3SDCA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
molecule tags Immune system
source organism Mus musculus
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3sdcA01
1EMTH 1I3UA 2J8UA 2MSPA 1RFDL 4LMQI 4OFKA 4QRPD 1OWWA 5GGVY 3T77B 1QLEL 4M02A 4WCYH 2YXMA 3G5YB 3EAKA 4PJEA 1NCBH 5IWLA 4E41A 4DFIA 4XVUC 5D96C 3FT2A 4XP4L 3ARRA 3AS2A 3IJSA 5F9WB 5A16B 4L8BB 4J7RA 5KG9A 4JFDE 5JTWA 4X5WA 4LCYB 5KSVA 4YDJA 1IRAY 1KN4H 3RKDD 3EW3B 3FQNA 3LKRB 4JM2C 3BXNB 4MVBC 4PJ5B 5D7SH 1A5FL 2FIRT 2EDQA 4HWEH 3WS3B 4XWGL 1OARH 2B1AH 2VZVA 1K2DA 4TSAH 2BRRH 4LBEB 4LLUB 3FHQA 3RHWF 2BVOA 3HG1B 4LSRH 1RZIA 3K74B 4UI2A 1ZLUK 2VUOA 5D7IA 4EDXB 4X4XB 1CGUA 1IC5L 1SBBA 2F5BL 2CLVA 4KTYA 4NNYA 2DIBA 4U1LB 2DBLL 5HYEA 3VXNB 3OAYK 4N68A 1JRHL 4AEFA 3WJLA 1KB9J 2Y06H 4ZOCA 1H3PH 2NY2D 1QSZA 2X1XR 2M2DA 2VDPL 4Z0BH 5F9JB 4NC1E 4QCIB 4H26A 1EAJA 5IMMB 2BNQD 3TJHD 2HLFC 1MELA 5AWNH 3NZ8B 1T1ZB 4R7NB 1VACA 2AJVL 4HIHB 4DZBA 3BZ4A 4FFYH 1ED3A 3CK0H 4RAVB 4YDLC 12E8H 3KYNB 1IFHH 5T3XL 4X6CB 5DQDH 2A6IA 1ZAGA 5IQ9B 4FABL 4MD4A 4RFOH 4YDIH 5DC9B 2MWCA 3VXSE 2C9AA 1FZOB 3FQWB 3FZUC 3LKPB 1NBQA 3K2MC 5JUEL 5F44A 2YN5A 4LLMB 5DLML 3MYZA 4N1HB 3DI2B 2KQMA 2CDGB 1HQRA 1RU9L 4XXDA 3OF6A 1BEYL 4X9HA 4XMLH 2W9LA 1CLZH 1GCFA 4JPKH 4WI9A 2R0ZH 4HGWB 3BT2L 1MFCL 3ESVF 3DBXA 4RSVA 4MX7A 4XVTL 1P4BL 3Q6FB 5L7XH 4NN7B 2X40A 5IGXL 4U1SB 2A83A 4QOKD 1I7UB 3ULVD 4Q9QL 3CCHA 2BNUB 3O4OC 4AEHH 4OUOA 4ZNEE 2MCPH 4P46B 3QJHB 2Q7NA 4NPYA 2C3WA 3MLWH 1H3PL 4JFFA 2ZUXA 2VITB 4HLJA 3NIGF 4PLKC 1DQLL 2ED9A 4PLNC 1XH3A 5FAAA 3MGOB 2ZG1A 2VO5A 5DT1L 1UWGH 5F96H 5DMYA 4XGZB 3RNQA 5SX4H 1I4FA 3TBVA 5HYQB 4K94L 5DQ9A 5DJXB 5FA4B 2G60L 5F72S 2MFNA 5F1IA 5L2JA 5LGKA 3U0PA 3F58H 5I66B 5JA9A 3OJDB 1H5BB 5C0CB 1XIWD 3GSQA 4UB0H 4Y1AA 1JMZA 4XNQA 2I9LB 4YAQB 4BUGA 2YZ1A 4LAQL 3NZ8A 5EBGA 4JY4B 4HBCL 4R0LA 5FYLH 4WI7A 3EHBC 5I8KL 4BQBA 3TH3T 1JMXA 1EZVY 1UCBL 3VFGH 3QUMB 1C12B 1YPZB 4X7CC 3FQRA 3OR6B 3CSGA 4LP4A 4K8RL 1LILA 1MWAB 3MA7A 1XGPA 4CVXA 4U7MA 2Z9TA 4JGJA 3UPAA 3WNNA 3BKMH 4XNXH 2ZP0T 3N1MC 4JO1L 4QXGL 1A6AA 1YC7A 2YMXL 2V2XA 3W0WA 5T1DL 1M7IA 3LEVH 5GXBB 3R0NA 1CLCA 3QHZH 3HMWH 2PCPB 4FQ1H 4PJCB 3JVGC 4ZXBB 2XPGA 5CSZA 4WWID 5HPMA 1JNNL 2GK0B 4ZTPL 1I8MA 3NN8B 1D5MB 1WBZA 1K4CA 3BPCA 1NUDA 2BNUA 1FSKC 3BKJH 2ADGB 5DVMA 5E5MA 1T1XB 4L8SC 4L8DA 5DK2A 1YEEH 2WANA 3UROR 3MACH 1KN4L 5GIRB 4OIIH 4M7LT 4NOBA 2A6JB 2CUMA 1BHGA 3L3HB 4CUCA 1X3DA 1D6EA 1KLUA 4FQIL 5ERWA 4PJFE 1B0GA 3PWPD 5B39B 2QQNL 5I15H 1NKRA 1I1AD 3RBGA 3OAZK 5F3BB 1AGCB 3VDAA 3HCVA 5IG7A 2A6IB 1RUPH 4P5KB 5HVHB 1TVHB 2V7NB 3NCJH 1QTYT 3GI8H 2Z8SA 1NGYB 3L7FA 1QFWM 1WTGT 5F9AC 4YAQA 1UWEH 3ILPB 1GZPB 1UWGL 2OMBA 4UU9A 2F54B 4Y88A 3T0WA 3EYOA 3MBXH 2GY5A 3GM8A 3QUMA 2IFFL 5HGGS 3QAZB 2EDHA 3DUSA 2X9YA 4FFWC 3BPOC 1CXIA 1YN6B 4WJ5A 3WFHA 1KPUB 4MHHI 3UAJD 3EYUH 3BJ91 4X6BA 2WM0A 3BHBA 2VZSA 4P57B 5E08H 5GJTL 4JB9L 4QWWC 3DX6A 5CEZE 3DX7B 4J23A 1Q9OA 2AJYH 3D85D 2IMNA 3QEHB 3UTSD 3UTTA 2ARJQ 1GGCL 3QHFL 1T04B 1LEGB 1BQHB 4PTTB 1KJ2B 4UOW1 3ARDA 2FL5B 3OKKA 1AXIB 2DQUH 4K8RD 4JFFD 2ICWB 5FYKL 1FIGH 2ZG3A 3CU1A 2DQIL 4HBQA 1NJ9A 4OIAA 3TNNA 3FQTB 4UU9B 3G6JE 3L5XH 4L1HA 1YEKL 1RMFL 3AREB 4UOJA 4UV4L 2DD8H 3BN9D 1OGAA 5DFTA 1OP9A 4YE4L 3MV8D 3QUXD 5C0GA 4JM2B 4ODWA 5I19H 4O2CA 5C09D 5D7LD 1XGRB 3BDBA 1R3LB 1A7QH 2BSTA 2E8ZA 2PXYA 3GMMB 3QIBC 2WBWB 4X5XA 4I5BB 4Z7NF 4UBDD 5ERWB 2FYYA 3KJ6L 5IBLC 2DLFL 5CZXC 5AAMA 5GS2H 4GLRH 5EU7E 5F9DC 3MRQB 4PG9B 1U3HA 4EI6B 3IJYA 3RUGA 4FOMA 2W1NA 2KZWA 4L4JA 4NFCA 2B1HL 3ROOB 2X1PA 4X0KB 5J6HA 1D9KC 1IT9L 4ETQB 4HG4K 3RWCB 1IARB 4YK4B 4MMZC 1JHKL 5C0BD 5JZ7D 1G7LA 4R4BA 4WEMB 2IADA 4RMRA 2D7TH 2VZTA 4NKMB 1J8HD 5E4IA 2CPCA 3VGGA 3GO1L 2AK4D 3BP4B 5EC1B 4EDWH 2NY2C 4L5FL 4XCNB 2YRPA 1S7RB 5I8CB 4JQXA 5JHLL 4KAQL 1EEYB 4GJTB 3M8OL 4JHBA 3AB0B 4QRQB 2AJSH 2O5ZH 3MV7E 4POYA 1IGJA 4YHOH 4JFEE 1H5BC 3R06A 1TJIH 1XR8B 2ESVD 1V5JA 1LEGA 5BRZD 4JN2B 1QBAA 3PQYB 1QR4A 5B21A 4XPAH 3VDCA 1N8ZB 1CWVA 5CAYB 4PDCE 4KGJA 1H0DB 1U91A 3EO9L 1H15A 4L8CA 4MAUH 1LO5A 3C2SA 4GW1B 5FM4A 4YC2B 2HVKA 3EZ8A 4X4YA 1G6RB 1IC5H 2F5BH 3BWAA 5DK0B 4DN3H 3T4YB 2VLLA 3MNZB 1D7FA 4HK0A 3DUSB 2P5WB 4J8RB 4PJIB 4MJ6A 1I1RA 3BEWA 1KFAL 4OZFG 3LN4B 2NMSA 5HJ3A 3GMRB 3MCKA 1KEML 3LV3A 1I8KB 4UOW0 1AGEA 1M05B 1X5HA 5DZNA 3U9UA 4LVNB 4P5TA 1U8OB 4OZHE 4X7TB 3DMMB 4HZAA 4O5LL 3TN0B 5HYJA 4MA8H 1OLLA 3D25A 2HFTA 2VRAA 1WZ1L 3ZKMC 2E7HA 1XF5A 4LGRB 3VXUB 5D5MB 5INCB 4LEXH 4KQ3H 3E1F1 1ZK9A 2DM4A 3RZCB 1YECL 4Y5YB 4APQD 3MA9L 1ZT1A 4O2FA 5HGHA 3CC5A 3QNXB 3BGMA 2V9RA 1FYTE 2IEPA 3UDWC 1MJ7H 4Y19E 2CGRL 3VFRB 5J4MA 1KULA 2YA2A 2VR9A 2RR3A 3KS0H 4C56D 1F3DH 3RA7H 1UM5L 2JK5B 2YRLA 3CMGA 5C3TA 2Z35B 2DLHA 5IVXB 3MJ8A 4BKLA 4S0UC 1G9NL 3SGEH 3RY4A 2X41A 4FXGB 4NRZB 4ZO6A 3QH3A 1QHPA 3STLB 5HVWA 3TESA 3BKCL 4F15B 3OBAA 5C07E 2OSLB 3PHOB 2QR0A 5FCUL 4PY7B 1BJ8A 4CN6A 2Y23A 4Y4KC 2DYPB 3BKYL 3DSFL 3QDMB 2DJ4A 3BRGC 5DUMH 2B2XH 5E8NB 5F97E 3C5ZC 2DQGL 4LL9A 2PF6A 2OP4H 5MENE 4G6ML 3QPXH 3UZVB 