3SD9A

Crystal structure of serratia fonticola sfh-i: source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
KNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
molecule tags Hydrolase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3sd9A00
4YSBA 2H6AA 5ACWA 5EVBA 4DILA 1MQOA 1XTOA 4XUKA 3P2UA 3QH8A 4RL2A 4Z7RA 4GCWA 5HH5A 1KR3A 2YNTB 3DH8A 3LVZA 1BC2A 1DXKA 5FQAA 3SBLA 1E5DA 5ACTA 4RBSA 5AEBA 1HLKA 4C1HA 2GCUA 2XR1A 4EFZA 4HL2A 4RL0A 4C09A 5ACQA 2YNWA 4DIKA 4AWYB 5EWAA 4CHLA 4D1UA 4HL1A 1YCGA 1Y44A 4EYFA 4UBQA 2BFKA 3IE0A 5IQKA 3MD7A 4TZFA 4AD9A 1ZTCA 5K4MA 4EXSA 5EH9A 5AYAA 3BV6A 1SMLA 3X2YA 5ACRA 2DKFA 1KO3A 5LCHA 4F6ZA 1P9EA 4BZ3A 1A8TA 4Z60A 3FCZA 3ADRA 4KEQA 2Y8AA 3RKKA 3SFPA 4NQ5A 4FR7A 3IELA 3DHCA 3ZR9A 3IEKA 5LCAA 3IE1A 1XM8A 2Q0IA 1JJEA 3I13A 2QJSA 4PVOA 2GMNA 3PY5A 3KNRA 4ZEJA 3SRXA 4D1TA 2Q9UA 2GFKA 3PG4A 2YNVA 4O98A 5ACSA 2YNVB 4XWTA 3IOGA 4P62A 2ZWRA 4C1EA 1X8GA 2XF4A 5EV8A 2UYXA 3KNSA 3L6NA 4C1DA 4D1WA 5K0WA 1WUOA 2FM6A 3Q6VA 2YNTA 1WUPA 4TZBA 2VW8A 2BTNA 4NQ2A 1KO2A 4EYBA 4Z67A 2QDSA 4TYFA 4U4LA 3H3EA 2Q42A 4JO0A 4ZO3A 3X2ZA 4UA4A 5B3RA 4RAWA 3ZNBA 1YCFA 2QDTA 3ZWFA 4ZO2A 3FAIA 2BC2A 4HKYA 3BK1A 3KL7A 4J5FA 2NZEA 2BG8B 1VGNA 5EHTA 5EW0A 4C1FA 2I7TA 5ACUA 5KIKA 2WYMA 3DHAA 2ZZIA 5B1UA 1DDKA 4WD6A 5DPXA 5FQCA 2QINA 4BP0A 3TP9A 5HH6A 5EV6A 3BC2A 2BFLA 4UWPB 4Z5YA 2FK6A 4GYUA 5K4KA 1JT1A 1M2XA 1BVTA 1BMCA 3AF5A 1QH5A 4Z5ZA 2BG7A 1A7TA 2P1EA 4H0DA 2HB9A 4ZNBA 4LE6A 1K07A 2YZ3A 4UWSB 5A5ZA 3VPEA 4AX0B 1ZNBA 4RAMA 5HIQA 3WXCA 2BFZB 3X2XA 1VMEA 3T3OA 4TZEA 2NZFA 3VQZA 2FHXB 2BR6A 1X8HA 2WRSA 4FEKA 3SD9A 3IDZA 2P4ZA 3ZQ4A 2BMIA 2AIOA 2NYPA 2BG2A 2FU8A 2Y87A 5ACXA 4C1GA 5LMCA 5HISA 2M5DA 1JJTA 2DOOA 3PY6A 1WRAA 2BGAA 2WYMC 4C1CA 5LS3A 5AHOA 2A7MA 5EVKA 1DD6A 5AXRA 4AX1B 5HIOA 5HIPA 2OHJA 2P97A 4V0HA 3I0VA 4TYTA 5ACPA 2NXAA 4UWOB 2I7XA 5LCFA 2FU9A 2CBNA 5KILA 3X30A 3I11A 2GKLA 3SW3A 2Q0JA 5A87A 2AZ4A 4EXYA 4EYLA 2BG8A 5K4NA 4UWRB 5A0TA 3DHBA 3RPCA 4D02A 5LE1A 1WW1A 4XWWA 1QH3A 1ZKPA 4F6HA 2FU6A 5B15A 2WYLA 3ESHA 2BIBA 2GFJA 4J5HA 2WHGA 3IOFA 3G1PA 2YCBA 2FU7A 4Z6XA 5EVDA 5AXOA 2YNUA 2ZNBA 1VJNA 2QEDA 4B87A 3BK2A 5ACVA 5LSCA 3IEMA 5FQBA 2M5CA 4YSLA 4KEPA 3AJ3A 5AHRA 5LM6A 4YSKA 1L9YA 5HH4A 4UAMA 2E7YA 1X8IA 4FSBA 2BFZA 2OHIA 3IE2A 3I15A 2FHXA 3A4YA 1YCHA 3RKJA 2BG6A 3T3NA 2ZO4A 4GYQA 3I14A 5A0VA 2I7VA 4RM5A 3AF6A 3S0ZA 4EY2A 2Y8BA 4NQ4A 4PVTA 3JXPA 3T9MA 3R2UA 4AWZA 2R2DA 3SPUA 4TZ9A 3F9OA 5LLDA 2OHHA 2P18A 4D1VA 4NQ6A
