3SD9A

Crystal structure of serratia fonticola sfh-i: source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
b'KNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase
source organism Serratia fonticola
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3sd9A00
4Z6XA 2FM6A 5ACQA 3Q6VA 4YSBA 4DIKA 4V0HA 2M5DA 4XUKA 2BFLA 3IDZA 1A7TA 5EVBA 3MD7A 3RKKA 2DOOA 1DXKA 3ZQ4A 5HIQA 2BGAA 1JJTA 5EVDA 3X2XA 3X2ZA 2Y87A 3S0ZA 3RKJA 2GKLA 3AJ3A 3ZR9A 4ZNBA 4TZBA 1WRAA 1X8GA 4HKYA 2FU6A 2A7MA 5EV8A 4WD6A 2BG7A 4C1EA 3T3OA 2WYMC 4F6ZA 4O98A 5FQAA 3QH8A 3IE1A 5A5ZA 2BR6A 2QEDA 5LSCA 4D1WA 2FHXB 1L9YA 3ADRA 3DH8A 3RPCA 5LS3A 5HH4A 1VJNA 4H0DA 1M2XA 4NQ4A 2AZ4A 2XR1A 2YNVB 4AD9A 3AF5A 1DD6A 4XWWA 4BP0A 4UAMA 3I14A 2NZEA 5AXOA 1E5DA 1A8TA 2YNVA 3WXCA 4Z60A 4FSBA 1VGNA 1ZTCA 3DHBA 1SMLA 3DHCA 2CBNA 3IEKA 4DILA 2BFKA 5LE1A 5HH6A 4HL1A 2BG6A 4TYTA 1KO2A 5AEBA 5FQCA 4GCWA 3X30A 4BZ3A 4D1TA 5LMCA 3FAIA 2ZZIA 2NYPA 4C1FA 2BG2A 5B15A 5EWAA 2Q0IA 1VMEA 2QDSA 1BMCA 3F9OA 4C1GA 4AX1B 2ZO4A 3LVZA 3VQZA 3SD9A 4C1DA 4NQ5A 4UBQA 2E7YA 1MQOA 1YCHA 2P97A 4RAMA 3T3NA 2BC2A 4PVOA 4P62A 1JT1A 5LCFA 4CHLA 4AX0B 2WYMA 2OHIA 2BMIA 2XF4A 2NXAA 5EV6A 3IOGA 4GYQA 5A0VA 5IQKA 1XM8A 2ZWRA 2GFKA 3BK1A 4TZEA 3T9MA 4UWPB 3H3EA 3I13A 4RBSA 4UA4A 3AF6A 5KIKA 2AIOA 2YNWA 5ACUA 3SFPA 5KILA 3TP9A 2YZ3A 5AHRA 5EVKA 2H6AA 1DDKA 1WUPA 4RAWA 1YCGA 2HB9A 3G1PA 2GMNA 2BG8A 2WRSA 5K4NA 3R2UA 2OHHA 2Q0JA 4GYUA 4Z5ZA 4UWSB 3BV6A 2M5CA 5ACTA 2BG8B 5K4KA 5DPXA 4KEQA 2Y8BA 3KL7A 1Y44A 5EHTA 3I11A 4AWZA 4ZEJA 3IEMA 2ZNBA 4NQ2A 4C1CA 2GCUA 2P1EA 3IOFA 3VPEA 5B3RA 2YNTA 4U4LA 1HLKA 2NZFA 4YSLA 2P4ZA 1YCFA 3KNSA 2GFJA 5EW0A 5LCHA 1KR3A 1QH5A 4B87A 4FEKA 4Z5YA 3ZNBA 3FCZA 2QDTA 3PY6A 1QH3A 5LM6A 4TYFA 2YNUA 3IELA 2Q9UA 4NQ6A 1JJEA 1XTOA 5AHOA 4TZFA 4EXSA 3SW3A 4RM5A 1WUOA 4LE6A 5FQBA 3X2YA 1ZNBA 3BC2A 2BFZB 3PY5A 4F6HA 4UWOB 4D1UA 2DKFA 3I15A 2FU7A 4KEPA 4TZ9A 4EYLA 2VW8A 1X8HA 3IE2A 5ACSA 2FU9A 5ACPA 2YNTB 4EFZA 3SRXA 5K0WA 2I7VA 5AXRA 5K4MA 5LCAA 2OHJA 4YSKA 5EH9A 2QJSA 3PG4A 1ZKPA 1K07A 4D1VA 5A87A 3P2UA 3KNRA 4J5HA 1KO3A 2FK6A 4PVTA 4C1HA 5ACVA 2Y8AA 4RL0A 2BFZA 4EYBA 2FU8A 4JO0A 4XWTA 2I7TA 4FR7A 3ESHA 1BC2A 4EYFA 2R2DA 2UYXA 4ZO3A 2QINA 5AYAA 2Q42A 5LLDA 5ACRA 5HIPA 2FHXA 3I0VA 1X8IA 5HH5A 4J5FA 2WYLA 4RL2A 4UWRB 3BK2A 2YCBA 5ACWA 3SBLA 4EXYA 2BIBA 5ACXA 5HIOA 1P9EA 2I7XA 3SPUA 3JXPA 1BVTA 5A0TA 4EY2A 3A4YA 4C09A 5HISA 2P18A 1WW1A 4Z7RA 4Z67A 2BTNA 5B1UA 4ZO2A 4AWYB 2WHGA 3ZWFA 4D02A 3L6NA 3IE0A 4HL2A 3DHAA