1L9MA 4ONHA 4Z7WB 3CVHH 4XPTH 4F9LC 1F6AB 3I85A 2YUVA 4WTZA 4X7SH 1KEGH 2VL5A 4ORZC 3IAQA 5GHWH 4PGCA 3GJEA 3K4DA 3LQAH 4FA8A 1M71A 3AUVA 1HSAA 1KTRL 5T5NF 3FT4B 1YEFH 4F9LA 2I25N 3QEUA 4Q6IA 3HZKB 2NY2B 3MV7A 4KRMB 4M6AA 4O58H 4AQ1B 4HWBA 4H1LH 4X5LA 1LD9B 1A1NA 3PHOA 3V4UH 5D2NE 4MWFA 3MLWL 3MLZH 3ZTNH 3FQNB 4GMSL 2EDBA 4YDIL 5E1AA 1FORL 5FEBA 5EDXA 5I71C 3LN5A 1FNLA 4U1IB 4OLYH 4JZJA 2NY4D 3SCMD 4KH2A 3MRBA 4YHPB 5BRZE 3N85H 3RX8A 3CXHK 4HWBH 4JDTH 4ZXBC 3CU7A 4TRPH 5CLTA 2JJUA 1BOGB 5HDBE 3WD5L 4QOKA 5DO2D 5IMLB 3IXTB 1U58A 4XMLL 4OM0L 4ELKA 3RY6C 5JXEA 3H3PL 3SDXB 1NBZB 5H8DA 1JTOA 3L95B 1W0VA 4M7KH 2BOBA 1W72L 3I9GL 4IJ3C 3C8KB 1DVFA 1XGQB 2AJ3B 1OP3K 3F65A 5D2NC 3TPUE 1A6TB 3RDTA 4F33B 2DBLH 1J11A 32C2A 2A6JA 2XZQL 2R1YA 3SJVB 1FVEB 4M8QB 4DUVA 3GSRA 3OKLB 3D0LA 1SYVB 5IHZB 4MA3B 4NNXB 4ZFFA 1XGTB 2J1KA 4OCXH 4X9BA 3DARA 3BP5A 3SKJL 3MOBH 4QRPB 3BD5A 1QRKA 2H9GB 2WW8A 4XRCB 1SY6L 4EI5A 3OKMA 1NC2A 2BFVL 3WO4B 3ULUH 1QSFA 2YK1H 4NDMB 4MJ6B 1MLBB 3HZYA 5IFHL 4H20H 1QLFB 4PJ8D 3VGHA 1UM4H 3GI9L 1UZ8A 4TNVF 3T2NH 1V7MH 4OZFB 4GW5A 1D5ZA 4HGWA 1KCKA 4UILH 1DQLH 3SQOH 3QQ4B 1ORQB 5HI4D 5DHXB 3H2WA 1X5YA 4UNVA 2X42A 2G2RA 5IMKB 2D0HA 4KKLC 1JE6A 3IDUA 3TBSB 3OTTA 2APBA 3C6LA 1TPXB 1QNZH 1FZMB 35C8H 5T33L 3KPQA 4XP9L 3EYSL 4UV7H 4U3HA 4TOYH 5DQ9B 2D7MA 1KIRA 1YNKL 3A6OA 1KJ2H 4PPTA 2FIKA 3HE6B 4XVTH 5L7XL 2W60B 3QXWA 4LRNL 4Z8FH 4Q58C 1YMME 3SDAD 2BHZA 4QHLA 2G75A 3Q6GH 5E8EB 3N1FC 1OSPH 4N5ED 3NVQA 4ZG1A 5L6YH 2R8SH 5IMOB 1WZLA 2JTDA 4LQ1A 1AE6H 2ZPKH 1R24A 1Z9MA 4ODHL 4P2CG 5JXAH 4WHYG 1UCTA 4IOFD 3WFBH 4LHUD 1HHKA 4MA1B 3D39A 1NGQL 3ZYZA 3Q48A 1CL7H 1GC1C 1QBLL 4DGVH 1KCUH 4Y5YC 3G6AA 2CKBL 5CGMA 1VACB 3NCJL 3RTQB 5MI0C 5ISZE 1YNLH 4LU5L 1TCMA 4NKIL 2VWEE 2Y5TA 3WNMA 3VWKB 5JXED 4NWUH 3PWNA 5CHNB 4PD4K 5ETUB 5GGRB 2VDKL 3QUKA 4P2OA 2IFGA 2IANA 3GHEH 3V5KB 5C0EB 2OP4L 4JDVA 3V5HA 3T04D 3KYMA 3LRGA 1CICC 1R3JB 5IROA 1AI1L 3S8WA 2ADJB 2XWBB 4TOYL 4JFXA 3MACL 5FO9A 1NLBL 1BVLB 3O6LH 4GSDH 4O2EB 3DX8B 2YOCA 3BKYH 1EGJH 3BN9C 4XP5H 4MZ2A 3D6GA 5JOFB 4XHJD 3RJDA 4CMHB 3OX8A 4JFPB 5KSAD 2VN7A 5FDWB 4Q9BA 4CVXB 3PG2A 4BFIA 5TE4H 5K33A 1JFQL 1Z3GH 3KDMA 4YDJB 3SCMC 1R5IB 4GAYA 3H9SD 4W70A 3F5WB 5D93C 5D7IE 3SGDI 4MNHB 1NFKA 3NA9L 2BVTA 4NN6B 1X4ZA 3IETA 2RBLA 2XTJE 4KZEH 2J7LA 1LP9F 1NGYA 4NQVA 4Y2DA 5TDNA 5TE7L 5C0CD 1NUGA 5C9JA 1NC4A 3HUJF 2R0KH 2ADFL 4L29B 4LARL 2WBKA 1CTOA 1X44A 2J6EH 4FZ8H 2R0LH 3CH1A 2E5EA 4ZMAT 2GSGB 4QTHA 4JHWH 5J0BA 4ZFOL 1CR9L 5KS9B 3CIQA 4KDWA 1EFXA 3C8KA 3RWEB 2YS4A 2YD1A 1G7HB 1INQB 4QHNB 4WFHD 1TVBB 1RQ5A 3OSKA 1SMOA 2VXVL 1U8QB 1I8LC 3PWPE 2X4TB 3E2HC 5F6HJ 3KPNB 3ZE2E 2HJLB 4KI5C 3CLEH 3BXNA 4G7YH 1ETZA 4LPVA 4PJ5A 4PP2B 4QEGA 2NY1C 3GRWA 4U1KA 1RI8A 2C7UA 1RUKL 3BIKA 2Z31D 1CIUA 3MXVL 4J6RH 5BO1L 3MCLH 1GOGA 1IT9H 3TBWB 2B7DT 1PZUB 1KXTB 4NN7C 3REVB 2CH8A 1IGMH 1BF8A 3N85L 4QHUB 3RZCC 3D39E 3DECA 4LKCA 1KT2B 5C9JB 5KVEH 1E4JA 1JZ3A 2C4FU 2QQLL 4XBGB 3HRZA 4NO3A 2Q8AH 1Q9OB 3QEHA 2HVKB 1VERA 2VXTL 1B3JA 5HYSG 2H45A 4U6VH 5DD0L 4Y5VA 1YQVL 4QHKJ 3F12A 1WVZA 1U8PB 1E4KC 1KPUA 2VABB 2X4RA 3TBSA 5BVJB 1CBVH 2LQRA 1JPTL 3DPBA 1NANH 5SWSD 3GBNH 2HJLA 3CX2A 1ZHLA 4BK5A 4D94A 5DMKB 5FB8B 1MCRA 4PRIE 2NLJB 4G6FD 4X7TA 4PJHF 5HGAA 4WNQB 5BJTB 3B8YA 3PWUB 5SX5K 4I2XA 2I60L 2FHFA 1T22A 5C0DA 5F21B 4NQEE 3ULSB 1OW0C 5KSBF 4GRMB 4GAJH 1QFWI 4IRSD 1CGYA 4N0RA 2C1PA 3SGJC 3WDIA 5ADOH 1A22B 2R29L 5EB9A 1MCKA 4NCC2 1WEJL 2R4RL 4XCFH 5E8PB 5HBBA 1CE6B 4HCRA 5CIPB 1Y18B 1IEAA 4EN3D 1AQDB 1NSNL 3P0GB 2V9TA 4H8WL 2ZCHH 2VXUH 2V5SA 2DKMA 1IQWH 2CDEA 4R97C 5CEZH 3SY0B 4E0RB 4YXLH 4H25B 1YMHB 1VEMA 3OPZL 4HJJH 5GGVL 5JW3H 1FC1A 5F9OL 3P9LB 3KPRE 3CX5K 1T03L 4ORGA 4PJCF 4ODTH 3VU2A 5C0BA 3G6DL 4Z5RB 1JZ8A 3HLAB 4LPWA 5KSUB 2CDGA 3VXRE 4KTEH 1E4WH 1F3JA 3KGRA 4G9DB 5EU6E 1IILE 4P46D 4K7FB 3Q3GA 2WLYA 3Q5YA 3QWOA 3E0GA 4R4BB 5AZ2L 1CDIA 4DK6A 1KIPB 2HFGL 4D9QE 5DA0B 2AJUL 5I8OH 1ZHNB 2B2XL 1P69B 3U7WH 3O4OB 1C08A 3WE6B 3QUXB 5GZOC 1JZ7A 3BKCH 2MKWA 1T83C 2XA3A 3QCTL 1P4LB 2H6PB 4XPTL 1CD9B 3VFNA 2VLLB 1HHIB 4OGZA 1FFQA 3MV9E 4HS6B 5DMGC 5C09A 1BJMA 2ZOKB 3OB0K 4MA7L 3IETB 4AENB 5KN5B 3UPCA 6FABL 2YWZA 3PGFH 1OP5K 3ZKQD 3MYJA 5MEPA 3JV0A 3FZUD 4OZGB 3UXFA 4XPBL 4TTGA 3FN0H 1P7HL 1LWRA 3DVNB 5ETUA 4YIQA 3U0PB 1F90L 3N9GL 3LOWA 2ZKHL 2CGRH 3QAZC 3MRFA 4OLVH 5JORA 1JPFB 3ARZA 4LEOB 4DVBB 1OB1A 4Z18A 1ZHBB 4K2UH 1IGIH 5DVOA 5GRJH 4JVWA 1YY8A 1J8HB 1GPOH 3BX7C 2QQNH 1KLFA 4I77L 5FO9B 1WZKA 2P44B 1R24B 4X4ME 1FE8L 2ILLA 4E0RA 1LEKB 3EYQD 2FEDC 5JW4Q 5IV2A 5AEAA 4HV8B 1I1FB 4R97B 2P47B 4ZAKD 2G9HB 3K4ZA 4NNPL 2YD6A 3IDYB 1NDGB 2R2EB 3FONA 4NQCA 1SYSB 2ZUWA 4OF3A 1KIUA 3HNSL 3L3DA 4OTXL 4JFZL 1MWAL 4P57A 1OP3H 3O8XA 1MLCA 3S98A 1K6QH 1UXSA 3C5ZD 4MJ2A 3PP4H 2GJ6D 2ICES 3DGGA 4J3WA 3ZTJG 3NH7H 3OKDA 1Q9LA 1EHAA 2MPAL 3FT3B 3TM6A 3QDAA 3OXSB 4RGOH 2R0ZL 3IFOA 5DK3A 4ZUTA 4DN4L 1GZPA 1R3KB 1JGDB 3N06B 1L0YA 3O2VL 2OCFD 3X3GH 4HUVB 5I1GL 2VKWA 5EC2B 4FQXA 1AGDB 4R0LC 5FM5M 5GS0H 2GSIA 1WWBX 