3SDCA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3sdcA01
5C09A 1BD2D 4JFQA 3MBEB 3WLBA 1YQ2A 4P4KB 1I3RB 1X9QA 4P2QB 5DD5L 4S11A 3BGMA 1AD9B 3T0XA 5CKGA 1QSFE 2B8OT 4S1DC 3VXOB 2YD2A 1A14L 1T66C 4X9HA 4YZFE 1F11A 5FUOH 4P46C 1MNUH 1NGWB 4UT6L 1A9BA 2CRIA 4Q9RH 5I0ZA 3TM6A 3WN5C 3MJ8A 3L3GA 4U7SA 4HS8H 4B50A 1TMCA 2LTQB 1T1XA 4GT7A 1BD2B 1WC7B 3R06A 3IJYA 3BWUC 5CKAA 2VXSL 4TUJA 1ZLVK 5KSBE 5IEHA 1KLGB 1QA9A 1MHHA 1AY1H 2AJVH 3QDGE 1J1XL 1JV5A 3IS1X 1LK2A 2CDGB 1QFHA 3PXHA 3G6JA 3PWUA 5F9DC 3C8KA 1KLUB 4KDVA 3EAKA 2CKBB 2NLJB 5HHNB 4RAVA 4YE4H 5F96L 3IAQA 2FIKA 2BSTB 2AERT 2GW5A 4LPWA 3MLUL 3BDYL 3SE4C 3LQMA 1HILA 4G7YL 4HH8A 4EN3B 3V0VA 5EOTB 5I1HH 2J6EL 1MELA 2JK5B 4MJ2A 4XMKH 4C56B 4EBQH 1A6VL 4P4RB 4Z7NE 5DO2C 4FQ1H 2DQUL 3GSXB 3TA3A 4PJAA 3PGDB 3EOAA 2F53D 3F5WB 4OCXL 4EI6B 1Z9SA 2BOBB 1NCUA 1XIWC 2PR4L 4LCYB 3MJ8B 1S7UB 5GJSL 1NEUA 3EKCA 5DMGC 2XZCH 4LVNB 3ABZA 2VN4A 1FSKB 1A1MA 2X1QA 4JDTH 1CXLA 1I3UA 3P11L 1GC1L 4Y5XB 3VGDA 4JGJA 3BP4A 2QV2A 2F53A 3V6ZA 3MLVH 3OX8B 3H9SB 4FQIH 5AZEH 1A4JA 4M7JL 5IBTH 3FO9B 4M6AA 2UZXB 5F9JA 4LIQH 1T0NA 5B39B 3MCKA 4R2GB 3OTTA 5HPOA 3T0EB 2ZUTA 1XGQA 4RGND 1T1WA 1ND0B 3O2WL 2D7NA 5GS2D 1QG3A 2WUCL 4DKEL 4XP5H 1VACA 1XR9B 2ICCA 1FZKB 4JGMA 4P46A 2IFGA 5AWNH 5E99H 1FCGA 2OR9H 4G6FB 5DJCB 4DN3L 1RVFH 2E7LE 5CS7A 3KNBB 4MHHG 3LD8C 4RAUB 4XVSL 4Q9BA 2N56A 3WUWG 2FIRT 3MYJB 1XGUA 3WCYA 2JTDA 3Q3GB 1Q1JL 5GIRB 1JPST 1S7UA 1FFOB 4JFOA 2R69L 5IIEB 2IPKA 4K7PH 2E9IA 3FQTB 3RY6A 4XTRC 3RTQC 4JFFB 1OTUC 4XPGL 2DQCL 1XF1A 4NNPL 3NMEA 1NCTA 2UUDK 4NQCE 3MV7A 1X5JA 3MX0A 1CWVA 4WTZG 2HFGH 2EIDA 3FT3B 3NABL 1YN7A 2GI7A 2DLTA 1JNLL 4U3HA 4XGZA 1A02N 1RZGB 2A6JB 4PRNA 1AC6A 2FEEI 4HUWB 1CT8A 3QR2A 3U4BL 1LDPL 1JF1B 3MJ9H 3ZDZF 5A1AA 1OAKH 1HYSC 3GI8L 2FJGA 1CF8H 3DSNA 4OF0A 5IB5B 2BSRA 4JFPB 4NQTA 4K94L 4LKXB 5EZIL 3TA3C 4E5XB 1CFNB 4QWWC 4EDWL 1NCDL 4K07A 1L9NA 1A47A 5EUOA 3WFCL 4FRWA 4JO3H 3WD5H 4HG4J 1E28B 2VC2H 4IRSC 5EFIB 4MMXC 3TYFB 4C4KO 5EU6D 3DVNB 1JGUH 4Q74A 4M8QB 4MAYD 4D0DA 4MAUH 5SWQA 4IRJC 2F54B 4LCWB 3UTSA 3VRIA 4BK5A 4P23A 4M3JA 2NY6C 1AKJB 4JREB 1N26A 5DXWA 4LSQL 3KPOA 4UOW0 2BVOA 5HYSA 5EIQA 4UDTB 4YZFF 5IKCA 1HINL 3OHXB 2NW3A 2GTWB 4MB5A 2DIAA 1T83A 4OZFB 1SBSL 1RZJC 2F8VA 1OPGL 4MDJB 1U8NB 3QCVH 4JFDE 3G6JF 1PJ9A 5BJTB 3P0VL 4K3JH 1WFTA 4NQXA 3GSUB 3T3PE 1K3IA 4OLZL 3M1BA 4V2CB 3BAEH 4AENB 5C0JA 1BIIA 2BNUA 3MV8B 2R4RH 2VDKH 3GMRA 2W0LA 4PFEA 5GJTL 1T4KA 1P53A 4YHNB 3LHPH 2UYLA 2O61B 1A3RL 4EI5C 5FA4B 5HXMA 3L3HB 3BKCH 3D18A 4PR5B 3KPMB 4M1CD 3FQUA 3CGTA 2QQKL 3KPRB 1QBBA 4M6NH 4K7PY 3EYQC 1WSST 4O2CB 4FQXD 5D71H 4HWBH 4ZFOL 4P5MB 4KKCD 3QQ9C 5CJ5A 2DTML 4DVBB 1Q0XH 4QRTB 3C5SA 3X3FH 2PW2A 1T1YB 2G5BB 4NUJA 4HUMB 2Q7NA 4Z7NF 4G6JL 1T03H 4M48H 2P8PB 2XXMB 3EYUH 3KJ4B 3MREB 5BMFL 2XWTB 5FO8B 4HGMA 5IT2L 4Z0BL 4P59L 3MRCB 1KYOK 5IFAL 4JKWA 2F5BL 3GB7A 1TVBA 1FZMB 8CGTA 3L5IA 1PZ5A 3CIQA 1EBPA 1QFWL 3S37H 3BEVA 4Y4FD 4PJXB 1MLBA 1MCJA 5D6CA 3QUMH 3HRZB 1J12A 5DR5L 1OTUD 2RFXB 3NFSH 4YR6A 3TH2T 3OGCB 3D2UB 2NR6D 4QRPD 4X9GA 3MLUH 3SN6N 1KCRH 2NZ9D 1VDGA 5EA0L 2A0LD 4RMSA 2ZG1A 3MJGX 2FECI 4XWOC 3BPOB 4MJIA 3EFDH 5GRXG 5JA9A 5EOCJ 3RL2A 5CIPB 2AJYL 4U6YB 1DQDL 4RGMB 5C0BA 4C55A 1AHWC 2EXWD 4Y19A 7FABH 5D2NB 4L29A 4QTIL 5L8KB 3QHZL 4PRPA 1MFNA 3VXUA 4R4FH 1FYTB 4FS0A 4WWKA 3SJVA 2V2WA 4P3CH 1VFAA 4FQXC 5T3XL 3RY5A 1BMGA 3B8SA 3SE8L 3SDDB 3S8WA 