 4XGRA 1OI3A 1SV0C 1GCGA 2JFVA 4KPGA 2VJ5A 3FPKA 4KGVA 1PD1A 4U7PB 3EY9A 5FTMA 5GGXA 4ZYUA 4V1CI 3QXGA 4TLCA 4ZOAA 5EE1A 3LGXA 1YBMA 3FNBA 5K45A 4KFTA 3HZOA 1T9BA 3DTNA 3KKQA 2EJTA 5L45A 1W1UA 2WWIA 4UVIA 1RM6C 4MW4A 2ANCA 1PTKA 4YUAA 5CNIA 2BP7B 2QP9X 5AHRA 1XLWA 1AB6A 1GZSA 5A3SA 3MUOA 1IQ0A 2AD1A 5CVDA 2WZCA 1X1EA 3GLHE 2V9PA 5A1JA 4LRTB 3RABA 5G4KB 4HB2A 3K1YA 4OHUA 1OR8A 4MFAA 2VI5A 2VTBB 2NP7A 3CZ4A 1G59A 3ZJTA 1R4ZA 2XEDA 5CDHA 5L4SA 7ICVA 2WUEA 3SM3A 2KVCA 4GXIA 1NX9A 1VXOA 2OC4A 5TPWA 2F43A 3TQ1A 1RQLA 4CHGA 4RTRA 4GC6A 2Q4DA 4I6GA 1SAYA 1A5ZA 1KJJA 3JD0A 4IEIA 4ZK2A 1GTSA 4BY9E 3HX0A 2G9NA 4QT4A 5A2QA 1ECFA 1DAMA 2E37A 1VCOA 2WSMA 2ZS9A 1HTTA 3F7MA 4R0NA 4TVSA 1QQBA 4BU1A 5I4IA 1NUUA 3ZHYA 5C9ZA 4NFSA 4HVTA 4PLPA 3AHFA 4K8RB 1MKYA 3EOAI 1Z8DA 1MV8A 1P5JA 1R9MA 1T1RA 1BWQA 1VHQA 1QE5A 5BYKA 4L5BA 4DB2A 3GRCA 2G71A 1H2BA 3C3EA 3QFSA 1T36B 3VU9A 5A4KA 3B60A 4YUYA 4JU9A 1K1SA 1HDYA 1GG2A 3LYLA 4KIFA 1DIGA 1VHWA 4B9AA 1R8SA 4ZDJA 1H0SA 3NDBB 2BJWA 1IAQA 1Z5WA 3PL5A 3ZPXA 4AB1A 1Y8CA 2B7LA 3RS7A 4HJXA 1MIHA 1DT5A 5GTHU 1I4LD 4OXNA 3L7LA 3G5AA 3CRZA 2IOHA 2Q6OA 2E89A 3GAMA 3CVXA 1SY7A 1W94A 4L4YA 8ICFA 2QRPA 3DL4A 3LPAA 3MJEA 4FGKA 4M9QA 5AUQA 3V8EA 5K6AA 1J5PA 3X1YA 2QT1A 3PQEA 3MTIA 4PCAA 4D6XA 2IYYA 2RKBA 4IS2A 5AOBA 4UU1A 1ZK4A 2GM9A 1DPFA 5F3XB 4QELA 2BR5A 2C9CA 4URHA 1Y1LA 1XTKA 4TUYA 3H8VA 3P32A 4TZKA 1AMUA 3E58A 2YVUA 5SV2A 3BZKA 2Y0SC 3O9ZA 5CFRA 2NUPB 5F77A 1X6IA 4NDZA 1NKSA 5JS2A 1CFZA 2AC7A 3LP8A 4NFHA 3PQ8A 5FEUA 1WG8A 4YJ3A 5JNTA 1MEJA 3BORA 1XNSA 2QYOA 4ZVKA 3REQA 2YMMA 2KJ9A 4AF7A 3CNQS 1AN9A 1V97A 2BGRA 4AZTA 2PUEA 2Q6LA 1MSWD 2BRUC 1F06A 1Q0UA 1U45A 1LDGA 1K7XB 4MP8A 4FFPA 4F5WA 4ZHQF 1PDVA 5E7JA 1Y98A 2PJRA 4KQFA 4TWIA 1F8FA 4KXVA 5T41A 3E0QA 5EMLA 2PRIA 2XZDA 3OUTA 3TNDA 3KQUA 3UQYS 1UADA 2Y1DA 2E2WA 4LJ6A 1LBTA 2VRWA 3NIDB 3OU6A 3V72A 2XBUA 2YXNA 4GRAA 5IXSA 1FSSA 1L4NA 1T15A 4WZZA 2BYTA 3DLTA 5IKMA 1XJWA 2EU8A 4RPLA 4WW0A 2C8JA 1I7NA 3M5DA 3O93A 2Q3LA 2TSYB 2RQ5A 1W85B 1Z5PA 2RK6A 2Y6VA 1OX6A 5CJ7A 2TMGA 1VB5A 3DEYX 1L0BA 3DO5A 3H3JA 1KXJA 1IMOA 3MMXA 4JBNA 4CN9A 2KZZA 1Y3BE 4YV1A 5B6JA 4UQOA 5K6AC 2PXCA 4DHEA 1YB6A 3AIIA 4W9RA 1NWHA 3P7MA 4C14A 1YUBA 2QE6A 1KZHA 4JUZA 3KJQA 1D8BA 2AFIB 2Y05A 5J1TB 4CLXA 5AIAA 5J0UA 3OZUA 2QQFA 2XMBA 2HDWA 2HHSA 1G6HA 2PCJA 3Q8XB 4Q4AB 3S0JA 1U2EA 3E1KA 4DCVA 4E09A 1NQVA 3KE9A 1ND5A 4DNPA 4ZPXA 4CU5A 3WK5A 2AI2A 2PGIA 2XGQA 1P1KA 4MJLA 4RS3A 1UEIA 5AOVA 3UFBA 1Y34E 3OKAA 5HS6A 1Y4UA 1B41A 3RSGA 5LVAA 3K2IA 1ZQQA 1CUYA 1KO5A 1IONA 3RT7A 1M1XB 3OH8A 1XTRA 5KTNA 3ECSA 5ARDA 3WMEA 1L7PA 1XHLA 1SH7A 3PFBA 4K05A 4RANA 4WRRA 1A4RA 3DB2A 3L1UA 4H15A 3K5PA 4QO7A 3T52A 2ECOA 3ED5A 4H4DA 1D6JA 2PHZA 1DCFA 5AKKA 3OZRA 1U7TA 4FS3A 4WXHA 5JDCA 4QSMA 5IDVA 3FN4A 3M9MB 2B69A 2BFFB 2FJUA 4UU0A 1XGKA 3CVUA 5DYGA 1I0IA 4MUIA 4JI7B 4ENVA 3W8DA 4NDNE 1MENA 2WIDA 3ED1A 1KEVA 