3SD9A

Crystal structure of serratia fonticola sfh-i: source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
KNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3sd9A00
4NQ2A 4ZO3A 4C1FA 1KO2A 5ACPA 1WUPA 5AXRA 3JXPA 2ZNBA 3X30A 2YNVB 1ZTCA 2GFKA 5AEBA 4UWOB 2GFJA 4RAWA 4RAMA 2OHJA 5EWAA 2A7MA 5HH5A 5AHRA 2I7TA 4UWSB 3IE0A 3G1PA 5EV6A 2DKFA 3PY6A 4AWZA 4UA4A 5LS3A 1A7TA 2HB9A 3X2ZA 3S0ZA 3LVZA 2FU7A 2P18A 3ZNBA 2NYPA 2QINA 4O98A 1M2XA 2XR1A 2QEDA 4HL2A 5KIKA 1ZKPA 5EVBA 4UWRB 2OHIA 4D1UA 2P4ZA 4KEQA 3FAIA 3ZWFA 4UWPB 4J5HA 2Y8BA 4ZO2A 3MD7A 3TP9A 3IE1A 3H3EA 3I13A 1Y44A 4EXSA 2OHHA 2P1EA 2VW8A 2M5CA 5HH6A 1WW1A 2NZEA 2Q0IA 3ADRA 3A4YA 3IEKA 3RKJA 5ACUA 2WYLA 5EVKA 4H0DA 5DPXA 4C09A 2FU6A 4Z67A 1JT1A 3R2UA 1QH5A 4D02A 2QJSA 5ACRA 5LCAA 4GCWA 2ZO4A 4BP0A 2BG7A 4YSKA 2BFZA 2FM6A 3AF6A 3QH8A 5K4KA 5EH9A 1DXKA 3SBLA 3SRXA 5B1UA 1YCGA 1MQOA 3IE2A 2YNUA 5FQBA 3SD9A 1SMLA 3Q6VA 1P9EA 4DIKA 2GKLA 5HISA 4ZEJA 4FR7A 2WHGA 1HLKA 1JJTA 2Y87A 3IDZA 4EY2A 4JO0A 5EW0A 2CBNA 4D1TA 5IQKA 1X8HA 3BK1A 4U4LA 4Z60A 4TZBA 5ACQA 3T3OA 5ACTA 2UYXA 3T9MA 3RPCA 4NQ4A 4Z6XA 2WYMA 5LM6A 2YNTB 2DOOA 2BFKA 3BC2A 5KILA 3AJ3A 4AD9A 4RL2A 5ACXA 2ZWRA 3SPUA 4BZ3A 2AZ4A 4UAMA 4CHLA 2BG6A 3IOFA 4FEKA 5B15A 4KEPA 1VJNA 4RL0A 5ACWA 5B3RA 2E7YA 2GCUA 1KR3A 4V0HA 1YCFA 4NQ5A 2I7VA 4Z7RA 3SW3A 2P97A 4NQ6A 4YSLA 2YZ3A 4XWWA 5HIPA 5EHTA 2M5DA 4C1CA 3KL7A 5HIQA 2YNTA 4Z5YA 1VGNA 3ESHA 2WRSA 4C1EA 2BC2A 5HIOA 4HL1A 4F6ZA 5EV8A 4Z5ZA 4C1GA 2YNVA 1E5DA 1BC2A 2Q9UA 3F9OA 3KNRA 4WD6A 5A87A 5A5ZA 4EYLA 4TZFA 4ZNBA 1X8IA 2Q42A 3RKKA 3AF5A 4C1HA 5AHOA 1XM8A 1K07A 3DHBA 3IEMA 3X2XA 3I14A 3T3NA 4AWYB 2YNWA 4TYFA 2ZZIA 4P62A 1KO3A 3KNSA 4AX1B 3DHAA 4B87A 2FU8A 2NXAA 3BK2A 5K4MA 1BVTA 4EYBA 5AYAA 5LLDA 4EFZA 4PVOA 2WYMC 4FSBA 2Q0JA 2FHXA 2QDSA 1DD6A 5ACSA 5A0TA 4D1VA 3X2YA 1BMCA 3SFPA 3IELA 2YCBA 3DHCA 3FCZA 1A8TA 4XWTA 2FHXB 5LCFA 2XF4A 3I15A 5FQCA 4D1WA 2FU9A 4LE6A 1ZNBA 4GYUA 5LCHA 3P2UA 4XUKA 2BG2A 2Y8AA 3VPEA 1DDKA 4EYFA 5K4NA 2BFLA 2BFZB 4C1DA 3BV6A 5EVDA 2R2DA 4YSBA 1WRAA 2BG8A 1JJEA 3I0VA 5LMCA 3PY5A 3I11A 1QH3A 4GYQA 1WUOA 3IOGA 3ZR9A 2BG8B 2BTNA 5A0VA 4J5FA 3VQZA 2FK6A 2BIBA 2NZFA 4TYTA 5AXOA 4DILA 4TZ9A 4RM5A 4AX0B 5HH4A 2GMNA 5ACVA 1L9YA 2BGAA 1X8GA 4EXYA 3ZQ4A 2I7XA 2QDTA 4UBQA 4TZEA 4RBSA 2BMIA 4PVTA 3DH8A 1VMEA 1XTOA 4HKYA 3WXCA 2BR6A 5LE1A 4F6HA 2H6AA 5LSCA 1YCHA 3PG4A 2AIOA 5FQAA 5K0WA 3L6NA