chains in the Genus database with same CATH superfamily
4YSBA 2H6AA 5ACWA 5EVBA 4DILA 4AXHA 1MQOA 2YHEA 1XTOA 4XUKA 3P2UA 3QH8A 4RL2A 4Z7RA 4GCWA 5HH5A 1KR3A 2YNTB 3DH8A 3LVZA 1BC2A 1DXKA 5FQAA 3SBLA 1E5DA 5ACTA 4RBSA 5AEBA 1HLKA 4C1HA 2GCUA 2XR1A 4EFZA 4HL2A 4RL0A 4C09A 5ACQA 2YNWA 4DIKA 4AWYB 5EWAA 4CHLA 4D1UA 4HL1A 1YCGA 1Y44A 4EYFA 4UBQA 2BFKA 3IE0A 5IQKA 3MD7A 4TZFA 4AD9A 1ZTCA 5K4MA 4EXSA 5EH9A 5AYAA 3BV6A 1SMLA 3X2YA 5ACRA 2DKFA 1KO3A 5LCHA 4F6ZA 1P9EA 4BZ3A 1A8TA 4Z60A 3FCZA 3ADRA 4KEQA 2Y8AA 3RKKA 3SFPA 4NQ5A 4FR7A 3IELA 3DHCA 3ZR9A 3IEKA 5LCAA 3IE1A 1XM8A 2Q0IA 1JJEA 3I13A 2QJSA 4PVOA 2GMNA 3PY5A 3KNRA 4ZEJA 3SRXA 4D1TA 2Q9UA 2GFKA 3PG4A 2YNVA 4O98A 5ACSA 2YNVB 4XWTA 3IOGA 4P62A 2ZWRA 4C1EA 1X8GA 2XF4A 5EV8A 2UYXA 3KNSA 3L6NA 4C1DA 4D1WA 5K0WA 1WUOA 2FM6A 3Q6VA 2YNTA 1WUPA 4TZBA 2VW8A 2BTNA 4NQ2A 1KO2A 4EYBA 4Z67A 2QDSA 4TYFA 4U4LA 3H3EA 2Q42A 4JO0A 4ZO3A 3X2ZA 4UA4A 2CG2A 5B3RA 4RAWA 3ZNBA 1YCFA 2QDTA 3ZWFA 4ZO2A 3FAIA 2BC2A 4HKYA 3BK1A 3KL7A 4J5FA 2NZEA 2BG8B 1VGNA 5EHTA 5EW0A 4C1FA 2I7TA 5ACUA 5KIKA 2WYMA 3DHAA 2ZZIA 5B1UA 1DDKA 4WD6A 5DPXA 5FQCA 2QINA 4BP0A 3TP9A 5HH6A 5EV6A 3BC2A 2BFLA 4UWPB 4Z5YA 2FK6A 4GYUA 5K4KA 1JT1A 1M2XA 1BVTA 1BMCA 3AF5A 1QH5A 4Z5ZA 2BG7A 1A7TA 2P1EA 4H0DA 2HB9A 4ZNBA 4LE6A 1K07A 2YZ3A 4UWSB 5A5ZA 3VPEA 4AX0B 1ZNBA 4RAMA 4PDXA 5HIQA 3WXCA 2BFZB 3X2XA 1VMEA 3T3OA 4TZEA 2NZFA 3VQZA 2FHXB 2BR6A 3SD9A 1X8HA 2WRSA 4FEKA 3IDZA 2P4ZA 3ZQ4A 2BMIA 2AIOA 2NYPA 2BG2A 2FU8A 2Y87A 5ACXA 4C1GA 5AIJA 5LMCA 5HISA 2M5DA 1JJTA 2DOOA 3PY6A 1WRAA 2BGAA 2WYMC 4C1CA 5LS3A 5AHOA 2A7MA 5EVKA 1DD6A 5AXRA 4AX1B 5HIOA 5HIPA 2OHJA 2P97A 4V0HA 3I0VA 4TYTA 5ACPA 2NXAA 4UWOB 5AJLA 2I7XA 5LCFA 2FU9A 2CBNA 5KILA 2CG3A 3I11A 3X30A 2GKLA 3SW3A 2Q0JA 5A87A 2AZ4A 4EXYA 4EYLA 2BG8A 5K4NA 4UWRB 5A0TA 3DHBA 5A23A 3RPCA 4D02A 5LE1A 1WW1A 4XWWA 1QH3A 1ZKPA 4F6HA 