2QSZA 5FOWA 1WCNA 4E5KA 3ROFA 1GPAA 4W4TA 1GU1A 2YC2C 1XN4A 2NNWB 3C41J 4WV3A 4A0FA 5CFQA 3KSAC 2QROA 5DNCA 2BW0A 2J0UB 2H7VA 4LI3X 2IITA 3GLRA 4HYYA 4XRHA 2ZRQA 5F21A 3M8RA 2BDEA 2DHQA 5HR6A 3GEHA 4J0EA 5BOSB 1DAFA 1JFFA 4DV7B 4W7SA 4CIYA 3W3AA 2IPNA 3TW6A 4C0LA 2WHRA 2HHTA 2YHUA 4D25A 1Y7TA 3TD9A 3ZVMA 3BE5A 1LFDB 4I2NA 2J07A 2QN9A 4OQEA 5CGQB 2DETA 5ALGA 5CRIA 5JYCA 3IP8A 5EOZA 1P3DA 5EVJA 4XWGA 3IDQA 3SR0A 2I7DA 4BWFB 4ENTA 1V5FA 4JWKA 1PYDA 5MGBA 3GGPA 3K0SA 3EFEA 3WTCA 1SHJA 4PPNA 4D3SA 3E3NA 2K89A 4M04A 4LRSB 5CDSA 4QZCA 2VZLA 4Q7KA 4DOBA 4EL0A 4JS0A 5D5HA 4DV0B 1X74A 2I7XA 1ORVA 2OZPA 4M7WA 1POXA 4U8GA 1WABA 3A9WA 4BQSA 1KFTA 3PRYA 1XB2A 1AUOA 1W52X 2RKOA 3DEFA 3K9GA 4YGYA 2JVKA 3AUXA 3RKRA 3TSOA 4E4YA 3BMNA 4RDXA 2GEJA 1KK3A 2WINI 2XAAA 4QODA 3RSZA 1YZYA 4LF7B 1YIOA 4J2HA 3H04A 3JYOA 4YRCA 1NW8A 4COKA 2VTVA 3I3OA 1DLIA 1PV1A 1YZUA 1ISJA 2K4IA 4KQXA 4X54A 3NHJA 3SEZA 4CKXA 2E4XA 4DJJA 3FNQA 3KB2A 9MHTA 4AD8A 3IB6A 1B16A 5EHNA 3TW4A 4A1FA 3HY4A 1CS0A 1XDBA 1JDBC 1O58A 1PR9A 3FPGA 2ESEA 3SI8A 4ECUA 3D2SA 4RT2A 2W6MA 3DKPA 3FNFA 1OXBB 1SQ0A 3OIVA 3Q12A 4EHJA 2IS1A 3G6YA 1GNRA 1OBVA 2IVFA 3FBGA 4O4IF 2FETA 3L6DA 5IJXA 4BX0A 3DLBA 1Y6ZA 4X8LA 3GRZA 3QPBA 3GZNA 2AWOA 3BKWA 4DTCA 5K3OA 3V7FA 5DX1A 1Z5VA 4HAVA 2GEFA 2JA1A 4ZARA 1O0SA 3G79A 4NECA 4EDFA 2QD1A 4XTCS 1H94A 3VPGA 2DFPA 4ALIA 1XTUA 2Q5OA 2XMDA 1NUPA 4K28A 4G23A 4KFSA 4YJGB 4LBVA 2WJWA 4ESHA 2OV8A 1N60A 3BA1A 3IQGX 4DY4A 4WN3A 2ASVA 5KSWB 3GZNB 3T1TA 1WUIS 2ZRHA 2WG0A 4MZXA 2O7RA 4BP1A 1EFVB 4YWHA 5CDFA 1GCAA 5BV8A 4QWBA 1P33A 4YREA 5KQRA 3W79A 3HR8A 3PI7A 1F4VA 3K70B 2EL7A 3FCAA 1JYFA 4KXQA 1ODKA 3OE7D 1DKRA 5B7QA 2XJ9A 1ZISA 3AGQA 3BXOA 3OTIA 2E5LB 1SR8A 3DXYA 4Q1EA 3VC1A 1P5ZB 2Y1IA 1BJRE 2PI4A 1ESCA 3LLSA 3M5CA 3SZ2A 2ZJOA 4OJNA 4S1VA 4HVAA 4WXEA 2REQB 4RHXA 5ALHA 5EIHA 2AU0A 2H4FA 2O3TA 2IYLD 1U31A 5MN4A 1ZQMA 4P3NA 4BRWA 3FHTA 2XWQA 3E4DA 3BQMB 4WGFA 4Z2YA 1U5BB 2ZPTX 4H6WA 3D8SA 3W5CA 3QX7A 3E7WA 4BEJA 2G72A 1SHUX 3QVGA 4Q8EA 2P4QA 1N2EA 2GXSA 4MIKA 3MDCA 2Y0PA 4TZ0A 5DN6A 1RHQA 3LY8A 3P2OA 2JJ8A 4R8UA 2FW6A 4NE2A 1GY8A 1VI5A 3V7YA 3TACB 1HFWA 1LJ8A 2GFHA 2SBTA 2WLTA 4FCCA 2H1LA 3B13B 3TDNA 2PKWA 1YJBA 3F6SA 5KFFA 1T5OA 4NJMB 4XWYA 4Y1RA 4NENA 2BCJQ 1TO1E 2A94A 4DS4A 3RH6A 2IPXA 3OZAA 1Q3HA 1AXEA 4JJFA 4UZEA 4OLAA 1MQSA 2C9DA 4EENA 3K16A 1BRMA 4EYQA 1GR0A 1AJEA 1IATA 2P5YA 2J0SA 3B1JA 3LW8A 1MABB 1XCJA 4BLRA 4EG3A 2BEUB 2IXAA 5GVRA 1MEOA 4PX9A 3W3AD 5HK9A 5FHRA 4TWBA 3DDHA 1ZQFA 1QFZA 2EKZA 5ETJA 2O6KA 3LFUA 4JI2B 4X20B 1XCBA 4PFQA 3DG9A 4DNXA 3H4IA 3IPLA 3UT6A 2EL9A 1RPTA 2IF2A 4DYDA 2J9XB 2QI9C 2BPGA 4E2YA 3DCIA 4HN4B 4JP2A 4R8SA 4XDGA 4UNRA 3UBTA 1SUPA 2BEJA 2BMAA 2QV0A 2X6QA 4EW2A 2KZMA 4V1CA 4N8DA 1SBIA 2PSHA 1DQYA 3AJDA 3R5FA 2SCUB 4JJIA 3JZIA 1JEQA 1U0NA 7ICHA 3OF5A 1RAGA 2H2HA 1UM9A 3KLOA 4IUBS 2EH9A 1GL3A 3Q7TA 4XVCA 2ZJ4A 4G4SP 1TC2A 