chains in the Genus database with same CATH superfamily
4NQ2A 4ZO3A 4C1FA 1KO2A 5ACPA 1WUPA 5AXRA 3JXPA 2CFZA 2ZNBA 3X30A 2YNVB 1ZTCA 2GFKA 5AEBA 4UWOB 2GFJA 4RAWA 4RAMA 2OHJA 5EWAA 2A7MA 5HH5A 5AHRA 2I7TA 4UWSB 3IE0A 4AXHA 3G1PA 5EV6A 2DKFA 3PY6A 4AWZA 4UA4A 5LS3A 1A7TA 2HB9A 3X2ZA 3S0ZA 3LVZA 2FU7A 2P18A 3ZNBA 2NYPA 2QINA 4O98A 1M2XA 2XR1A 2QEDA 4HL2A 5KIKA 1ZKPA 5EVBA 4UWRB 2OHIA 4D1UA 2P4ZA 4KEQA 3FAIA 3ZWFA 5A23A 4UWPB 4J5HA 2Y8BA 4ZO2A 5AIJA 3MD7A 3TP9A 3IE1A 3H3EA 3I13A 1Y44A 4EXSA 2OHHA 2P1EA 2VW8A 2M5CA 5HH6A 1WW1A 2NZEA 2Q0IA 3ADRA 3A4YA 3IEKA 3RKJA 5ACUA 2WYLA 5EVKA 4H0DA 5DPXA 4C09A 2FU6A 4Z67A 1JT1A 3R2UA 1QH5A 4D02A 2QJSA 5ACRA 5LCAA 4GCWA 2ZO4A 4BP0A 2BG7A 4YSKA 2BFZA 2FM6A 5AJLA 3AF6A 3QH8A 5K4KA 5EH9A 1DXKA 3SBLA 3SRXA 5B1UA 1YCGA 1MQOA 3IE2A 2YNUA 5FQBA 3SD9A 1SMLA 3Q6VA 1P9EA 4DIKA 2GKLA 5HISA 4ZEJA 4FR7A 2WHGA 1HLKA 1JJTA 2Y87A 3IDZA 4EY2A 4JO0A 5EW0A 2CBNA 4D1TA 5IQKA 1X8HA 3BK1A 4U4LA 4Z60A 4TZBA 5ACQA 3T3OA 2YHEA 5ACTA 2UYXA 3T9MA 3RPCA 4NQ4A 4Z6XA 2WYMA 5LM6A 2YNTB 2DOOA 2BFKA 3BC2A 5KILA 2CG3A 3AJ3A 4AD9A 4RL2A 5ACXA 2ZWRA 3SPUA 4BZ3A 2AZ4A 4UAMA 4CHLA 2BG6A 3IOFA 4FEKA 4AV7A 5B15A 4KEPA 1VJNA 4RL0A 5ACWA 5B3RA 2E7YA 2GCUA 1KR3A 4V0HA 1YCFA 4NQ5A 2I7VA 4NURA 4Z7RA 3SW3A 2P97A 4NQ6A 4YSLA 2YZ3A 4XWWA 5HIPA 5EHTA 2M5DA 4C1CA 3KL7A 5HIQA 2YNTA 4Z5YA 1VGNA 3ESHA 2CFUA 2WRSA 4C1EA 2BC2A 5HIOA 4HL1A 4F6ZA 5EV8A 4Z5ZA 4C1GA 2YNVA 1E5DA 1BC2A 2Q9UA 3F9OA 3KNRA 4WD6A 5A87A 5A5ZA 4EYLA 4TZFA 4ZNBA 1X8IA 2Q42A 3RKKA 3AF5A 4C1HA 5AHOA 1XM8A 1K07A 3DHBA 3IEMA 3X2XA 3I14A 3T3NA 4AWYB 2CG2A 2YNWA 4TYFA 2ZZIA 4P62A 1KO3A 3KNSA 4AX1B 3DHAA 4B87A 2FU8A 2NXAA 3BK2A 5K4MA 1BVTA 4EYBA 5AYAA 5LLDA 4EFZA 4PVOA 4PDXA 2WYMC 4FSBA 2Q0JA 2FHXA 2QDSA 1DD6A 5ACSA 5A0TA 4D1VA 3X2YA 1BMCA 3SFPA 3IELA 2YCBA 3DHCA 3FCZA 1A8TA 4XWTA 2FHXB 5LCFA 2XF4A 3I15A 5FQCA 4D1WA 2FU9A 4LE6A 1ZNBA 4GYUA 5LCHA 3P2UA 4XUKA 2BG2A 2Y8AA 3VPEA 