2FU6A 5B15A 2WYLA 3ESHA 2BIBA 2GFJA 4J5HA 2WHGA 3IOFA 3G1PA 4NURA 2YCBA 2FU7A 4Z6XA 5EVDA 5AXOA 2YNUA 2ZNBA 1VJNA 2CFZA 2QEDA 4B87A 3BK2A 5ACVA 5LSCA 3IEMA 2CFUA 5FQBA 2M5CA 4YSLA 4KEPA 3AJ3A 5AHRA 5LM6A 4YSKA 1L9YA 5HH4A 4UAMA 2E7YA 1X8IA 4FSBA 2BFZA 2OHIA 3IE2A 3I15A 2FHXA 4AV7A 3A4YA 1YCHA 3RKJA 2BG6A 3T3NA 2ZO4A 4GYQA 3I14A 5A0VA 2I7VA 4RM5A 3AF6A 3S0ZA 4EY2A 2Y8BA 4NQ4A 4PVTA 3JXPA 3T9MA 3R2UA 4AWZA 3SPUA 2R2DA 4TZ9A 3F9OA 5LLDA 2OHHA 2P18A 4D1VA 4NQ6A
chains in the Genus database with same CATH topology
4YSBA 2H6AA 5ACWA 5EVBA 4DILA 1MQOA 1XTOA 4XUKA 3P2UA 3QH8A 4RL2A 4Z7RA 4GCWA 5HH5A 1KR3A 2YNTB 3DH8A 3LVZA 1BC2A 1DXKA 5FQAA 3SBLA 1E5DA 5ACTA 4RBSA 5AEBA 1HLKA 4C1HA 2GCUA 2XR1A 4EFZA 4HL2A 4RL0A 4C09A 5ACQA 2YNWA 4DIKA 4AWYB 5EWAA 4CHLA 4D1UA 4HL1A 1YCGA 1Y44A 4EYFA 4UBQA 2BFKA 3IE0A 5IQKA 3MD7A 4TZFA 4AD9A 1ZTCA 5K4MA 4EXSA 5EH9A 5AYAA 3BV6A 1SMLA 3X2YA 5ACRA 2DKFA 1KO3A 5LCHA 4F6ZA 1P9EA 4BZ3A 1A8TA 4Z60A 3FCZA 3ADRA 4KEQA 2Y8AA 3RKKA 3SFPA 4NQ5A 4FR7A 3IELA 3DHCA 3ZR9A 3IEKA 5LCAA 3IE1A 1XM8A 2Q0IA 1JJEA 3I13A 2QJSA 4PVOA 2GMNA 3PY5A 3KNRA 4ZEJA 3SRXA 4D1TA 2Q9UA 2GFKA 3PG4A 2YNVA 4O98A 5ACSA 2YNVB 4XWTA 3IOGA 4P62A 2ZWRA 4C1EA 1X8GA 2XF4A 5EV8A 2UYXA 3KNSA 3L6NA 4C1DA 4D1WA 5K0WA 1WUOA 2FM6A 3Q6VA 2YNTA 1WUPA 4TZBA 2VW8A 2BTNA 4NQ2A 1KO2A 4EYBA 4Z67A 2QDSA 4TYFA 4U4LA 3H3EA 2Q42A 4JO0A 4ZO3A 3X2ZA 4UA4A 5B3RA 4RAWA 3ZNBA 1YCFA 2QDTA 3ZWFA 4ZO2A 3FAIA 2BC2A 4HKYA 3BK1A 3KL7A 4J5FA 2NZEA 2BG8B 1VGNA 5EHTA 5EW0A 4C1FA 2I7TA 5ACUA 5KIKA 2WYMA 3DHAA 2ZZIA 5B1UA 1DDKA 4WD6A 5DPXA 5FQCA 2QINA 4BP0A 3TP9A 5HH6A 5EV6A 3BC2A 2BFLA 4UWPB 4Z5YA 2FK6A 4GYUA 5K4KA 1JT1A 1M2XA 1BVTA 1BMCA 3AF5A 1QH5A 4Z5ZA 2BG7A 1A7TA 2P1EA 4H0DA 2HB9A 4ZNBA 4LE6A 1K07A 2YZ3A 4UWSB 5A5ZA 3VPEA 4AX0B 1ZNBA 4RAMA 5HIQA 3WXCA 2BFZB 3X2XA 1VMEA 3T3OA 4TZEA 2NZFA 3VQZA 2FHXB 2BR6A 1X8HA 2WRSA 4FEKA 3SD9A 3IDZA 2P4ZA 3ZQ4A 2BMIA 2AIOA 2NYPA 2BG2A 2FU8A 2Y87A 5ACXA 4C1GA 5LMCA 5HISA 2M5DA 1JJTA 2DOOA 3PY6A 1WRAA 2BGAA 2WYMC 4C1CA 5LS3A 5AHOA 2A7MA 5EVKA 1DD6A 5AXRA 4AX1B 5HIOA 5HIPA 2OHJA 2P97A 4V0HA 3I0VA 4TYTA 5ACPA 2NXAA 4UWOB 2I7XA 5LCFA 2FU9A 2CBNA 5KILA 3X30A 3I11A 2GKLA 