3SD9A

Crystal structure of serratia fonticola sfh-i: source of the nucleophile in the catalytic mechanism of mono-zinc metallo-beta-lactamases
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
230
structure length
230
Chain Sequence
KNLTLTHFKGPLYIVEDKEYVQENSMVYIGTDGITIIGATWTPETAETLYKEIRKVSPLPINEVINTNYHTDRAGGNAYWKTLGAKIVATQMTYDLQKSQWGSIVNFTRQGNNKYPNLEKSLPDTVFPGDFNLQNGSIRAMYLGEAHTKDGIFVYFPAERVLYGNCILKENLGNMSFANRTEYPKTLEKLKGLIEQGELKVDSIIAGHDTPIHDVGLIDHYLTLLEKAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Serratia fonticola Sfh-I: Activation of the Nucleophile in Mono-Zinc Metallo-beta-Lactamases
rcsb
source organism Serratia fonticola
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 80
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3sd9A00
1YCGA 1P9EA 1A7TA 5LCHA 4HL2A 3I11A 1HLKA 4WD6A 4YSBA 2Q0JA 5LSCA 3VQZA 2M5DA 1A8TA 5EH9A 5A0VA 4Z5YA 3IE0A 2FHXB 4UWPB 2CBNA 4GYQA 4GCWA 5FQCA 2GKLA 3SRXA 2FU9A 2M5CA 2QEDA 1DDKA 4Z7RA 5ACVA 5AEBA 4EYLA 4EYBA 4ZNBA 2BC2A 4EY2A 2I7TA 5LCFA 4F6HA 1KR3A 4TZBA 5B15A 3AF5A 4D1VA 3MD7A 4AWZA 2FU6A 3RKJA 3AJ3A 3R2UA 3IEKA 4U4LA 4AWYB 4XWTA 1DXKA 2YNTA 1VJNA 5LS3A 4JO0A 3TP9A 2BG8A 2FM6A 4V0HA 5FQBA 2A7MA 4C1DA 4C1FA 3AF6A 5EV6A 2ZZIA 3BK1A 2ZNBA 4KEQA 2GFKA 1BVTA 5IQKA 1SMLA 4NQ6A 5AHOA 3DHCA 3IE1A 4O98A 4GYUA 2Y8AA 4Z67A 3X2ZA 2Q9UA 3KNSA 4RBSA 1QH3A 1YCFA 1VGNA 1K07A 3BC2A 3PG4A 5EHTA 2XF4A 4DIKA 4UAMA 4RM5A 3T3OA 5B1UA 3X2YA 4TZFA 2FU7A 3QH8A 3IOGA 4TZEA 3SPUA 4TYFA 1WUOA 5EW0A 5HISA 2BG6A 4FSBA 2P1EA 5AYAA 4FEKA 4AD9A 1Y44A 4RL2A 2AIOA 4TYTA 3X2XA 4C1HA 1WRAA 4C09A 4ZO3A 5HIOA 1X8IA 5LM6A 5HIPA 2BFLA 5AXRA 2QDTA 5EV8A 2DKFA 3I0VA 1YCHA 4C1EA 2BFZB 4HL1A 4UWSB 5ACPA 1QH5A 4FR7A 2YNWA 5HIQA 3P2UA 2BGAA 4UWOB 5B3RA 2VW8A 3IDZA 4H0DA 2OHHA 2BFKA 4CHLA 1KO3A 2UYXA 2FU8A 4EYFA 1WUPA 2GMNA 5ACRA 2WYLA 3L6NA 5KILA 4P62A 2R2DA 5ACTA 1BMCA 4BZ3A 4LE6A 3SD9A 5ACUA 2GFJA 1ZTCA 2WYMA 3PY6A 3KNRA 5EWAA 4AX1B 5DPXA 1VMEA 2NZFA 4HKYA 3FAIA 4TZ9A 3PY5A 2WRSA 4AX0B 1WW1A 2YCBA 2BFZA 2BIBA 2QJSA 4NQ2A 4D1UA 5ACWA 2I7XA 4Z60A 2BG7A 4ZO2A 1BC2A 5ACQA 3H3EA 2YNVB 3ZNBA 4EXYA 3F9OA 1KO2A 3IOFA 5K4NA 3JXPA 4RAWA 4B87A 5LLDA 3T3NA 3Q6VA 3BV6A 5LCAA 3X30A 3BK2A 3DH8A 4J5HA 2Y8BA 1DD6A 