1DDKA 4EYFA 5K4NA 2BFLA 2BFZB 4C1DA 3BV6A 5EVDA 2R2DA 4YSBA 1WRAA 2BG8A 1JJEA 3I0VA 5LMCA 3PY5A 3I11A 1QH3A 4GYQA 1WUOA 3IOGA 3ZR9A 2BG8B 2BTNA 5A0VA 4J5FA 3VQZA 2FK6A 2BIBA 2NZFA 4TYTA 5AXOA 4DILA 4TZ9A 4RM5A 4AX0B 5HH4A 2GMNA 5ACVA 1L9YA 2BGAA 1X8GA 4EXYA 3ZQ4A 2I7XA 2QDTA 4UBQA 4TZEA 4RBSA 2BMIA 4PVTA 3DH8A 1VMEA 1XTOA 4HKYA 3WXCA 2BR6A 5LE1A 4F6HA 2H6AA 5LSCA 1YCHA 3PG4A 2AIOA 5FQAA 5K0WA 3L6NA
chains in the Genus database with same CATH topology
4NQ2A 4ZO3A 4C1FA 1KO2A 5ACPA 1WUPA 5AXRA 3JXPA 2ZNBA 3X30A 2YNVB 1ZTCA 2GFKA 5AEBA 4UWOB 2GFJA 4RAWA 4RAMA 2OHJA 5EWAA 2A7MA 5HH5A 5AHRA 2I7TA 4UWSB 3IE0A 3G1PA 5EV6A 2DKFA 3PY6A 4AWZA 4UA4A 5LS3A 1A7TA 2HB9A 3X2ZA 3S0ZA 3LVZA 2FU7A 2P18A 3ZNBA 2NYPA 2QINA 4O98A 1M2XA 2XR1A 2QEDA 4HL2A 5KIKA 1ZKPA 5EVBA 4UWRB 2OHIA 4D1UA 2P4ZA 4KEQA 3FAIA 3ZWFA 4UWPB 4J5HA 2Y8BA 4ZO2A 3MD7A 3TP9A 3IE1A 3H3EA 3I13A 1Y44A 4EXSA 2OHHA 2P1EA 2VW8A 2M5CA 5HH6A 1WW1A 2NZEA 2Q0IA 3ADRA 3A4YA 3IEKA 3RKJA 5ACUA 2WYLA 5EVKA 4H0DA 5DPXA 4C09A 2FU6A 4Z67A 1JT1A 3R2UA 1QH5A 4D02A 2QJSA 5ACRA 5LCAA 4GCWA 2ZO4A 4BP0A 2BG7A 4YSKA 2BFZA 2FM6A 3AF6A 3QH8A 5K4KA 5EH9A 1DXKA 3SBLA 3SRXA 5B1UA 1YCGA 1MQOA 3IE2A 2YNUA 5FQBA 3SD9A 1SMLA 3Q6VA 1P9EA 4DIKA 2GKLA 5HISA 4ZEJA 4FR7A 2WHGA 1HLKA 1JJTA 2Y87A 3IDZA 4EY2A 4JO0A 5EW0A 2CBNA 4D1TA 5IQKA 1X8HA 3BK1A 4U4LA 4Z60A 4TZBA 5ACQA 3T3OA 5ACTA 2UYXA 3T9MA 3RPCA 4NQ4A 4Z6XA 2WYMA 5LM6A 2YNTB 2DOOA 2BFKA 3BC2A 5KILA 3AJ3A 4AD9A 4RL2A 5ACXA 2ZWRA 3SPUA 4BZ3A 2AZ4A 4UAMA 4CHLA 2BG6A 3IOFA 4FEKA 5B15A 4KEPA 1VJNA 4RL0A 5ACWA 5B3RA 2E7YA 2GCUA 1KR3A 4V0HA 1YCFA 4NQ5A 2I7VA 4Z7RA 3SW3A 2P97A 4NQ6A 4YSLA 2YZ3A 4XWWA 5HIPA 5EHTA 2M5DA 4C1CA 3KL7A 5HIQA 2YNTA 4Z5YA 1VGNA 3ESHA 2WRSA 4C1EA 2BC2A 5HIOA 4HL1A 4F6ZA 5EV8A 4Z5ZA 4C1GA 2YNVA 1E5DA 1BC2A 2Q9UA 3F9OA 3KNRA 4WD6A 5A87A 5A5ZA 4EYLA 4TZFA 4ZNBA 1X8IA 2Q42A 3RKKA 3AF5A 4C1HA 5AHOA 1XM8A 1K07A 3DHBA 3IEMA 3X2XA 3I14A 3T3NA 4AWYB 2YNWA 4TYFA 2ZZIA 4P62A 1KO3A 3KNSA 4AX1B 3DHAA 4B87A 2FU8A 2NXAA 3BK2A 5K4MA 1BVTA 4EYBA 5AYAA 5LLDA 4EFZA 4PVOA 2WYMC 4FSBA 2Q0JA 2FHXA 2QDSA 1DD6A 5ACSA 5A0TA 4D1VA 3X2YA 1BMCA 3SFPA 3IELA 2YCBA 3DHCA 3FCZA 1A8TA 