3ITDA 4IINA 4L85A 3TXXA 1G0OA 1Z0DA 3L4KA 4FFOA 2Q99A 4JIMA 2NP6A 3VU8A 4PS1A 3H5WA 4LHWA 1T9ZA 4I28A 2ZQZA 3KPJA 4YCDA 5EYPB 2Y1FA 3WYEA 2W9CA 1Y8RB 1KAMA 1Z07A 3RRFA 4YAGA 4MRVA 4JZKA 1K92A 4QUAA 5E3JA 2F7SA 1R6VA 3TOCA 3FAHA 3KFUF 1DX9A 3A6GA 2G80A 3BTUA 5DHSA 4CMBA 1JHUA 2R25B 1JSXA 3KAKA 1PJBA 2WABA 3CEMA 1E2PA 1K88A 3HBJA 3BH0A 1KH2A 3E9YA 3G6WA 5T6MA 4FT2A 5AHXA 1P18A 2H51A 3KQWA 2V8BA 3MT7A 1H4VB 2OCBA 4P58A 3SBDA 1GVNB 2QPOA 3C1ZA 2LYAA 3BMOB 4XYGA 4JLOA 5EYPA 1FJHA 1QVWA 1H6AA 4FCWA 4RQMA 4XGQA 4N6NA 3S2IA 1JDNA 3D6UA 3EMDA 5JCZA 4K0KB 1ZDMA 2I6XA 1AV7A 1WO8A 3EEQA 3EDQA 3WWZA 4PGYA 2AXTU 3R4CA 3FLMA 1OYVA 4EA7A 3HJBA 4F3KA 5EQFA 4GWKA 1O57A 1CJBA 2K4MA 4QNMA 4UFNA 4U7DA 2DTDA 5KINB 3QMWA 3JPSA 2GBPA 4YACA 1AMNA 1YMUA 4FVTA 5AW8A 4MEAA 1Z0UA 3GQVA 4DSOA 4Z0TA 3D4BA 2HBRA 3ONEA 4GWLA 5EE3A 1QOZA 4J7CA 4MR7A 4KQCA 2W8KA 4DA0A 1GQOA 1TM7E 4OQFA 4PVCA 4DCNA 3QFTA 2JEZA 4I5DA 1VG1A 3CYMA 4QDZA 1IOVA 3UAVA 3STYA 5KT6A 1KFSA 1VIMA 2GJSA 3AL3A 3S29A 2ZVQX 4DM7A 2CXNA 1RYEA 4GR4A 4U7FA 2CXPA 3JQ9A 5DHPA 4JKYA 1UKCA 1OWMA 3B6KA 4E1VA 2GZ3A 4EG8A 3O2NA 3WWDA 3LWNA 3IRUA 4HJRA 4IKPA 2PUDA 3EQ7A 4IUYA 1ZVVA 5AKYA 2I33A 2PUHA 2CVZA 2VWQA 4Z6DA 3P9SA 3AR3A 4IIYA 4LY3A 2EZUA 3K1RB 9ICSA 3OIYA 3P9RA 2DLDA 1YSCA 4ACAA 2JLUA 1F38A 1VHLA 4U5XA 3ZEAA 1SVNA 3F73A 1IBKB 2XF2A 3AFGA 4MB2A 2QTCA 5CBPB 5GJBA 4ECVA 3WE7A 2YXDA 4ARCA 2HHVA 2X2OA 1KYIA 4O4HA 4P34A 4ER3A 4ID3A 2HMVA 4B7ZA 1EEHA 2UYGA 3HMKA 1NBOA 1FSFA 3TGLA 1RU3A 1WE2A 3OCUA 2Z8YA 3KHKA 5AW1A 4QX6A 1FSZA 5AESA 1RQ7A 2V3WA 4NQRA 5GP1A 2W8BA 1F0YA 1W0CA 3I30X 4XKJA 2RSLA 3VDMA 3LNTA 2FX5A 4ROSA 3IDSA 2EG5A 3L0SA 3U4HA 5KREA 3B6MA 3LY9A 1KFCB 2J5RA 1CV2A 3FGPA 3KOZA 2G9RA 1JGTA 1WVMA 1RC8A 1N7JA 2H9AA 5CW1A 4EZBA 1JVNA 2HOFA 2GKGA 5C4GB 4R1QA 3UPDA 3KSUA 1QCYA 1YJQA 3HLTA 1A71A 3IQIX 1ESDA 3PFFA 1X7XB 1L5KA 1UEXC 3TTTA 2ZAYA 4L73A 3JPPA 5KWVA 4B0PA 4YRRA 1AN0A 4K87A 1FA9A 1AO3A 2HPAA 3EGIA 2GOLA 4BWJA 1KY3A 2ZANA 5H80A 2FN7A 3M4ZA 1ZI6A 3N28A 2NZ8A 3E8XA 4G8DA 2DTXA 3SK0A 2F3NA 1GZ6A 3TW8A 4YT4A 2Y66A 2XOEA 4D4GA 3KQQA 4ZMBA 1QAOA 1XO1A 1CZLA 4YQFA 2W98A 2QQGA 5T4HA 3ZI7A 1KYWA 2AUNA 2HJRA 1YB2A 4KQKA 2EGGA 3T5JA 1J09A 4N8EA 4YRNA 4CKCB 5KNDD 4FOOA 3TQHA 3KSBC 2EGUA 3HJFA 4M9GA 3HR7A 4M9NA 4CRWB 1AQNA 1VKZA 3ZDEA 4MQ5A 5BR8B 1JT2A 2RKWA 2X7XA 3U7EB 4CCAA 3OTQA 3H1BA 2FG5A 4R40A 5EUMA 1AUQA 4F85A 5AVWA 4V38A 2CT8A 2XUKA 2IMWP 3E2MA 4IKEA 3EVFA 1G98A 3LUAA 1UQTA 5IARA 4MW5A 4RD6A 3KKEA 2Y1XA 2ZUSA 4B6QA 2O8CA 4BZWA 4UREA 1S96A 4XVHA 3HT3A 3GLTA 3HDTA 4IDNA 3TL3A 3UXHA 4A8EA 2NTNA 2W6PA 4BB0A 1Z22A 2F8TA 1P77A 2ZVDA 4JR2A 4UUPA 4D9IA 2A3NA 2P1ZA 4NG4A 4W7HA 3G2MA 4Z3DA 5IVPA 3IURA 3SEIA 1QH1B 3RIHA 5ABPA 4EJFA 4ECEA 1NSTA 3OZWA 3HKBA 2RI6A 2RP5A 3Q6NA 4BJHB 2VWPA 2O8CB 4NYMR 1XMIA 4DRYA 1AQIA 2IWRA 5L1JA 1LWNA 3QOYA 4PTZA 5CA1B 1Q21A 4MJ3A 2G5PA 2A84A 1TM3E 1RS0A 1IM4A 