5HH6A 4YSLA 1ZKPA 4Z6XA 3ZQ4A 4RAMA 1ZNBA 5ACXA 2QINA 3SFPA 4J5FA 4D1TA 2XR1A 5AHRA 1M2XA 1X8HA 2BTNA 3IE2A 3SBLA 2OHIA 3ADRA 4YSKA 4RL0A 5LMCA 2P97A 4D1WA 2YNVA 3ZR9A 5KIKA 3RPCA 2YZ3A 4C1GA 3G1PA 2Q0IA 5AXOA 4ZEJA 5HH5A 3RKKA 3T9MA 3KL7A 4PVOA 4PVTA 3DHAA 4EFZA 1XM8A 2E7YA 4BP0A 3I15A 4F6ZA 2QDSA 2BG8B 1JT1A 3S0ZA 5A0TA 2H6AA 3IEMA 3ZWFA 4XUKA 4C1CA 2OHJA 5EVKA 4D02A 1E5DA 1X8GA 2GCUA 3SW3A 2BG2A 4KEPA 5HH4A 2ZWRA 1JJEA 2FK6A 5K0WA 2HB9A 4DILA 3WXCA 1MQOA 2BR6A 2FHXA 5LE1A 4Z5ZA 1JJTA 5EVDA 5FQAA 2P4ZA 4UBQA 5ACSA 2AZ4A 2YNTB 2BMIA 3FCZA 4XWWA 2NYPA 3ESHA 3LVZA 2YNUA 2NZEA 4EXSA 5A5ZA 4NQ4A 2ZO4A 4UWRB 5EVBA 5K4MA 5K4KA 3VPEA 3DHBA 4UA4A 3I14A 2Y87A 3IELA 2P18A 1XTOA 2WYMC 3I13A 2DOOA 2Q42A 5A87A 1L9YA 2I7VA 2WHGA 2NXAA 4NQ5A 3A4YA
chains in the Genus database with same CATH superfamily
1YCGA 1P9EA 1A7TA 5LCHA 4HL2A 3I11A 1HLKA 4WD6A 4YSBA 2Q0JA 5LSCA 3VQZA 4AXHA 2M5DA 1A8TA 5EH9A 5A0VA 4Z5YA 3IE0A 2FHXB 4UWPB 2CBNA 4GYQA 4GCWA 5FQCA 2GKLA 3SRXA 2FU9A 2M5CA 2QEDA 1DDKA 4Z7RA 5ACVA 5AEBA 2YHEA 4PDXA 4EYLA 4EYBA 4ZNBA 2BC2A 4EY2A 2I7TA 5LCFA 4F6HA 1KR3A 4TZBA 5AJLA 5B15A 3AF5A 4NURA 4D1VA 3MD7A 4AWZA 2FU6A 3RKJA 2CG2A 3AJ3A 3R2UA 3IEKA 4U4LA 4AWYB 4XWTA 1DXKA 2YNTA 1VJNA 5LS3A 4JO0A 3TP9A 2BG8A 2FM6A 4V0HA 5FQBA 2A7MA 4C1DA 4C1FA 3AF6A 5EV6A 2ZZIA 3BK1A 2CG3A 2ZNBA 4KEQA 2GFKA 1BVTA 5IQKA 1SMLA 4NQ6A 5AHOA 3DHCA 3IE1A 4O98A 4GYUA 2Y8AA 4Z67A 3X2ZA 2Q9UA 3KNSA 4RBSA 1QH3A 1YCFA 1VGNA 1K07A 3BC2A 3PG4A 5EHTA 2XF4A 4DIKA 4UAMA 4RM5A 3T3OA 5B1UA 3X2YA 4TZFA 2FU7A 3QH8A 3IOGA 4TZEA 3SPUA 4TYFA 1WUOA 5EW0A 5HISA 2BG6A 4FSBA 2P1EA 5AYAA 4FEKA 4AD9A 1Y44A 4RL2A 2AIOA 4TYTA 3X2XA 4C1HA 1WRAA 4C09A 4ZO3A 5HIOA 1X8IA 5LM6A 5HIPA 2BFLA 5AXRA 2QDTA 5EV8A 2DKFA 3I0VA 1YCHA 4C1EA 2BFZB 4HL1A 4UWSB 5ACPA 1QH5A 4FR7A 2YNWA 5HIQA 3P2UA 2BGAA 4UWOB 5B3RA 2VW8A 3IDZA 4H0DA 2OHHA 2BFKA 4CHLA 1KO3A 2UYXA 2FU8A 4EYFA 1WUPA 2GMNA 5A23A 5ACRA 2WYLA 3L6NA 5KILA 4P62A 2R2DA 5ACTA 1BMCA 4BZ3A 4LE6A 3SD9A 5ACUA 2GFJA 1ZTCA 2WYMA 3PY6A 3KNRA 5EWAA 4AX1B 5DPXA 1VMEA 2NZFA 4HKYA 3FAIA 4TZ9A 3PY5A 2WRSA 4AX0B 1WW1A 2YCBA 2BFZA 2BIBA 2QJSA 4NQ2A 4D1UA 5ACWA 2I7XA 4Z60A 2BG7A 4ZO2A 1BC2A 5ACQA 3H3EA 2YNVB 3ZNBA 4EXYA 3F9OA 1KO2A 3IOFA 5K4NA 3JXPA 4RAWA 4B87A 5LLDA 3T3NA 3Q6VA 3BV6A 5LCAA 3X30A 3BK2A 3DH8A 4J5HA 2Y8BA 1DD6A 5HH6A 4YSLA 1ZKPA 4Z6XA 3ZQ4A 4RAMA 1ZNBA 5ACXA 5AIJA 2QINA 3SFPA 4J5FA 2CFZA 4D1TA 2XR1A 5AHRA 1M2XA 1X8HA 2BTNA 3IE2A 3SBLA 2OHIA 3ADRA 4YSKA 4RL0A 5LMCA 2P97A 4D1WA 2YNVA 3ZR9A 5KIKA 3RPCA 2YZ3A 4C1GA 3G1PA 2Q0IA 5AXOA 4ZEJA 5HH5A 3RKKA 3T9MA 3KL7A 4PVOA 4PVTA 3DHAA 4EFZA 1XM8A 2E7YA 4BP0A 3I15A 4F6ZA 2QDSA 2BG8B 1JT1A 3S0ZA 5A0TA 2H6AA 3IEMA 3ZWFA 4XUKA 4C1CA 2OHJA 5EVKA 4D02A 1E5DA 1X8GA 2GCUA 3SW3A 2BG2A 4KEPA 5HH4A 2ZWRA 1JJEA 2FK6A 5K0WA 2HB9A 4DILA 3WXCA 1MQOA 2BR6A 2FHXA 5LE1A 4Z5ZA 1JJTA 5EVDA 5FQAA 2P4ZA 4UBQA 5ACSA 2AZ4A 2YNTB 2BMIA 3FCZA 4XWWA 2NYPA 3ESHA 3LVZA 2YNUA 2NZEA 4EXSA 5A5ZA 4NQ4A 2ZO4A 4UWRB 5EVBA 5K4MA 5K4KA 3VPEA 3DHBA 4UA4A 3I14A 2CFUA 2Y87A 3IELA 2P18A 1XTOA 2WYMC 3I13A 2DOOA 2Q42A 5A87A 1L9YA 2I7VA 2WHGA 2NXAA 4NQ5A 4AV7A 3A4YA
chains in the Genus database with same CATH topology
1YCGA 1P9EA 1A7TA 5LCHA 4HL2A 3I11A 1HLKA 4WD6A 4YSBA 2Q0JA 5LSCA 3VQZA 2M5DA 1A8TA 5EH9A 5A0VA 4Z5YA 3IE0A 2FHXB 4UWPB 2CBNA 4GYQA 4GCWA 5FQCA 2GKLA 3SRXA 2FU9A 2M5CA 2QEDA 1DDKA 4Z7RA 5ACVA 5AEBA 4EYLA 4EYBA 4ZNBA 2BC2A 4EY2A 2I7TA 5LCFA 4F6HA 1KR3A 4TZBA 5B15A 3AF5A 4D1VA 3MD7A 4AWZA 2FU6A 3RKJA 3AJ3A 3R2UA 3IEKA 4U4LA 4AWYB 4XWTA 1DXKA 2YNTA 1VJNA 5LS3A 4JO0A 3TP9A 2BG8A 2FM6A 4V0HA 5FQBA 2A7MA 4C1DA 4C1FA 3AF6A 5EV6A 2ZZIA 3BK1A 2ZNBA 4KEQA 2GFKA 1BVTA 5IQKA 1SMLA 4NQ6A 5AHOA 3DHCA 3IE1A 4O98A 4GYUA 2Y8AA 4Z67A 3X2ZA 2Q9UA 3KNSA 4RBSA 1QH3A 1YCFA 1VGNA 1K07A 3BC2A 3PG4A 5EHTA 2XF4A 4DIKA 4UAMA 4RM5A 3T3OA 5B1UA 3X2YA 4TZFA 2FU7A 3QH8A 3IOGA 4TZEA 3SPUA 4TYFA 1WUOA 5EW0A 5HISA 2BG6A 4FSBA 2P1EA 5AYAA 4FEKA 4AD9A 1Y44A 4RL2A 2AIOA 4TYTA 3X2XA 4C1HA 1WRAA 4C09A 4ZO3A 5HIOA 1X8IA 5LM6A 5HIPA 2BFLA 5AXRA 2QDTA 5EV8A 2DKFA 3I0VA 1YCHA 4C1EA 2BFZB 4HL1A 4UWSB 5ACPA 1QH5A 4FR7A 2YNWA 5HIQA 3P2UA 2BGAA 4UWOB 5B3RA 2VW8A 3IDZA 4H0DA 2OHHA 2BFKA 4CHLA 1KO3A 2UYXA 2FU8A 4EYFA 1WUPA 2GMNA 5ACRA 2WYLA 3L6NA 5KILA 4P62A 2R2DA 5ACTA 1BMCA 4BZ3A 4LE6A 3SD9A 5ACUA 2GFJA 1ZTCA 2WYMA 3PY6A 3KNRA 5EWAA 4AX1B 5DPXA 1VMEA 2NZFA 4HKYA 3FAIA 4TZ9A 3PY5A 2WRSA 4AX0B 1WW1A 2YCBA 2BFZA 2BIBA 2QJSA 4NQ2A 4D1UA 5ACWA 2I7XA 4Z60A 2BG7A 4ZO2A 1BC2A 5ACQA 