1L0YA 4HZAA 2AVGA 4MA7L 1I9EA 2WANA 5DMJB 5DK0A 2VXVL 4XHJD 5B3JE 4ODTH 5DF0A 4OLXH 2HVJB 4GG6E 2EYSB 4CW1B 2DI7A 4KK9D 2HTLC 3ARDD 5D6DC 2PKDA 2UZIH 1JYNA 4F37F 4LNRB 5C3LD 4KJWD 4QGTA 2EE2A 5E5MB 2Q8BH 3V52L 2DD8L 2HJLA 3MJ6A 5HHQB 5J4MA 1Y6MR 3K74B 5EZJB 1Q9OA 3OXRB 3VXRB 5D5MB 4UV7L 1F6FB 4J3VA 1I1AC 5IG7B 1LO3L 4NCDA 5I1JL 5D1ZC 5GGRB 2MMXA 1OTSC 3QIUB 1EHAA 2N4IA 2Y36L 1MWAL 2R0KH 4KKNA 4MJ6A 4XNQB 5GGRY 1SYSA 1XIWA 3DGCR 5TGBA 3UC0H 4L5FH 3EOBB 5CGYC 2C3GA 4I2XB 1U36A 1LK2B 4ALAL 3W0WB 1YY9D 4ODWB 5DK2B 4IDJH 1EJOL 4BQBA 2P7TA 5D7LD 1SY6L 1BBJA 5TE6L 4GSDH 2HG5B 1NC4A 4NKIH 5FYLL 4XP6L 4N0RA 5ICZA 1U9KA 1KCUH 4N1EA 1GJIA 4H8WL 1X5YA 2X4PB 5EIIB 5GZOC 3RWGB 2O26U 4DN4H 1JFMA 1IGTB 4ZNEA 1HSAA 4Z76B 1UQSA 3FOLA 3UJTH 5JOPE 4QOKD 4I9WE 2F5AH 4QXUL 4Z7UA 1Q9LB 5EZJA 4HIXH 4FQLL 4G43B 4Y4KB 1NGYB 3L3JA 5FGBA 1UGNA 2HVKB 3T2NL 2YOCA 4YDVB 5JMRA 4IS6A 1XF2A 2VERN 4OCMC 4R26L 4OV6F 3PQYD 1P2CA 3MLXH 1EUTA 3P2TA 3GSOA 3MRQB 2J1KA 3GSRA 4Y4HD 3BH8B 3VXMB 5I6XB 2AGJL 4QOKE 1TVHA 4PJIF 2CGRH 4CJ1A 4R4BB 4CMHC 1IRAY 2QKIA 2WWMC 4G8GE 1A1OA 3W11C 5DFTA 2GYSA 5HTSA 3FFDA 1UWXH 4P59H 5EBMA 1WT5C 2IFFL 3MRJB 3WKNA 1RUQL 1OSPH 3RWCB 5B38A 3QYCA 3FO0H 1Q9KB 2BC4A 3S5LG 4ETQA 2NXYB 2ZNXA 4WW2B 1IZKA 3GGWB 3SGEI 2VQ1B 1AQDA 2EXYC 4ZUSA 1DQQA 4G8GD 4J3SA 3BPLC 5HVFB 1FL6A 2AV7A 1T21B 5DC4B 4N0YH 3WS3B 1S3KL 5L9DL 2OJEB 4YPGB 4AEFA 1T04B 3JWNC 4QKXB 3TGXA 2GKIA 3IU4H 3QA3A 4FA8A 1FAIL 1VKXB 3DX8B 1N64L 3ARED 3X14B 3FT3A 3WSQH 2W65A 1KCLA 1AGDB 4XT1C 4RAHA 1CLCA 1YJDC 2ICEA 1TJGH 4Y1AB 3O45B 2VXSH 1D5IH 2LE9A 1HEZA 5CEZH 5GGSA 4TYUA 3VWKB 4HF5H 5HGDB 1JF1A 4GRLD 3C8DA 2VUYA 2BCKA 3ISWA 1U58A 4O2EB 3AU1B 1KJVB 1BZ7B 1MCRA 4TULH 2IQAA 1QLFA 3MRJA 5TDOA 1Z2KA 3I2CL 4GRLA 2HT2C 2Y06H 2Y9RT 3TN0C 4XVJL 3HC3H 1K9TA 4XC3L 2UZYB 4MVBC 1ORSB 2JIXD 4FN0A 2NW2A 3QEHB 1DVFA 2Q86A 1KB5L 1TCMA 4ZG1A 1JWMA 5I74B 4YIQA 2HFFB 3F7RA 4K2UL 3EJYD 4EDWH 3HFMH 4GW5B 1G1YA 1IAOA 3W9DB 1HIML 4JAMB 3T0VA 1EHLL 5DD1L 1A3QA 3LEXB 1GH7A 2I60H 4MMZC 5E6IC 5C1MB 3LQZB 4NQSB 3SGJA 3HUJB 4E41B 3U46B 3LEYH 3TJHC 1FBIH 5C92A 1WLHA 3DSFH 4NQCA 3L1OH 4L3EA 2FR4A 2V17H 2AXGA 5DZNA 4GAGL 5C86A 2MQ3A 4M48L 4EQ2A 1IE5A 4LLYA 1KN4L 3RQ3A 4KMLB 1CLOL 3HA0A 3LKRA 1YEHL 2FJFB 1CFQA 3T77B 3RP1A 3RPKA 3MRNA 3GMLB 3FB7B 1J88A 2DN7A 5H35A 1GGCL 4ZUUB 5T33L 4QXGL 1U8LB 4E41D 2ADJB 1F42A 2CDEA 3GHEL 3HR5A 1NEZB 5JNYA 2DQFA 3OL2A 4IRJA 2E8YA 2FECL 3DURA 4ZAKC 3BAEL 2YUVA 4OBRA 3QG6B 5I1DA 1R3KA 5FGBC 2R4RL 2VDKL 3MA7B 1NC2B 2W0FA 5IMMB 4HSQA 4OFIA 5KANI 4LVNC 5D7SH 4PUBL 4YHPB 5D72L 4M61A 1RJLB 4X6DB 2YEZB 5K93A 4BSWB 1MUJB 2VDML 4JVWA 3BQUD 5F7MC 1JGLL 3KPLB 2CLRA 1Y6KR 3GUTA 3FRUB 1UH2A 2HH0L 4MNGB 3CSYA 1OT2A 3VRJA 2IBBA 3SY0B 3NABH 1S7WA 2E7HA 4LSPL 3Q3GA 1NLBL 4TUKH 3T3MF 3HZVB 1PD6A 2I24N 4PJXF 1IM9D 2FJFA 3V7MA 4JFOB 4AZ8A 2DTSA 3E6FB 3H3PH 1LD9B 2IPKB 2X4TB 3SJVD 1E0OB 4G9FD 3QUKA 2XQYG 2ZCLL 3BPNB 4LF3A 3GBLA 1IFHH 4JPIA 1KCGC 2L0DA 3KPNA 5EZLA 1P4BL 1GGUA 5DQ9B 4TTGA 5I18H 3RGVB 3NCEB 1SJEB 1C7TA 1VEMA 5L2KA 3MCG1 5I8OH 4Y5YB 4LL9A 3T2QA 1EH9A 3RWIB 1R5WB 4JPVL 1ORQA 3HZYA 4PBXA 4MS8A 1YEKH 2AJYH 4JRYB 1CIDA 4L4VB 1TVDA 1NBVH 1S5HB 5EU6A 3GMNB 1HQRB 3U36A 4N0FA 5T3ZE 1DR9A 4ELME 1HCVA 4ODXB 5TDPB 1WFUA 4LIQE 4O4YL 4BM7A 3RVWC 4WRLA 1JYWA 3CLEH 2R0WH 1KJ2L 4MGXA 3D25A 3SO3C 3U83A 4XCFL 3SKUD 4RMWA 3QHTC 1Z5LB 1MCBA 4LIQL 4HG4K 4H0IA 4OIIH 2DM4A 