chains in the Genus database with same CATH superfamily
4Z6XA 2FM6A 5ACQA 3Q6VA 4YSBA 4DIKA 4V0HA 2CG3A 2M5DA 4XUKA 2BFLA 3IDZA 1A7TA 5EVBA 3MD7A 3RKKA 2DOOA 1DXKA 3ZQ4A 5HIQA 2BGAA 5A23A 1JJTA 5EVDA 3X2XA 3X2ZA 2Y87A 3S0ZA 3RKJA 2GKLA 3AJ3A 3ZR9A 4ZNBA 4TZBA 1WRAA 1X8GA 4HKYA 2FU6A 2A7MA 5EV8A 4WD6A 2BG7A 4C1EA 3T3OA 2WYMC 4F6ZA 4O98A 5FQAA 3QH8A 3IE1A 5A5ZA 2BR6A 2QEDA 5LSCA 4D1WA 2FHXB 1L9YA 3ADRA 3DH8A 3RPCA 5LS3A 5HH4A 1VJNA 4H0DA 1M2XA 4NQ4A 2AZ4A 2XR1A 2YNVB 4AD9A 4AV7A 3AF5A 1DD6A 4XWWA 4BP0A 4UAMA 3I14A 2NZEA 5AXOA 1E5DA 1A8TA 2YNVA 3WXCA 4Z60A 4FSBA 1VGNA 1ZTCA 3DHBA 1SMLA 3DHCA 2CBNA 3IEKA 4DILA 2BFKA 5LE1A 5HH6A 4HL1A 2BG6A 4TYTA 1KO2A 5AEBA 5FQCA 4GCWA 3X30A 4BZ3A 4D1TA 5LMCA 3FAIA 2ZZIA 2NYPA 4C1FA 2BG2A 5B15A 5EWAA 2Q0IA 5AIJA 1VMEA 2QDSA 1BMCA 3F9OA 4C1GA 4AX1B 2ZO4A 3LVZA 3VQZA 3SD9A 4C1DA 4NQ5A 4UBQA 2E7YA 1MQOA 1YCHA 2P97A 4RAMA 3T3NA 2BC2A 4PVOA 4P62A 1JT1A 5LCFA 4CHLA 4AX0B 2WYMA 2OHIA 2BMIA 2XF4A 2NXAA 5EV6A 3IOGA 4GYQA 5A0VA 1XM8A 5IQKA 2ZWRA 2GFKA 3BK1A 4TZEA 3T9MA 4UWPB 3H3EA 3I13A 4RBSA 4UA4A 3AF6A 5KIKA 2AIOA 2YNWA 5ACUA 3SFPA 4PDXA 4NURA 5KILA 3TP9A 2YZ3A 5AHRA 5EVKA 2H6AA 1DDKA 1WUPA 4RAWA 1YCGA 2CG2A 2HB9A 3G1PA 2GMNA 2BG8A 2WRSA 2CFUA 5K4NA 3R2UA 2OHHA 2Q0JA 4GYUA 4Z5ZA 4UWSB 3BV6A 2M5CA 5ACTA 2BG8B 5K4KA 5DPXA 4KEQA 2Y8BA 3KL7A 1Y44A 5EHTA 3I11A 4AWZA 4ZEJA 3IEMA 2ZNBA 4NQ2A 4C1CA 2GCUA 2P1EA 3IOFA 3VPEA 5B3RA 2YNTA 4U4LA 1HLKA 2NZFA 4YSLA 2P4ZA 1YCFA 3KNSA 2GFJA 5EW0A 5LCHA 1KR3A 1QH5A 4B87A 4FEKA 4Z5YA 3ZNBA 3FCZA 2QDTA 3PY6A 1QH3A 5LM6A 4TYFA 2YNUA 3IELA 2Q9UA 4NQ6A 1JJEA 1XTOA 5AHOA 4TZFA 4EXSA 3SW3A 4RM5A 1WUOA 4LE6A 5FQBA 3X2YA 1ZNBA 3BC2A 2BFZB 3PY5A 4F6HA 4UWOB 4D1UA 2DKFA 3I15A 2FU7A 4KEPA 4TZ9A 4EYLA 2VW8A 1X8HA 3IE2A 5ACSA 5AJLA 2FU9A 5ACPA 2YNTB 4EFZA 3SRXA 5K0WA 2I7VA 5AXRA 5K4MA 5LCAA 2OHJA 4YSKA 5EH9A 