3H3EA 2YNVB 3ZNBA 4EXYA 3F9OA 1KO2A 3IOFA 5K4NA 3JXPA 4RAWA 4B87A 5LLDA 3T3NA 3Q6VA 3BV6A 5LCAA 3X30A 3BK2A 3DH8A 4J5HA 2Y8BA 1DD6A 5HH6A 4YSLA 1ZKPA 4Z6XA 3ZQ4A 4RAMA 1ZNBA 5ACXA 2QINA 3SFPA 4J5FA 4D1TA 2XR1A 5AHRA 1M2XA 1X8HA 2BTNA 3IE2A 3SBLA 2OHIA 3ADRA 4YSKA 4RL0A 5LMCA 2P97A 4D1WA 2YNVA 3ZR9A 5KIKA 3RPCA 2YZ3A 4C1GA 3G1PA 2Q0IA 5AXOA 4ZEJA 5HH5A 3RKKA 3T9MA 3KL7A 4PVOA 4PVTA 3DHAA 4EFZA 1XM8A 2E7YA 4BP0A 3I15A 4F6ZA 2QDSA 2BG8B 1JT1A 3S0ZA 5A0TA 2H6AA 3IEMA 3ZWFA 4XUKA 4C1CA 2OHJA 5EVKA 4D02A 1E5DA 1X8GA 2GCUA 3SW3A 2BG2A 4KEPA 5HH4A 2ZWRA 1JJEA 2FK6A 5K0WA 2HB9A 4DILA 3WXCA 1MQOA 2BR6A 2FHXA 5LE1A 4Z5ZA 1JJTA 5EVDA 5FQAA 2P4ZA 4UBQA 5ACSA 2AZ4A 2YNTB 2BMIA 3FCZA 4XWWA 2NYPA 3ESHA 3LVZA 2YNUA 2NZEA 4EXSA 5A5ZA 4NQ4A 2ZO4A 4UWRB 5EVBA 5K4MA 5K4KA 3VPEA 3DHBA 4UA4A 3I14A 2Y87A 3IELA 2P18A 1XTOA 2WYMC 3I13A 2DOOA 2Q42A 5A87A 1L9YA 2I7VA 2WHGA 2NXAA 4NQ5A 3A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCG A;  1P9E A;  1A7T A;  5LCH A;  4HL2 A;  3I11 A;  1HLK A;  4WD6 A;  4YSB A;  2Q0J A;  5LSC A;  3VQZ A;  2M5D A;  1A8T A;  5EH9 A;  5A0V A;  4Z5Y A;  3IE0 A;  2FHX B;  4UWP B;  2CBN A;  4GYQ A;  4GCW A;  5FQC A;  2GKL A;  3SRX A;  2FU9 A;  2M5C A;  2QED A;  1DDK A;  4Z7R A;  5ACV A;  5AEB A;  4EYL A;  4EYB A;  4ZNB A;  2BC2 A;  4EY2 A;  2I7T A;  5LCF A;  4F6H A;  1KR3 A;  4TZB A;  5B15 A;  3AF5 A;  4D1V A;  3MD7 A;  4AWZ A;  2FU6 A;  3RKJ A;  3AJ3 A;  3R2U A;  3IEK A;  4U4L A;  4AWY B;  4XWT A;  1DXK A;  2YNT A;  1VJN A;  5LS3 A;  4JO0 A;  3TP9 A;  2BG8 A;  2FM6 A;  4V0H A;  5FQB A;  2A7M A;  4C1D A;  4C1F A;  3AF6 A;  5EV6 A;  2ZZI A;  3BK1 A;  2ZNB A;  4KEQ A;  2GFK A;  1BVT A;  5IQK A;  1SML A;  4NQ6 A;  5AHO A;  3DHC A;  3IE1 A;  4O98 A;  4GYU A;  2Y8A A;  4Z67 A;  3X2Z A;  2Q9U A;  3KNS A;  4RBS A;  1QH3 A;  1YCF A;  1VGN A;  1K07 A;  3BC2 A;  3PG4 A;  5EHT A;  2XF4 A;  4DIK A;  4UAM A;  4RM5 A;  3T3O A;  5B1U A;  3X2Y A;  4TZF A;  2FU7 A;  3QH8 A;  3IOG A;  4TZE A;  3SPU A;  4TYF A;  1WUO A;  5EW0 A;  5HIS A;  2BG6 A;  4FSB A;  2P1E A;  5AYA A;  4FEK A;  4AD9 A;  1Y44 A;  4RL2 A;  2AIO A;  4TYT A;  3X2X A;  4C1H A;  1WRA A;  4C09 A;  4ZO3 A;  5HIO A;  1X8I A;  5LM6 A;  5HIP A;  2BFL A;  5AXR A;  2QDT