2NNAB 4NOBA 1JPSH 3LIZL 3O3AB 2GJ6D 4Z7QF 3KPQA 1OSZA 5KSVA 4ODVL 4HPOH 3VRIB 1R24B 5IHBA 4LCCA 3P0VH 1AP2A 3SGEH 4XVJH 1QRNE 3TA3B 3QIBC 4X6FB 3D3VA 3QIWA 5ACMA 5C0GB 3L3KA 5EUOF 5DEGA 3RGVA 4KROB 4HKXB 3ARBD 4MB4A 1I9RH 3D5OF 1PVHA 4JGUA 4KK5C 1DEDA 1X4YA 4NFBA 4D0BA 4L8CB 2R1WB 4Z7QE 3RUGF 3RWHB 4EBQL 3H9HA 5SWSE 3H0TB 2ZUXA 3BDBA 3NIGE 1AO7E 4PIRF 1KT2A 2BY3A 2NY6B 2W59A 5IJVA 2XA8L 3EJJX 3KAAA 2YXMA 4YBQD 5J1AB 1YJDH 1MWAH 2R0KL 3DSFL 1P69B 2W38A 3TJHA 5I16B 4ZUWA 3FZUC 3PABB 4BFEA 1FZOA 5E1AA 3MV8A 4KK6C 3QULB 2ZJSH 1JTTA 1RQ5A 2EO1A 1UB5B 2PO6D 3A6CH 1I8MB 3OMZA 3CNKA 3K81A 1UWEL 4FG6C 5E2UL 4NM8L 3U0WL 1FLTX 2PCPA 3I85A 1OSZB 3P73B 4HMDA 1UENA 3N0PB 3KPMA 3GM0A 5ENWB 2EDYA 1UXWA 1OAXL 4P23D 1MFCL 4HKXA 4MA3B 3GJFK 1RUPH 4HZLB 2WBJD 4PBVC 4HLJA 1KELL 1EEZA 4PRBA 1RUMH 4NBYB 1WITA 5IESH 4GBXD 5E8DH 3T1FB 1WWBX 2KQNA 4KI5E 3MO1B 4PRDB 1G9MC 2YD6A 4H25A 4KRLB 3STZA 2EEAA 3BH8A 4W4OC 1NJ9A 2D7QA 3MGAA 3VMNA 1OGAB 4H20H 1CDUA 4I0PA 4PJ7E 1VADB 3ZYOA 1ZT7B 1UJ3C 2C4FT 3O4LA 4K3DH 3GSWB 4BA8A 1ZT1A 4K7PL 4V2BA 4YXLL 2IADB 3LEVH 4XCEA 1M71B 4ONGL 3GKWL 2J8UB 1NANH 4TULL 3OAYK 1NUGA 2P5WD 3OF6A 3SKJL 3EJZD 5I19L 3MNVA 2AK4A 2EE6A 1ZLWK 5C0FB 4MDIA 4QRRE 4QGYA 1HQ4A 2R29H 3RZCD 4LBEB 1BFOA 3RDTB 4N5EA 2HT4D 1K4CB 5DRXA 1CD8A 4WU7B 1WCBB 2ZUQB 2Z91B 4XHJC 2FX8L 3MLTA 1HYRC 1C5CH 2HJFB 1YNKH 1OWRM 4PJ5A 43C9A 2CRZA 1P84K 3QWOB 4RAVB 1I1RA 1CDIA 3DRQB 2EDTA 2GUOB 4NN5C 5CEZE 4UTAL 2CDFB 1HHIB 4IMKA 1UKSA 5D7JB 1PG7L 3FHAA 2XKNA 4JM2B 2F74B 3MR9B 5F7DA 5M7QA 5F7FA 2UY6A 3RZCA 1DN0A 3CZFA 3HC0A 3UC0L 2PYEE 3MLWH 4X80H 1OB1A 2EKJA 3IFOB 4NFDA 2NX5D 2VLKE 3NCBB 3JUZA 4YHYB 4JO2L 5DUMH 1JV5B 1A7OL 1CL7I 2ESVA 3IDGA 1XF3A 4JM2D 3P4NA 1R3IL 2EDXA 4ZO8A 3QUXA 3SDXF 3VFGL 1NAMH 1A1NB 3C08L 3ESVF 4FQPA 1MJ7H 5C0NC 2XZQL 3WFEH 1AE6H 3HCVB 4XP4H 2BRRL 3JWDL 2CR6A 1WZMA 2FIKB 1BBDH 4F8QA 3JTSA 4UU9A 2Z91A 3IFLL 3S36L 4QXUH 4NN7B 4K3EL 1YEEH 5F9JB 4X5XA 1FPTH 1GXEA 4PJEA 1SEQL 2VDRH 4XAKE 3U6RA 1KJ2A 3MCKB 5IBLD 5LCVH 4DUWA 4XMLL 4U1LA 1DP0A 5HVHC 2A38A 2V7HB 1IMHC 5LGKA 2NY7H 3LB6C 4YX2H 1CDCA 1ZVSA 1KTRL 3LRHA 3WUZA 3IRZA 5ADOH 1RIHL 2E9BA 2NXYD 3WIIH 4FQQA 3UTZB 5C08A 1KPRA 1T20B 4XBGB 2OYPA 1GAFH 2FO4B 1IQDB 3F58L 3PDGA 3P0GB 5EU4B 5JOFB 2VE6B 4PB9L 4WUUB 3SE8H 3HNVL 4Q2ZB 5T5NG 2HLAB 3RAJH 2ZJSL 3LV3A 1WBYB 3ECBA 3VGEA 4OD1H 1NDGB 1LMKA 2BVEA 3MRNB 4UV4H 3MXWH 5BV7H 3B5TA 4UINH 3MBED 3I9GL 1Q72H 4DTGH 2Z8RA 1REIA 4R0LB 3RX8A 4EEEA 2P5WA 3MJ9L 4MJIE 2Y4SA 3MODL 3DJ9A 3WLBB 5HHME 1XIWD 3D69B 5IOPB 1QHPA 5C7XL 1PKQB 1MJ8H 4S1SH 4S1RH 3BZFA 2V7NB 2YKLL 5E8OA 2VKXA 4KJQD 4OKDA 5JW4M 1OAYL 4HGKC 4IMKC 4M43L 4KJQC 5FYJH 5EU7C 1OW0A 5CCKH 4JG1H 5C9JA 1HWGB 3F12B 4FZEH 2IG2L 3MBEC 4GMTH 3NIDF 1CGXA 1UZ6F 4DZ8B 3BVNA 3EZ8A 4L8SA 4U33A 5DJ2B 1VGKA 1BD2A 2B5IB 2ITDB 1P7HL 2BC4B 4WJ5A 3QHZH 4PG2A 3HZVA 1TNMA 3QRGL 1QPPA 3JV5A 3AREC 4F7MB 4XP6H 4Y89A 1B3JA 4S0UC 3ARXA 4ZAKD 1U2CA 4XH2A 3WFDL 3ZT7A 1MRFH 5A3ID 2WM0A 1RIUH 3WN5B 4EDXA 1MRCH 4X6EA 1U95B 1SBSH 2EXYD 1VKXA 2WQ8A 1E27B 4WI6A 3RX5A 4X9FA 1A3LH 2AXFA 5IP4A 3BZEA 5J3HD 5I2IB 3O45A 2AABH 3LAFA 5F7LB 3HG1B 4LLAA 3VFMB 1YEIL 4L9LB 1KB5H 1YY8A 3BN9C 3PGCA 3ARFD 5HPMA 1EK3A 3DX9A 2AEPL 4MNQE 5BS0A 1K5NA 4FP8H 1EFXB 3FJTA 1MJUL 5IUSA 2XT1B 2CKNA 1R6VA 2ZKHL 3DRTA 2XICA 3PP4L 2WBKA 1DLFL 1CQYA 1F3JB 5DJZA 1U3ZA 2XN9B 3HZMB 5HVWA 1J86A 3QQ4A 3KHOA 1BIIB 1VFBA 1L0XA 