4XWTA 2FHXB 5LCFA 2XF4A 3I15A 5FQCA 4D1WA 2FU9A 4LE6A 1ZNBA 4GYUA 5LCHA 3P2UA 4XUKA 2BG2A 2Y8AA 3VPEA 1DDKA 4EYFA 5K4NA 2BFLA 2BFZB 4C1DA 3BV6A 5EVDA 2R2DA 4YSBA 1WRAA 2BG8A 1JJEA 3I0VA 5LMCA 3PY5A 3I11A 1QH3A 4GYQA 1WUOA 3IOGA 3ZR9A 2BG8B 2BTNA 5A0VA 4J5FA 3VQZA 2FK6A 2BIBA 2NZFA 4TYTA 5AXOA 4DILA 4TZ9A 4RM5A 4AX0B 5HH4A 2GMNA 5ACVA 1L9YA 2BGAA 1X8GA 4EXYA 3ZQ4A 2I7XA 2QDTA 4UBQA 4TZEA 4RBSA 2BMIA 4PVTA 3DH8A 1VMEA 1XTOA 4HKYA 3WXCA 2BR6A 5LE1A 4F6HA 2H6AA 5LSCA 1YCHA 3PG4A 2AIOA 5FQAA 5K0WA 3L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ2 A;  4ZO3 A;  4C1F A;  1KO2 A;  5ACP A;  1WUP A;  5AXR A;  3JXP A;  2ZNB A;  3X30 A;  2YNV B;  1ZTC A;  2GFK A;  5AEB A;  4UWO B;  2GFJ A;  4RAW A;  4RAM A;  2OHJ A;  5EWA A;  2A7M A;  5HH5 A;  5AHR A;  2I7T A;  4UWS B;  3IE0 A;  3G1P A;  5EV6 A;  2DKF A;  3PY6 A;  4AWZ A;  4UA4 A;  5LS3 A;  1A7T A;  2HB9 A;  3X2Z A;  3S0Z A;  3LVZ A;  2FU7 A;  2P18 A;  3ZNB A;  2NYP A;  2QIN A;  4O98 A;  1M2X A;  2XR1 A;  2QED A;  4HL2 A;  5KIK A;  1ZKP A;  5EVB A;  4UWR B;  2OHI A;  4D1U A;  2P4Z A;  4KEQ A;  3FAI A;  3ZWF A;  4UWP B;  4J5H A;  2Y8B A;  4ZO2 A;  3MD7 A;  3TP9 A;  3IE1 A;  3H3E A;  3I13 A;  1Y44 A;  4EXS A;  2OHH A;  2P1E A;  2VW8 A;  2M5C A;  5HH6 A;  1WW1 A;  2NZE A;  2Q0I A;  3ADR A;  3A4Y A;  3IEK A;  3RKJ A;  5ACU A;  2WYL A;  5EVK A;  4H0D A;  5DPX A;  4C09 A;  2FU6 A;  4Z67 A;  1JT1 A;  3R2U A;  1QH5 A;  4D02 A;  2QJS A;  5ACR A;  5LCA A;  4GCW A;  2ZO4 A;  4BP0 A;  2BG7 A;  4YSK A;  2BFZ A;  2FM6 A;  3AF6 A;  3QH8 A;  5K4K A;  5EH9 A;  1DXK A;  3SBL A;  3SRX A;  5B1U A;  1YCG A;  1MQO A;  3IE2 A;  2YNU A;  5FQB A;  3SD9 A;  1SML A;  3Q6V A;  1P9E A;  4DIK A;  2GKL A;  5HIS A;  4ZEJ A;  4FR7 A;  2WHG A;  1HLK A;  1JJT A;  2Y87 A;  3IDZ A;  4EY2 A;  4JO0 A;  5EW0 A;  2CBN A;  4D1T A;  5IQK A;  1X8H A;  3BK1 A;  4U4L A;  4Z60 A;  4TZB A;  5ACQ A;  3T3O A;  5ACT A;  2UYX A;  3T9M A;  3RPC A;  4NQ4 A;  4Z6X A;  2WYM A;  5LM6 A;  2YNT B;  2DOO A;  2BFK A;  3BC2 A;  5KIL A;  3AJ3 A;  4AD9 A;  4RL2 A;  5ACX A;  2ZWR A;  3SPU A;  4BZ3 A;  2AZ4 A;  4UAM A;  4CHL A;  2BG6 A;  3IOF A;  4FEK A;  5B15 