1P4AA 1XDGA 2ZJ0A 4FHGA 3DFFA 2IZ6A 3SQOA 4BFCA 3FUWA 3OP1A 5CYPA 1QV9A 3AQIA 3WGIA 4AQ7A 1WZCA 2KKVA 1Z19A 1M1ZA 1ZRHA 1NTOA 8ICIA 2OO5C 2QTVB 2W83A 3ASYA 3GXBA 4I1VA 4KXXA 3PG5A 3GA0A 1K66A 5FUBA 5JMPA 2VP2A 2JK0A 3IVXA 4LOIA 1JAIA 1V4BA 4TKVB 4ZFNA 3PQFA 3L4EA 4ZEMA 4J4BA 5ADWA 1I1QB 1NRXA 3C5VA 1EA7A 2ASLA 2Y1GA 3DVRX 3K20A 4NU5A 4FKZA 4IDCA 3DOHA 3GLFB 2V6IA 3T7DA 1Q5PA 3K1AA 1T1JA 5IINA 3OOYA 2W93A 1L5RA 3HABA 4D9HA 1C1XB 2IHZA 5HCIA 3K72B 1Q7GA 1YJ8A 2VJMA 3SR4A 5CBKA 2EFJA 2WFZA 4IIBA 4C7ZA 1NHWA 4ZOLF 3JPNA 1K27A 1E2DA 2NXCA 5IASA 4HXYA 3ICOA 3VU3A 5JE8A 3T38A 2XQFA 3DE3X 1VDVA 1UK7A 2XRFA 4HWTA 4K2AA 3TL6A 5FTKA 2DXIA 3I52A 2ZCVA 1LJLA 1HYQA 4WZBE 5D85A 3GLFA 4PCLA 1BNOA 2MRLA 1EE1A 5DGIA 5AVJA 4WX2B 2A9QA 1XXHE 1PZXA 1VG8A 3NVDA 3D8TA 2O7NA 4QAQA 1E3WB 2W4MA 4JHXA 2JJ1A 2BKAA 3B89A 1N2ZA 2XGGA 4G2NA 3L0YA 4GPTA 3FHJA 1SL1A 4MULA 1GU7A 3LSTA 5IX8A 1E32A 2VH5R 1WEHA 1EWVA 2ZJBA 4K86A 2EX4A 3T3DA 2YFYA 4JOQA 4KR6A 4LZGA 2VHYA 3EZXA 1L1QA 1U0JA 5IC4A 1RMQA 2VSYA 1RHKA 2J5BA 4FYKA 2ZRJA 3DKRA 2ZVJA 3NRCA 3R0JA 4XSHA 3U7FB 3N3AC 4FI3C 3HMQA 3NIGB 1N36B 5AXAA 4EGJA 1UEJA 2ZIEA 4TMXA 3FCXA 2OM6A 1BPYA 1T3ZA 3TQIA 1CETA 1RYRA 2OTCA 3AZOA 3U13A 5IFLA 4FJ0A 3QVOA 3T5DA 4EECA 3EPRA 1CT9A 1NN0A 2ICAA 3WFZA 4DWVA 1SCDA 2FP4B 3Q15C 4KJZA 4F96A 2EQYA 3CM0A 4WY8A 4BFVA 1ISMA 2IT1A 3RC3A 3RJTA 3D3EA 2C2MA 4LTNA 3HDJA 4HEHA 3HNOA 3M9LA 3TOVA 3L0BA 4GUDA 5J2TF 3WL8A 4A23A 1V41E 5DGAA 2AGOA 3BCUA 1AQUA 1HORA 4RK0A 2HCFA 3N7PD 1FUYB 1K6XA 3VSCA 4ZO7A 3HYLA 3WWCA 2NSHA 2GO7A 1ZESA 5F7ZA 3C2QA 3VC2A 1F0MA 5KNLA 2C8LA 4ED8A 1VYUA 4LY0A 3CUWA 3ZLTA 1R9GA 5MDHA 2RIPA 4Z7QB 2VTBA 1SVOA 3UA3A 3JQDA 3QLJA 3NZEA 2G0TA 4JT4A 1LBQA 2ZTEA 1V11A 1XJ0A 4R7ZA 3CUYA 1V7QA 4Q4HA 1PKEA 2V45A 3CISA 3FSGA 4IFBA 4X0EA 5K09A 1E8NA 2ZB4A 3VUEA 3KJXA 1AGYA 4EHIA 4WXYB 3K96A 3VPSA 4IY1A 4ASUA 3R8CA 5IG2A 2DKOA 1LF0A 1KL7A 4KR2A 4L0DA 4R8VA 4ED0A 4H0FA 4LSGA 1NVXQ 2GJ4A 4WFKA 3LK7A 3EDYA 2QN8A 1IRIA 3WL5A 4B6RA 4DTIA 1M5UA 3KRTA 1IHYA 2WWFA 5A7FA 3DZBA 5F4ZA 4AZ3B 1CZRA 1BTOA 1FNBA 4M49A 5LDGA 4RELA 1U8YA 2QN1A 2Y1EA 4MR8B 2CFCA 2DY1A 1J1IA 4G4JA 2DPYA 5T4FA 1U2GA 4BLWA 5IKEA 4D7AA 4PFJA 1MPTA 2LGJA 4KWIA 3EVCA 3H1EA 4Z6EA 1AA9A 2VP5A 3GA5A 1CZNA 1SNYA 2IELA 3JVVA 1CF4A 3GUVA 4OK6A 4XGNA 3NM5A 4MKZA 1K7EB 1K98A 3CUTA 1ZEMA 3ETDA 4ZAFA 5K1ZA 4LDZA 4RESA 3TE7A 4M1WA 5KNBD 4H0NA 1WDWB 1HKHA 1W2GA 3QMPA 4PZAA 4M9SA 3OJUA 4RF3A 4W1PA 3T5CA 2UYHA 1JFTA 3KX2A 4UTOA 4MR8A 3TSZA 2I3BA 3UOAB 2B92A 2J4CA 2CF5A 4BVGA 1OXMA 4NCXA 3RV4A 4D4HA 4NAVA 1FLDA 1U5CA 2GF2A 1WA5A 2ZRCA 3DAHA 4RKRA 1LBHA 5DYYA 4YP7A 2R6ZA 1L3UA 3HM9A 2PSJA 5AM1A 2PVPA 1BWRA 1W85A 5DFAA 4IP0A 3SYMA 5KQSA 3T7JA 3NTUA 3A2KA 5HFAA 3R9WA 2A58A 2FZ5A 1RLMA 1ODLA 3CF2A 3I9LA 4UCXA 3RTVA 5MF6A 1UDWA 1LS1A 5FI1B 1BH2A 2CYBA 1G7TA 2PKCA 4K4IA 4KQHA 1KOJA 1V96A 1XRMA 1HT2E 2AFIA 3GJ8A 3UUWA 4D0GA 