3SW3A 2Q0JA 5A87A 2AZ4A 4EXYA 4EYLA 2BG8A 5K4NA 4UWRB 5A0TA 3DHBA 3RPCA 4D02A 5LE1A 1WW1A 4XWWA 1QH3A 1ZKPA 4F6HA 2FU6A 5B15A 2WYLA 3ESHA 2BIBA 2GFJA 4J5HA 2WHGA 3IOFA 3G1PA 2YCBA 2FU7A 4Z6XA 5EVDA 5AXOA 2YNUA 2ZNBA 1VJNA 2QEDA 4B87A 3BK2A 5ACVA 5LSCA 3IEMA 5FQBA 2M5CA 4YSLA 4KEPA 3AJ3A 5AHRA 5LM6A 4YSKA 1L9YA 5HH4A 4UAMA 2E7YA 1X8IA 4FSBA 2BFZA 2OHIA 3IE2A 3I15A 2FHXA 3A4YA 1YCHA 3RKJA 2BG6A 3T3NA 2ZO4A 4GYQA 3I14A 5A0VA 2I7VA 4RM5A 3AF6A 3S0ZA 4EY2A 2Y8BA 4NQ4A 4PVTA 3JXPA 3T9MA 3R2UA 4AWZA 2R2DA 3SPUA 4TZ9A 3F9OA 5LLDA 2OHHA 2P18A 4D1VA 4NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSB A;  2H6A A;  5ACW A;  5EVB A;  4DIL A;  1MQO A;  1XTO A;  4XUK A;  3P2U A;  3QH8 A;  4RL2 A;  4Z7R A;  4GCW A;  5HH5 A;  1KR3 A;  2YNT B;  3DH8 A;  3LVZ A;  1BC2 A;  1DXK A;  5FQA A;  3SBL A;  1E5D A;  5ACT A;  4RBS A;  5AEB A;  1HLK A;  4C1H A;  2GCU A;  2XR1 A;  4EFZ A;  4HL2 A;  4RL0 A;  4C09 A;  5ACQ A;  2YNW A;  4DIK A;  4AWY B;  5EWA A;  4CHL A;  4D1U A;  4HL1 A;  1YCG A;  1Y44 A;  4EYF A;  4UBQ A;  2BFK A;  3IE0 A;  5IQK A;  3MD7 A;  4TZF A;  4AD9 A;  1ZTC A;  5K4M A;  4EXS A;  5EH9 A;  5AYA A;  3BV6 A;  1SML A;  3X2Y A;  5ACR A;  2DKF A;  1KO3 A;  5LCH A;  4F6Z A;  1P9E A;  4BZ3 A;  1A8T A;  4Z60 A;  3FCZ A;  3ADR A;  4KEQ A;  2Y8A A;  3RKK A;  3SFP A;  4NQ5 A;  4FR7 A;  3IEL A;  3DHC A;  3ZR9 A;  3IEK A;  5LCA A;  3IE1 A;  1XM8 A;  2Q0I A;  1JJE A;  3I13 A;  2QJS A;  4PVO A;  2GMN A;  3PY5 A;  3KNR A;  4ZEJ A;  3SRX A;  4D1T A;  2Q9U A;  2GFK A;  3PG4 A;  2YNV A;  4O98 A;  5ACS A;  2YNV B;  4XWT A;  3IOG A;  4P62 A;  2ZWR A;  4C1E A;  1X8G A;  2XF4 A;  5EV8 A;  2UYX A;  3KNS A;  3L6N A;  4C1D A;  4D1W A;  5K0W A;  1WUO A;  2FM6 A;  3Q6V A;  2YNT A;  1WUP A;  4TZB A;  2VW8 A;  2BTN A;  4NQ2 A;  1KO2 A;  4EYB A;  4Z67 A;  2QDS A;  4TYF A;  4U4L A;  3H3E A;  2Q42 A;  4JO0 A;  4ZO3 A;  3X2Z A;  4UA4 A;  5B3R A;  4RAW A;  3ZNB A;  1YCF A;  2QDT A;  3ZWF A;  4ZO2 A;  3FAI A;  2BC2 A;  4HKY A;  3BK1 A;  3KL7 A;  4J5F A;  2NZE A;  2BG8 B;  1VGN A;  5EHT A;  5EW0 A;  4C1F A;  2I7T A;  5ACU A;  5KIK A;  2WYM A;  3DHA A;  2ZZI A;  5B1U A;  1DDK A;  4WD6 A;  