2QJSA 3PG4A 1ZKPA 1K07A 4D1VA 5A87A 3P2UA 3KNRA 4J5HA 1KO3A 2CFZA 2FK6A 4PVTA 4C1HA 5ACVA 2Y8AA 4RL0A 2BFZA 4EYBA 2FU8A 4JO0A 4XWTA 2I7TA 4FR7A 3ESHA 1BC2A 4EYFA 2R2DA 2UYXA 4ZO3A 2QINA 5AYAA 4AXHA 2Q42A 5LLDA 5ACRA 5HIPA 2FHXA 3I0VA 1X8IA 5HH5A 4J5FA 2WYLA 4RL2A 4UWRB 3BK2A 2YCBA 5ACWA 3SBLA 4EXYA 2BIBA 2YHEA 5ACXA 5HIOA 1P9EA 2I7XA 3SPUA 3JXPA 1BVTA 5A0TA 4EY2A 3A4YA 4C09A 5HISA 2P18A 1WW1A 4Z7RA 4Z67A 2BTNA 5B1UA 4ZO2A 4AWYB 2WHGA 3ZWFA 4D02A 3L6NA 3IE0A 4HL2A 3DHAA
chains in the Genus database with same CATH topology
4Z6XA 2FM6A 5ACQA 3Q6VA 4YSBA 4DIKA 4V0HA 2M5DA 4XUKA 2BFLA 3IDZA 1A7TA 5EVBA 3MD7A 3RKKA 2DOOA 1DXKA 3ZQ4A 5HIQA 2BGAA 1JJTA 5EVDA 3X2XA 3X2ZA 2Y87A 3S0ZA 3RKJA 2GKLA 3AJ3A 3ZR9A 4ZNBA 4TZBA 1WRAA 1X8GA 4HKYA 2FU6A 2A7MA 5EV8A 4WD6A 2BG7A 4C1EA 3T3OA 2WYMC 4F6ZA 4O98A 5FQAA 3QH8A 3IE1A 5A5ZA 2BR6A 2QEDA 5LSCA 4D1WA 2FHXB 1L9YA 3ADRA 3DH8A 3RPCA 5LS3A 5HH4A 1VJNA 4H0DA 1M2XA 4NQ4A 2AZ4A 2XR1A 2YNVB 4AD9A 3AF5A 1DD6A 4XWWA 4BP0A 4UAMA 3I14A 2NZEA 5AXOA 1E5DA 1A8TA 2YNVA 3WXCA 4Z60A 4FSBA 1VGNA 1ZTCA 3DHBA 1SMLA 3DHCA 2CBNA 3IEKA 4DILA 2BFKA 5LE1A 5HH6A 4HL1A 2BG6A 4TYTA 1KO2A 5AEBA 5FQCA 4GCWA 3X30A 4BZ3A 4D1TA 5LMCA 3FAIA 2ZZIA 2NYPA 4C1FA 2BG2A 5B15A 5EWAA 2Q0IA 1VMEA 2QDSA 1BMCA 3F9OA 4C1GA 4AX1B 2ZO4A 3LVZA 3VQZA 3SD9A 4C1DA 4NQ5A 4UBQA 2E7YA 1MQOA 1YCHA 2P97A 4RAMA 3T3NA 2BC2A 4PVOA 4P62A 1JT1A 5LCFA 4CHLA 4AX0B 2WYMA 2OHIA 2BMIA 2XF4A 2NXAA 5EV6A 3IOGA 4GYQA 5A0VA 5IQKA 1XM8A 2ZWRA 2GFKA 3BK1A 4TZEA 3T9MA 4UWPB 3H3EA 3I13A 4RBSA 4UA4A 3AF6A 5KIKA 2AIOA 2YNWA 5ACUA 3SFPA 5KILA 3TP9A 2YZ3A 5AHRA 5EVKA 2H6AA 1DDKA 1WUPA 4RAWA 1YCGA 2HB9A 3G1PA 2GMNA 2BG8A 2WRSA 5K4NA 3R2UA 2OHHA 2Q0JA 4GYUA 4Z5ZA 4UWSB 3BV6A 2M5CA 5ACTA 2BG8B 5K4KA 5DPXA 4KEQA 2Y8BA 3KL7A 1Y44A 5EHTA 3I11A 4AWZA 4ZEJA 3IEMA 2ZNBA 4NQ2A 4C1CA 2GCUA 2P1EA 3IOFA 3VPEA 5B3RA 2YNTA 4U4LA 1HLKA 2NZFA 4YSLA 2P4ZA 1YCFA 3KNSA 2GFJA 5EW0A 5LCHA 1KR3A 1QH5A 4B87A 4FEKA 4Z5YA 3ZNBA 3FCZA 2QDTA 3PY6A 1QH3A 5LM6A 4TYFA 2YNUA 3IELA 2Q9UA 4NQ6A 1JJEA 1XTOA 5AHOA 4TZFA 4EXSA 3SW3A 4RM5A 1WUOA 4LE6A 5FQBA 3X2YA 1ZNBA 3BC2A 2BFZB 3PY5A 4F6HA 4UWOB 4D1UA 2DKFA 3I15A 2FU7A 4KEPA 4TZ9A 