A;  4KEP A;  1VJN A;  4RL0 A;  5ACW A;  5B3R A;  2E7Y A;  2GCU A;  1KR3 A;  4V0H A;  1YCF A;  4NQ5 A;  2I7V A;  4Z7R A;  3SW3 A;  2P97 A;  4NQ6 A;  4YSL A;  2YZ3 A;  4XWW A;  5HIP A;  5EHT A;  2M5D A;  4C1C A;  3KL7 A;  5HIQ A;  2YNT A;  4Z5Y A;  1VGN A;  3ESH A;  2WRS A;  4C1E A;  2BC2 A;  5HIO A;  4HL1 A;  4F6Z A;  5EV8 A;  4Z5Z A;  4C1G A;  2YNV A;  1E5D A;  1BC2 A;  2Q9U A;  3F9O A;  3KNR A;  4WD6 A;  5A87 A;  5A5Z A;  4EYL A;  4TZF A;  4ZNB A;  1X8I A;  2Q42 A;  3RKK A;  3AF5 A;  4C1H A;  5AHO A;  1XM8 A;  1K07 A;  3DHB A;  3IEM A;  3X2X A;  3I14 A;  3T3N A;  4AWY B;  2YNW A;  4TYF A;  2ZZI A;  4P62 A;  1KO3 A;  3KNS A;  4AX1 B;  3DHA A;  4B87 A;  2FU8 A;  2NXA A;  3BK2 A;  5K4M A;  1BVT A;  4EYB A;  5AYA A;  5LLD A;  4EFZ A;  4PVO A;  2WYM C;  4FSB A;  2Q0J A;  2FHX A;  2QDS A;  1DD6 A;  5ACS A;  5A0T A;  4D1V A;  3X2Y A;  1BMC A;  3SFP A;  3IEL A;  2YCB A;  3DHC A;  3FCZ A;  1A8T A;  4XWT A;  2FHX B;  5LCF A;  2XF4 A;  3I15 A;  5FQC A;  4D1W A;  2FU9 A;  4LE6 A;  1ZNB A;  4GYU A;  5LCH A;  3P2U A;  4XUK A;  2BG2 A;  2Y8A A;  3VPE A;  1DDK A;  4EYF A;  5K4N A;  2BFL A;  2BFZ B;  4C1D A;  3BV6 A;  5EVD A;  2R2D A;  4YSB A;  1WRA A;  2BG8 A;  1JJE A;  3I0V A;  5LMC A;  3PY5 A;  3I11 A;  1QH3 A;  4GYQ A;  1WUO A;  3IOG A;  3ZR9 A;  2BG8 B;  2BTN A;  5A0V A;  4J5F A;  3VQZ A;  2FK6 A;  2BIB A;  2NZF A;  4TYT A;  5AXO A;  4DIL A;  4TZ9 A;  4RM5 A;  4AX0 B;  5HH4 A;  2GMN A;  5ACV A;  1L9Y A;  2BGA A;  1X8G A;  4EXY A;  3ZQ4 A;  2I7X A;  2QDT A;  4UBQ A;  4TZE A;  4RBS A;  2BMI A;  4PVT A;  3DH8 A;  1VME A;  1XTO A;  4HKY A;  3WXC A;  2BR6 A;  5LE1 A;  4F6H A;  2H6A A;  5LSC A;  1YCH A;  3PG4 A;  2AIO A;  5FQA A;  5K0W A;  3L6N A; 
#chains in the Genus database with same CATH topology
 4NQ2 A;  4ZO3 A;  4C1F A;  1KO2 A;  5ACP A;  1WUP A;  5AXR A;  3JXP A;  2CFZ A;  2ZNB A;  3X30 A;  2YNV B;  1ZTC A;  2GFK A;  5AEB A;  4UWO B;  2GFJ A;  4RAW A;  4RAM A;  2OHJ A;  5EWA A;  2A7M A;  5HH5 A;  5AHR A;  2I7T A;  4UWS B;  3IE0 A;  4AXH A;  3G1P A;  5EV6 A;  2DKF A;  3PY6 A;  4AWZ A;  4UA4 A;  5LS3 A;  1A7T A;  2HB9 A;  3X2Z A;  3S0Z A;  3LVZ A;  