5DPX A;  5FQC A;  2QIN A;  4BP0 A;  3TP9 A;  5HH6 A;  5EV6 A;  3BC2 A;  2BFL A;  4UWP B;  4Z5Y A;  2FK6 A;  4GYU A;  5K4K A;  1JT1 A;  1M2X A;  1BVT A;  1BMC A;  3AF5 A;  1QH5 A;  4Z5Z A;  2BG7 A;  1A7T A;  2P1E A;  4H0D A;  2HB9 A;  4ZNB A;  4LE6 A;  1K07 A;  2YZ3 A;  4UWS B;  5A5Z A;  3VPE A;  4AX0 B;  1ZNB A;  4RAM A;  5HIQ A;  3WXC A;  2BFZ B;  3X2X A;  1VME A;  3T3O A;  4TZE A;  2NZF A;  3VQZ A;  2FHX B;  2BR6 A;  1X8H A;  2WRS A;  4FEK A;  3SD9 A;  3IDZ A;  2P4Z A;  3ZQ4 A;  2BMI A;  2AIO A;  2NYP A;  2BG2 A;  2FU8 A;  2Y87 A;  5ACX A;  4C1G A;  5LMC A;  5HIS A;  2M5D A;  1JJT A;  2DOO A;  3PY6 A;  1WRA A;  2BGA A;  2WYM C;  4C1C A;  5LS3 A;  5AHO A;  2A7M A;  5EVK A;  1DD6 A;  5AXR A;  4AX1 B;  5HIO A;  5HIP A;  2OHJ A;  2P97 A;  4V0H A;  3I0V A;  4TYT A;  5ACP A;  2NXA A;  4UWO B;  2I7X A;  5LCF A;  2FU9 A;  2CBN A;  5KIL A;  3X30 A;  3I11 A;  2GKL A;  3SW3 A;  2Q0J A;  5A87 A;  2AZ4 A;  4EXY A;  4EYL A;  2BG8 A;  5K4N A;  4UWR B;  5A0T A;  3DHB A;  3RPC A;  4D02 A;  5LE1 A;  1WW1 A;  4XWW A;  1QH3 A;  1ZKP A;  4F6H A;  2FU6 A;  5B15 A;  2WYL A;  3ESH A;  2BIB A;  2GFJ A;  4J5H A;  2WHG A;  3IOF A;  3G1P A;  2YCB A;  2FU7 A;  4Z6X A;  5EVD A;  5AXO A;  2YNU A;  2ZNB A;  1VJN A;  2QED A;  4B87 A;  3BK2 A;  5ACV A;  5LSC A;  3IEM A;  5FQB A;  2M5C A;  4YSL A;  4KEP A;  3AJ3 A;  5AHR A;  5LM6 A;  4YSK A;  1L9Y A;  5HH4 A;  4UAM A;  2E7Y A;  1X8I A;  4FSB A;  2BFZ A;  2OHI A;  3IE2 A;  3I15 A;  2FHX A;  3A4Y A;  1YCH A;  3RKJ A;  2BG6 A;  3T3N A;  2ZO4 A;  4GYQ A;  3I14 A;  5A0V A;  2I7V A;  4RM5 A;  3AF6 A;  3S0Z A;  4EY2 A;  2Y8B A;  4NQ4 A;  4PVT A;  3JXP A;  3T9M A;  3R2U A;  4AWZ A;  2R2D A;  3SPU A;  4TZ9 A;  3F9O A;  5LLD A;  2OHH A;  2P18 A;  4D1V A;  4NQ6 A; 
#chains in the Genus database with same CATH topology
 4YSB A;  2H6A A;  5ACW A;  5EVB A;  4DIL A;  4AXH A;  1MQO A;  2YHE A;  1XTO A;  4XUK A;  3P2U A;  3QH8 A;  4RL2 A;  4Z7R A;  4GCW A;  5HH5 A;  1KR3 A;  2YNT B;  3DH8 A;  3LVZ A;  1BC2 A;  1DXK A;  5FQA A;  3SBL A;  1E5D A;  5ACT A;  4RBS A;  5AEB A;  1HLK A;  4C1H A;  2GCU A;  2XR1 A;  4EFZ A;  4HL2 A;  4RL0 A;  4C09 A;  5ACQ A;  2YNW A;  4DIK A;  4AWY B;  5EWA A;  4CHL A;  4D1U A;  4HL1 A;  1YCG A;  1Y44 A;  4EYF A;  4UBQ A;  2BFK A;  3IE0 A;  5IQK A;  3MD7 A;  4TZF A;  4AD9 A;  1ZTC A;  5K4M A;  4EXS A;  5EH9 A;  5AYA A;  3BV6 A;  1SML A;  3X2Y A;  5ACR A;  2DKF A;  1KO3 A;  5LCH A;  4F6Z A;  1P9E A;  4BZ3 A;  1A8T A;  4Z60 A;  3FCZ A;  3ADR A;  4KEQ A;  2Y8A A;  3RKK A;  3SFP A;  4NQ5 A;  4FR7 A;  3IEL A;  3DHC A;  3ZR9 A;  3IEK A;  5LCA A;  3IE1 A;  1XM8 A;  2Q0I A;  1JJE A;  3I13 A;  2QJS A;  4PVO A;  2GMN A;  3PY5 A;  3KNR A;  4ZEJ A;  3SRX A;  4D1T A;  2Q9U A;  2GFK A;  3PG4 A;  2YNV A;  4O98 A;  5ACS A;  2YNV B;  4XWT A;  3IOG A;  4P62 A;  2ZWR A;  4C1E A;  1X8G A;  2XF4 A;  5EV8 A;  2UYX A;  3KNS A;  3L6N A;  4C1D A;  4D1W A;  5K0W A;  1WUO A;  2FM6 A;  3Q6V A;  2YNT A;  1WUP A;  4TZB A;  2VW8 A;  2BTN A;  4NQ2 A;  1KO2 A;  4EYB A;  4Z67 A;  2QDS A;  4TYF A;  4U4L A;  3H3E A;  2Q42 A;  4JO0 A;  4ZO3 A;  3X2Z A;  4UA4 A;  2CG2 A;  5B3R A;  4RAW A;  3ZNB A;  1YCF A;  2QDT A;  3ZWF A;  4ZO2 A;  3FAI A;  2BC2 A;  4HKY A;  3BK1 A;  3KL7 A;  4J5F A;  2NZE A;  2BG8 B;  1VGN A;  5EHT A;  5EW0 A;  4C1F A;  2I7T A;  5ACU A;  5KIK A;  2WYM A;  3DHA A;  2ZZI A;  5B1U A;  1DDK A;  4WD6 A;  5DPX A;  5FQC A;  2QIN A;  4BP0 A;  3TP9 A;  5HH6 A;  5EV6 A;  3BC2 A;  2BFL A;  4UWP B;  4Z5Y A;  2FK6 A;  4GYU A;  5K4K A;  1JT1 A;  1M2X A;  1BVT A;  1BMC A;  3AF5 A;  1QH5 A;  4Z5Z A;  2BG7 A;  1A7T A;  2P1E A;  4H0D A;  2HB9 A;  4ZNB A;  4LE6 A;  1K07 A;  2YZ3 A;  4UWS B;  5A5Z A;  3VPE A;  4AX0 B;  1ZNB A;  4RAM A;  4PDX A;  5HIQ A;  3WXC A;  2BFZ B;  3X2X A;  1VME A;  3T3O A;  4TZE A;  2NZF A;  3VQZ A;  2FHX B;  2BR6 A;  3SD9 A;  1X8H A;  2WRS A;  4FEK A;  3IDZ A;  2P4Z A;  3ZQ4 A;  2BMI A;  2AIO A;  2NYP A;  2BG2 A;  2FU8 A;  2Y87 A;  5ACX A;  4C1G A;  5AIJ A;  5LMC A;  5HIS A;  2M5D A;  1JJT A;  2DOO A;  3PY6 A;  1WRA A;  2BGA A;  2WYM C;  4C1C A;  5LS3 A;  5AHO A;  2A7M A;  5EVK A;  1DD6 A;  5AXR A;  4AX1 B;  5HIO A;  5HIP A;  2OHJ A;  2P97 A;  4V0H A;  3I0V A;  4TYT A;  5ACP A;  2NXA A;  4UWO B;  5AJL A;  2I7X A;  5LCF A;  2FU9 A;  2CBN A;  5KIL A;  2CG3 A;  3I11 A;  3X30 A;  