A;  5EV8 A;  2DKF A;  3I0V A;  1YCH A;  4C1E A;  2BFZ B;  4HL1 A;  4UWS B;  5ACP A;  1QH5 A;  4FR7 A;  2YNW A;  5HIQ A;  3P2U A;  2BGA A;  4UWO B;  5B3R A;  2VW8 A;  3IDZ A;  4H0D A;  2OHH A;  2BFK A;  4CHL A;  1KO3 A;  2UYX A;  2FU8 A;  4EYF A;  1WUP A;  2GMN A;  5ACR A;  2WYL A;  3L6N A;  5KIL A;  4P62 A;  2R2D A;  5ACT A;  1BMC A;  4BZ3 A;  4LE6 A;  3SD9 A;  5ACU A;  2GFJ A;  1ZTC A;  2WYM A;  3PY6 A;  3KNR A;  5EWA A;  4AX1 B;  5DPX A;  1VME A;  2NZF A;  4HKY A;  3FAI A;  4TZ9 A;  3PY5 A;  2WRS A;  4AX0 B;  1WW1 A;  2YCB A;  2BFZ A;  2BIB A;  2QJS A;  4NQ2 A;  4D1U A;  5ACW A;  2I7X A;  4Z60 A;  2BG7 A;  4ZO2 A;  1BC2 A;  5ACQ A;  3H3E A;  2YNV B;  3ZNB A;  4EXY A;  3F9O A;  1KO2 A;  3IOF A;  5K4N A;  3JXP A;  4RAW A;  4B87 A;  5LLD A;  3T3N A;  3Q6V A;  3BV6 A;  5LCA A;  3X30 A;  3BK2 A;  3DH8 A;  4J5H A;  2Y8B A;  1DD6 A;  5HH6 A;  4YSL A;  1ZKP A;  4Z6X A;  3ZQ4 A;  4RAM A;  1ZNB A;  5ACX A;  2QIN A;  3SFP A;  4J5F A;  4D1T A;  2XR1 A;  5AHR A;  1M2X A;  1X8H A;  2BTN A;  3IE2 A;  3SBL A;  2OHI A;  3ADR A;  4YSK A;  4RL0 A;  5LMC A;  2P97 A;  4D1W A;  2YNV A;  3ZR9 A;  5KIK A;  3RPC A;  2YZ3 A;  4C1G A;  3G1P A;  2Q0I A;  5AXO A;  4ZEJ A;  5HH5 A;  3RKK A;  3T9M A;  3KL7 A;  4PVO A;  4PVT A;  3DHA A;  4EFZ A;  1XM8 A;  2E7Y A;  4BP0 A;  3I15 A;  4F6Z A;  2QDS A;  2BG8 B;  1JT1 A;  3S0Z A;  5A0T A;  2H6A A;  3IEM A;  3ZWF A;  4XUK A;  4C1C A;  2OHJ A;  5EVK A;  4D02 A;  1E5D A;  1X8G A;  2GCU A;  3SW3 A;  2BG2 A;  4KEP A;  5HH4 A;  2ZWR A;  1JJE A;  2FK6 A;  5K0W A;  2HB9 A;  4DIL A;  3WXC A;  1MQO A;  2BR6 A;  2FHX A;  5LE1 A;  4Z5Z A;  1JJT A;  5EVD A;  5FQA A;  2P4Z A;  4UBQ A;  5ACS A;  2AZ4 A;  2YNT B;  2BMI A;  3FCZ A;  4XWW A;  2NYP A;  3ESH A;  3LVZ A;  2YNU A;  2NZE A;  4EXS A;  5A5Z A;  4NQ4 A;  2ZO4 A;  4UWR B;  5EVB A;  5K4M A;  5K4K A;  3VPE A;  3DHB A;  4UA4 A;  3I14 A;  2Y87 A;  3IEL A;  2P18 A;  1XTO A;  2WYM C;  3I13 A;  2DOO A;  2Q42 A;  5A87 A;  1L9Y A;  2I7V A;  2WHG A;  2NXA A;  4NQ5 A;  3A4Y A; 
#chains in the Genus database with same CATH topology