3S8YA 2XVAA 2DGZA 1HEKA 5J2IA 1KARA 3PEYA 2MU1A 4QYWA 2XCSB 1JLLB 3LGAA 1XTTA 2XQKA 4DMGA 3I8SA 5L1KA 1Z2PX 3I9KA 2OG2A 3I01A 1ID1A 1KSPA 1A4XA 3QMVA 1SCNE 2BFCB 4RZRA 2AFHE 1O0BA 2XUZA 4BGIA 3PT9A 3MBYA 1XU9A 5JY1A 1IZ8A 2GZAA 3DBOB 3O8OA 2HM7A 3DBIA 4J1NA 4Z1MA 1IXRC 4EG6A 1GPLA 1YQUA 1NU8A 4HDNA 1A98A 1SD2A 2O6LA 3D7KA 4LJRA 2XB8A 1YS4A 3K94A 4MWSA 1JLLA 4CV0A 1I8TA 1T5BA 1JYSA 1C8LA 4J7XA 1SZCA 1ZAKA 1TZKA 3PC2A 4DR5B 1QTMA 4Z3KA 1CQPA 4LHEA 1C3XA 3IESA 3GYBA 2XXAA 4MRRA 3GFVA 4YLYA 3EPGA 2QSUA 3H6HA 5DMHA 2N42A 5KNBH 3PQ2A 5CX1A 5E38A 1C2TA 2IYAA 4M9LA 4MXDA 4OQLA 4GMHA 3V6HA 2GSDA 4OI4A 1W5TA 2BF4A 1DRUA 1YCDA 2J0UA 3JWGA 3R0VA 4X60A 2A9PA 4U6SA 3T06B 4F60A 2JHCA 2Z8XA 4KWCA 2F9LA 2IZZA 3PITA 1SC4A 10MHA 1TAMA 4JLAA 1HNZB 2HT1A 1M2GA 1WD7A 2ROQA 2XLCA 3LV8A 4G25A 4KNYA 2PWYA 1O6ZA 4YHHB 3DTTA 4GKAA 5JSHA 3R0IA 4EEYA 4NZOA 2Q2OA 2BCSA 3KUXA 2KIWA 1K7FB 1KAEA 2IHJA 3GCGA 4RVCA 3CURA 4X5VA 3R3SA 4LXUA 5AVKA 3T1VA 4C4OA 4NJOA 4TTQA 1CVIA 5FDFA 2MWMA 1Z08A 4FFWA 4CF5A 1FYXA 1ZEJA 2NRWA 2V7QA 1XSEA 1Y33E 1GPBA 2V6BA 2H1VA 1NQ5A 3QP9A 4OHOA 2EZXA 1GV0A 1CIPA 2JJ2D 3OCYA 3JQGA 3KOOA 3JZAA 3PR3A 1IXRA 1KVSA 2H7CA 2O9JA 5BSRA 3ZC3A 3PHGA 4G0WA 3QWAA 2BBTA 4GX1A 5F1KA 4RK5A 1NXPA 3C21A 1T3GA 4X91A 4ZYYA 3K7EA 4R5HA 1JHRA 3KUCA 3L7DA 1E98A 1JMYA 8ICYA 4H1TA 4R2MA 5HPYB 2GN4A 1YAHA 3P0FA 4DNFA 3ESAA 2CKMA 5EKSA 3LHFA 3SY8A 5KFXA 2EEPA 1SBCA 4JJ8A 4OA5A 3SVZA 5FBQB 3ZGOA 2JAOA 2XCOA 3SFTA 1RRKA 2BTOA 3EG9A 3K92A 1IHUA 4Z8YA 3THOA 2QTTA 3AKDA 3DDNA 3E22A 4BQQA 2EJVA 1JR3D 2VSXA 3O21A 5IIKA 4YJHB 3TDMA 3C2MA 3IUNA 1MH1A 3NRJA 4Y7DA 4CEJA 2C9MA 3UAOA 2AEJA 4FR0A 4AJ9A 2WA1A 2VXOA 3FPLA 1DXSA 3NHSA 1J97A 2FWMX 2YHIB 3UTDA 3VOSA 4XM1A 2VQSA 1B6GA 4D9FA 4Z86A 2HRQA 3TSWA 5KTYA 2P27A 2BFWA 4YJGA 2ZBEA 4OJKA 3N70A 2QVZX 3NOOA 4MHOA 1AXGA 1W49A 2ZRMA 4IXWA 2PG3A 2WPDA 2IY8A 4GOLD 3FF1A 1U0HC 5EZSA 1LVGA 4ND7A 1GUZA 4QEKA 3REGA 3B0XA 3VR2A 1I2ZA 5DYWA 4CCYA 2FW9A 4MDYA 4E2FA 3OPVA 3OJWA 3TI9A 3IP3A 1ZQKA 1WXXA 4TROA 4JI5B 1JV2B 1L2TA 1DU4A 2NX2A 3H2HA 3QVWA 4FYWA 1Q83A 4P84A 1KMNA 2IYUA 5ITZB 1FFUA 3RR7A 2IHMA 4QBKA 1KEZA 2JIZA 3A9UA 4EBCA 4I50F 3WSVA 2H3FA 3LBFA 3LHDA 2JHAA 3PHCA 4TRMA 4DQRA 1QCDA 3WLTA 2NV0A 3BWCA 3DKKA 4BDTA 3EOBI 4BAGA 3PENA 3RAFC 1C80A 4MUNA 4V3BA 4FLMA 2X5KO 4UMEA 3W3ZB 3ML1A 2X9NA 5T57A 4Z0NA 4C4ZA 3I28A 2HRRA 4M8LA 1H93A 3H5TA 4DL3A 2WAXA 4KIGA 3OKFA 4XR4A 1ZW6A 4F4UA 3ABRB 2H5JA 3OPXA 3AZQA 1N92A 4TQSA 5FBKA 2BE7A 1SQ6A 2FK7A 4R8RA 1ELOA 3IB3A 4ZI3A 3E1SA 2JGRA 2OZLB 3IVRA 4GNRA 4HWPA 1BQEA 3SHOA 3MRXA 3WI7A 4Y1RB 1ECPA 2ZTLA 2VUSA 4EDHA 3G59A 3HKDA 1Q57A 4FXPA 4L8VA 3T4EA 4JOBA 5D46A 1E4EA 3KFXA 4FMDB 4H35A 5I9NA 1YBHA 4Q3OA 2A67A 1UJNA 4YIHA 1PAUA 2REQA 5CMLA 1QJCA 2XKJE 3ZUPA 2GYVA 4B44A 3A7EA 1YS1X 1X3LA 4IF6A 4N5MA 3LE8A 1WXEA 1NUSA 1NFRA 1A9PA 4PBRA 3EDRA 1U5BA 5B3JC 2QT0A 1Y63A 1G66A 3CCFA 3KXLA 