4EYLA 2VW8A 1X8HA 3IE2A 5ACSA 2FU9A 5ACPA 2YNTB 4EFZA 3SRXA 5K0WA 2I7VA 5AXRA 5K4MA 5LCAA 2OHJA 4YSKA 5EH9A 2QJSA 3PG4A 1ZKPA 1K07A 4D1VA 5A87A 3P2UA 3KNRA 4J5HA 1KO3A 2FK6A 4PVTA 4C1HA 5ACVA 2Y8AA 4RL0A 2BFZA 4EYBA 2FU8A 4JO0A 4XWTA 2I7TA 4FR7A 3ESHA 1BC2A 4EYFA 2R2DA 2UYXA 4ZO3A 2QINA 5AYAA 2Q42A 5LLDA 5ACRA 5HIPA 2FHXA 3I0VA 1X8IA 5HH5A 4J5FA 2WYLA 4RL2A 4UWRB 3BK2A 2YCBA 5ACWA 3SBLA 4EXYA 2BIBA 5ACXA 5HIOA 1P9EA 2I7XA 3SPUA 3JXPA 1BVTA 5A0TA 4EY2A 3A4YA 4C09A 5HISA 2P18A 1WW1A 4Z7RA 4Z67A 2BTNA 5B1UA 4ZO2A 4AWYB 2WHGA 3ZWFA 4D02A 3L6NA 3IE0A 4HL2A 3DHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6X A;  2FM6 A;  5ACQ A;  3Q6V A;  4YSB A;  4DIK A;  4V0H A;  2M5D A;  4XUK A;  2BFL A;  3IDZ A;  1A7T A;  5EVB A;  3MD7 A;  3RKK A;  2DOO A;  1DXK A;  3ZQ4 A;  5HIQ A;  2BGA A;  1JJT A;  5EVD A;  3X2X A;  3X2Z A;  2Y87 A;  3S0Z A;  3RKJ A;  2GKL A;  3AJ3 A;  3ZR9 A;  4ZNB A;  4TZB A;  1WRA A;  1X8G A;  4HKY A;  2FU6 A;  2A7M A;  5EV8 A;  4WD6 A;  2BG7 A;  4C1E A;  3T3O A;  2WYM C;  4F6Z A;  4O98 A;  5FQA A;  3QH8 A;  3IE1 A;  5A5Z A;  2BR6 A;  2QED A;  5LSC A;  4D1W A;  2FHX B;  1L9Y A;  3ADR A;  3DH8 A;  3RPC A;  5LS3 A;  5HH4 A;  1VJN A;  4H0D A;  1M2X A;  4NQ4 A;  2AZ4 A;  2XR1 A;  2YNV B;  4AD9 A;  3AF5 A;  1DD6 A;  4XWW A;  4BP0 A;  4UAM A;  3I14 A;  2NZE A;  5AXO A;  1E5D A;  1A8T A;  2YNV A;  3WXC A;  4Z60 A;  4FSB A;  1VGN A;  1ZTC A;  3DHB A;  1SML A;  3DHC A;  2CBN A;  3IEK A;  4DIL A;  2BFK A;  5LE1 A;  5HH6 A;  4HL1 A;  2BG6 A;  4TYT A;  1KO2 A;  5AEB A;  5FQC A;  4GCW A;  3X30 A;  4BZ3 A;  4D1T A;  5LMC A;  3FAI A;  2ZZI A;  2NYP A;  4C1F A;  2BG2 A;  5B15 A;  5EWA A;  2Q0I A;  1VME A;  2QDS A;  1BMC A;  3F9O A;  4C1G A;  4AX1 B;  2ZO4 A;  3LVZ A;  3VQZ A;  3SD9 A;  4C1D A;  4NQ5 A;  4UBQ A;  2E7Y A;  1MQO A;  1YCH A;  2P97 A;  4RAM A;  3T3N A;  2BC2 A;  4PVO A;  4P62 A;  1JT1 A;  5LCF A;  4CHL A;  4AX0 B;  2WYM A;  2OHI A;  2BMI A;  2XF4 A;  2NXA A;  5EV6 A;  3IOG A;  4GYQ A;  5A0V A;  5IQK A;  1XM8 A;  2ZWR A;  2GFK A;  3BK1 A;  4TZE A;  3T9M A;  4UWP B;  3H3E A;  3I13 A;  4RBS A;  4UA4 A;  3AF6 A;  5KIK A;  2AIO A;  2YNW A;  5ACU A;  