3BP7A 4HJGB 2B0SH 4NQEA 4H20L 4N8VB 4NZUH 4F7PB 3ROLA 5FV1L 1TFHA 4Y4HC 4FZ8H 2G2RA 5JQHC 1T3FB 3P77B 5JHDB 4LGPB 4I77L 2E27H 1UQSB 3FOLB 4LLWA 3LQAL 4BFGA 1TZIB 4QYOB 4DCQB 1FO0A 2Y25A 4PJDE 4J8RB 3VMPA 2DJ4A 3BZDA 3ARZA 1T5XA 3GJFH 2R9HC 2OTPA 5I74C 4L9LA 1MREL 3DO3A 4ZS6C 3VXPA 3WO4B 3TCLA 1W72L 3STBA 3QUYB 5HDLA 4KK8C 4HIXL 4I18B 3IXTB 3H42H 4IRJD 1S7SB 2IQ9L 4JQXA 4R2GC 4M62H 4FFWC 4PUBH 3L3HA 4XCYB 5JIKA 4YC2C 4AIZB 2YUZA 5D8JH 4NRZA 2J5LC 5MEND 2R1XB 5IB3A 2A6KA 4XPFL 3MLPA 4JM4L 1IC7L 2PXYD 4NZJA 5IW6A 1FL5B 1FZJB 3VE0B 4N68A 3PL6A 4LRIC 5FK9A 5MEQA 5DYOB 2EYTA 1AR2A 3GSNH 1U8KB 5BVPL 4BUHA 3GMQB 2XZAH 3VFTB 2FGWL 4NZDA 3OKEB 1FFNA 1L9MA 1VEPA 3MA7A 4A2LA 5BVJB 5JW3L 1T2JA 3B9KC 5AG8A 5F88A 5LBSL 1U3HA 4JKMA 3T8XA 4ZO9A 4X6DA 4HIJA 3DVGB 4X6BB 5BRZA 4KVNL 5DI8A 3C8HA 3KPLA 1IVLA 1VCAA 1ZTXL 3TN0A 3FRPA 4NO0D 3FO1B 3LZFH 4WIQA 4UT9L 2XI9A 5C8JB 3QJFB 3KYNB 4ZAKB 2CJUH 5JDJA 3TBSB 1B0GA 3WS6A 5I66B 1LP9E 3IXTA 4MQ7A 2Y1VA 5IFJA 4RISH 3VW3L 2IWGA 3HZKB 1EAPB 1I8KB 3WXVL 4U6YA 3O4LB 2OQJA 4XNMB 3V0WL 5FFLA 3QPQD 1J0KA 2R69H 4N0YL 3PWLA 4AQ1B 3UROR 4Y4HA 4X4XB 1PLGH 3CCHA 3FFCB 3MV11 3IGAA 3TNNA 1SVZA 3V4VL 2DQCH 4M6OL 1CFVH 4HPYL 4JQVA 3Q5OA 4RRPG 3WO3B 2BHYA 3IJHB 4G9FB 4QNPF 5FGRA 3RA7L 4MXVE 2VZTA 1UYWH 3T2PA 1D5IL 5CEZL 3V5DA 2DRUA 2NW3B 3OHXA 1LO4L 3RWFB 5I1AA 5DRNB 5AYUH 3HZYB 1IEAA 2MCPH 4HBCH 3CFCL 4HFUL 5F7NC 1VA9A 4PRHE 4NNXB 5JLZB 2ED8A 1YEEL 5DZLA 1D6EA 3ULUF 4J3WA 3LKQA 4XNUL 3QSKB 5DTFA 4NO5A 3GRWH 3MRIA 1V7MH 2VXTH 1PQZA 3ALPA 5KBNC 5DUPH 1N3NB 4RFNB 1KJ3L 5TFSH 2C1OA 3RWGA 2EKSB 5IBUG 3ARRA 1RPQA 3SOBH 1YNLL 3LPWA 2VDLL 3MNWB 1OHQA 2ESVD 3IFOA 2DWEA 3BI9X 2DF3A 2XA8H 3QXDA 3QH3A 4YBLB 3ILQC 6FABL 1HE7A 12E8L 1ZGLA 3HMXH 3U30C 3MYJA 1R0AH 1HSBA 4XPAH 5HHOE 3ZDZE 3QQ9D 3HNTL 2DBJA 5J13B 1ZE3C 5FKAB 1X5IA 1YYML 3UTTE 2Y7QB 2IMNA 3BKJL 3BIAX 4L1DA 4IBLT 1V05A 2DI9A 3P4NB 2JCCF 1QEWB 4UNVA 1RJZA 2YUXA 2GCYB 3ALWA 3H8NA 1ED3A 3KXFB 1JGDA 2C3VA 1KSRA 5C08E 1I4FA 1CD1A 1X5HA 4EI5B 5HYJA 3HG1E 3WFBH 3MLZH 5L8JB 4FOMA 4P5TB 5KTEL 5C07D 5BO1L 3LRSA 4XWGL 4K7PX 4TQEH 1INEH 3L3IA 3C5JB 1A6TB 5HHPB 4CN4A 5EDXA 3QULA 1VFOA 4GBXA 4Z6AT 4PJCF 3MLSH 4JY5H 4PJ5E 3S5LB 4CKVX 2LFGA 5D1ZA 5EWIL 4FQQB 3MBXH 1MCWM 5I73B 1BEYH 2RR3A 3MUY1 2VZ3A 1AR1C 1GIGH 2GJ6E 1IKNC 5EU4A 1TMCB 5MEPA 2DKUA 3HNSL 3SHSA 3JTTA 5C09B 3KWWA 5B39G 5E4IA 5L88H 3ARTA 3GMOB 3VXQB 4KHXL 3WSQL 4G8FA 1RZJL 4P0DA 1AD9A 4QXTB 1OM3H 5TH2B 1ROWA 4R4BA 4XNYH 4LP4A 1W72A 2YWZA 3MV9E 2HH0H 1MRFL 5J6HB 3FFCE 5IHLB 1G0DA 2ZG2A 3VDCA 3WYRA 3DROA 3E6HB 5K9QG 1X44A 5TPWH 4H88L 5IVXF 4F7TB 1G7MB 3OAUH 5KVGL 2DMKA 2Y06L 3GNML 3O3UN 1INQA 2FL5A 1WCQA 1BJ1H 3BX7C 5LAXA 4AYFA 2BZDA 4MJ5B 1K2DB 5DEZA 1QA9B 2ZCHH 1BZ7A 1I85C 4MX7A 1E28A 3D3VE 5E2VH 2NY5L 4LDEB 4Y19E 1HZHL 3DVNA 3CSGA 5DJXB 4R97C 5GGVH 2CD0A 3DMMA 5J9PA 3NACL 4TVSa 5KSAD 3DXAE 1ACYH 4KGJA 2IG2H 4OD2A 4ZS7H 4F58H 4R7DB 4D94A 3X14A 4GW4A 2A1WL 3E2HC 1FBIL 1RZ7H 2OTUA 2ICEB 5D7LB 3EYFA 3GIVA 1H5BC 1T2QH 4JO2H 5DUML 2Z31C 2A2QT 1I1AB 4Z5RB 5HGDA 4NRXB 3QZWB 4PRHA 4UT7H 3DYPA 4M4RA 4Y8DC 3L5WB 1WT5A 4O00A 3TPUE 3TVMA 4JKPL 1XAUA 2E9JA 2EDEA 1BOGA 1FN4B 4DQOH 3I50H 4PY7A 1SMAA 4QRTA 1AXTL 2VYRE 2YPKB 4TPRL 4ONOA 4OCWL 1MY7A 5KSAB 3VXSE 2FL5B 5LBSH 4LHQB 5SV4A 1Z0MA 4WFHE 3EYSL 5T33H 1ZA6B 2JB5H 4MCYB 4H8WC 3BJLA 4MJID 1M4KA 1J0HA 3LS5L 4M7ZB 4U3CA 4BH7B 4OLVH 4NHUB 3DETC 3N1PC 