 1YCG A;  1P9E A;  1A7T A;  5LCH A;  4HL2 A;  3I11 A;  1HLK A;  4WD6 A;  4YSB A;  2Q0J A;  5LSC A;  3VQZ A;  4AXH A;  2M5D A;  1A8T A;  5EH9 A;  5A0V A;  4Z5Y A;  3IE0 A;  2FHX B;  4UWP B;  2CBN A;  4GYQ A;  4GCW A;  5FQC A;  2GKL A;  3SRX A;  2FU9 A;  2M5C A;  2QED A;  1DDK A;  4Z7R A;  5ACV A;  5AEB A;  2YHE A;  4PDX A;  4EYL A;  4EYB A;  4ZNB A;  2BC2 A;  4EY2 A;  2I7T A;  5LCF A;  4F6H A;  1KR3 A;  4TZB A;  5AJL A;  5B15 A;  3AF5 A;  4NUR A;  4D1V A;  3MD7 A;  4AWZ A;  2FU6 A;  3RKJ A;  2CG2 A;  3AJ3 A;  3R2U A;  3IEK A;  4U4L A;  4AWY B;  4XWT A;  1DXK A;  2YNT A;  1VJN A;  5LS3 A;  4JO0 A;  3TP9 A;  2BG8 A;  2FM6 A;  4V0H A;  5FQB A;  2A7M A;  4C1D A;  4C1F A;  3AF6 A;  5EV6 A;  2ZZI A;  3BK1 A;  2CG3 A;  2ZNB A;  4KEQ A;  2GFK A;  1BVT A;  5IQK A;  1SML A;  4NQ6 A;  5AHO A;  3DHC A;  3IE1 A;  4O98 A;  4GYU A;  2Y8A A;  4Z67 A;  3X2Z A;  2Q9U A;  3KNS A;  4RBS A;  1QH3 A;  1YCF A;  1VGN A;  1K07 A;  3BC2 A;  3PG4 A;  5EHT A;  2XF4 A;  4DIK A;  4UAM A;  4RM5 A;  3T3O A;  5B1U A;  3X2Y A;  4TZF A;  2FU7 A;  3QH8 A;  3IOG A;  4TZE A;  3SPU A;  4TYF A;  1WUO A;  5EW0 A;  5HIS A;  2BG6 A;  4FSB A;  2P1E A;  5AYA A;  4FEK A;  4AD9 A;  1Y44 A;  4RL2 A;  2AIO A;  4TYT A;  3X2X A;  4C1H A;  1WRA A;  4C09 A;  4ZO3 A;  5HIO A;  1X8I A;  5LM6 A;  5HIP A;  2BFL A;  5AXR A;  2QDT A;  5EV8 A;  2DKF A;  3I0V A;  1YCH A;  4C1E A;  2BFZ B;  4HL1 A;  4UWS B;  5ACP A;  1QH5 A;  4FR7 A;  2YNW A;  5HIQ A;  3P2U A;  2BGA A;  4UWO B;  5B3R A;  2VW8 A;  3IDZ A;  4H0D A;  2OHH A;  2BFK A;  4CHL A;  1KO3 A;  2UYX A;  2FU8 A;  4EYF A;  1WUP A;  2GMN A;  5A23 A;  5ACR A;  2WYL A;  3L6N A;  5KIL A;  4P62 A;  2R2D A;  5ACT A;  1BMC A;  4BZ3 A;  4LE6 A;  3SD9 A;  5ACU A;  2GFJ A;  1ZTC A;  2WYM A;  3PY6 A;  3KNR A;  5EWA A;  4AX1 B;  5DPX A;  1VME A;  2NZF A;  4HKY A;  3FAI A;  4TZ9 A;  3PY5 A;  2WRS A;  4AX0 B;  1WW1 A;  2YCB A;  2BFZ A;  2BIB A;  2QJS A;  4NQ2 A;  4D1U A;  5ACW A;  2I7X A;  4Z60 A;  2BG7 A;  4ZO2 A;  1BC2 A;  5ACQ A;  3H3E A;  2YNV B;  3ZNB A;  4EXY A;  3F9O A;  1KO2 A;  3IOF A;  5K4N A;  3JXP A;  4RAW A;  4B87 A;  5LLD A;  3T3N A;  3Q6V A;  3BV6 A;  5LCA A;  3X30 A;  3BK2 A;  3DH8 A;  4J5H A;  2Y8B A;  1DD6 A;  5HH6 A;  4YSL A;  1ZKP A;  4Z6X A;  3ZQ4 A;  4RAM A;  1ZNB A;  5ACX A;  5AIJ A;  2QIN A;  3SFP A;  4J5F A;  2CFZ A;  4D1T A;  2XR1 A;  5AHR A;  