3SFP A;  5KIL A;  3TP9 A;  2YZ3 A;  5AHR A;  5EVK A;  2H6A A;  1DDK A;  1WUP A;  4RAW A;  1YCG A;  2HB9 A;  3G1P A;  2GMN A;  2BG8 A;  2WRS A;  5K4N A;  3R2U A;  2OHH A;  2Q0J A;  4GYU A;  4Z5Z A;  4UWS B;  3BV6 A;  2M5C A;  5ACT A;  2BG8 B;  5K4K A;  5DPX A;  4KEQ A;  2Y8B A;  3KL7 A;  1Y44 A;  5EHT A;  3I11 A;  4AWZ A;  4ZEJ A;  3IEM A;  2ZNB A;  4NQ2 A;  4C1C A;  2GCU A;  2P1E A;  3IOF A;  3VPE A;  5B3R A;  2YNT A;  4U4L A;  1HLK A;  2NZF A;  4YSL A;  2P4Z A;  1YCF A;  3KNS A;  2GFJ A;  5EW0 A;  5LCH A;  1KR3 A;  1QH5 A;  4B87 A;  4FEK A;  4Z5Y A;  3ZNB A;  3FCZ A;  2QDT A;  3PY6 A;  1QH3 A;  5LM6 A;  4TYF A;  2YNU A;  3IEL A;  2Q9U A;  4NQ6 A;  1JJE A;  1XTO A;  5AHO A;  4TZF A;  4EXS A;  3SW3 A;  4RM5 A;  1WUO A;  4LE6 A;  5FQB A;  3X2Y A;  1ZNB A;  3BC2 A;  2BFZ B;  3PY5 A;  4F6H A;  4UWO B;  4D1U A;  2DKF A;  3I15 A;  2FU7 A;  4KEP A;  4TZ9 A;  4EYL A;  2VW8 A;  1X8H A;  3IE2 A;  5ACS A;  2FU9 A;  5ACP A;  2YNT B;  4EFZ A;  3SRX A;  5K0W A;  2I7V A;  5AXR A;  5K4M A;  5LCA A;  2OHJ A;  4YSK A;  5EH9 A;  2QJS A;  3PG4 A;  1ZKP A;  1K07 A;  4D1V A;  5A87 A;  3P2U A;  3KNR A;  4J5H A;  1KO3 A;  2FK6 A;  4PVT A;  4C1H A;  5ACV A;  2Y8A A;  4RL0 A;  2BFZ A;  4EYB A;  2FU8 A;  4JO0 A;  4XWT A;  2I7T A;  4FR7 A;  3ESH A;  1BC2 A;  4EYF A;  2R2D A;  2UYX A;  4ZO3 A;  2QIN A;  5AYA A;  2Q42 A;  5LLD A;  5ACR A;  5HIP A;  2FHX A;  3I0V A;  1X8I A;  5HH5 A;  4J5F A;  2WYL A;  4RL2 A;  4UWR B;  3BK2 A;  2YCB A;  5ACW A;  3SBL A;  4EXY A;  2BIB A;  5ACX A;  5HIO A;  1P9E A;  2I7X A;  3SPU A;  3JXP A;  1BVT A;  5A0T A;  4EY2 A;  3A4Y A;  4C09 A;  5HIS A;  2P18 A;  1WW1 A;  4Z7R A;  4Z67 A;  2BTN A;  5B1U A;  4ZO2 A;  4AWY B;  2WHG A;  3ZWF A;  4D02 A;  3L6N A;  3IE0 A;  4HL2 A;  3DHA A; 
#chains in the Genus database with same CATH topology
 4Z6X A;  2FM6 A;  5ACQ A;  3Q6V A;  4YSB A;  4DIK A;  4V0H A;  2CG3 A;  2M5D A;  4XUK A;  2BFL A;  3IDZ A;  1A7T A;  5EVB A;  3MD7 A;  3RKK A;  2DOO A;  1DXK A;  3ZQ4 A;  5HIQ A;  2BGA A;  5A23 A;  1JJT A;  5EVD A;  3X2X A;  3X2Z A;  2Y87 A;  3S0Z A;  3RKJ A;  2GKL A;  3AJ3 A;  3ZR9 A;  4ZNB A;  4TZB A;  1WRA A;  1X8G A;  