5IIEA 2EE3A 4F2MA 2YD3A 1ES0A 2LU4A 1QFUL 3VRLE 3O6MH 4AMKH 5HGHB 4OCNC 3TBYB 2X4SA 3OV6A 2P1YA 3OKKB 4OGXH 5JORA 2GFBB 3C60B 1XGQB 5EBMB 2AI0H 3SQBA 2VL5A 5DFVC 1DBBL 5DS8A 4XC1L 4OUOA 1WWWX 3GI9H 3MLVL 1QD0A 2CKBL 3SPVB 1IEHA 1T03L 4P4KD 5BRZE 5BV7L 1H3WM 3VRLF 1MCFA 5FYLH 4MJ4A 4GRWF 1ZTXH 2F5BH 2FYYB 3B9KA 3SKOB 4FTVD 2NY2B 4H1LB 4APQB 5IEKB 5GXBB 4ZSOB 5FECB 5ANME 4ZNEE 4WUUA 4PJIA 4QRRB 2VLRA 4TUJB 4NDMB 5DJ6B 4BQ8A 1PYWA 3QXAA 4QTHA 5EU3A 3AM8C 2KPNA 1RUPL 1KTLB 2AP2A 4O9HH 3F7VB 3STLB 1IC4L 4JG1L 5HBBA 1AC0A 5JR1H 2X40A 3C6SB 4NO2B 5KSUB 3V6FB 3CC5B 1I7ZA 4K9EH 1FNAA 1B2WH 2Q76A 5LWYH 4GRWH 4LSSH 5HD8D 4OZGA 1NAMA 2JIXB 5T5FL 3QHFL 1FFRA 3QEQD 1HHGB 5DZOA 2H2SC 2Z31D 4ZO6A 3VRJB 2YPLA 3CLFH 1AGBA 3RVTC 5ALBL 1RULL 4K3GA 5T1KD 4LOUD 1XH3A 4OLXL 1YEFH 3P4OA 2PXYB 5IHUH 2VITB 1J05A 4XP4L 3I3EA 2DLFL 1KIRA 2RJMA 1LDPH 4RGNC 5DSCB 3M1BB 5DJ2A 5FAAA 1C08B 3TVMD 3NN8A 2QADB 4LAQL 1MI5D 3JV6B 1FIEA 2JJUA 3LZFL 2E7BA 3LKPA 4ZD3H 3HPJA 3MCLH 3B2VH 5ESAA 3BRDA 4NNYA 1UWGH 4YX2L 4NQDA 1BM3L 1Z6JT 2EZ0C 1D9KB 1I8LA 1OF2B 3EO0A 3BD4A 5GZND 4CVXA 3RWIA 4TSCH 3KNBA 2CR3A 4OZFA 3KJ6L 4NT6A 2X4UA 5F6IB 5B3NA 2B5IC 1MH5A 3SBWA 5I30L 4XBPB 2BVPA 3ERYA 3LDBB 5EN2A 3BKJH 1U91A 5GGQL 3D9AH 4HK3N 7FABL 1YMME 2HLFC 3GSNA 2ZPKH 4LLDA 2VDPH 3BXNB 4UU9B 4O02H 2HJKB 3SGDI 4LHUD 1UWEH 5CLWA 4KUZL 1PX4A 2XV6B 5E6IB 3D39B 4WO4D 1RHHA 5L2JA 1KIRB 5MERB 3T0EC 3MUJA 2CUMA 4NP4L 2ZUSA 3DV4B 1KBGH 4U1LB 3P4MB 1IAKB 3IT8D 2F5AL 4YR6B 4HJGA 4L9LC 2MKLC 1UB5A 1V3LA 2VLJE 4JFDD 4PJFA 8FABA 5BQ7B 5C0BD 2O5ZL 1TJIH 3GRWA 3QI9A 3CDFA 2H3NB 2OR9L 4JDVB 4LKXA 4NUJB 4RWYL 3JVGA 3VFVA 4YLQT 3FQNA 5TDNB 2IC2A 5IROC 3MREA 4HDIB 3DXAB 4XMKL 4KHXH 4MQSB 3FN0H 4B5EA 1IGCL 3GHBL 5HI4D 3OPZL 1JK8A 5F89B 4XNYL 2A6DA 4JM4H 2QBWA 1MWAA 1RJCA 4CN1A 5B8CB 2C3VB 1OL0A 3EDFA 3P9MA 4CU8A 4XC1H 2P24A 2A77L 4FABL 5MENB 4HWNA 4YPJA 4MNHB 3VMOA 1ITBB 4DKAA 4OTXL 1BVLB 1ZHLA 1QRKA 2DLGA 4P9MH 2H32A 2Y07H 4H1LH 5AZEL 5JIHA 4YO0A 5E2WL 2B1AH 4LSRL 4EOWL 3QIWC 2HJLB 1MFAH 5HY9B 4O2FB 1EO5A 2EEDA 2VIRA 1HHJA 4L3CA 1QFWH 5J1TC 3GBML 5D5MA 4NQED 4PGEB 4GAYB 3PWPD 1M05A 4I18C 2WMPA 1RZIA 3ARYA 1RSFA 3WDHA 3SGKC 1CGSL 1AJ7H 2VLME 4C58B 3AM8A 3DXAA 3E8UL 2GTWA 1UACH 2NYYD 1F58L 1U41A 1H9VA 4Q6YA 4OT1L 3ULVD 1F6LL 1EO8L 5DT1H 5HHVL 4X7DC 1DVFD 4BZ1H 4PLJD 5JOEA 2BVOB 5E9DD 2WLZA 3VD3A 5F1KC 1G6RB 1LO2L 4ZPVB 3GSQB 3LRGA 1NDMA 5TE7L 5HDQH 4PJHE 2FSEB 2OCFD 4Z7WA 5FUZH 4LP5A 3FQRB 2K7PA 5ITBH 1FIGL 4XCCL 2LU3A 2CKBH 1OAQL 1CTOA 2NYYC 3C09B 1SYVB 4ZMAT 3UTPD 1E4JA 3GJFA 4P2YA 2DQJL 2XN9E 4U0RB 3MRLA 1S7TB 1HHHB 4J7RA 3QO1A 1NGZB 4YDKH 3LN4A 4ZODA 4K23H 1KN2L 2QQNH 3EO1B 4WNQB 3PWVB 1Z9OA 4HQQH 2PO6B 2FX7L 3SDCB 4D9QE 3PHOB 4PJHF 3C6LC 2Y6SC 3PDDA 4D9RD 3TF7A 5DQDH 4JQXC 2EC9U 1U8HA 3RPIA 4JCMA 2YSSA 1PG7W 4HMCA 4BFIB 1YY9C 3RVXC 2IGFH 1V3KA 2OTUB 3GB7B 1XGTA 1YN6A 4QT5A 2GJZB 4NNPH 2HMID 1FDLH 1TQBC 2E7LC 1II4E 1U8OB 2C4XA 1DEEB 4OZIB 2MPAH 4WI4A 4DFIA 2OMNA 4Y16B 3DTXB 3PWPE 1P7QD 3N9GL 4PV9B 1A6ZB 3D2UA 4LLVB 4IDJL 1F4WL 3RX7A 1T2QL 4WDIB 2R4SH 1DBJL 4LSTL 1QUNA 4UINL 4WV1B 1UA6H 3L3GB 2XRAL 1NCAH 1CF8L 5D1XD 4PJ8B 3WBDA 1WFOA 3CU7A 3LSOA 5DGRA 1FVDB 5MEOB 3T08A 4NOFA 4ZOEA 4H26A 1EGJA 1QQDB 1UG9A 4EXKA 4RFNC 4PREB 3UO1L 1B0RA 4RA0C 4PJBA 4PPTA 1OPGH 2B7DT 1N6VA 1RZGA 3VXNA 3G5YA 5I1KH 2QKIB 2YD7A 4KC3B 4J4PA 4IIQB 4XP1H 5J11B 3FT4B 1BEYL 1J1PH 2CLVA 