2FU7 A;  2P18 A;  3ZNB A;  2NYP A;  2QIN A;  4O98 A;  1M2X A;  2XR1 A;  2QED A;  4HL2 A;  5KIK A;  1ZKP A;  5EVB A;  4UWR B;  2OHI A;  4D1U A;  2P4Z A;  4KEQ A;  3FAI A;  3ZWF A;  5A23 A;  4UWP B;  4J5H A;  2Y8B A;  4ZO2 A;  5AIJ A;  3MD7 A;  3TP9 A;  3IE1 A;  3H3E A;  3I13 A;  1Y44 A;  4EXS A;  2OHH A;  2P1E A;  2VW8 A;  2M5C A;  5HH6 A;  1WW1 A;  2NZE A;  2Q0I A;  3ADR A;  3A4Y A;  3IEK A;  3RKJ A;  5ACU A;  2WYL A;  5EVK A;  4H0D A;  5DPX A;  4C09 A;  2FU6 A;  4Z67 A;  1JT1 A;  3R2U A;  1QH5 A;  4D02 A;  2QJS A;  5ACR A;  5LCA A;  4GCW A;  2ZO4 A;  4BP0 A;  2BG7 A;  4YSK A;  2BFZ A;  2FM6 A;  5AJL A;  3AF6 A;  3QH8 A;  5K4K A;  5EH9 A;  1DXK A;  3SBL A;  3SRX A;  5B1U A;  1YCG A;  1MQO A;  3IE2 A;  2YNU A;  5FQB A;  3SD9 A;  1SML A;  3Q6V A;  1P9E A;  4DIK A;  2GKL A;  5HIS A;  4ZEJ A;  4FR7 A;  2WHG A;  1HLK A;  1JJT A;  2Y87 A;  3IDZ A;  4EY2 A;  4JO0 A;  5EW0 A;  2CBN A;  4D1T A;  5IQK A;  1X8H A;  3BK1 A;  4U4L A;  4Z60 A;  4TZB A;  5ACQ A;  3T3O A;  2YHE A;  5ACT A;  2UYX A;  3T9M A;  3RPC A;  4NQ4 A;  4Z6X A;  2WYM A;  5LM6 A;  2YNT B;  2DOO A;  2BFK A;  3BC2 A;  5KIL A;  2CG3 A;  3AJ3 A;  4AD9 A;  4RL2 A;  5ACX A;  2ZWR A;  3SPU A;  4BZ3 A;  2AZ4 A;  4UAM A;  4CHL A;  2BG6 A;  3IOF A;  4FEK A;  4AV7 A;  5B15 A;  4KEP A;  1VJN A;  4RL0 A;  5ACW A;  5B3R A;  2E7Y A;  2GCU A;  1KR3 A;  4V0H A;  1YCF A;  4NQ5 A;  2I7V A;  4NUR A;  4Z7R A;  3SW3 A;  2P97 A;  4NQ6 A;  4YSL A;  2YZ3 A;  4XWW A;  5HIP A;  5EHT A;  2M5D A;  4C1C A;  3KL7 A;  5HIQ A;  2YNT A;  4Z5Y A;  1VGN A;  3ESH A;  2CFU A;  2WRS A;  4C1E A;  2BC2 A;  5HIO A;  4HL1 A;  4F6Z A;  5EV8 A;  4Z5Z A;  4C1G A;  2YNV A;  1E5D A;  1BC2 A;  2Q9U A;  3F9O A;  3KNR A;  4WD6 A;  5A87 A;  5A5Z A;  4EYL A;  4TZF A;  4ZNB A;  1X8I A;  2Q42 A;  3RKK A;  3AF5 A;  4C1H A;  5AHO A;  1XM8 A;  1K07 A;  3DHB A;  3IEM A;  3X2X A;  3I14 A;  3T3N A;  4AWY B;  2CG2 A;  2YNW A;  4TYF A;  2ZZI A;  4P62 A;  1KO3 A;  3KNS A;  4AX1 B;  3DHA A;  4B87 A;  2FU8 A;  2NXA A;  3BK2 A;  5K4M A;  1BVT A;  4EYB A;  5AYA A;  5LLD A;  4EFZ A;  4PVO A;  4PDX A;  2WYM C;  4FSB A;  2Q0J A;  2FHX A;  2QDS A;  1DD6 