4HKY A;  2FU6 A;  2A7M A;  5EV8 A;  4WD6 A;  2BG7 A;  4C1E A;  3T3O A;  2WYM C;  4F6Z A;  4O98 A;  5FQA A;  3QH8 A;  3IE1 A;  5A5Z A;  2BR6 A;  2QED A;  5LSC A;  4D1W A;  2FHX B;  1L9Y A;  3ADR A;  3DH8 A;  3RPC A;  5LS3 A;  5HH4 A;  1VJN A;  4H0D A;  1M2X A;  4NQ4 A;  2AZ4 A;  2XR1 A;  2YNV B;  4AD9 A;  4AV7 A;  3AF5 A;  1DD6 A;  4XWW A;  4BP0 A;  4UAM A;  3I14 A;  2NZE A;  5AXO A;  1E5D A;  1A8T A;  2YNV A;  3WXC A;  4Z60 A;  4FSB A;  1VGN A;  1ZTC A;  3DHB A;  1SML A;  3DHC A;  2CBN A;  3IEK A;  4DIL A;  2BFK A;  5LE1 A;  5HH6 A;  4HL1 A;  2BG6 A;  4TYT A;  1KO2 A;  5AEB A;  5FQC A;  4GCW A;  3X30 A;  4BZ3 A;  4D1T A;  5LMC A;  3FAI A;  2ZZI A;  2NYP A;  4C1F A;  2BG2 A;  5B15 A;  5EWA A;  2Q0I A;  5AIJ A;  1VME A;  2QDS A;  1BMC A;  3F9O A;  4C1G A;  4AX1 B;  2ZO4 A;  3LVZ A;  3VQZ A;  3SD9 A;  4C1D A;  4NQ5 A;  4UBQ A;  2E7Y A;  1MQO A;  1YCH A;  2P97 A;  4RAM A;  3T3N A;  2BC2 A;  4PVO A;  4P62 A;  1JT1 A;  5LCF A;  4CHL A;  4AX0 B;  2WYM A;  2OHI A;  2BMI A;  2XF4 A;  2NXA A;  5EV6 A;  3IOG A;  4GYQ A;  5A0V A;  1XM8 A;  5IQK A;  2ZWR A;  2GFK A;  3BK1 A;  4TZE A;  3T9M A;  4UWP B;  3H3E A;  3I13 A;  4RBS A;  4UA4 A;  3AF6 A;  5KIK A;  2AIO A;  2YNW A;  5ACU A;  3SFP A;  4PDX A;  4NUR A;  5KIL A;  3TP9 A;  2YZ3 A;  5AHR A;  5EVK A;  2H6A A;  1DDK A;  1WUP A;  4RAW A;  1YCG A;  2CG2 A;  2HB9 A;  3G1P A;  2GMN A;  2BG8 A;  2WRS A;  2CFU A;  5K4N A;  3R2U A;  2OHH A;  2Q0J A;  4GYU A;  4Z5Z A;  4UWS B;  3BV6 A;  2M5C A;  5ACT A;  2BG8 B;  5K4K A;  5DPX A;  4KEQ A;  2Y8B A;  3KL7 A;  1Y44 A;  5EHT A;  3I11 A;  4AWZ A;  4ZEJ A;  3IEM A;  2ZNB A;  4NQ2 A;  4C1C A;  2GCU A;  2P1E A;  3IOF A;  3VPE A;  5B3R A;  2YNT A;  4U4L A;  1HLK A;  2NZF A;  4YSL A;  2P4Z A;  1YCF A;  3KNS A;  2GFJ A;  5EW0 A;  5LCH A;  1KR3 A;  1QH5 A;  4B87 A;  4FEK A;  4Z5Y A;  3ZNB A;  3FCZ A;  2QDT A;  3PY6 A;  1QH3 A;  5LM6 A;  4TYF A;  2YNU A;  3IEL A;  2Q9U A;  4NQ6 A;  1JJE A;  1XTO A;  5AHO A;  4TZF A;  4EXS A;  3SW3 A;  4RM5 A;  1WUO A;  4LE6 A;  5FQB A;  3X2Y A;  1ZNB A;  3BC2 A;  2BFZ B;  3PY5 A;  4F6H A;  4UWO B;  4D1U A;  2DKF A;  3I15 A;  2FU7 A;  4KEP A;  4TZ9 A;  