2OL3H 5ISZE 1XR8A 4JHWL 3QRFM 5ICXA 1NCCL 4XXCC 4EKXA 3DOSA 3ILQD 5GRUL 1BWMA 1W0WA 4U1IB 2KBGA 4HEPG 5EB9A 3BE1H 1LEIB 1ZXQA 4FQHB 3VXUD 4LEXL 1LP9B 4GBXB 2HVJA 1UYWL 4QY8B 4P57B 5JHLH 3F12A 3ULVE 1NBZB 2CGRL 1S9VA 2K9UA 1SM3H 4HWEH 1ZT4A 1S8DB 2AK4B 3OBAA 1CLZH 1FRGL 2FATL 6CGTA 4LCIL 2F54A 1DFBH 1U8JB 1TNNA 5I66A 4GS7B 4GRMA 5IVZB 4G6KL 5DJAB 2B4CC 4OF5A 4HWZB 3LKOA 4NO3A 4P3WA 3PV7A 5AUMA 3KLHC 4HK3J 1ZKAA 3W0WA 4NPYA 2F54D 5HYSB 3V0VB 4YHZH 3MJ7A 3ZHDA 1Q0YL 2X4NA 2NY5H 2WW8A 3BJ91 4C56A 2Q3ZA 2UVFA 4HH9A 2R23A 2AQ3A 4F3FB 4G43A 4P9HL 4Y4KA 3TNNB 3L9RA 3DGGB 4NQSA 4XPHL 4WFFE 3IJHA 3PHSA 3OXSA 3B2UD 5GGQH 4YDVA 1IL1B 3PIQB 4S2SB 5IHZB 1I1AD 3QUXB 1OGTA 2AJ3B 4M8VA 4OSUH 4JZOA 4G8EA 1UM5H 4OFDA 5IFHL 4K3DL 1Q9LA 3X3FL 1A6PA 2VAAB 2NW2B 1IGCH 2WUBH 3QEHA 4J1UA 3S35L 1JHKH 2ZUYA 2VITA 5F9WC 4M1GL 4LLUA 5DFVD 1YNTA 5EC2A 3EYVA 5FKPA 3LKQB 1XR9A 4HUXB 4NP4H 2YD9A 5DSCA 2GAZA 3VXTA 4PR5A 3VXOA 3D85B 5I16A 3MUHL 5D7JC 1KIQA 1RJYA 3FQTA 1KGCE 3GEWB 4HK0A 3TV3L 1QR1A 2OMBA 1F11B 3NPSB 4QHNA 2R0ZH 4C57C 1MSPA 5IB4B 2DQJH 3FFDB 3I6LE 4QRSB 5KVFH 2PTTA 2ADGB 3MJ7B 4LAQH 4Y88A 3S36X 5JXEC 2CRYA 2ICWB 4I5BA 5EWIH 2UZIL 4JCLA 1DBAL 4OLVL 2VDNH 3MBEA 3G5ZB 5C07E 3UEZA 3A67L 4JVUA 3JWOC 4PJHA 1DL7L 3O4OB 5L0QB 1AQDB 4PP1C 4AEIH 5K9OA 4OGXL 3BHBA 2OK0L 4NN7C 5H35B 4P4KC 4S1QL 5I6XC 4HBQA 3VWJC 4PYGA 3F65A 4CVWA 1ZGLP 3TJEL 1JTOA 4X80L 1MFEL 4Q2ZA 2I9TB 2W9LA 1MJJB 2NY1C 2W0KA 5D96B 5ISZD 4ERSH 4BKLA 4JLRB 2NY2D 2OP4H 4Q6IA 3MFFA 1ZT7A 1X6LA 5DMIL 1NSNH 3RWCA 5B38B 3GSWA 4WEBL 4HT1H 3V6OA 4M8QA 1CFSA 3QNYA 1FV1B 3U0TA 1VB9A 1UEMA 1M71A 1UM6L 1KN4H 3X3GL 4JZJA 1WIPA 3MRMA 4Z7OF 2LTQC 1YEHH 3WFEL 2NTFA 2Y5TA 3PE9A 2FJGB 4HKBA 5A2JH 3MGTB 2NCMA 2XNAA 2G75A 3L3DB 4WW2C 4Y1AA 3BO8B 5GHWH 2R0LL 5FOBB 4PYHA 3QDMB 3SCMD 4OZHB 1XCQB 1AGEB 1TJIL 1LO3H 3QA3B 4HUVB 4Z77B 3DYMA 4ZFFB 5ID0A 5JPNB 5CJBA 5HYSG 4MD4B 1Y18A 4G8IA 2P8LA 3U9PL 3P9WB 3T2NH 5D7SL 2NY0C 4JJ5B 2MNUA 3FN0L 1TXKA 4EN3D 3EYOA 2X7LA 4RBPH 5IB2A 3E2HA 3PG2A 5FK9B 5MEQB 4TVPD 3FQXB 1I8KA 5EBWA 2O5XH 4ZXBA 1U8PB 2H32B 1KCUL 2HRLA 2JJWA 1RUAL 2BNRB 4LHUG 3BP5B 4DUVA 1DUZB 5DRZA 1JE6A 3CK0L 4PP8C 3TWCH 9CGTA 4XNZB 4X7TA 4YXKL 1L8JA 1JGEB 1WCBA 1JBJA 1XGUB 3EOBA 3UTTD 1X5LA 4LRNL 2Y23A 1AXSA 5TPWL 5TF0A 1QNZH 2JB5L 1QSFD 5GGUA 5J0BA 1CFBA 2IAMB 1E4KC 4L3EE 3O0RH 5DQDL 1YNKL 4K8RL 4LGRB 4ZUUA 1CK0L 1GGYA 2L7UA 5E8NB 3TESA 3HI6H 4P5MA 4PS4H 1MQKH 5JDSB 4P4KA 3RI5F 4YHNA 3TF7C 3KPQB 4ODHL 4CDHA 5I8KH 1VACB 3KPRE 4GJTB 3D18B 4PRPD 5I30H 1S7XA 2C9AA 3K8LA 4Y19D 5DEFA 1N7MH 1N5AB 4RAUA 5L9DH 3N9GH 1U8LA 5TF1L 1FORH 4RFEB 1TENA 3L5HA 1CE1L 4F7PA 4K3HA 4UIKH 3T77A 2M1KA 4OF6A 2RCSL 3LKSB 4G9DB 4GLRI 3EHBC 3LEVL 4LSUH 5K9KA 3QUYA 3TBVB 1FYHB 4X4ME 3DO7A 2AJXL 4MCZB 4RGNB 1JGEA 4OIBA 4P5KB 3MRCA 1PGRB 3QFJD 2BVPB 3QG7H 1ZS8A 4NBZB 3FO2A 3CFJB 2CDGA 4JRYE 2IBZY 1QEWA 5GSRA 5HGHA 3G6AA 4YDKL 1CU4H 4TNWK 3DX6B 3OR6A 4QRQA 1EJ6A 4EUPH 2K1MA 3ARDA 3BUTA 2I07A 3O4LD 1MCIA 3S9DB 5D4QA 3VG0H 3DV6B 1IM9B 1NCDH 2PYFB 4BQ9A 4J4PC 3KPTA 3ZKNC 1IGMH 1FVCB 2ENSA 4NRZB 1S7XB 3IFNH 2F54E 4TSAL 4PV9A 2CO7B 4ELMA 3DVGA 1WBZB 1Q9OB 4N8PA 4FTVA 1YJDL 3IDJB 2AI0L 2NY4B 5IGXH 3VH8G 3QPXH 1G0YR 2A77H 4PJ9A 3KLSA 4HS6B 1BX2A 4TN9A 4FABH 1LHZA 3BVNB 3GDBA 1DFBL 3LMJL 4OJFH 4IRSB 1JHKL 4KJPD 4OI7A 1RK1B 3UAJD 4QO1A 2W65B 3RVWD 2H26A 3IETB 5EOCH 3QXAB 3ZKND 5IMOA 3HE7D 3IJSB 3GMMA 4OLWH 