2GKL A;  3SW3 A;  2Q0J A;  5A87 A;  2AZ4 A;  4EXY A;  4EYL A;  2BG8 A;  5K4N A;  4UWR B;  5A0T A;  3DHB A;  5A23 A;  3RPC A;  4D02 A;  5LE1 A;  1WW1 A;  4XWW A;  1QH3 A;  1ZKP A;  4F6H A;  2FU6 A;  5B15 A;  2WYL A;  3ESH A;  2BIB A;  2GFJ A;  4J5H A;  2WHG A;  3IOF A;  3G1P A;  4NUR A;  2YCB A;  2FU7 A;  4Z6X A;  5EVD A;  5AXO A;  2YNU A;  2ZNB A;  1VJN A;  2CFZ A;  2QED A;  4B87 A;  3BK2 A;  5ACV A;  5LSC A;  3IEM A;  2CFU A;  5FQB A;  2M5C A;  4YSL A;  4KEP A;  3AJ3 A;  5AHR A;  5LM6 A;  4YSK A;  1L9Y A;  5HH4 A;  4UAM A;  2E7Y A;  1X8I A;  4FSB A;  2BFZ A;  2OHI A;  3IE2 A;  3I15 A;  2FHX A;  4AV7 A;  3A4Y A;  1YCH A;  3RKJ A;  2BG6 A;  3T3N A;  2ZO4 A;  4GYQ A;  3I14 A;  5A0V A;  2I7V A;  4RM5 A;  3AF6 A;  3S0Z A;  4EY2 A;  2Y8B A;  4NQ4 A;  4PVT A;  3JXP A;  3T9M A;  3R2U A;  4AWZ A;  3SPU A;  2R2D A;  4TZ9 A;  3F9O A;  5LLD A;  2OHH A;  2P18 A;  4D1V A;  4NQ6 A; 
#chains in the Genus database with same CATH homology
 4YSB A;  2H6A A;  5ACW A;  5EVB A;  4DIL A;  1MQO A;  1XTO A;  4XUK A;  3P2U A;  3QH8 A;  4RL2 A;  4Z7R A;  4GCW A;  5HH5 A;  1KR3 A;  2YNT B;  3DH8 A;  3LVZ A;  1BC2 A;  1DXK A;  5FQA A;  3SBL A;  1E5D A;  5ACT A;  4RBS A;  5AEB A;  1HLK A;  4C1H A;  2GCU A;  2XR1 A;  4EFZ A;  4HL2 A;  4RL0 A;  4C09 A;  5ACQ A;  2YNW A;  4DIK A;  4AWY B;  5EWA A;  4CHL A;  4D1U A;  4HL1 A;  1YCG A;  1Y44 A;  4EYF A;  4UBQ A;  2BFK A;  3IE0 A;  5IQK A;  3MD7 A;  4TZF A;  4AD9 A;  1ZTC A;  5K4M A;  4EXS A;  5EH9 A;  5AYA A;  3BV6 A;  1SML A;  3X2Y A;  5ACR A;  2DKF A;  1KO3 A;  5LCH A;  4F6Z A;  1P9E A;  4BZ3 A;  1A8T A;  4Z60 A;  3FCZ A;  3ADR A;  4KEQ A;  2Y8A A;  3RKK A;  3SFP A;  4NQ5 A;  4FR7 A;  3IEL A;  3DHC A;  3ZR9 A;  3IEK A;  5LCA A;  3IE1 A;  1XM8 A;  2Q0I A;  1JJE A;  3I13 A;  2QJS A;  4PVO A;  2GMN A;  3PY5 A;  3KNR A;  4ZEJ A;  3SRX A;  4D1T A;  2Q9U A;  2GFK A;  3PG4 A;  2YNV A;  4O98 A;  5ACS A;  2YNV B;  4XWT A;  3IOG A;  4P62 A;  2ZWR A;  4C1E A;  1X8G A;  2XF4 A;  5EV8 A;  2UYX A;  3KNS A;  3L6N A;  4C1D A;  4D1W A;  5K0W A;  1WUO A;  2FM6 A;  3Q6V A;  2YNT A;  1WUP A;  4TZB A;  2VW8 A;  2BTN A;  4NQ2 A;  1KO2 A;  4EYB A;  4Z67 A;  