1P7WA 5TC4A 3IUBA 1B43A 3PWTA 3TTVA 3ICEA 1D9FA 3IKJA 1Q77A 2JGMA 3A3KA 4PZLA 1E9SA 3JASB 3KT0A 3KB1A 3KEGA 4HX2A 1FFHA 4NYIQ 4MKFA 5LYYA 3URKA 2KB0A 3BRWD 3EF3A 3IAM6 3WJAA 4ZIRA 5IKPA 1SPXA 4P7GA 1EJ0A 1LLDA 3LKZA 1LPNA 2TMDA 4GLJA 3L40A 2IPAB 2R65A 1XKLA 2FEMA 1AS3A 1LSJA 3D4PA 3HRHA 4MAAA 1O77A 1ONOA 4RL6A 4CMJA 5JBIA 4DDMA 5I7SA 2FUG1 1GADO 1M8FA 1EVZA 2HHCA 4LAFA 3ZWNA 1Z4LA 4AYTA 4D4KA 4YP1A 1ZU5A 2F9MA 4Y6PA 2QX9A 1EHIA 4V3CA 5KAIU 2QR3A 1KY4A 2J6UA 2PRZA 1R4AA 3LVWA 2PWAA 2X23A 1WCIA 1G21B 1WD5A 4OQYA 4F1JA 5EZ6B 4IGEA 4TQUS 3V1KA 2VP0A 2WM9B 1QO7A 3QX9A 2QZ4A 1MRZA 4M83A 2ANBA 2IXEA 3R3ZA 2BCVA 4B3HA 4D42A 2JGFA 1SQGA 3NHLA 3NPAA 3IM1A 2VNAA 3TMAA 4U7TB 2EP7A 1GQQA 1Z35A 2BD0A 2QN3A 2D06A 3U62A 3DZHA 4TTSA 2H5LA 5A9SA 1M83A 2PX2A 3NBMA 5FULA 4BRSA 1NG9A 3OPMA 4WWHA 4O5OA 4QUBA 4BL5A 1L8OA 1QR6A 3NDJA 1DBSA 2J7PA 3O7MA 4GQIA 4TVBA 3WHLA 4ZI2A 1QQAA 2BFDA 1LGYA 1XTBA 2WDPA 4HL6A 2WZQA 1HPLA 4UBNA 3QTBA 3VO2A 1BU5A 4L9RA 3ZE1B 4V1CB 1S0NA 3PICA 2CPRA 1TRHA 4IJQA 3GUCA 2ZQ5A 3UK6A 4RQ6A 1AURA 5A9SB 3ZE0B 1VJ0A 1AGXA 4X65B 3GP8A 1UZUA 3GIDA 3S2UA 3G68A 3RBZA 1DEKA 3FGZA 5HIAA 3X2EA 2CLKB 3CQ9A 3B7PA 2OHVA 3NUGA 1VLZA 2CB0A 4F5NA 4PWZA 1NJXA 4G0QA 1JXLA 1I2AA 4M9HA 2K8AA 2UZ3A 2V58A 4WH0A 5I9LA 1H69A 2ZE6A 1MJ5A 3MWKA 4LYYA 3U5TA 1VHTA 3X1ZA 5J0WA 1IM2A 1NOJA 5KX5F 1HYBA 1KY5A 2B9VA 2Q9AA 3ECAA 1URPA 1ZP6A 4QUHA 5KVVA 3K70C 1QZZA 2EZ4A 2Z2XA 1AKEA 3LDAA 2C78A 3KJZA 1P1FA 3SJCA 4HDSA 5JEEA 4OQDA 4UMDA 2FDXA 1PJAA 1THGA 1XMJA 3CTPA 4MCHA 3TRDA 3MB8A 4CHTA 4WLFA 5ESDA 5JJ5A 1WBDA 1HDCA 4F56A 3OOWA 3MCWA 5ECDA 3COSA 3WIBA 4KHPB 2A1AA 1CF9A 5T4EA 5M34A 1ZBDA 3A4NA 3BEDA 2IOFA 1S8AA 4AK9A 3M9XA 1QYDA 2P78A 1SCBA 1D0VA 5C5EA 2CNNA 3MOSA 3OPYA 4J3FA 1GDTA 3JW8A 4M22A 2IXBA 2VK8A 3NXKA 5KG6A 3WJ2A 4C7MA 4DV6B 3QVTA 4EHNA 3QTTA 1QTNA 1SIUA 4R1LA 4LV5B 5EMNA 1QO0D 4PAGA 2R8IA 3KOYA 4J6FA 7AT1A 3VR3D 5M04A 5CH8A 4HQOA 1HETA 5TVKA 1SO8A 2I0FA 2N47A 1GPYA 4FE3A 2W8BB 1J06A 3FHCB 1M54A 3IGFA 4C5CA 2GXAA 2IUUA 3NC1C 1YWGO 4TQGA 3OPYB 2OQRA 1LX7A 4J0GA 2HA2A 3PPWA 5JCXA 1E2HA 1O6BA 5F3WB 4IGIA 3FC4A 4EITA 1O6GA 2OHOA 2C9ZA 2JJYA 3ETNA 2YUTA 1V85A 3QKIA 5J8YA 4IDFA 3OZCA 1FRZA 3ZK7A 3V46A 1WLYA 1DXHA 3MJRA 3ZS8A 1RJWA 2ASEA 2G1KA 1L7AA 1JXQA 4R41A 3BE4A 3GELA 1WHSB 5F1OA 5AXCA 3BXPA 3VH2A 2FPKA 4NJ8A 2VCYA 3D6NB 3HSKA 1SOUA 1MPXA 4UM8B 4NHEA 3WAKA 1GRQA 1BJTA 3G85A 3GJZA 4GMXA 2PBFA 4JZYA 3UHAA 4UBMA 3ZHRA 4C06A 2DQYA 3L7KA 4W1RA 4B6FA 3ASVA 2DFLA 4I9FA 4EI8A 4NZ9A 3EZ9A 3W2HA 8ICTA 5DV9A 5DW0A 5LQCA 1C30A 2ATXA 5JT1A 4IXMA 1A2QA 1RYYA 4PQEA 3RVOA 8ABPA 5IUJC 3T3OA 1SZJG 5IM5A 2FA9A 1GQYA 1WKVA 1NY5A 1VDMA 4H6VA 4LXXA 5KFOA 5DHAA 5LMCA 5HZKA 2B1RA 1QDLB 2GRJA 3BERA 4HN2A 2BL4A 3KE8A 2UVDA 2GS9A 2XHEA 3S27A 3ZXUB 7YASA 5JFGA 2ID9A 2QKQA 1TQDA 3G8AA 3N7RC 5EI5A 2CVQA 2RI1A 5DN9A 1XQWA 4LZOA 4QXMA 3EMVA 1YZTA 2P77A 5SYAA 1DWUA 