4AT6A 3VXOB 4MS8D 3ZKSD 5CILH 5I73C 4QHNA 3GMPA 3EJJX 3D0VA 3F8UB 4A2MA 1U6AH 1QLRA 4HG4J 4ISVA 4DCQB 1OM3H 3M8OH 3HG1E 1EEZA 3P2TA 3SQOL 2IQ9L 4P59H 2UZIL 1ZVHA 1A4JA 5IK3A 1ETZB 2ICCA 4H25A 4GS7B 1LDSA 3CXHJ 2XOTA 4CAGA 3SE3A 1NMCB 2ZJSL 2K9UA 4L4VB 5JQHC 2VXQL 2F19H 3UEZA 4JG0H 2HFFB 4PJCE 3TBTA 2Q3AA 4LLAA 4P9MH 2EKSA 3T4AA 3UYPA 5D7IB 3UJJH 1DVFC 1MI5A 3ILQC 3GSVB 3IAPA 1MF2L 3E3QA 1U36A 3CXDL 4PJXA 5B38B 1JJUA 5I1LB 3RAJL 5C6PB 2W0FA 4XMPL 5D1XA 3NCMA 4XCEB 4Q74A 3VFOA 4A6YB 4JGMA 2JK5A 1QFUL 5J8OA 3U2SB 1GYAA 1M7DA 3GHBH 1IGYB 4KHXL 1TJHH 3U30B 4R4ND 1CU4L 4RMSA 3MOAH 5E2WL 1WICA 3OKDB 4RGNB 4ZTOH 1BQSA 1A6TA 4HJGA 1CG9A 3RDTB 4I1NB 3DMMC 5D1QB 4JHAH 3QXTA 3CFDB 1EZVX 1WT5A 4HXAH 5EPMA 4AH2B 1BFVL 5JQ6H 2Z31C 4K71C 1BVKB 3V4VH 3H9HB 2F8VA 4AJ0A 1MWAH 1RIHL 4NBYB 3SDXA 1VB9A 1BVLA 4TUKL 3OB8A 1EO8L 3FT4A 5D2LB 2LVEA 1OTSD 2DWDA 3MV8E 3VXTA 1AY1L 4Z7VA 5D6DC 5SWSB 4PJAE 5EOQH 5DFWH 1A3LH 4NWTL 4IIQC 1EEZB 1F00I 1FIGL 4LVHB 3D3VE 43CAA 1IZKA 2N1KA 4PJGB 3BZ4B 3NIGE 2VZ3A 4KRLB 2FD6L 1EIBA 1AGBA 4Y0GA 3ARVA 3GKZA 3ARBD 1RFDH 1FL5A 1QRNA 2Y07H 5KZCD 3BE1L 2NCMA 2NY4B 3MRCB 2WUCL 3SJVE 4P4RA 3L3DB 1DSFH 4GSDL 5C2UB 1CVRA 1PEWA 2DLTA 3T8XB 4I3SL 2XNAB 5BQ7B 1IVLA 4L9LA 3VD9A 4HZLA 1U9KA 2EDXA 3EJYC 2E7LC 4J3XA 2FEDD 3V0WH 1ZT1B 4O2FB 4B7LA 5B38A 3U7WL 4MQSB 3P9WB 4JO3H 3RUGF 3CH1B 2X05A 2UY7A 4NSKB 2BNRB 4XX1G 1GPOL 2Z91A 2UYLB 4HK0B 1JRHI 5EU3B 2E3VA 4AT6B 1YNLL 2B0SL 1RUMH 3GKWL 1ZLUH 4DW2H 4KY1L 3ZHDA 2YD3A 3W11C 3QDJB 4XNMA 3ECBA 2I9TA 3T3PF 4H0HB 1P4IL 4LVNC 4LEXL 4CW1A 4OI8A 1OARL 2B1AL 1KTLB 4LU5H 5FYJH 3TO4D 3FO9B 1WWWX 4L8DB 4CMMA 1NCTA 2XQBH 3U82B 2PXYC 4K7PY 5EO9A 5DHVH 5CINH 2ITCA 2I24N 2DDQL 4GBXD 4ZYKA 4OGAD 2FX9L 3LPWA 2EH7L 4G6KL 5I6XC 1MIML 2EYTA 4HFWB 2GFBB 2Q6WB 3OKMB 3VXRD 3HI6L 1FZKB 5K9QG 4GS7C 5JIKA 1AE6L 5DUPL 5IIEB 2W9EL 1SYVA 3O6FA 2C4XA 3QIBB 5F6HI 3VG9C 1I9RL 5EG6C 3V6ZB 1FCCA 3QUXC 1QUNA 4UINL 1V05A 3GSNL 4BZ2H 4MNQA 3QUZC 4IRJC 4L3EB 2N4IA 4Z7UA 4NDMA 3HZVB 2QHRL 4DFHA 3BEWB 5IB3A 3EFDH 3LD8C 3MV9D 3P4MA 3QCUH 4PJ8A 1JV5B 2DS4A 5HDBF 4KKBC 5F7UA 5J9PA 5DRNB 4Q6YA 1NSNH 4EUPA 1FDLL 3OAYH 4APQB 4NHUA 4FQJH 4NQSA 1YEIL 2XZAL 1HILA 3L5HA 1BJ1J 3QFJE 1KJMA 4QF1B 3EOBA 4AEHL 4PRDA 5FYLL 3O3AA 4NQCB 1GOHA 1JPTH 4ZD3H 3C09B 4JGUA 3IDXL 3U30C 3KHQA 4OFDA 4PJBB 5HGDA 5F9OH 5K9QI 5HPMB 3ULSA 2R15A 2ICWA 3N1PC 4L4TA 5I0ZA 1RK0A 4B7IA 3SKMA 3MLTB 8FABA 4ZPTB 4JJ5B 3FFCD 1T04A 4OB5L 2BCKA 3MREB 4NHCH 1NDMB 1A6VL 1NH6A 1OAQL 1JHKH 3WUZA 4DVBA 1U8NA 2P5WA 3Q5OA 1XR9B 3WFEH 4JCLA 4KZDH 3F58L 3QHTC 5EZJB 1ZEAH 1V7ML 4UIKH 3HFMH 4RGMC 3LZFL 5T1KA 2R4RH 4MAYB 1IEBA 2VISB 1OM3L 3MXVH 4J6RL 4HF5L 4LDOB 5AG8A 2KKQA 3AAZA 4OGXH 4MXVE 4TQEH 3GHBL 4M62H 2EIZA 4H8WH 3VWKD 3FOLA 1TJHL 3IKCA 4OSUL 4NQVB 1D9KD 5D7JA 1WC7B 4OM0H 1JHLL 1MCOH 3C8HA 5D5MA 3Q5TA 5ITFB 3DXAA 4XCFL 1CL7I 3T0ED 4CVUA 4WO4D 4U4BA 3SQBA 5E9DB 1K5NA 4F2MA 5D7JC 4YHLL 2X09A 1FZJB 4TVPE 4OV5B 3TBWA 1Z0NA 4KI1A 4HGKC 2BC4B 1YMMA 3TT3H 4YHNB 3QSKB 1U95A 5IHBA 1KV3A 4KJWD 1R0AH 3QUZB 4IRJB 5AD0A 1TPXC 3D3VA 2AV7A 3NIFE 2APVA 2X9WA 4GMSH 1MCHA 2F54A 4X6CF 4HIHA 4WDIB 3J7HA 4PS4H 4NM4L 3BQUD 5DDHA 3IDYC 3LKQB 4BA8A 3MOQA 5JNYA 2P46B 4V3EB 2XXMB 4PBXA 4S1DD 1YN6A 4WJ5B 4UV4H 4XNMB 3S9DB 2I9TB 2GUOA 3ZYJA 3W82A 4K3JL 3NACL 5K93A 2B20A 3VRLE 5HGBA 3KPRA 3WIIL 1ZMYA 3CUPB 3O4LD 3TBYA 2AW2A 4U6VL 3UBXB 5KANI 4PRPA 5MEQA 3DX7A 5GGTL 1X5LA 2P8MA 5E8NA 1WCBA 5F93C 1IAIM 1OAUL 3ELAT 4Y5VB 4RQQB 1GZQB 4N0CD 1FH5L 5IWLC 3HMXA 1MCPL 1Z5LB 2BVEA 2Z8VC 3LQZB 4JB9H 4QOKB 5IIEA 2PYEE 3GMOB 3D3VB 4JO4L 1T2JA 3VXMB 3KPOB 4IBLT 1SBSH 1KLGB 1GIGL 5AYQA 3RX7A 4OLXH 5C1MB 4XZUB 1IC7H 1I8LA 1U8LA 3LV3B 1FNGA 4GG6B 4Z0BL 1KGCD 4RAVA 4FG6D 2GKIA 5I1HH 4L9DA 4NYLA 5ALBH 5IP4A 1OCWL 3MODL 4WI5A 4U0QB 3VI4E 4UT6H 3E6FB 2EH7H 1G0DA 2CDFB 3P4NA 3TN0C 3O8XB 1Q38A 4XMKH 1I75A 2VMFA 1U8JA 1XCQA 4R4NC 4YGAB 4L4TE 4NNPH 1FO0L 1OTUD 3QNXA 4XP4H 4WW2F 2R0WH 1T66D 3DO3A 2VLMD 4ZXBA 1RJZB 2RIKA 4HK3J 5D9SB 2F8OA 2J4WL 3MNVB 5C0AE 2Z4QB 9CGTA 4PJEF 3MV11 4TSCH 1HEZA 3N9GH 5ADPL 4G6KH 1KPVB 1KYOJ 1C16B 2J2ZA 5DJ6A 4MXQC 1F3JB 3C6SB 5K9KB 5DMGD 4EIGB 4X4YB 4PRAB 4O2EA 4PLJD 2A6KB 3IJHA 5DC0A 3MLPA 2YA1A 3CDGB 4YPJA 4X6DB 1I7RB 1L6ZA 3KPRB 1BD2A 3HKFA 2ZUQC 5DMIH 1ZGLA 2R2HA 3MRKA 1OSPL 2QHRH 3BSZL 1OW0A 2V2XB 3W0WB 2VLKE 4MYWB 2NX5D 2ESVA 1HH6B 5A2JH 1TQCC 5EU5B 5ICXB 3T4AB 1GGYA 4PJHE 1S7SA 1A6WH 3GIZH 3PHQA 2L0DA 4LKXA 1G84A 3MNVA 4BUHA 1Y18A 1CL7L 1FSKB 3KYMB 2NY3D 3X3FL 2YEZB 3U7YL 1FAIH 1QNZL 35C8L 1B2WH 5T1LA 3R4DA 3WIFA 2XN9A 2BHYA 3EHBD 3S35X 4ZNEA 1R6VA 1A7QL 1MCLA 1SVZA 4Q6IC 3MRRB 2R0WL 3M17B 5A3IC 3KYNA 4K94H 4YX2H 3IXAB 2EDNA 2O5ZL 3ARQA 5E95B 4KI5F 5FUOH 3CD4A 3VFWA 1DANU 3ARWA 3U36A 4LSSL 5DFVD 4LPCA 4BFGA 1UCBH 1IGTB 1QBMH 3HC4H 5TDPB 4HXBL 5L2KD 4N5UA 3EUUA 1MIEL 2PW2B 1FNSL 4NZUH 4XPAL 2OQJA 5E1AB 3NTCH 3KYKH 1Z0MA 2GJZB 4LAQH 2E6JA 4UIMB 3JXAA 3MROB 1FYTD 1YMMB 3P9MB 1WUNT 3K4AA 3MOBL 1BM3H 1AO7A 1T0PB 4IOIA 4PGDB 2DMCA 3FO1B 3ZT5A 