1M2X A;  1X8H A;  2BTN A;  3IE2 A;  3SBL A;  2OHI A;  3ADR A;  4YSK A;  4RL0 A;  5LMC A;  2P97 A;  4D1W A;  2YNV A;  3ZR9 A;  5KIK A;  3RPC A;  2YZ3 A;  4C1G A;  3G1P A;  2Q0I A;  5AXO A;  4ZEJ A;  5HH5 A;  3RKK A;  3T9M A;  3KL7 A;  4PVO A;  4PVT A;  3DHA A;  4EFZ A;  1XM8 A;  2E7Y A;  4BP0 A;  3I15 A;  4F6Z A;  2QDS A;  2BG8 B;  1JT1 A;  3S0Z A;  5A0T A;  2H6A A;  3IEM A;  3ZWF A;  4XUK A;  4C1C A;  2OHJ A;  5EVK A;  4D02 A;  1E5D A;  1X8G A;  2GCU A;  3SW3 A;  2BG2 A;  4KEP A;  5HH4 A;  2ZWR A;  1JJE A;  2FK6 A;  5K0W A;  2HB9 A;  4DIL A;  3WXC A;  1MQO A;  2BR6 A;  2FHX A;  5LE1 A;  4Z5Z A;  1JJT A;  5EVD A;  5FQA A;  2P4Z A;  4UBQ A;  5ACS A;  2AZ4 A;  2YNT B;  2BMI A;  3FCZ A;  4XWW A;  2NYP A;  3ESH A;  3LVZ A;  2YNU A;  2NZE A;  4EXS A;  5A5Z A;  4NQ4 A;  2ZO4 A;  4UWR B;  5EVB A;  5K4M A;  5K4K A;  3VPE A;  3DHB A;  4UA4 A;  3I14 A;  2CFU A;  2Y87 A;  3IEL A;  2P18 A;  1XTO A;  2WYM C;  3I13 A;  2DOO A;  2Q42 A;  5A87 A;  1L9Y A;  2I7V A;  2WHG A;  2NXA A;  4NQ5 A;  4AV7 A;  3A4Y A; 
#chains in the Genus database with same CATH homology
 1YCG A;  1P9E A;  1A7T A;  5LCH A;  4HL2 A;  3I11 A;  1HLK A;  4WD6 A;  4YSB A;  2Q0J A;  5LSC A;  3VQZ A;  2M5D A;  1A8T A;  5EH9 A;  5A0V A;  4Z5Y A;  3IE0 A;  2FHX B;  4UWP B;  2CBN A;  4GYQ A;  4GCW A;  5FQC A;  2GKL A;  3SRX A;  2FU9 A;  2M5C A;  2QED A;  1DDK A;  4Z7R A;  5ACV A;  5AEB A;  4EYL A;  4EYB A;  4ZNB A;  2BC2 A;  4EY2 A;  2I7T A;  5LCF A;  4F6H A;  1KR3 A;  4TZB A;  5B15 A;  3AF5 A;  4D1V A;  3MD7 A;  4AWZ A;  2FU6 A;  3RKJ A;  3AJ3 A;  3R2U A;  3IEK A;  4U4L A;  4AWY B;  4XWT A;  1DXK A;  2YNT A;  1VJN A;  5LS3 A;  4JO0 A;  3TP9 A;  2BG8 A;  2FM6 A;  4V0H A;  5FQB A;  2A7M A;  4C1D A;  4C1F A;  3AF6 A;  5EV6 A;  2ZZI A;  3BK1 A;  2ZNB A;  4KEQ A;  2GFK A;  1BVT A;  5IQK A;  1SML A;  4NQ6 A;  5AHO A;  3DHC A;  3IE1 A;  4O98 A;  4GYU A;  2Y8A A;  4Z67 A;  3X2Z A;  2Q9U A;  3KNS A;  4RBS A;  1QH3 A;  1YCF A;  1VGN A;  1K07 A;  3BC2 A;  3PG4 A;  5EHT A;  2XF4 A;  4DIK A;  4UAM A;  4RM5 A;  3T3O A;  5B1U A;  3X2Y A;  4TZF A;  2FU7 A;  3QH8 A;  3IOG A;  4TZE A;  3SPU A;  4TYF A;  1WUO A;  5EW0 A;  5HIS A;  2BG6 A;  4FSB A;  2P1E A;  5AYA A;  4FEK A;  4AD9 