4MS3A 3UJ7A 1J7JA 2WVAA 1XRJA 2XY6A 1U47A 2YDYA 3KXKA 4KVGA 5CWRA 3A31A 4TV8B 5DTMA 5AO9A 5E8RA 1PUZA 2CHUA 4DUGA 1TUBA 4XIIA 4C4RA 3VPFA 4O63O 5E0KB 3C70A 4PV7A 3WIEA 3NDIA 1ENPA 2Z9DA 4IDBA 4LQ4A 3OTHA 4LV8B 3LX5A 1N3BA 4KI0A 4C3UA 1NDUA 3T7EA 3F5FA 3BBPA 4BX3A 5DBHX 2I22A 2CVOA 5F5LA 4ZGWA 3GFSA 3R44A 2XI9A 3TW8B 3TG2A 3ENQA 4Q1BA 3T9BA 3K3PA 4AJ4A 4QU9A 1M1NA 2E9SA 1L4GA 3PWSA 5KNCD 4QXRA 2ZSIA 1VQ1A 4X44A 5K6TA 4KU4A 2J9ZB 4X84A 2YN4A 2GB4A 5FR2A 3TADC 4TTRA 4MUGA 5AKEA 1HE8B 3VJMA 3BDVA 3KVOA 1UMBB 4QTTB 5JD5A 1E1YA 1SC1A 3A27A 4HQKA 4JB2A 2O3SA 3RVQA 3TM5A 3SC4A 2GHTA 3TCNA 2IW3A 3PEEA 4LHYA 3M6KA 4BBAA 1NV8A 3B3AA 1CQXA 3WNQA 2OL4A 4DLTA 4RQ8A 1EVIA 3GRFA 1JMVA 1YKSA 4FNAA 3UICA 3AHCA 2H2AA 3TANA 4EWLA 5B4UA 5C7LO 1H6CA 3T7AA 4D4JA 1A97A 1JU9A 1X1DA 3UWSA 1CIJA 2V97A 2W3RA 3MVEA 1J22A 1Y9ZA 1D4OA 1II8A 1Y82A 2AG5A 1N8NA 3HB9A 3W5UA 1UMDB 2DR2A 1VZ3A 5KFAA 4QWDA 4PPGA 1H1LA 1HE2A 5TEVA 1CYDA 3D3WA 2PKYX 3ZCPA 4D9BA 3V4SA 2IYNA 4D92A 1WQ1R 5CXQA 2I2XB 4R2JA 4OSEA 2OP1A 3RE1A 4YRTA 1KQOA 1BVHA 4JLSA 3RWOA 3AKCA 1G38A 2B7CA 4EKYA 3SHVA 3ZW9A 3GPCA 4X71A 4MMXB 1JL3A 3PXXA 2F1HA 2V65A 2QLTA 2DSNA 4NM2A 3KOWA 3VVLA 5HCUA 2A5GA 2D0OB 1QZ3A 3SE7A 1Q1ZA 3TCKA 2DPLA 4GVPA 5LLDA 5FEMA 5D6NA 2YHBA 4OQQA 1B2RA 1E3WA 4B7AA 1Y9AA 3QOXA 3M3DA 4X8HA 1BXRB 2BVNA 3FW1A 3DM9B 1ZJJA 2O2EA 3MPOA 3RC1A 2HNBA 4TLEA 1NK6A 4ZRDA 2DY0A 2IEDA 4O8ZA 2SNIE 3WIOA 1Z4QA 1RRCA 4WZAB 2XY5A 4B33A 4KXFB 1UP7A 1XLUA 5KWSA 2HGSA 3V1UA 4MEBA 3K1AB 2NSYA 3D1JA 4G4IA 1EUDA 4PY2A 5EL0A 2EDCA 3PX0A 1BXRA 5KFKA 1QBKC 1Y3CE 1HG0A 2AN9A 1JQLB 2EBUA 1U9YA 2XVXA 4KDRA 1XL0A 4TN1A 4QWCA 1RJGA 1PVPA 5D3MB 2DRIA 4RY0A 3KU4A 1K9VF 1Z62A 1GTG1 1GEGA 1F6WA 4LTDA 3CKLA 2YTZA 5GZ1A 2FLWA 3AB8A 1E7WA 1ZQOA 3GRUA 3BAFA 3MT0A 1D1TA 3AF4A 1WV0A 3HYRA 1CUIA 4UW9A 1E2IA 3GEPA 3OLVA 1VLQA 2SHKA 3RU7A 1HNXB 1ZZEA 2CNWD 5EWJA 1N32B 3H87A 2INGX 5DEOA 5A71A 4M1YA 4U6NA 1K97A 1MAAA 2KBFA 4L5IA 1AZTA 4Q7EA 4PZDA 4A5SA 4NG5A 5B37A 4KYTA 4RV5A 4IRCA 4PPQA 5DM1A 3H16A 3WAGA 1GKYA 1ECBA 3EPLA 2XVTA 4YP5A 3JZDA 1E1DA 4KLUA 4PR3A 3ZY2A 2AJBA 3H4MA 2X2PA 1NVDA 1XQ9A 1MD9A 5F2KA 3WHIA 1RIFA 4AVYA 3N2EA 1QE0A 2PKRA 3SAHA 3FYCA 5H4GA 2FXIA 3KEQA 2WUGA 3M4XA 3AW9A 2WF7A 3ISBA 1GIAA 1LCIA 2OR3A 2N46A 3NS7A 1Z4IA 2BM9A 1ZU4A 2LCFA 4N3AA 2FJPA 4U3JB 2JI8A 3H0KA 2BKXA 3B2QA 5KT2A 2X58A 4KKVA 5DO9A 2FHPA 1BPXA 1UC4B 2ZPAA 3ICVA 2VJQA 4UDNA 5CAEB 1FMTA 1Z74A 1JJ7A 3ZY5A 5A05A 2ZB8A 1ICIA 3VYTB 4F2GA 3L43A 3DEHA 1DE0A 1P7PA 3C16C 5A5FA 3WLPA 1FLVA 2XUAA 4Z5XA 1KHTA 1CNMA 5EIOA 5J2AA 1BC5A 5ERGB 4G0OA 1SL2A 3A05A 2RB4A 4NLGA 1R0BA 2YNMC 5BW5A 4LHZA 5JOQA 3N2ZB 1KJIA 1HDIA 1UJMA 3T5LA 4KXNA 4W7IA 5FWXB 2PQ2A 4LA4A 1NQOA 1YU9A 3ORRA 4R51A 3RBXA 1C3JA 3A70A 2E3JA 2HXSA 1ZN8A 3PNMA 3HDYA 3IP9A 4FILA 4YROA 3VHLB 1GSHA 2WLSA 4A6PA 4DBLE 5KB3A 3ANLA 2PS3A 1EFRA 4HNAB 4R54A 2ZUCA 1H38A 3H05A 3CF0A 