4JPIB 3PP3H 1Z5LA 2AK1L 4HX1A 1V3MA 4P48A 4E5XB 5KSAB 2QBWA 2R29H 2W91A 3CFCH 3QHZL 4CJ1A 5BS0D 1ZLVH 1WEJH 3G08A 1NCDL 4KJPC 4NRYB 4U1HA 3V79C 3BVNB 4JFXB 2YUWA 4LNRA 5CSBA 3H9SB 3FRUB 3DROB 4I3RH 3M17A 3LS5L 3B43A 3C60D 3HMXH 2ZUTA 4XAWH 3BYTA 3MRHA 1NDGA 1W2KT 2R2EA 1F6AA 5ACMA 4ZUSA 4X6DA 4ZUWB 4LIQE 2BSED 2VLJA 4K55A 2HLAB 2VDNH 1B6UA 3DIFB 3ZHLA 3NACH 4PP2A 2BVPB 3IRZA 5AUMA 5KJRL 3VXOA 5I1KH 4W4OC 3A67H 4LLUA 5E24E 5DJYB 4RMQA 2R1YB 1JPFA 4DEPB 3CVIL 2FO1A 3G04B 1D5IL 3G5ZA 3R1GL 4Q2ZB 3L7EB 5JR1L 5C2BH 4N1EA 1X5KA 1A1OB 3O6FC 4BJLA 3PJSA 1QKZL 1FVCB 2WIIB 4DVRH 1NC2B 3CK0L 3ZDXE 2ICWI 1Q72L 3KPPB 3MNZA 3QEUB 4Q6IB 2A0LC 4MX7B 2DQGH 1DUYA 1DQJA 1CGXA 3K80A 3WNPA 2EXWC 2I07B 5HHOA 4CW1B 4X6BB 4KJYA 1BFOA 2Q7YA 5IQ7H 2D03H 5AAWA 1LK2B 4JN1H 1YEJH 3HB3D 4HUKB 3H3PH 4QT5A 4M7KL 5FYKD 4JQXC 3MRNB 3VRIB 2XTJB 4HKZB 2F53D 3OKYA 2DMBA 1KENL 5HHQB 3U2SA 1ITBB 1RD6A 3TIEA 2JELL 1S78C 4B41A 2COQA 3MLYL 4HPYL 3RX5A 4GMTH 4QRPE 1P7QB 2BY1A 1YUHB 5FCUH 2EEDA 3MLTA 3V0AC 1WCBB 4Z7UF 2NR6D 4U05A 5IVOA 3VJ6A 4JFOB 4KKLD 3VFVB 3EOAA 2IADB 1UVQA 3FKUS 3BOVA 4Z7OF 2VC2H 4N90E 2HG5B 5HD8D 1QPXA 4HH9A 2AK4B 5TJWK 5H35B 2ATKB 4LDEB 3GZKA 3QHFH 3BFOA 4LSVH 2DQDH 2VLRD 3HR5B 1DQTA 3D0LB 1AQKH 4RBPK 1NCBL 5BV7H 5F7HA 1WJ3A 4NO5A 1JFMA 4EI6A 1DTUA 2ESVB 5C0JA 4HT1H 4UB0L 1IGCH 3NBNA 1EBPA 1BBDL 5DTFB 1AO7E 3RZCA 1YDPA 1AKJD 3L3KA 3WUWG 3SGEI 1D6VL 5B4MC 2ZCHL 1KPRA 2P5WE 1C7SA 3NPSC 4I18B 3WEXB 1G1YA 3QUYD 2GHWB 1KF9B 2Z0BA 1MJUL 3EYOB 3Q3GB 1JN6A 4D9LL 5C71A 4UMGA 3L3IB 3RGHA 1HINH 2OS7A 5DD6B 1JBJA 2WLZA 1A9EB 1HKLH 2FNBA 2I9LA 5HXMA 4M00A 3VXRB 5DZLA 3SDYL 1VDGA 3PGCA 4S0SD 3HNTL 2X5PA 4N0UA 3NFNB 3SN6N 3QEGH 2EDOA 5KW9L 4GG6A 3JWOC 2ZUVA 1DJSA 3KYOA 1OF2A 3W5NA 2Y07L 1NBYB 1A4KA 3BO8A 1OHQA 4NN5B 5IB4B 4FQQB 2OLDA 3ZHKA 2D7QA 3PABB 3OQ3B 5CEXA 1MRFL 1NFIA 4X80H 5JHLH 1F6LL 1F4HA 1RIVH 3ZT6A 4RDQF 3BEVA 2QKIB 3DXAB 1U8JB 1KBGH 3QDMA 4K9EC 5I1IH 3RZCD 3ZSTA 4LLMA 4KK6D 3MUY1 1HH9A 1I1YA 2A74A 3WSQL 3QRGL 4G7VL 3RZWA 1W8NA 3QNYA 4F37F 3VA2C 4JQIH 4FNLH 4A6YH 1AXSB 3GUTB 4P9HL 4KQ4H 3ARGA 3CGTA 5DD0H 1S7UA 2A38A 1QFWL 3LB6C 1X7QA 4LPYA 1N59A 1S7QB 4I48A 1T6WA 3EGSA 4C56B 1K8IB 1WFOA 4QLRA 3PWVB 3Q6GL 3TIDB 1FNAA 3P4OA 1H3XA 5E2UH 3EYQC 3T1FA 1WBXB 4PFEA 1HXYA 4JZOA 4C57C 2DQJL 3U9UB 1E6OH 5EUOA 1CN4A 1FLRH 5E5UB 2L7UA 4F33A 4HKZA 1TTGA 1P1ZB 3A6CL 1A6ZA 5IESH 3LS5H 2DYPD 1D6EB 3TT3L 3DX9B 4JPVL 3S3PA 2KDGA 2A9ML 4WTWA 1NCUA 5AYUH 3ULUE 4G42A 4Z7WF 2D03L 1IGJB 5GS1B 1J1OH 5GZNC 5FYKE 1WCQA 1M1SA 3QWRA 4K23H 4KPHH 4EDWL 2O93L 1MCJA 3VFRA 2J3SA 4RZCA 3MSPA 5F9JA 4L3EE 3I6LD 5IHUL 1H15B 1DBBL 1XEDA 5H35A 3RVTC 3TJEL 4LFHG 2J88H 3H6JA 5KSVB 4OGXL 1FFOA 1IGFH 1MCQA 1R5IA 4UQ2A 3S37X 1D5IH 2AJYL 1DL7L 4R2GD 2WWMC 3GMPB 1XF4A 5ECJE 4HIIB 2G2RB 4YXLL 1MRCH 2B1HH 2VDQH 3PWUA 1OPGH 1HWHB 3HG1A 1KTLA 4LSUH 2K7QA 2F5AL 3DHJA 1ZHLB 1YJDL 1AHWC 3VCLB 4NHCL 3FAXA 5FGRA 3ES6A 3EJZC 4KK5C 5F1NA 5H2BB 3T0XA 3QIBD 4XH2B 4H1LB 1IFHL 5T3XH 3SDXE 1Z2KA 3LKNB 1G7JB 3S36H 2VZ1A 4QWWD 5KS9F 5DJ0A 5ENWA 5J6HB 1FN4B 1F4YL 5C92A 4FP8L 3VG0L 3QA3B 4PJAF 3WHE0 3WIHL 5J9PB 3MC0A 3QQ9C 3JUYA 3KVQA 1G7PA 2BOCA 5DJDB 4Q9CA 3QJFA 2ZJSH 2G9HA 5MEND 3CJJA 3EO0B 1KB5H 4P4KB 2VQTA 2AV7B 1A5FH 4YFLI 4MCYB 5EU6A 3VW3H 3CFJB 4UNUA 3IU4L 2JE8A 2G5BA 3SEPA 3EDEA 3IDGB 2NYYD 4N8PA 3IGAA 4NQEB 3M1BB 5BOZG 3NPZB 1JNLL 4OF7A 3VXQB 3BESR 1DE4B 4PY8J 4K3EH 5EOTA 1X4XA 4JFDA 4QRTA 1T7ZA 4NGHH 1CDJA 4YDLB 4PRDB 3RUGB 5C8JA 3KPLB 1ZTXH 5GGSA 2UV3A 1RJYA 5ISZA 3BSZH 4PGDA 2D2OA 5L2KA 4DKEL 2CSPA 4HKXB 5C7XH 3ARED 1LP9A 2DQFB 2AS5M 3UPRB 1S7TB 1OT1A 2VISA 5TF0A 1A7RH 2EDKA 1ZT4A 4NC1C 5I2IA 1T0MA 4DKAA 1AD0A 5LXGH 5C09B 3HMWL 5IBUB 4MAYC 2R23A 4PV8A 1YYMH 3PL6A 1A3RH 1FL6A 2W07A 4LF3B 2BDNH 5DVLA 5C07B 1CICA 4HT1L 4NKDB 1M71B 3DX9A 1KCSH 3I02B 4LPTA 4NQEA 5IVNA 1XIWB 3QCVL 4BQ8A 4YLQT 1ORSB 4WO4B 1PG7X 2IFFH 2AI0L 1MRDH 2WBJA 1PJ9A 4FN0A 4HXBH 4P4RB 1ZHKB 4XNUH 1Z9LA 4Y19A 3WXVL 1A2YB 1YEDA 1MQ8A 1OB1B 4JVPA 4OBRA 3P30H 4PJ7A 2FGZA 3KLHC 5IJKC 1LE5A 2WUBL 1G9EA 4QOKE 1AQDA 1AFVL 1LK3H 1JZ5A 4E42B 4ELMB 1G6RA 1PFCA 2VQUA 2LVCA 1CD0A 2GSGA 4QTHB 3W9EA 1NMCC 2D4FA 2Z4QA 2EDWA 1TETH 1WZ1H 4XPGH 1QSEA 2MKLC 4KJYB 2A9NL 4ONGL 1MVFA 4PG2C 1PY4A 2YPKB 5GZND 5IVXA 1CTNA 1A9BA 1B4JL 2PYFB 3KS0J 4NUGH 4ZXBD 1JGUL 4U1MB 3DMMA 3SE4C 1HHJB 2E6PA 4F8TA 1DBAH 1FNFA 4AY0A 1FL5B 1TVHA 3SDCD 1Y6MR 2VNCA 3KXFA 2XACC 4D8PB 1RUAL 3SGKA 3MNWB 2VL4A 4G8IA 1YNTA 4L4TB 3JTTA 1RK1A 5T1MA 3EDFA 4LCWD 3VXMD 1U8LB 1QFHA 2JELH 2H9GA 4HC1H 3PWJA 3SDDD 3SKOA 2OTWB 4OJFL 1CYGA 5HDQL 1A9EA 2V6HA 3S37L 4QXGH 3LQZA 3QXVA 3BE1H 3MLUL 2LTQB 3ECBB 1U8QA 4JG1L 5K9OB 4K7PL 1DDHA 3HAEA 5FF6B 1C7TA 4JKPH 1FG2A 1T2QH 3ZTJH 4OI7A 3O9WA 3DMMD 1S9VA 2GITB 3LMJH 5EIIB 4V1DA 4Y16D 3SOBH 15C8L 1G6RH 3U4BH 4BSJA 4HS8H 1N7ML 1F42A 1NEZB 3RGVD 3IYLW 1J1OL 4X8JB 5IUSA 4LLQB 1Q0XL 2NY6C 1DL7H 2VTFA 4H1LG 1IKNC 3C60B 4YO0A 5I71B 2OXGA 4E42A 4HSQA 1LO5B 3SKMB 4JKKA 2E9IA 4I3RL 3B2UC 1YQVH 5LGJB 4HEPG 5DRZB 