A;  5ACS A;  5A0T A;  4D1V A;  3X2Y A;  1BMC A;  3SFP A;  3IEL A;  2YCB A;  3DHC A;  3FCZ A;  1A8T A;  4XWT A;  2FHX B;  5LCF A;  2XF4 A;  3I15 A;  5FQC A;  4D1W A;  2FU9 A;  4LE6 A;  1ZNB A;  4GYU A;  5LCH A;  3P2U A;  4XUK A;  2BG2 A;  2Y8A A;  3VPE A;  1DDK A;  4EYF A;  5K4N A;  2BFL A;  2BFZ B;  4C1D A;  3BV6 A;  5EVD A;  2R2D A;  4YSB A;  1WRA A;  2BG8 A;  1JJE A;  3I0V A;  5LMC A;  3PY5 A;  3I11 A;  1QH3 A;  4GYQ A;  1WUO A;  3IOG A;  3ZR9 A;  2BG8 B;  2BTN A;  5A0V A;  4J5F A;  3VQZ A;  2FK6 A;  2BIB A;  2NZF A;  4TYT A;  5AXO A;  4DIL A;  4TZ9 A;  4RM5 A;  4AX0 B;  5HH4 A;  2GMN A;  5ACV A;  1L9Y A;  2BGA A;  1X8G A;  4EXY A;  3ZQ4 A;  2I7X A;  2QDT A;  4UBQ A;  4TZE A;  4RBS A;  2BMI A;  4PVT A;  3DH8 A;  1VME A;  1XTO A;  4HKY A;  3WXC A;  2BR6 A;  5LE1 A;  4F6H A;  2H6A A;  5LSC A;  1YCH A;  3PG4 A;  2AIO A;  5FQA A;  5K0W A;  3L6N A; 
#chains in the Genus database with same CATH homology
 4NQ2 A;  4ZO3 A;  4C1F A;  1KO2 A;  5ACP A;  1WUP A;  5AXR A;  3JXP A;  2ZNB A;  3X30 A;  2YNV B;  1ZTC A;  2GFK A;  5AEB A;  4UWO B;  2GFJ A;  4RAW A;  4RAM A;  2OHJ A;  5EWA A;  2A7M A;  5HH5 A;  5AHR A;  2I7T A;  4UWS B;  3IE0 A;  3G1P A;  5EV6 A;  2DKF A;  3PY6 A;  4AWZ A;  4UA4 A;  5LS3 A;  1A7T A;  2HB9 A;  3X2Z A;  3S0Z A;  3LVZ A;  2FU7 A;  2P18 A;  3ZNB A;  2NYP A;  2QIN A;  4O98 A;  1M2X A;  2XR1 A;  2QED A;  4HL2 A;  5KIK A;  1ZKP A;  5EVB A;  4UWR B;  2OHI A;  4D1U A;  2P4Z A;  4KEQ A;  3FAI A;  3ZWF A;  4UWP B;  4J5H A;  2Y8B A;  4ZO2 A;  3MD7 A;  3TP9 A;  3IE1 A;  3H3E A;  3I13 A;  1Y44 A;  4EXS A;  2OHH A;  2P1E A;  2VW8 A;  2M5C A;  5HH6 A;  1WW1 A;  2NZE A;  2Q0I A;  3ADR A;  3A4Y A;  3IEK A;  3RKJ A;  5ACU A;  2WYL A;  5EVK A;  4H0D A;  5DPX A;  4C09 A;  2FU6 A;  4Z67 A;  1JT1 A;  3R2U A;  1QH5 A;  4D02 A;  2QJS A;  5ACR A;  5LCA A;  4GCW A;  2ZO4 A;  4BP0 A;  2BG7 A;  4YSK A;  2BFZ A;  2FM6 A;  3AF6 A;  3QH8 A;  5K4K A;  5EH9 A;  1DXK A;  3SBL A;  3SRX A;  5B1U A;  1YCG A;  1MQO A;  3IE2 A;  2YNU A;  5FQB A;  3SD9 A;  1SML A;  3Q6V A;  1P9E A;  4DIK A;  2GKL A;  5HIS A;  4ZEJ A;  4FR7 A;  2WHG A;  1HLK A;  1JJT A;  2Y87 A;  