1A4JB 1HN1A 4KZDH 2QQQA 5GGRA 1TCRB 3GNMH 4R96A 5DMKA 1JI1A 3O2WH 3SE3A 5ILTL 5KZCD 4JY6A 2EDNA 5TGBB 4YE4L 2V9RA 4X6FA 3QP3A 4Y5YC 2BOCB 4MNQA 2AK1L 5DEGB 4PRAA 5CJOH 1EHLH 3OG4B 1G7MA 4HX1B 1I7UA 1GZQA 1P4IH 5IESL 1IJ9A 3EW3B 1HQ4B 2BJMH 2KUTA 2XTJE 3FCTA 4ZTPL 3D25B 5F9OL 1NBVL 2VLLA 1IEAB 3RNKA 1L0QA 4JHWH 3ARFB 4KVCH 1EAJA 1ADQH 2R2EB 4UUJA 4M7KL 4Z7OE 3GMRB 4PJDF 4HV8B 1CGTA 1S9VB 1FNEA 1RZ7L 5TH2A 4JFYA 1YEDA 1JGVL 3NCMA 4PJXA 1RD6A 3P0YL 2H8PA 5I8EA 2V2XA 4WCYL 2ZSVA 1NMCC 4NQEB 1F90L 3HUJA 3QO0B 2H26B 3IETA 3C6LD 3WHE0 2Q6WB 4M9OA 4RMTA 4AEHH 3QIBB 4TPRH 1OT1A 4NNYB 4E41E 2HT3C 4XXDB 3HTLX 4XGZB 2HTLD 2N7BA 3ARDC 4G7YH 3H2WA 3X3GH 4DCQA 1F4HA 2D7TH 3O11A 4HQQL 3T2OA 3DX7A 2QQLH 4OB5H 3ZDXE 1A6VH 3L5JA 2NY3B 4LQ1A 4PY7B 2H9GA 1T83C 2FHFA 3QQNA 4KPHL 1WEJL 2BSRB 2AJ3A 3DUSB 4E42B 3HRZA 1MHPH 4MNGA 4Y16D 2HWZH 2P5EB 5AWNL 1BFSA 5JOFA 1JGLH 3AREA 3WHXB 2WLYA 1KNOB 2AQ2A 2J4WH 3B6SA 2UWEE 4PJ9C 1NGWA 2IANA 5GRZA 1UZ8A 3PDOA 4N1HB 5FM5M 4X5XB 1ETZB 3BMVA 4L8BB 5JZ7D 1GC1C 4LDOB 1K6QL 4TRPL 4M6MH 2HYMA 4YGVB 3TPUA 4JFDA 1U8HB 3WFZA 2NY3D 5GGVY 4MAYC 5E2UH 3U0WH 4GW1B 4M61B 1L7IL 2JJTC 2NR6C 4RGMC 4J8RA 1VFUA 5EZLB 1AHWB 2PTTB 2PW1B 3L95B 3KYOA 3WIHL 5KOVC 1FFNB 1KLUA 1KCSH 5DK3A 4K7FA 4JANA 4HDIA 3E3QE 4BZ2H 4I18A 4I13B 1GGCH 4MJ6B 3SDDC 4DGVH 2PF6A 4YAQB 2XWBA 4WW2A 1PG7X 4WU7A 3ECBB 1YEGH 1SEQH 5A2FA 4C4KT 1YEIH 4K94H 5CILH 5E5MA 4X7SL 3U1SL 3BP6B 4QRRA 4K94C 4LLMB 3D48R 1F6AB 4NQCD 3SCMA 1BZQK 3CLEL 1FFPA 3F7PC 3VFWB 4PLJC 1IC5L 1NCBH 3CMOH 4XPAL 4OQ1A 1GGBL 5JQ6L 2Y5EA 1W0VB 4HIIA 3ULUE 4HJJH 2Q8AH 3V6FA 4WV1C 3PQYB 1QSEB 3ZE0E 4AT6A 2G60L 3HI1B 3MXWL 4UBDC 4JM2F 3VXME 1QSED 4RMUA 1R5VA 4LCYA 1G9NL 2O93L 4N8CH 4OGAD 3ARBA 4KZDL 5J89A 4OD3L 4I0KA 3IU3B 1HINH 1SEBA 4MS8D 3VU2A 4G5ZH 5JW5B 3QCTH 1A9EA 3DBXA 2B2XL 3VDBA 2ILLA 3UYRH 5EIIA 4YIQB 5D2LA 1QBLL 3BEWA 4U6HA 3MRPB 3S34H 4F80A 1HSAB 4NN5B 4Z76A 5T3XE 5IVXA 3H3KA 1S9YA 4KXZH 3NA9L 3T4YA 2V7HA 4JN1L 3MNZA 4HUUB 1T6WA 1WJ3A 4M7KH 4Y4KD 1CD9B 1BFVL 4M6OH 4YHYC 2HP4A 4R4FL 1T22B 1J1OL 1T1YA 3S37X 3VFMA 5E5UB 1MAKA 1RUKL 4OIAA 4N9GA 1N4XL 2V5RA 1AY1L 2PETA 3IJYB 4LQFH 1XGYH 2VAJA 1VGEH 2ENYA 3B8YA 4FXKA 1BQUA 3PWVA 3N1MC 4NHCH 4TUOB 4P9HC 3QCVL 1DQQB 1JNLH 1CVSC 3WFDH 2DQHH 3FT2B 2D31B 2XZQH 1OGTB 3JSSA 1HHKB 1AE6L 3FB7A 1LNUA 2ATKB 4G8EB 2D4DA 2GT9B 1S9WB 3JV6A 5BMFH 3D39E 1T1ZB 2ICWJ 2VZVA 3OKOA 4RWHA 5E4EC 3UCRA 4A6YA 1IAIM 3QDME 2EYSA 2WINB 1A9BB 1PKQA 5D5ME 4UILL 1MY5A 4XCYA 1IQDA 3OAZK 4YHKL 1YMMB 1P7QB 4U1NB 4NKQB 5I1LB 5DD5H 3R8QA 1JMXA 3MLRH 4KY1H 5C0ND 5C0EA 3WIIL 1BIHA 5C9JB 2XFXB 1TETL 5F7UA 1O7SA 3PP4H 4PD4J 2H2SD 3QXTA 5FUOL 5EC1B 2DL2A 2IH3B 2WIMA 4X9BA 1JRHL 4DEPB 4M7ZC 5FYKL 3SDXA 4I5BB 2ICWA 2LAAA 3O3DA 1FORL 3F6IA 4KKAD 4P23B 5AD0A 5FOJA 2X4RA 2JJVA 3BPLB 2QHRH 3RY6C 4J2XA 2QLVB 1MFDH 5E0QA 4NZRL 4R0LC 5DJ8B 1HKLH 3UZVB 4MAYA 4JFXA 5E94A 2XY1A 3ARGC 3U0PA 3VCLB 4IEFB 2XTLA 4PJ7F 1IAOB 5KJRL 1T66D 3QUML 4NYLA 5CINL 1JYXA 1FGVH 3RUGB 1I1FB 3CX2A 4PJAB 5DWUH 5GHWL 3IAPA 4I48B 4EUPA 1W72H 1IGTA 4E9LA 4ORGA 2VXTL 1LO5B 2QQLL 1IGFH 3DNKA 4Z7UB 4DAGH 4K2UH 1CXIA 3CVHH 4APQC 1F58H 5E8DL 1R5WA 3I6KA 2J7LA 4PJXE 2JELH 3QBTB 2OR8A 4KUCD 3B3IA 3QNXA 1AGCB 4XB7A 2NY1B 5D8JL 1C08A 1DBKH 5DUBB 3MV7D 2PR4H 2Y36H 3RIFK 2Q1EA 4O2CA 2AJUH 4EJ1C 1N0LA 3QPXL 4WU5A 3MV7B 2VKWA 3UXFA 1H3PL 1MJ7L 4X0KB 2LVEA 3SKNA 4DWHA 3X13A 3FTGB 4JHZA 