3MJ9A 1ZVSB 1QSFB 5DEFB 2MQCA 3C08H 4HCRH 2JJVA 5HI3D 2UWEF 5C08A 4HEME 1MFDH 1I7UA 3QXAA 3A67L 4PJDE 1T1ZA 1RZJC 5KJRH 5BVPL 5TQ2H 3WKML 3RY6A 4LAJH 3C6SA 2J8OA 1CICB 4KMQA 3VDBA 4N0YH 3B6SA 2LE9A 4EUPB 3RVTD 1G9MC 2I60H 1PQZB 1DEEB 5DD5L 3LIZL 3VMOA 3TFKD 2VITA 1OSZA 4U7KA 3U1SL 2OK0H 4KV5F 3VXME 2OL3H 1I3GL 1UEMA 1JRHH 1MQKL 1FZOA 2DQTH 3CZFB 3P73A 4RGNC 4JRYB 4ZPVB 4MVBA 3T0EA 5BXFB 3LKOA 5FK9B 1C5BH 1LO3L 3MRGA 5EBLB 3O8XC 3PE9A 4AEEA 5C86A 1MREH 2GW5A 3IF1B 5F1SA 4HUUA 4OI9A 3I6LE 1W8OA 3NCCB 2H3NA 4OCYH 4IRZL 1RJCA 4NFBA 5IF0A 3ZMRA 3ARYA 2XTJD 4NN6C 1OP5H 4D3CH 3OGOE 4PJ7B 3ZYIA 2RB8A 4A6YL 4JZNA 1MLBA 3AXLB 4NRXA 3WXVH 5INDB 2FEEL 5DQDL 4R2GB 4KKBD 1G7QB 1T0NA 5C0ND 3LHPH 4Z7UE 3MJ9H 3PIQA 3QH3B 4Z7VB 3EO0A 4U2YA 5CKAA 1C1EL 5ITBH 3W2DH 3FFCA 4O51B 5EZIH 1E6OL 3KLSA 3TYGH 2FDBP 3LKSA 2YPKA 4OLVL 5C0BB 1FFPA 2KQNA 3L5IA 2Y06L 2VDPH 2FR4A 3WS3A 3IF1A 3EJZD 1IGCL 4KK5D 4N8VB 1B4JH 8FABB 5CGYD 1I9JH 3PWLB 4UIMA 3CNKA 4NC2B 2VDRL 5C0FB 4OQTL 1IL1A 4G5ZL 4OLUL 5D1ZA 5TDNB 2XPGB 1AQKL 3CLFH 5F7YC 4L8BA 4OZIF 4Y8DC 4P4KC 2FH8A 4Z77B 4YDKH 3WS6A 3G08B 1P7QA 3TIDA 4HWEL 3EO9H 4POUB 1ZLSH 3O9WC 1IJ9A 4TSAL 2QQKH 3IKKA 2LABA 4WHTA 3U48A 2R39A 2X4OA 2W0FB 1T20A 4CRPA 3L3GB 3RWGA 3VRIA 1JUFA 3MCKB 1UYWL 3QDGA 4JANB 2VSCA 4JKLA 4IS6A 3QUYC 3RL1A 3MV01 1MFAH 2DJSA 2HJKA 3D2UA 2BSSB 4JQVA 1KEMH 3JWDL 4Z9KB 3ZKND 3BGAA 4G6AD 4G8GA 2Z92B 3FQXA 1PKQB 2BVQA 3L3IA 4OCMC 5CD5C 4X9GA 4G9FD 5FHBL 3CFDA 4PRID 1IL1B 1OL0A 4KRPC 3ZZ1A 1YYLL 5C08B 2NTFA 5T1DH 5DI8B 4OM1H 2EZ0C 5EU4B 2HFEA 5DEGB 2FZ3B 5CKGA 5I8EA 4RIRA 4WU7A 1FNGB 5F96L 2AABL 5D1XC 2CJUL 1RHHA 1I7TB 4PGEB 1WF5A 5I9QB 1T89C 4MAUL 4Z7QF 1OAUH 2JB5H 1GXEA 5FXCH 4ODWB 3T2QA 3H9ZA 3VGFA 5HYJB 1UWXH 1WIPA 1TXKA 4OFYD 1CGSL 3F7YA 1CE1L 4DKFH 3MBED 3SJVA 2XQYK 3BUYB 5DJCB 1AC6A 3AGVA 4ZFOB 4LKCB 4NWTH 4PRNB 1B0GB 5B39A 1IC7L 4PRPB 2NZ9C 3FHAA 3DVNA 3IFNL 4M6MH 4AIOA 1G0XA 2OL3B 3CXDH 3V8OA 1AXSA 3FN9A 4X4ZA 3RL2A 3GUTA 4FTVD 4U1SA 1FJ1A 1I1AC 2R1WA 4Q7DA 2HT3D 3B9DA 1E4WL 1HH9B 4XWOC 4KVCH 3QG6B 2NXYC 2P8PA 5DWUH 3V8CA 3TFKC 1N3NA 1LGVA 3PF2A 4JDZA 5K59E 1S7TA 5D6DA 4X6DE 4XNZB 5DJ8B 4ODXB 3HUJA 1I7TA 4HMCA 4ZS6C 5BVPH 3RWEA 4JPWH 2EXYC 5CEXB 3RPIA 3VXUE 3G6JA 1P84J 3OR6A 4OZFH 5DC4B 3QDMD 1JPST 1GVIA 4PJXE 4ZS7H 2E7LE 3PQYE 3QT2A 1LO2H 4RMWA 4P3WA 2X4TA 3DHMA 2OL3L 4WY7L 5C0CE 2NY3B 4XXCC 4M4PA 4HIXH 3O6FB 3VXQA 4EQ3A 4BH7B 1HQ4A 3E6HB 2D9QB 2IQAA 1OTUC 4LDLB 4XNYH 4PB0H 5J3HD 1WLHA 5IKCA 1ZT7A 3GSQB 5HI5C 2HTKD 5D7JB 3HPLB 4OT1H 4ZUUA 4ORGB 3FMGL 1VEPA 4W6YB 4X6CE 4UQ3B 3HS0A 3BUTA 5HGDB 4TULH 5AD0B 3JTTB 1I85A 1KPRB 2W0LA 1DUZA 4LSSH 1WITA 4X6FB 7FABH 4J12A 2LTQC 2ITDA 2APFA 2NY1D 3BH9A 4K3GA 3EDDA 4TVPH 2B5IC 2P8LB 3L3OA 4NKOB 2E7MA 4WHTB 2W9EH 1X6LA 1MH5A 5C9KA 2C3VB 4YPGA 5ESQB 5DD3L 4KK9C 1J0IA 4HWZB 2DQEH 4APQC 3ARUA 3OAUH 2HLAA 1MIMH 3FTGA 2FYYB 4GKSA 1EHLH 3QIUC 1NBYA 3BO8B 1KSRA 3AAZB 2UZXB 3C09C 3STLA 3VWJC 3JWOH 4ZFGH 4JKMA 1FDLH 4KK8C 4L4VD 1WFNA 3INUL 3ZE2F 3RIFF 1H3TA 1MY7A 4PJHB 4KI5D 3TJEH 3K2UL 4Q97A 3RWHB 2PTTB 5IB1A 1SJVA 1N6VA 1HINL 3G5YA 3I50H 2FX7L 1MHCA 3OG6B 3BWUC 3MREA 2BCKB 2M8XA 3UTZB 4CN4A 3QCUL 2RHEA 5A2IH 5I1LA 1DR9A 1QD0A 4AG4L 1F4XL 5CJOL 3ARPA 1BPVA 5HHMA 5FV1L 3PP4L 3C5JB 3MPCA 5DEGA 3L5WA 1DCLA 2AK1H 4GAGH 1FPTH 5JHDE 1CLOH 1MPAH 1IGTA 2CD0A 3KPSD 2OXHA 2XV6B 2DAVA 3S34L 5D1ZC 4CVZB 1D5XA 3QQ4A 5KVMC 1X5XA 1YQ2A 1DE4A 3BP6A 1IM9D 1NAKH 3B9EA 3WFHB 3WFBL 5ICYB 3LKNA 2Z8RA 3KAAA 1HZHH 4PRIA 3O2WH 1N8ZA 4I4WB 3GSNH 4P23D 3T8XA 1N4XH 3ZKXB 3KPQB 5I75C 5L9DH 5DJZB 2GK0A 1I8MB 1N26A 5T1MB 1RULH 4Y5YA 4OZIB 4NT6B 1LNUB 5IT2H 1RY7B 4XBPA 5D1QC 4R2GC 4KY1H 5GGQL 5H37G 1FAIL 3BZFA 3MA9H 2O5XL 1TNNA 4F7PA 1JF1A 3B9KC 3C60C 2QQQA 4R7DA 5EU7C 3DXAE 5F7EL 2F9BT 3ULVH 5FYJU 3ROLB 3E8UL 1JGDA 5E6ZA 1GRWA 3IDIB 3P4MB 4V1DE 1CZ8H 1OAZH 4XXCA 4IM8A 1LEKA 2FX7H 3TBYB 4LASL 4QY8B 3H0TA 4C83A 1OGTB 4AIZA 4M3KB 1S5IL 4F80A 1EGJL 2GUOB 1K3ZA 1HH6A 3VRLF 3RGVC 3HC3H 2BVOB 1MVUB 4Z7VF 4Y2DB 5JPNB 3SKUD 1IAII 1I85C 4GAGL 4AH2A 4P23A 2R1WB 3GIVB 1UM6L 1K4DA 2AEQH 3WIIH 2OM5A 5F7KC 3DETD 1A3QA 1UJ3A 4YIQB 4H20L 1A1OA 4MS8C 1YN7B 4C54A 3OJDA 4XH2A 5HYJE 1IM9A 3RRQA 3GI9H 3HE6C 3S97C 1JPGA 3BZDA 3G5VA 1IC4H 4JFQA 5F7WC 1J18A 1X6NA 2VDKH 1MF2H 2AP2A 4ZUUB 3QQ3A 3IJSB 1Q9WA 3MRLB 4JFED 4PGBA 3U7AA 4NKQB 4JKWA 4GKNB 1O0VA 5INDA 5C07A 2EDLA 4NCC1 2X1OA 43C9A 2GEEA 4JCMA 1E28A 4NZTL 3DX8A 2H2PC 3P4OB 1K9TA 5FB8A 3IGAB 3VFNB 1R0AL 4NUJA 2WZPD 2YPVH 2VDQL 4AK1A 4YR6B 1VGEH 5T3ZH 4EOWH 3OKNB 4BM7A 5I6XB 5LKNA 4QYOA 1ZWIB 1RZKL 2J6EA 5ANME 3UTPE 1IKNA 4I4WA 3LEYL 2E27H 4OZGA 4D8PA 2ATPA 3D87B 2MCPL 3VFSB 5ACZB 1XCQB 1H8NA 1PSKL 3RAJH 1DBKL 2AEWA 5I1EL 1HHJA 1JZ4A 4LSTH 1MHPH 1GIGH 3SKOB 2X7LA 4K9EL 2KPNA 5EU3A 3ARDC 3FQUB 3BD3A 5D1XB 2N56A 1CD1B 4LRIA 4XHJC 1IBGH 1JPSH 4F58H 3HC0A 4GRWF 1CT8A 3RGVB 2Y6SC 2BSTB 3TO4C 2YHGA 4JAMA 1PG7L 4OD1H 4QRQA 4F8QA 1YC8A 3IDNB 3W39B 3VXTB 3FN3A 4D0CA 5EUOE 1JTTA 1S9YA 1J0KA 3LKQA 2K3TA 3UJJL 4HIXL 1SJEB 