1JTVA 2FZKA 1JEEA 2EANA 3HDQA 1EDDA 9LDBA 3S5UA 3O0DA 4R71A 2BUAA 2QTBA 5B3KA 4GOMD 5ICEA 5JATA 4TYYA 2I1LA 2IX9A 1IPHA 2XVMA 4LY6A 2HL6A 1G2IA 4MVYA 3RUCA 2HPVA 1SV0A 4P4GA 1T0BA 2DTEA 2VEDA 1K0UA 3WISA 5AKGA 1Z5NA 3T1YB 4IQ0A 4E5DA 4W5QA 1QRRA 1KBUA 3DMRA 4YP0A 3REOA 4M76B 4QASA 2UZ4A 5FPQA 1W25A 2ZBQA 5LU8A 1NOMA 2JGIA 3VPDA 4AP9A 3O3NB 4IL6U 1O4WA 5KFBA 5T14A 4PGGA 3WGTA 1YQTA 5FFFA 1QU2A 4ONEA 1M8PA 1LBIA 1JE0A 3GVIA 2ZRKA 1N0WA 1S2LA 4FSDA 3HTXA 2OBXA 4FWBA 1DARA 1WY7A 7ABPA 5CXUA 4UAYA 4IHJF 2IDMA 4MGHA 4XIGS 3HWTA 2Q0HA 2CVPA 4D3ZA 2J9YB 1KP2A 4L9AA 4WKGA 2FFHA 4FZLA 3OIDA 2D2VA 2VAXA 3BQ1A 5AKLA 3PY8A 4GH5A 2VBGA 4HS4A 2XCIA 1OX4A 1KGSA 1I94B 1NX6A 1UBTS 1P2DA 5A04A 2HWXA 3HU3A 4BLOA 3MR5A 2D59A 4PAOA 3IV6A 1U2RA 1YTLA 1HDZA 1WMFA 4X95A 2BZFA 3E15A 4BP8A 1RM3A 4NCNA 2GK3A 5FB3A 3NKVA 2R2GA 3GJ5A 2Q8NA 2GO1A 2C2HA 1A8PA 1XLTC 4O29A 5KFGA 1YBFA 3EH1A 4DV4B 3D3JA 3D81A 2FEWB 3WMWA 4CJXA 3H1TA 1G5FA 3IDOA 4FZRA 2OCXA 4LYGA 1USGA 1SHTX 3BGWA 4L3WA 4BUJA 1EU1A 2RAVA 2JFNA 3EFOB 3MWGA 4MZDA 3W77A 4BX2A 2JGAA 3QPVA 1U1CA 1U90A 1ECJA 3EIWA 3S3TA 3SVTA 4MWCA 5LP6F 1P80A 1JMSA 3U4AA 4NL9C 1GNVA 3B1FA 3WLJA 4XIJA 5JZ9A 1N33B 3H4BA 2PK3A 3QIVA 1Z2AA 3BE8A 4CUKA 4BVJA 3VA7A 1QAQA 3NVAA 2ZZKA 3U1VA 4ABYA 5E3HA 3H1FA 5LQNA 3O8OB 2P2NA 1LI5A 2LWIA 3A36A 3PSPA 1RDFA 1J8MF 1MAUA 2J87A 2UVPB 4LRXA 4MVJH 1H5QA 5CX4A 3ANMA 3LC2O 1QE3A 2HY7A 5TQ0A 5LDHA 3NX4A 2PSSA 2CJXA 3N6VA 1COWD 4NONA 3A0RB 4FOPA 1COOA 1G21E 1ZNQO 2C5HA 1L3CA 4CKWA 1I4DD 4M8SA 1PUJA 3ABIA 1BPDA 4RT3A 3DAGA 4G1EB 5DG9A 1QZUA 3PKIA 4RQ0A 3WTBA 4DG8A 1EVEA 5JDIA 3PXEA 4OLJA 3BD7A 3SJBA 1F20A 3EC2A 4IEFB 2ZWAA 4WHMA 5CIWA 3TS1A 5JCPA 2RARA 2PMFA 2WTFA 4JODA 4K1XA 3DE1X 5ERYA 3BRSA 5JS7A 4OYYA 1JH8A 5F2EA 3W2FA 4DKXA 1PSDA 1R0ZA 1W0JD 3AINA 4AJ2A 4TRJA 2P9TA 1ZGHA 1XAIA 2RGUA 4QOSA 1TKAA 3UFXB 3ZBPA 5KVCA 5HRAA 1VSUA 3ZY6A 4C2UA 5FRDA 3TRKA 1Q2XA 2CVFA 3OIWA 1J5XA 3CLUC 3PE4A 3CVWA 3W3AH 1T5TA 1EGMB 1WMBA 2AYYA 2J7KA 1SXJD 4XFDA 5AKIA 5C0YA 5EMKA 4F1KA 1M2EA 1GITA 1LSUA 3FSRA 4N7RA 4P8RA 2WKPA 4NCKA 1QGUA 3O84A 5LWHA 1VPTA 4UARA 1ZQJA 1MAWA 1XPOA 1YFJA 3L7JA 4HMPA 3RFTA 1AKVA 1WU7A 2F1OA 3NP9A 1X7WA 1Z3IX 3CLTD 3GDWA 3J81j 4FHCA 2WR8A 3DHNA 3EXFA 4FKMA 4UAGA 3K9LA 2B5VA 3ZE8A 1K1QA 4QNRA 1P75A 1RWXA 2YHAA 3EQ2A 4J3JA 3B52X 2OO7A 3VV3A 1QF6A 1EVQA 3H4TA 1OT3A 3LXXA 1ZUD1 2P68A 1FVXA 1GPNA 4JLPA 4U8HA 2WF8A 4M47A 3EMKA 3TM4A 5AVYA 3MJ4A 1Q95A 3M83A 3PB3A 3ZZTA 1UXKA 3MMPA 4NLZA 3ZNPA 4F5ZA 4FSXA 5DGTA 4BHTA 1D4AA 1ECWA 2N3ZA 1DKLA 2EJWA 4TQ9A 2VOJA 3HJUA 3T99A 1AX9A 3L8MA 4YR2A 2FFAA 2GJAA 3OJOA 2ZXEA 3D4IA 3IAM1 3F6CA 2H2GA 4R01A 1ZNWA 2VP4A 2JCYA 2YRFA 3FPHA 2NXNA 3G8DA 2A9OA 5ITZA 1L5UA 3GT7A 3QK7A 4QULA 1L7MA 2CK3A 4HQ0A 4IDQA 1L5GB 3GJRA 1VFPA 3F98A 2RD2A 4JXXA 4LJSA 4ANFA 4KAJA 3I9NA 1F9AA 1OYOA 2WDZA 4LYEA 5GONB 3ZWWA 1Q0TA 2WAYA 3FTNA 3QKRA 4BLVA 4DMCA