4EYL A;  2VW8 A;  1X8H A;  3IE2 A;  5ACS A;  5AJL A;  2FU9 A;  5ACP A;  2YNT B;  4EFZ A;  3SRX A;  5K0W A;  2I7V A;  5AXR A;  5K4M A;  5LCA A;  2OHJ A;  4YSK A;  5EH9 A;  2QJS A;  3PG4 A;  1ZKP A;  1K07 A;  4D1V A;  5A87 A;  3P2U A;  3KNR A;  4J5H A;  1KO3 A;  2CFZ A;  2FK6 A;  4PVT A;  4C1H A;  5ACV A;  2Y8A A;  4RL0 A;  2BFZ A;  4EYB A;  2FU8 A;  4JO0 A;  4XWT A;  2I7T A;  4FR7 A;  3ESH A;  1BC2 A;  4EYF A;  2R2D A;  2UYX A;  4ZO3 A;  2QIN A;  5AYA A;  4AXH A;  2Q42 A;  5LLD A;  5ACR A;  5HIP A;  2FHX A;  3I0V A;  1X8I A;  5HH5 A;  4J5F A;  2WYL A;  4RL2 A;  4UWR B;  3BK2 A;  2YCB A;  5ACW A;  3SBL A;  4EXY A;  2BIB A;  2YHE A;  5ACX A;  5HIO A;  1P9E A;  2I7X A;  3SPU A;  3JXP A;  1BVT A;  5A0T A;  4EY2 A;  3A4Y A;  4C09 A;  5HIS A;  2P18 A;  1WW1 A;  4Z7R A;  4Z67 A;  2BTN A;  5B1U A;  4ZO2 A;  4AWY B;  2WHG A;  3ZWF A;  4D02 A;  3L6N A;  3IE0 A;  4HL2 A;  3DHA A; 
#chains in the Genus database with same CATH homology
 4Z6X A;  2FM6 A;  5ACQ A;  3Q6V A;  4YSB A;  4DIK A;  4V0H A;  2M5D A;  4XUK A;  2BFL A;  3IDZ A;  1A7T A;  5EVB A;  3MD7 A;  3RKK A;  2DOO A;  1DXK A;  3ZQ4 A;  5HIQ A;  2BGA A;  1JJT A;  5EVD A;  3X2X A;  3X2Z A;  2Y87 A;  3S0Z A;  3RKJ A;  2GKL A;  3AJ3 A;  3ZR9 A;  4ZNB A;  4TZB A;  1WRA A;  1X8G A;  4HKY A;  2FU6 A;  2A7M A;  5EV8 A;  4WD6 A;  2BG7 A;  4C1E A;  3T3O A;  2WYM C;  4F6Z A;  4O98 A;  5FQA A;  3QH8 A;  3IE1 A;  5A5Z A;  2BR6 A;  2QED A;  5LSC A;  4D1W A;  2FHX B;  1L9Y A;  3ADR A;  3DH8 A;  3RPC A;  5LS3 A;  5HH4 A;  1VJN A;  4H0D A;  1M2X A;  4NQ4 A;  2AZ4 A;  2XR1 A;  2YNV B;  4AD9 A;  3AF5 A;  1DD6 A;  4XWW A;  4BP0 A;  4UAM A;  3I14 A;  2NZE A;  5AXO A;  1E5D A;  1A8T A;  2YNV A;  3WXC A;  4Z60 A;  4FSB A;  1VGN A;  1ZTC A;  3DHB A;  1SML A;  3DHC A;  2CBN A;  3IEK A;  4DIL A;  2BFK A;  5LE1 A;  5HH6 A;  4HL1 A;  2BG6 A;  4TYT A;  1KO2 A;  5AEB A;  5FQC A;  4GCW A;  3X30 A;  4BZ3 A;  4D1T A;  5LMC A;  3FAI A;  2ZZI A;  2NYP A;  4C1F A;  2BG2 A;  5B15 A;  5EWA A;  2Q0I A;  1VME A;  2QDS A;  1BMC A;  3F9O A;  4C1G A;  4AX1 B;  2ZO4 A;  3LVZ A;  3VQZ A;  3SD9 A;  4C1D A;  4NQ5 A;  4UBQ A;  2E7Y A;  1MQO A;  1YCH