2QDS A;  4TYF A;  4U4L A;  3H3E A;  2Q42 A;  4JO0 A;  4ZO3 A;  3X2Z A;  4UA4 A;  5B3R A;  4RAW A;  3ZNB A;  1YCF A;  2QDT A;  3ZWF A;  4ZO2 A;  3FAI A;  2BC2 A;  4HKY A;  3BK1 A;  3KL7 A;  4J5F A;  2NZE A;  2BG8 B;  1VGN A;  5EHT A;  5EW0 A;  4C1F A;  2I7T A;  5ACU A;  5KIK A;  2WYM A;  3DHA A;  2ZZI A;  5B1U A;  1DDK A;  4WD6 A;  5DPX A;  5FQC A;  2QIN A;  4BP0 A;  3TP9 A;  5HH6 A;  5EV6 A;  3BC2 A;  2BFL A;  4UWP B;  4Z5Y A;  2FK6 A;  4GYU A;  5K4K A;  1JT1 A;  1M2X A;  1BVT A;  1BMC A;  3AF5 A;  1QH5 A;  4Z5Z A;  2BG7 A;  1A7T A;  2P1E A;  4H0D A;  2HB9 A;  4ZNB A;  4LE6 A;  1K07 A;  2YZ3 A;  4UWS B;  5A5Z A;  3VPE A;  4AX0 B;  1ZNB A;  4RAM A;  5HIQ A;  3WXC A;  2BFZ B;  3X2X A;  1VME A;  3T3O A;  4TZE A;  2NZF A;  3VQZ A;  2FHX B;  2BR6 A;  1X8H A;  2WRS A;  4FEK A;  3SD9 A;  3IDZ A;  2P4Z A;  3ZQ4 A;  2BMI A;  2AIO A;  2NYP A;  2BG2 A;  2FU8 A;  2Y87 A;  5ACX A;  4C1G A;  5LMC A;  5HIS A;  2M5D A;  1JJT A;  2DOO A;  3PY6 A;  1WRA A;  2BGA A;  2WYM C;  4C1C A;  5LS3 A;  5AHO A;  2A7M A;  5EVK A;  1DD6 A;  5AXR A;  4AX1 B;  5HIO A;  5HIP A;  2OHJ A;  2P97 A;  4V0H A;  3I0V A;  4TYT A;  5ACP A;  2NXA A;  4UWO B;  2I7X A;  5LCF A;  2FU9 A;  2CBN A;  5KIL A;  3X30 A;  3I11 A;  2GKL A;  3SW3 A;  2Q0J A;  5A87 A;  2AZ4 A;  4EXY A;  4EYL A;  2BG8 A;  5K4N A;  4UWR B;  5A0T A;  3DHB A;  3RPC A;  4D02 A;  5LE1 A;  1WW1 A;  4XWW A;  1QH3 A;  1ZKP A;  4F6H A;  2FU6 A;  5B15 A;  2WYL A;  3ESH A;  2BIB A;  2GFJ A;  4J5H A;  2WHG A;  3IOF A;  3G1P A;  2YCB A;  2FU7 A;  4Z6X A;  5EVD A;  5AXO A;  2YNU A;  2ZNB A;  1VJN A;  2QED A;  4B87 A;  3BK2 A;  5ACV A;  5LSC A;  3IEM A;  5FQB A;  2M5C A;  4YSL A;  4KEP A;  3AJ3 A;  5AHR A;  5LM6 A;  4YSK A;  1L9Y A;  5HH4 A;  4UAM A;  2E7Y A;  1X8I A;  4FSB A;  2BFZ A;  2OHI A;  3IE2 A;  3I15 A;  2FHX A;  3A4Y A;  1YCH A;  3RKJ A;  2BG6 A;  3T3N A;  2ZO4 A;  4GYQ A;  3I14 A;  5A0V A;  2I7V A;  4RM5 A;  3AF6 A;  3S0Z A;  4EY2 A;  2Y8B A;  4NQ4 A;  4PVT A;  3JXP A;  3T9M A;  3R2U A;  4AWZ A;  2R2D A;  3SPU A;  4TZ9 A;  3F9O A;  5LLD A;  2OHH A;  2P18 A;  4D1V A;  4NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...