3UBXI 4C59B 4PV8B 1L7IL 1K8DA 3MRDB 4FQ2H 1SJHA 1N5YL 4M6NL 5ILTL 5JHDD 3JWOL 1SEBB 5FGCB 1YEDB 3INUH 4Y4HD 4R26H 4LMQE 5JIIA 4QXWA 4CU8A 5DGRA 1J5OL 5DXWA 2DQEL 5GS0L 3BGMB 2Y9RT 4EOWL 2YPLA 2DQHL 4WFGE 5EH1A 3SE3C 5SWQA 2HKFL 3SKJH 2APWA 2WWKO 3DV4B 1QFOA 5E4EB 1SY6H 3PGCB 3BH8A 5EOCH 5IM7A 3V6OE 2W9DH 1BF2A 2YBRA 1FP5A 4RDQG 1ZOXA 1Y6KR 3O9WD 3BAEL 5DSCA 1A6WL 3GIZL 5FYLD 5IEKB 3H3BC 4LLVB 1M05A 2AJVH 4WUUD 1QR1B 3QIWA 1AJ7H 3QO0A 1HHGB 3DSFH 4MHHG 2GJZA 1N0LA 4GG6F 1FORH 3VXPA 3DO7B 1S78D 4LCYA 2YUZA 3GBLA 3QBTB 3TCLB 3I9GH 3D69A 1HYRC 4OCWL 3X13A 4M1CD 4G6MH 5TDPA 1A6UH 3KWWB 3MRMB 1Q8MA 1QEWB 2GTWA 2QHLA 3VE0A 3HLAA 1K4DB 3FRPA 3QNZB 2ENYA 5MEOA 2JCCA 1GGBH 4W6WB 1TJGH 4AL8L 4WWKD 5HGAB 3V0VB 3ERYA 5DFVC 2VJXA 1NCAL 4Y4KD 3V5KA 3ARGB 3VWJD 4Z76B 5BXFA 5T5NG 3NMEA 3OG4B 4BFEA 4Z78B 3TF7C 1D5MA 1CXKA 1DQDH 2CRIA 2PETA 3GK8L 3GMRA 4DGIL 3NCFB 5I75B 4BSVB 4MAYA 1UKTA 4YBLB 1SEQH 1U8KA 3RBSA 1J88A 1HHIA 5E6IC 1QLEH 1DEEA 3Q2CA 2L4OA 3CFEB 2EE6A 1MAKA 5E94A 5LQBH 2B4CL 1AIFA 3L5JA 3MRLA 4PGBB 1MVUA 1J87A 1FZKA 1NGQH 5JMRA 2EE9A 4G9FA 4JEGB 4G5ZH 4RAUB 5EUOF 3VXUD 4IRSC 4Y4HA 3V4PL 1XFPA 2EECA 5I18H 3ES6B 4G9DA 1NGWA 3MX0A 5BCAA 5F88B 2NX5E 4Y4FD 5TFSL 2EDDA 5F7DB 2BVUA 4YDKL 5SX4I 4JR9H 2WBJD 3QUMH 5GRUH 4B5EA 1B0RB 5ENWB 5ESAB 3MJ9L 2DI9A 1MCIA 5F7EH 3TVMB 4HWNA 5GRYA 2J12B 1FVCA 4XTRC 2R69L 4NQED 4EXPX 2VOTA 3UMTA 4F57H 4KTEL 5A2FA 1I1FA 1MFEL 1CICD 4GAJL 5DO2C 5D1ZB 3MQIA 4Z7UB 1OAKH 5GS0D 1KGCE 3BPNC 4PJGF 1LEIB 1WQVT 5E99L 4J4PD 3NIDE 4F7TB 4JRXE 2Q7YB 1NCWH 4KUZL 2IPUK 4Z95L 3OR7B 2E9JA 3B6SB 1VA9A 3VWKA 4JRYD 4M9PA 4X99A 2NR6C 2AVGA 4B50A 3AM8A 4P3CH 4P3DA 3ORJA 3IJYB 4AIZB 3BGFB 1NGWB 1T3FA 2GFBA 1H5BA 3KLAA 5CEZL 1AO7B 4JANA 5C0EA 1J7VR 5AZ2H 2LU4A 2UUDH 4EVNA 4LLWB 3SDCC 3VW3L 5FA4A 1Z9OA 4C4KO 4ZTPH 2VLJE 5IHUH 5E56A 1T1YA 3CVIH 1F45A 5K9KA 4RGMB 3S96B 3UZEA 4FQPA 2FJGA 3LDBB 1G7PB 6CGTA 4LEOA 1JF6A 2F53B 4HW6A 5A1AA 4WW2A 1AI1H 1PGRB 3BH8B 5EU6D 3QYCA 4KJQD 5I1CH 3UCRA 1WIOA 4P2YA 3TZVD 3E2HB 5E7BA 2D0GA 4PGCB 1Q72H 4X98B 3OJ2C 1AXTL 1T0NB 4O4YH 2IPTH 2V7HB 1QSFE 3MO1B 2CR6A 5IQ7L 5JNYB 2VE6B 4JN1L 3PNWB 5BMFL 2WAHA 4QHLB 2DKSA 3M07A 5BV7L 4HLZH 2VZUA 5JW4N 4JPWL 1IAIL 3H9HA 4G42B 1G7MA 1XGYL 3QIBA 4HF5H 3S36L 4PS4L 3LN5B 4PGZA 5L0QB 4V3DB 5D6CB 1TQCB 2IMMA 1J10A 1JWMB 1MUJA 3MLXL 5JDSA 1B0WA 5KBNC 5IHLB 5DHYA 1QR1A 4CNIA 5DEFA 1T20B 2IAMB 3O6FD 3ARTA 3QO1B 4JRYE 4WI2A 5C0GB 1U8PA 1P9MA 2EDRA 3W9DA 3MGOA 3V4VL 3EKCA 4HUMB 4Y4FA 1NAMH 1N3NB 4LRNH 3T3ME 4Z8FL 5E08L 4HAFA 5AWNL 4HIEA 2FGWH 4TULL 4CN1A 5E94B 5HHVL 4JM2F 4U6XB 1KIQA 1MHEA 2EIZB 1EFQA 1NEZA 3WO3B 4FXKA 3VD3A 4Z7NE 4G8GD 1LVEA 2UUDK 1CF8L 4ZOAA 3CLEL 2A77L 3CZFA 4K7PH 4J3OC 1FLRL 1FGVH 3GDBA 1ACYH 1GSMA 1ULVA 2JJSC 4RFNB 1NCCH 3O6KL 3KPSA 4NRYA 3BP5B 3HNSH 4U1HB 3WDJA 2VWEC 4Y2DC 3GSUA 3V7MA 4R4FL 4M8VA 1WBXA 4YXKH 3EYFA 5F3HA 5KTEH 2DWEB 5TQ0L 1S7WA 3HHRB 1RMFH 2RFXA 1ADQH 2J6EL 1Q9WB 3BPLC 2ZSVB 3VWJA 5TFSH 5IW6B 3R0MA 3NH7L 2ATKA 1JHLH 1K8IA 1CR9H 5BVJA 5J1TC 2XTJC 4PJXB 3P0YL 1CCZA 2OYPA 4XWGH 4DAGL 3VH8G 1JYXA 3EYVA 4QRSA 4N0CC 1N0XH 1QSVA 2OR7A 4ZYKB 3MLXH 3LB6D 5D71H 3GNML 3VD7A 4P59L 1IAMA 1HHGA 1INDL 1KBGL 4NO5B 5I1IL 1A8JH 4WVRA 4KXZH 3H9YA 4JY6A 4YWGL 4PJAA 4AENA 5KN5A 2HFFA 3TBTB 1YA5A 5CJQH 4NZRL 1A1NB 4KDTC 1I9IH 3CMOH 4OIIL 2WP3O 2YD7A 5KVGH 4OZGE 4MXVF 1XGUA 5T3ZE 1UB5B 1U8MB 1A7NL 1KIRB 2Y72A 3RVUD 5MEQB 2P49B 2EIDA 4M1CC 2VR5A 1A7BA 1IM9B 1CFSB 4MSWA 3RWFB 1DFBH 2E6QA 3PP3K 4ACPA 1S7SB 2BVYA 3WJJA 4LSDA 4XC3H 4HJ0D 1YPZF 8CGTA 1OQOA 2X89A 4WHCA 3QG6A 1QSED 2X4NB 3WNOA 5KSAC 3I6GA 3L6FA 1Z9SA 4I13B 2IALA 1MCFA 4PJ7E 4HHAB 4WHDA 4QXUH 4JREB 4KMLB 4F15C 4P4KA 3CDGA 3O2DH 5JA8B 3VXPB 2X44D 1JUFB 5ICYA 4JQIL 4URTB 2N7AA 1X5JA 4ZODA 3C2AL 1NC4B 1MFBL 2ZNXA 4RA3A 5EOQL 3TBVB 1S9WA 1KLUB 3BIAX 4OZHF 4YO0B 4XPFH 2KL6A 3PWNB 3BP6B 4WRLA 2VLKB 4JLRB 2AK4E 2ZG2A 4X7EC 4LSPL 3NFPA 3O2DA 1Q1JL 4Y19B 4IMKA 5B22A 5L6YL 3LN9A 3FO1A 2R8SL 3HZVA 4UT6L 2IAMA 4JDVB 3QEQE 1NAMB 5LGHH 5EU4A 3V52L 1DANT 5E6ID 5EORL 1II4E 1ED3B 1HXYB 5DT1H 1T66C 1H3GA 2W0PA 4KHXH 4IRSB 1CQKA 2EH8H 4JY6B 3WN5C 1NGPL 4I2XB 1K8DB 3MRDA 1IQWL 5GRXG 4MD5A 2VLJB 3TCLA 1P4IH 4IS6B 3RL1B 2R1XB 3NPSB 4ZDHA 2Z8WC 1RK1B 3VGAB 5EBLA 3MGTA 1KB5L 3QEQA 3U4EB 5EZOL 3B9AA 1KCSL 2PW1B 2RCSL 4XAWL 1EA9C 3FRUA 3WFCH 1Q9LB 3FT3A 5D70L 3KLAB 4YHYB 1CZ8L 1OAZL 2BSRB 4HMEA 3PHQB 3TT1H 3QDJA 2HN7A 5EZJA 3GBNL 5BW7C 4R0LB 1UH4A 3L5WB 4S0TD 5I16A 4FFWD 1OPGL 4WENB 4ENED 1HI6B 3WDHA 3JV6B 2DI7A 1S5HA 1HYSC 1Q9KA 3SO5A 4FFZL 4YH6A 4OCXL 1A4KB 4XT1C 4YBHA 5HSFA 5IQ9A 2OI9A 3LEYH 4O2CB 1N2RB 3MZGB 5HJ3B 1QOKA 4ZQKA 4LVOC 3O8XD 3G6DH 1U3JA 3KLHD 5HHVH 2DTML 4GXVL 4GT7A 4NBZB 2VQ1B 1VFBA 4FQHB 1IGYA 1QO3A 4YHML 1VFUA 2DJUA 3HFML 4GFTB 4L5FH 4LCUB 4WFED 4HH8A 2X4PB 5EBMA 1UM4L 1HQRB 1HILB 3QIWD 1HQ4B 3E6HA 3V6ZA 3D9AH 3MRJB 2IQ9H 2NXZD 3MRBB 4YHPA 2VLRE 3O6ML 5E8PA 3EFFB 4NIKB 4G8EA 3IFOB 2YC1A 1NAMA 1CE1H 1YY9C 4OFPA 2MPAH 4FQCL 4W81A 4AG4H 5I9QC 5LJYH 1N5AB 