A;  1Y44 A;  4RL2 A;  2AIO A;  4TYT A;  3X2X A;  4C1H A;  1WRA A;  4C09 A;  4ZO3 A;  5HIO A;  1X8I A;  5LM6 A;  5HIP A;  2BFL A;  5AXR A;  2QDT A;  5EV8 A;  2DKF A;  3I0V A;  1YCH A;  4C1E A;  2BFZ B;  4HL1 A;  4UWS B;  5ACP A;  1QH5 A;  4FR7 A;  2YNW A;  5HIQ A;  3P2U A;  2BGA A;  4UWO B;  5B3R A;  2VW8 A;  3IDZ A;  4H0D A;  2OHH A;  2BFK A;  4CHL A;  1KO3 A;  2UYX A;  2FU8 A;  4EYF A;  1WUP A;  2GMN A;  5ACR A;  2WYL A;  3L6N A;  5KIL A;  4P62 A;  2R2D A;  5ACT A;  1BMC A;  4BZ3 A;  4LE6 A;  3SD9 A;  5ACU A;  2GFJ A;  1ZTC A;  2WYM A;  3PY6 A;  3KNR A;  5EWA A;  4AX1 B;  5DPX A;  1VME A;  2NZF A;  4HKY A;  3FAI A;  4TZ9 A;  3PY5 A;  2WRS A;  4AX0 B;  1WW1 A;  2YCB A;  2BFZ A;  2BIB A;  2QJS A;  4NQ2 A;  4D1U A;  5ACW A;  2I7X A;  4Z60 A;  2BG7 A;  4ZO2 A;  1BC2 A;  5ACQ A;  3H3E A;  2YNV B;  3ZNB A;  4EXY A;  3F9O A;  1KO2 A;  3IOF A;  5K4N A;  3JXP A;  4RAW A;  4B87 A;  5LLD A;  3T3N A;  3Q6V A;  3BV6 A;  5LCA A;  3X30 A;  3BK2 A;  3DH8 A;  4J5H A;  2Y8B A;  1DD6 A;  5HH6 A;  4YSL A;  1ZKP A;  4Z6X A;  3ZQ4 A;  4RAM A;  1ZNB A;  5ACX A;  2QIN A;  3SFP A;  4J5F A;  4D1T A;  2XR1 A;  5AHR A;  1M2X A;  1X8H A;  2BTN A;  3IE2 A;  3SBL A;  2OHI A;  3ADR A;  4YSK A;  4RL0 A;  5LMC A;  2P97 A;  4D1W A;  2YNV A;  3ZR9 A;  5KIK A;  3RPC A;  2YZ3 A;  4C1G A;  3G1P A;  2Q0I A;  5AXO A;  4ZEJ A;  5HH5 A;  3RKK A;  3T9M A;  3KL7 A;  4PVO A;  4PVT A;  3DHA A;  4EFZ A;  1XM8 A;  2E7Y A;  4BP0 A;  3I15 A;  4F6Z A;  2QDS A;  2BG8 B;  1JT1 A;  3S0Z A;  5A0T A;  2H6A A;  3IEM A;  3ZWF A;  4XUK A;  4C1C A;  2OHJ A;  5EVK A;  4D02 A;  1E5D A;  1X8G A;  2GCU A;  3SW3 A;  2BG2 A;  4KEP A;  5HH4 A;  2ZWR A;  1JJE A;  2FK6 A;  5K0W A;  2HB9 A;  4DIL A;  3WXC A;  1MQO A;  2BR6 A;  2FHX A;  5LE1 A;  4Z5Z A;  1JJT A;  5EVD A;  5FQA A;  2P4Z A;  4UBQ A;  5ACS A;  2AZ4 A;  2YNT B;  2BMI A;  3FCZ A;  4XWW A;  2NYP A;  3ESH A;  3LVZ A;  2YNU A;  2NZE A;  4EXS A;  5A5Z A;  4NQ4 A;  2ZO4 A;  4UWR B;  5EVB A;  5K4M A;  5K4K A;  3VPE A;  3DHB A;  4UA4 A;  3I14 A;  2Y87 A;  3IEL A;  2P18 A;  1XTO A;  2WYM C;  3I13 A;  2DOO A;  2Q42 A;  5A87 A;  1L9Y A;  2I7V A;  2WHG A;  2NXA A;  4NQ5 A;  3A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...