3IDZ A;  4EY2 A;  4JO0 A;  5EW0 A;  2CBN A;  4D1T A;  5IQK A;  1X8H A;  3BK1 A;  4U4L A;  4Z60 A;  4TZB A;  5ACQ A;  3T3O A;  5ACT A;  2UYX A;  3T9M A;  3RPC A;  4NQ4 A;  4Z6X A;  2WYM A;  5LM6 A;  2YNT B;  2DOO A;  2BFK A;  3BC2 A;  5KIL A;  3AJ3 A;  4AD9 A;  4RL2 A;  5ACX A;  2ZWR A;  3SPU A;  4BZ3 A;  2AZ4 A;  4UAM A;  4CHL A;  2BG6 A;  3IOF A;  4FEK A;  5B15 A;  4KEP A;  1VJN A;  4RL0 A;  5ACW A;  5B3R A;  2E7Y A;  2GCU A;  1KR3 A;  4V0H A;  1YCF A;  4NQ5 A;  2I7V A;  4Z7R A;  3SW3 A;  2P97 A;  4NQ6 A;  4YSL A;  2YZ3 A;  4XWW A;  5HIP A;  5EHT A;  2M5D A;  4C1C A;  3KL7 A;  5HIQ A;  2YNT A;  4Z5Y A;  1VGN A;  3ESH A;  2WRS A;  4C1E A;  2BC2 A;  5HIO A;  4HL1 A;  4F6Z A;  5EV8 A;  4Z5Z A;  4C1G A;  2YNV A;  1E5D A;  1BC2 A;  2Q9U A;  3F9O A;  3KNR A;  4WD6 A;  5A87 A;  5A5Z A;  4EYL A;  4TZF A;  4ZNB A;  1X8I A;  2Q42 A;  3RKK A;  3AF5 A;  4C1H A;  5AHO A;  1XM8 A;  1K07 A;  3DHB A;  3IEM A;  3X2X A;  3I14 A;  3T3N A;  4AWY B;  2YNW A;  4TYF A;  2ZZI A;  4P62 A;  1KO3 A;  3KNS A;  4AX1 B;  3DHA A;  4B87 A;  2FU8 A;  2NXA A;  3BK2 A;  5K4M A;  1BVT A;  4EYB A;  5AYA A;  5LLD A;  4EFZ A;  4PVO A;  2WYM C;  4FSB A;  2Q0J A;  2FHX A;  2QDS A;  1DD6 A;  5ACS A;  5A0T A;  4D1V A;  3X2Y A;  1BMC A;  3SFP A;  3IEL A;  2YCB A;  3DHC A;  3FCZ A;  1A8T A;  4XWT A;  2FHX B;  5LCF A;  2XF4 A;  3I15 A;  5FQC A;  4D1W A;  2FU9 A;  4LE6 A;  1ZNB A;  4GYU A;  5LCH A;  3P2U A;  4XUK A;  2BG2 A;  2Y8A A;  3VPE A;  1DDK A;  4EYF A;  5K4N A;  2BFL A;  2BFZ B;  4C1D A;  3BV6 A;  5EVD A;  2R2D A;  4YSB A;  1WRA A;  2BG8 A;  1JJE A;  3I0V A;  5LMC A;  3PY5 A;  3I11 A;  1QH3 A;  4GYQ A;  1WUO A;  3IOG A;  3ZR9 A;  2BG8 B;  2BTN A;  5A0V A;  4J5F A;  3VQZ A;  2FK6 A;  2BIB A;  2NZF A;  4TYT A;  5AXO A;  4DIL A;  4TZ9 A;  4RM5 A;  4AX0 B;  5HH4 A;  2GMN A;  5ACV A;  1L9Y A;  2BGA A;  1X8G A;  4EXY A;  3ZQ4 A;  2I7X A;  2QDT A;  4UBQ A;  4TZE A;  4RBS A;  2BMI A;  4PVT A;  3DH8 A;  1VME A;  1XTO A;  4HKY A;  3WXC A;  2BR6 A;  5LE1 A;  4F6H A;  2H6A A;  5LSC A;  1YCH A;  3PG4 A;  2AIO A;  5FQA A;  5K0W A;  3L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...