2YPLD 4F9PC 3DROA 3UX9B 2NXYD 1YPZE 3O6KH 4OT1L 3EOTH 2MQ3A 4PJAB 1CFTB 2ZCLL 3TGXA 3WFEL 3AS3A 4LHUG 4K8RC 5JHDA 3SKNA 1OAXH 5T5FL 1NUFA 5TE6H 1DBKH 5I1EH 5C2BL 5I17A 5D72L 2X4QB 3QWRD 3OKOB 3O9WB 5IGXH 3I6KB 3IVKB 5LWYL 1U8IA 4GRLD 4JFZH 3SE9L 4DTGL 5C8JB 1SJHB 4I77H 3LMJL 4X8XA 4P2RD 1U8NB 4CVWA 3SOBL 1R5VB 2DYPA 3VA6A 4G6JL 2H32B 5EZLB 3P77B 4NQDB 2PN5A 5C0NC 3T77A 4NO2A 2DOCA 5JIHA 4JHZA 4RNRA 2A73A 5TGBA 4NSKA 3EZJB 2CO7B 1U92A 1VSCA 4FG6C 4XVSL 3SDCB 4HC1L 3K1KC 4L3CA 5HDQH 3VWJB 2VXSL 3DOSA 2CK0L 1CFTA 1BFOB 3SDDC 3E2HA 3GM0A 1HNGA 1VESA 1F90H 3ARGD 5F70A 1D5XB 4NQUA 2WK2A 4TTDD 5DRXA 4YQXH 1TCRB 4O4YL 3AVEA 5FUCC 2HWZH 4GW4A 5M94B 4F37K 2YC1B 1ZHNA 5D2LF 2ADIA 5BQ7A 3EO1A 2ARJB 3QWQB 3TA3A 1CFQA 4MJIA 3G9VA 1FO0B 4LHQB 5IB5A 1NCNA 1KYOK 4BKLB 3VH8B 4MNGB 2OJEA 1FBIL 4WTXA 4YBLC 1XF4B 4IRSA 4QTIH 5FKPA 2AAVA 3RPKA 2P5ED 2ERJB 1N59B 2R0KL 5I18L 2FO4A 1X5IA 1RULL 2H26A 2QR0B 3QDGB 4YBQD 2X4SA 5I17B 1IAOA 5AZEH 1UXWA 4IEFB 3OPZH 3QXDA 3HE7C 1MRDL 4LVOB 5GGRA 4KQ3L 2X89D 2PR4L 3QFJA 4PTUA 4FZEL 3STBA 1JK8B 1NMBH 4LQFH 3U0TB 4EDXA 4TUKH 3BEVB 4PJ9D 1BGXL 5EA0L 4TNVK 5GS2D 4U6HB 4S10A 4KWUA 2DQTL 4OAWB 3GFUA 4ZPTA 1KFAH 2BNRE 1P84K 1JWMA 1OT2A 5GISL 4Q9RL 2AXFA 5EO1B 2Q76B 2X1WL 1LDPH 1RVFH 5CSZB 3V0WL 1TNMA 1KOAA 3FB6A 4HS3A 2JCCF 4BSWA 5IW6A 1FYHB 4R7NA 3FO9A 1XF1A 2XN9E 3STZA 1OQXA 2YMXH 4DZ8A 2PNDA 2I26N 5KOVC 2MOVA 3KWWA 4MJ4A 4RMVA 1J8HE 2CKBB 4JJHA 1VFMA 2FIKB 2HT2C 3HE6A 5IT2L 4PJ5D 5I1DA 4NWUL 2F5AH 2GJ6B 5EBWA 1BFVH 5JQ6L 3MA7B 4WWKB 1OLZA 4ELME 2NZIA 3QZWA 4GW4B 1UKSA 5DTFA 4MNQE 2EC8A 4KUCD 3RJQB 4DN3L 2DLGA 2EYSB 4I0PB 1I9IL 3MJGX 1BFSA 5D4QA 1DEDA 3DGGB 3RKDC 4W68A 5HHNA 3QEQD 2E7LA 3RP1A 3S4SA 3PDDA 5E00B 2BVQB 3BD4A 1ZXQA 5IFJB 3KPRD 1FJ1B 1OWRM 3QFDB 4OB5H 2FCBA 2XRAH 2O5YH 1NL0L 3Q1SH 1Y0LA 4QXTB 1CDGA 4ODTL 3U46B 1F4WL 2AERT 4MLSA 1FFRA 5KTEL 3IFLL 1HHHA 1EDQA 1KN2H 1VPOL 1T83A 1T5WB 2I27N 4P3DB 2F54D 2DQCL 1GHFL 5CJXA 1AHWB 1T2XA 3MUHL 4WNQA 1URLA 5GJTH 1FL3A 4O02L 5FYJD 2IAMD 1A6UL 3REWA 1NEUA 3WLWC 4F9PA 5F7DA 4GUPA 3VFMA 5ITFA 3FCTA 2EYSA 4NO0B 1HSBA 1RK0B 2ZCLH 4U2ZA 5I19L 2YD5A 1MIEH 1XZ0A 1TIUA 1V8HA 3TO4B 1MFDL 2C26A 3NTCL 1VGEL 5T3ZL 3N50A 1RZ7H 4JHWL 4Z7WA 3VMPA 1J05A 1NAML 2GT9A 4PJIE 2HTLC 3F7QA 4GH7B 5D1ZD 2P5EA 1PSKH 4XCCH 2FJFB 1R5WB 3ULUL 4UTBL 2OTUA 3DIFA 4P2OD 5SWZB 1MJ8H 3FB7B 3TZVA 2JJSA 3U7YH 3TPUA 2ZNWA 5HDLA 1FNSH 3MROA 2EDYA 2YN3A 2W65A 3QULB 5TH2B 1R3LA 2O61B 4MWFB 3BUYA 4GUPB 4F3FA 4R4FH 2R1XA 3NGBB 1AO7D 4DKFL 3GSXB 4YX2L 3DSNA 4LHUA 5A2KH 2XKNB 1ZA3A 3TH2T 1S9KC 1U3HB 3VI3E 2Z91B 1G9MH 5FV2A 4P9HC 5EZOH 1RJZA 2BERA 1HOCA 3OXSA 1SVCP 2E7CA 4QCIA 4MCZA 1C5CL 1I3RA 2AV1A 2EDEA 3HMXL 2YXFA 3SDAA 1B88A 2FGWL 4ZD3L 1MHCB 3E8UH 1MJJA 3TEUA 1UH2A 1N6QH 2BXYA 3PGDA 3BZEB 1U0QA 3O3EA 4AEIL 3MV9A 1C5DB 2CK2A 3DYMA 2EKJA 5GISH 4Q9RH 4RISH 3IXAA 1IGIL 3UTQA 4ZNCD 2PO6A 3HAEG 2NY3C 4DKEH 1ZHKA 5DR5H 3FO0L 4NUGL 3MLVH 4GRLB 3ETBF 3TVMC 1GGTA 4P2RA 15C8H 1G6RL 1BGXH 3JV4B 1XF3A 4PJ7F 3RFZC 4DUWA 1KCUL 1FE8H 4FFYL 3C2AH 4LPXA 1U6AL 5GRVL 3HPLA 4X80L 4CDHA 3BRDA 2XKUA 1WWCA 4TSBL 1TZIA 4KFZC 3VXRA 4IMLB 1RV6X 4BSWB 3ZE0E 1R3JA 4DOHE 3TNNB 3O2DL 3GJEB 5EWIH 1MJJB 1G6VK 3ZT7A 3J8F7 4GMTL 4XNUL 4E41D 5TF1L 1MJUH 5ICZB 1KNOA 4U6XA 5GZOD 3I2CH 4YZFF 5T3ZD 5GRUL 4HWZA 1MCWM 2ZUQB 1T22B 1J9CT 1RZFL 1SEBA 2XZCL 4U0RB 3HAEB 1VFAA 4KJPD 3VFMB 1U8MA 1KENH 2BSSA 1NPUA 4HQQH 2CRYA 1A6AB 3P0VH 1DFBL 5EOTB 1MPAL 4U6TA 4LSQL 2R56H 3ARGC 2NYYC 4P5MB 3RL2B 4KTDL 4I9WD 4TTDC 2HG5A 3CDYA 1AC0A 4Q0XL 4YEFA 4OZIE 3H7LA 3AXLA 3I3EA 2VLJD 4L3ED 4NRXB 3RWCA 3B5GA 5H37H 2F15A 2P5EE 5DD3H 2FJFA 1PYWA 4PB9H 2JKXA 3T4YA 3S3JA 1U93B 4LLVA 1BFTA 1OTTC 2DWDB 4EQ2A 4NQSB 1T0MB 1U8OA 5ACLA 1AKJB 2V2WB 3NZHH 2BX5A 4BZ1H 1P6AB 1SYSA 2P48B 1RZ7L 32C2B 5JIPA 3QUYB 3V6BR 1UADC 2OZ4H 4G59A 2CQVA 3FB7A 4HBCH 2NPLX 4PJ9B 1L4IA 2NTSP 5JOPD 1ZA3B 1UB6B 2HMIC 4XMKL 1VGKA 1L6XA 1NAKL 4LK4A 4U1GC 5D72H 2AXGA 4Y89A 4M5YL 4ODVH 4RISL 3WKMH 1OCWH 3MODH 3PHSA 5ESVB 3O11A 1QLFA 1DUZB 2IPTL 3EOTL 5DJ2B 4CU7A 2F74A 4RIRB 4GBXC 5FGBA 2ESVE 1G7LB 5DRZA 2AXFB 5EO1A 3BQUA 5GS3A 1RZGB 1IEHA 5DHYB 5E6IA 2BOCB 3H7BA 2X1QA 4QXTA 4J4PA 1ES0B 1G9ML 5DD1L 3KHOA 5D1QD 4XGZA 5JPNA 4UDTB 1T7VA 4UZGA 4OTXH 2PYFA 4LCUA 1MNUH 3MRGB 5AUMB 5GQBA 1A0QL 5EIIA 3TYFB 2HTKC 4Y4FC 2XFXA 5D1QA 1P1ZA 4KXZI 2CRMA 1MJ8L 4JPKL 1DN2A 3KR3H 3HE7B 3X14A 2XNAA 1NCAH 1JNHB 1G7IA 4GRMA 5BO1H 2IAMC 2NY0D 4YHKL 4JY4A 1K5NB 4JKPL 4UBDC 1HI6A 1YEGH 4XNZC 3DTXB 4GW5B 5K59F 1PZ5A 1AD9A 3AREA 1V3JA 4WDIA 2AQ3A 4XCCL 1CDUA 3DRTA 2V5YA 2VERN 3TP4A 5E7FA 5CBAB 2CIIB 2Q8AL 5CIPH 2DRUA 4Z7VE 2AJXL 5IBTH 4ZQKB 2F58H 3P9LA 4ZUWA 3DO7A 4HKJB 3MCLL 4KV5E 2AABH 2H8PB 3RGVA 1L0XA 4GKSB 2UWEA 1BM3L 1IQDA 3O3DA 4ONOA 3RI5K 2FR4B 1HDMA 1DBJH 1DQMH 3UTTB 1NEZG 4RGNE 2NY4C 3HI1B 4RQQA 5HHXL 3PNWA 4L4TD 1EVTC 3MRPB 1N6UA 4WUKH 4I0PC 3S35L 3KYKL 2CJUH 1FRGH 4TVSa 1UM5H 3HPJB 2IWGA 4G80A 3B3IB 1NMBL 1HYSD 1LP9B 2DQFA 4MMXC 4YHZH 3P11L 3ARFD 5FOJA 4GBXB 2FX9H 4KRNA 