A;  2P97 A;  4RAM A;  3T3N A;  2BC2 A;  4PVO A;  4P62 A;  1JT1 A;  5LCF A;  4CHL A;  4AX0 B;  2WYM A;  2OHI A;  2BMI A;  2XF4 A;  2NXA A;  5EV6 A;  3IOG A;  4GYQ A;  5A0V A;  5IQK A;  1XM8 A;  2ZWR A;  2GFK A;  3BK1 A;  4TZE A;  3T9M A;  4UWP B;  3H3E A;  3I13 A;  4RBS A;  4UA4 A;  3AF6 A;  5KIK A;  2AIO A;  2YNW A;  5ACU A;  3SFP A;  5KIL A;  3TP9 A;  2YZ3 A;  5AHR A;  5EVK A;  2H6A A;  1DDK A;  1WUP A;  4RAW A;  1YCG A;  2HB9 A;  3G1P A;  2GMN A;  2BG8 A;  2WRS A;  5K4N A;  3R2U A;  2OHH A;  2Q0J A;  4GYU A;  4Z5Z A;  4UWS B;  3BV6 A;  2M5C A;  5ACT A;  2BG8 B;  5K4K A;  5DPX A;  4KEQ A;  2Y8B A;  3KL7 A;  1Y44 A;  5EHT A;  3I11 A;  4AWZ A;  4ZEJ A;  3IEM A;  2ZNB A;  4NQ2 A;  4C1C A;  2GCU A;  2P1E A;  3IOF A;  3VPE A;  5B3R A;  2YNT A;  4U4L A;  1HLK A;  2NZF A;  4YSL A;  2P4Z A;  1YCF A;  3KNS A;  2GFJ A;  5EW0 A;  5LCH A;  1KR3 A;  1QH5 A;  4B87 A;  4FEK A;  4Z5Y A;  3ZNB A;  3FCZ A;  2QDT A;  3PY6 A;  1QH3 A;  5LM6 A;  4TYF A;  2YNU A;  3IEL A;  2Q9U A;  4NQ6 A;  1JJE A;  1XTO A;  5AHO A;  4TZF A;  4EXS A;  3SW3 A;  4RM5 A;  1WUO A;  4LE6 A;  5FQB A;  3X2Y A;  1ZNB A;  3BC2 A;  2BFZ B;  3PY5 A;  4F6H A;  4UWO B;  4D1U A;  2DKF A;  3I15 A;  2FU7 A;  4KEP A;  4TZ9 A;  4EYL A;  2VW8 A;  1X8H A;  3IE2 A;  5ACS A;  2FU9 A;  5ACP A;  2YNT B;  4EFZ A;  3SRX A;  5K0W A;  2I7V A;  5AXR A;  5K4M A;  5LCA A;  2OHJ A;  4YSK A;  5EH9 A;  2QJS A;  3PG4 A;  1ZKP A;  1K07 A;  4D1V A;  5A87 A;  3P2U A;  3KNR A;  4J5H A;  1KO3 A;  2FK6 A;  4PVT A;  4C1H A;  5ACV A;  2Y8A A;  4RL0 A;  2BFZ A;  4EYB A;  2FU8 A;  4JO0 A;  4XWT A;  2I7T A;  4FR7 A;  3ESH A;  1BC2 A;  4EYF A;  2R2D A;  2UYX A;  4ZO3 A;  2QIN A;  5AYA A;  2Q42 A;  5LLD A;  5ACR A;  5HIP A;  2FHX A;  3I0V A;  1X8I A;  5HH5 A;  4J5F A;  2WYL A;  4RL2 A;  4UWR B;  3BK2 A;  2YCB A;  5ACW A;  3SBL A;  4EXY A;  2BIB A;  5ACX A;  5HIO A;  1P9E A;  2I7X A;  3SPU A;  3JXP A;  1BVT A;  5A0T A;  4EY2 A;  3A4Y A;  4C09 A;  5HIS A;  2P18 A;  1WW1 A;  4Z7R A;  4Z67 A;  2BTN A;  5B1U A;  4ZO2 A;  4AWY B;  2WHG A;  3ZWF A;  4D02 A;  3L6N A;  3IE0 A;  4HL2 A;  3DHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...