1BLNA 5BV7B 5IJVA 4G9FE 3DBXB 1RUPL 1HOCB 4L3EA 4NZTH 4WIQA 2CIIA 3PV6B 3QXUA 2ICWJ 3D0VB 3C9NA 1WIUA 4RAHA 3BQUC 4WCYL 1ZTXL 1I1AB 1AFVH 3PWVA 3K0WA 2ID5A 4K23L 2HKHH 4S1SL 2A0LD 43CAB 3WL9B 2JB5L 3F6LA 1T03H 5DUML 3VGEA 1J0YA 1T5WA 5F3BA 4PJ9A 1NGZA 2DBJA 3CLFL 3GMLA 4GKOA 2DIJA 1KB9K 4X7FC 1U3YA 3JZ7A 3ZE0F 4R90L 4NJ9H 4WW1A 4K3HA 3QIUB 4PJ9C 1PX3A 1P6FA 4K9EH 1QRNE 4ETQA 2RCSH 2AKRB 2UVEA 4I9WE 4XBEL 5CGTA 1A02N 1HK6A 5FYJE 1RURH 3DTXA 4UT9L 3S4SB 1U93A 3AY4C 3JTSA 4FP8H 4MDJA 1VGKB 4NHUE 4GBXA 5FGBC 2CKBH 2FSEA 1TZHA 4EUPH 3QCTH 3FN0L 3H7BB 3LVEA 3TWCL 5C08E 1UACH 3RUGE 3OKEB 1WBZB 3BPCB 3C5JA 3DJ9A 4UV7L 2AQ1A 3NFNA 2F74B 3DGCR 3FL7A 4MA7H 1FG2B 4HHAA 1W0VB 5E1HB 1PKOA 4S1QL 1JWUB 2VC2L 5DJ8A 4M4RA 2YWYA 1E6JL 2DLIA 3G5XA 5EA0H 5I1AA 4GLRI 3BPLB 1YJDH 3QQNA 4LQFL 4XCEA 3VFOB 5I15L 4RWYH 1P7KB 2HT3C 2NX5B 3MUJA 5FA3B 5GS1C 3WCYA 2X9XA 3UJIL 2IBZY 3BGFC 5D7LE 2NY5C 4P2RB 1P53A 3RWJB 4WUUE 1D9KA 5LBSL 4KAQH 5JXAL 5L8JB 1WFUA 2Y1VA 4JM2D 5TGBB 4PG2A 4PJCA 5C0AD 1GGBL 2X7LB 4LCCA 4RZCB 2HT4D 1FC2D 4M7ZB 2H32A 1QQDB 2VDNL 1SQ2N 1RUML 3GKWH 3VD4A 4M1DH 2EC9U 2JCCE 4Y5XA 4YUEL 2WIIA 2WP3T 3LRHA 4U0RC 2PTVA 4HIJA 3L3OB 4OFIA 1X5GA 3O3DB 5LAXB 4FQQA 1YPZA 3TYFA 4OFVA 4H8WC 2BRQA 3FMGH 4U1GB 4M7LH 4CDGC 5FDWA 3WJLC 2CUIA 1KJVA 1TJGL 1RU9H 2NX5A 3O41A 5FA3A 1BZ9B 2AJXH 1FYTB 4NM8L 1NBVH 2XXCB 4LSTL 4AM0A 1CF8H 3RY5A 1U42A 4ODVL 3WFDL 4N0YL 4XBGA 4XVJH 2NW3A 3UZQA 4O00A 2R2BB 1PG7W 1PX4A 1LNUA 1BOYA 5KVDH 1T7WA 4WO4C 2QSVA 1JPGB 5L9DL 1BLNB 4U1JA 5F8RC 1YEKH 4PIRF 2B5IB 2HA1A 3OAUL 4UT7H 2HTLD 5J13C 3VXNA 4NO0D 3MJ7B 4L1DA 5DSCB 1JI1A 2JF1A 5K9JH 4RMUA 1RIHH 3HZKA 1KACB 5KVEL 1OGTA 1UWXK 3RKPA 3W9DB 1JK8A 3BHBB 4PY7A 2VDLL 3CZJA 5E2VL 4Y4HC 5F7LB 4X5XB 3G6JF 1ZGLB 4FQCH 3SDDB 3FFDA 4EVNB 3TVMD 3WXWL 1PY9A 2C1PB 3MGTB 2F58L 1ERNA 5DMJB 3TH4T 1FZJA 2VLRA 5ID1A 5FIEA 4JFOA 2HVJB 4JY5H 4WFHE 3CFKB 4JREC 5DD5H 3FRPG 1UGNA 1XF5B 2QQLH 5KSBB 3TZVC 4UUJB 3HAEH 3FB6B 2YD8A 4P2QD 5HYSB 1NJ9B 1KCRH 1VADA 2YD9A 5DURB 1ZEAL 4Y16B 1AGEB 3RU8L 1J0JA 5CMAA 1J86A 5B3JE 3QIWB 2A1WL 3TJHC 5J11C 2AJ3A 3RPIB 1S3KH 3IU3A 5TE7H 2APTA 1XIWC 1LD9A 3OKEA 4HUNB 4NCDA 3GMQA 3O3BB 4HC1A 3KJ4C 5JHDB 1R5WA 1VFAB 1XGUB 3WSQH 4PRPD 1EFXD 2IBZX 5H94B 3B8SA 3HE6D 2UVFA 3NCEB 4M5ZH 4LGSB 3X11A 1KCGC 3HRZB 4NO3B 1HDMB 4XPFL 4JJ5A 3TCXA 2YPLB 2GJ6A 5EBWB 3QULA 5FECA 1EX0A 2Q6WA 5C0CA 3C5ZA 4JPVH 1KIPA 2Q86A 2ERJC 2ZUYA 3EBAA 2VR4A 4ONHB 4M6OL 5FFLA 4UQ3A 5B8CC 2KUTA 2SEBB 5KW9H 2WNGA 1YNTB 4R8WH 5DMIL 5FHAL 3U46A 4F7MA 1TQBB 5IB1B 5A43C 5ESVA 4NM8H 4Y1AD 3TVMA 4WEBL 4OGYH 4XX1E 3ULVE 1PZ5B 4PJEE 2H3NB 5E00A 3HUJE 1OTTD 1S8DA 4D0CB 4WUUB 3ME0A 4OZHA 3MV7B 3BKML 1WAAF 5B39G 3D1MC 4BZ2L 1LMKA 3I3BA 3KNBB 5KS9E 1XGPB 3CFJA 2FWOA 1K3IA 4XNXL 1I7RA 2AEQL 1W0YT 3KLDA 1H3VA 4IIQA 4J1UB 4K7PX 4MXWL 2HFGH 1DN0B 1HNFA 2CXKA 4FNLL 4KRPB 1KUMA 4NO0A 5C0IB 2QSCH 3CAFA 3NZHL 4FQLH 1CXEA 1MHEB 5D7JD 4QF1A 5GGSY 5GGTH 4AMKH 2GCYA 3LKSB 4YWGH 3VGDA 5I8KH 5CUSL 5D7KD 2XYCA 5FUOL 4NGHL 2CK0H 3T09A 5J12C 1FFNA 4NQCE 2ADGA 5DS8A 4RWYL 4HKXA 4OZIA 5HGHB 3S34H 4KTDH 2EYRB 4FRWA 5MP6L 1KEGL 4PP8C 4XPHH 3IU4H 2BOBB 4K2UL 5GRJL 3TA3D 4YR6A 3CVHB 3QO0B 5D2NA 5L88L 5IMKA 3FAWA 3B2VH 1ONQA 1E6JH 1XCTB 3BDYH 2ZSWA 3WIHH 4PRPE 3WHXB 2ZKHH 3LH2H 1S7RA 1FYTA 2Z35A 3STZB 4H88H 4XCYB 1A9BB 4PREA 3V5DA 1QA9A 1GAFL 1F3DJ 2NY6B 1EUTA 3IVKA 2CLRA 1TQBC 3TPUB 5CGYC 2NZ9D 1KTDA 5DUBA 5C6TL 1T89A 2P42B 3B83A 5D5ME 5C0AA 3LDBC 4JRYA 3AM8C 4Y2OA 5EWIL 5T3XE 4NNXA 2AGJL 4S11A 4NKIH 4P99A 3ZYOA 4Z7OE 4MQTB 1VENA 1VHPA 4GW1A 1KB5A 3T65B 3ZDYE 1LO4L 3GSOA 5HPOA 1GZQA 1P4BH 5KVGL 3CH8A 2H6PA 5IVXE 4D9RE 3KR3L 3OV6A 4N9OB 4NYLB 3MBEA 3SJVD 1S9YB 2OR9H 3QO1A 4OFYA 5C0BE 5CP7B 1LE9B 3QUZA 2DLFH 4IRJA 1NGXA 4H5SB 2FWOB 4JFEA 3U9PL 3R1GH 1SEQL 1EO7A 3OGCB 4EN3A 4R8WL 4GRLA 4BYHA 5IEKA 2PW2A 4RRPG 5E9DA 4DGYL 5DDHB 1W72B 2VLME 3P40A 4G6AC 5C08D 5CZVH 5CP3H 1B90A 3VXSB 3LPGA 1XGYH 1F4YH 1WC7A 4PJHA 3SE9H 4M61B 3D69B 5I1JL 4EI5D 3EO1B 2YK1L 1MCOL 2J8UB 2ENSA 5IJKA 3LS4L 1XZ0B 1I1CA 5CZXD 3D2UD 4U6YA 4QHMA 4FFVC 1YEJL 4WUKL 3S35H 3P0YH 4PP1C 4PLJC 4P2RE 1U3HC 3MBEB 2CUHA 2NNAA 3RU8H 4YPGB 5ESQA 5MERB 1WBYA 4EBQL 2R23B 3CDCA 1OGAE 5EC2A 2P7TA 3X12B 5D7KE 4TPRH 3MFFB 2CXGA 4R96B 5IBTL 4GQ9L 1FGNH 4QNPF 4FTVB 5IFHH 5CEZD 1P7QD 3T0EC 2FATH 1EAPB 2WBJC 2EYTB 2OL3A 2XRAL 1ACYL 2BNQB 1BAFH 5J11B 4MGXA 3FO2A 4PRHE 5DJYA 2ZOLA 4ISVB 4DCQA 3ARBA 3L3HA 5CWSA 5F71A 4PY8I 5ISZB 1KG0A 2O5YL 4D9RD 4HDIA 1MHHA 3DLQR 4X9IA 1JGUH 4K3JH 1IKFH 3ZL4H 2CKNA 3VXMA 1NGPH 4ZFFB 2IQAB 4LHUB 3ARBC 4YE4H 1E0OB 4HUUB 4DGYH 2BY0A 2VLRB 5ID1B 5HHNB 3GSUB 2APXA 1LO3H 3LCYA 4KUZH 1DZBA 4OCRL 4DJMA 4LFHD 4OV6F 1INQA 1G7HA 3GBMH 3SDCA 3O0RH 3NFSL 3GB7A 3QDJD 4HLZG 4MCZB 5JW4M 2YEZA 4MCYA 1NUNB 3CFBB 1TDQA 2FZ3A 3VFUB 5I16B 2PXYB 1TFHA 3GMMA 3MJ8B 3OMZA 3S37H 4XCYA 4QHKI 3E3QE 4LGPB 2AJZB 4O9HH 4PV9A 2D9CA 1MSPA 1NLBH 5TPWL 2F8XC 2OR8A 1YZZA 1K2DB 4RGOL 2IF7A 4JR9L 2QEJA 4FMFA 5FO8B 3ARFB 3CSPA 5TH2A 4JFYA 4XNYL