5F7DB 5I19H 2UYLB 3QFDA 1G9MH 3RBSA 4MVBD 3TNMA 1OB1B 5F44A 2YZ8A 4JY6B 3EYOB 5IB2B 1LQVA 4L1HA 3VGBA 1QNZL 1F5WA 3CXDH 4MSWA 1T0MB 2DD8H 4MD0A 1RJLA 4Y2DA 2C1OB 1FZMA 5HHMD 3OXSB 1BHGA 4ENED 1I8MA 1NUFA 3O0RL 1KXVC 1T5XB 2SEBB 5IHZA 4G6FD 4Y0GA 2C7UA 3FHQA 3GUTB 4ONFH 1CZ8L 1A64A 2DS4A 5DR5H 3UTPE 4ZUWB 4KQ4L 2YR3A 3PHQB 3TCLB 5HDBE 2IANE 3SY0A 3T3ME 3PWNB 5CJQH 5EO9B 2Z9TA 1MFBH 3MRRB 3QEUB 3PWJA 3H9HB 3ZE0F 5JR1L 4WY7L 2NY0B 4HFWA 4LEOB 3GSRB 3QUZB 2AAVA 3CH1B 2QADC 3O9WD 4PV8A 4XX1G 4MVBA 2VDOH 4NRYA 3FONB 5ANMA 2FHCA 1R3KB 4P2RB 2B0SL 4QHMB 3BOVA 1MI5A 2HAZA 1CXEA 4P2RD 3AS0A 1JNNL 2DWDA 4HIEB 4AIOA 5FYKE 4FXGA 3VFSB 4LQFL 3RA7H 2EKSA 4XNZC 5KN5A 4R3SB 2CPCA 2ZCKL 1ZANH 1PSKH 4JZNA 5SWZE 4QRRD 4Z18A 4ZDHB 1NANI 4JZJC 3ME0A 4UNUA 1UA6L 5GGTA 3RL2B 2JJTA 3LDBC 4WGWB 3V4PL 3O11B 3JWOH 2VE6A 3GKZA 1ZT1B 1I9IL 4R4NC 3UYOD 3ULUC 5FF6A 1A6TA 1FCCA 5EULV 5ELIA 1A6WH 1ORQB 2BCKB 3WO4C 5FM4A 4KKBD 1IEBB 3VFPA 2R0LH 1BJMA 5I1CL 1S9XB 4EI5D 4PRIE 1X5XA 1HQRA 2H41A 4C56D 1SBBA 1MIEH 4H5SB 5DD6B 1BQHB 1RJZB 4NWTH 1KJ3H 3QIBD 4XTRD 5DDHA 3TFKD 2WWMD 3T1FA 1QFUH 1GCFA 3W39B 4UOJA 4YC2B 3QUZA 4JPIB 1QBMH 5JPMA 1CYGA 3L5XH 4RFOH 3T8XB 1Z9MA 5DYOA 3V95A 5DA4A 1EBAA 3CVHB 1TQCC 2ADIB 2P5EE 4QXTA 3EIFA 3ZSSA 4JPVH 2HRPH 4BQ6A 3IAGC 3MGOA 1JPTL 1KEMH 5GGSB 3QIWD 4O2FA 1UB6A 5C0CB 3K80A 4F9PA 4L5FL 4OGZA 3TJEH 2OBGA 3D3VB 4GAYA 5E95B 4UQ2A 1W0YT 2R0WL 4QCIB 3TWCL 2FWOA 3D1MC 5IEKA 3UP1A 2W60B 3H7BA 2YD1A 3CZFB 4MHHI 4FQCH 1JNHA 3BYTA 3HLAB 5LAXB 2BY2A 2VDQH 1KENL 3N06B 4U6XA 1HHIA 1KB9K 3PUCA 3QJHA 5DWUL 1JWUA 2DQHL 4OZ4B 2FB4H 2XN9D 3C6SA 4NO2A 3MRHA 4M4PA 1G6RA 1HOCA 5DHVH 3RFZC 1M7IA 4MD5A 3V5HB 5E8PA 3KGRA 3MBXL 4GW4B 4M1DH 3L3KB 5AUMB 5T5FH 5D7LA 1CFTA 4JRXA 1Y0LA 5DO2D 3SDCD 1MCSA 5HYJE 1NMBH 4KY1L 1FG2A 5DRNA 1R3LA 1LP9A 3BD3A 1CICA 3SQOL 3CZJA 1FQ9C 3QISA 4XPFH 1NBZA 4BH8B 1CI5A 4XHQA 4WWKB 1U8MA 2HVKA 3QRGH 3MOAH 3KYKL 4LLQB 5GSVB 1I7UB 4MS8C 4XPTL 3BQUC 2KKQA 5D7IF 5DJZB 1UVQA 3RJQB 3IDMB 1HXYB 1UKQA 5F3BB 2VLLB 3RNKB 1N3NA 4LHUA 4M3KB 4KROD 1JI2A 5JDSA 1QLRA 3RKPA 3U4BH 1FL3B 1SJHA 3CMGA 3LRSB 4OLZH 3MZGB 2A6IA 5C08B 3GMPB 1Z3GL 1M7DB 5FM5O 5CINH 4FQJH 4ZS6D 1KJ2B 1QKZL 3VI3F 1GOGA 3ORJA 5EU6E 2DQDH 4JB9H 1KF9B 1QP1A 1FL5A 1FZJA 1X4ZA 2HWZL 3C2SA 4OV5A 4YBLC 3HB3D 2HN7A 3BWAA 3U30B 3ZKSD 4WFED 1EEZB 3MTRA 4PRBB 1P4LB 3MRKA 4F7CB 4N5UA 3VFVB 5J13C 32C2A 3RIAK 4XI5C 3NCYP 1UC6A 2G5RA 1ZLUK 1D5MA 3CDGB 2XA3A 1KCVH 4AG4H 4JDTL 3NAAH 5D1XA 1LO2H 4U1MB 2DDQL 4FXKB 2W9DH 4P5TA 1NLDL 2IPTH 4PJBF 1NMCB 4BH7A 1E6JH 1EJOH 2C1PA 3GIZL 1E4WL 2RGSA 5GS1C 3VFOB 1WZ1L 3B4NA 3SGDH 3DV4A 3WXWL 1QSVA 3KYNA 4NKIL 5KSBB 1SJXA 1S9WA 3E0GA 3QWOA 2I5YL 3UTTA 4YHIB 1M6OB 3TPKA 3GZKA 1UJ3B 3E6HA 2OXHA 4HPOL 2XACC 3CSPA 2YC1B 3OKLA 5EO0B 3AMLA 3KPSD 3VXRA 1ODAA 2NY3C 5HGAA 2F74A 3QXVA 1KOAA 2NX5A 3MR9A 4PGBA 3F7VA 3BZFB 4WFHD 4NC0B 2ZCLH 5TDNA 2CXKA 4FTVE 4ZO7A 4LCCB 1AO7D 2YRLA 3AAZA 2A73A 3AXLA 3ULUL 2A9MH 5DUPL 3TT3H 1ZT4B 1AIFB 2D9CA 1HXMB 4PJ9B 4YK4C 3WHE1 4QRUB 5D1ZD 4XMPH 1QACA 4KGLA 4H1LA 4APQA 1FH5H 4GW5A 4LSVH 2ZUQC 1I3GL 3VGFA 3O4LE 3T0BA 1VPOL 5IF0B 5B39A 3P40A 2FBJH 2VLRB 1RMFL 1OVZA 5HI3D 4N0UE 1YECH 4CRPA 2BNUB 2EO9A 4JRXD 1JRHH 4OZGF 1L6ZA 4QY8A 2BNQE 1H3PH 4DZBB 5E94B 1MEXH 4I3RL 1IBGL 3U7WH 1EO7A 4L3EB 4D0CB 4HWBL 2CH8A 1YQVH 4R96B 4PRPE 5LXGL 1J8KA 3CFCH 1FZKA 4X7FC 3PWLB 1PQZB 1A1OB 1RZKL 1E27A 1ZEAL 4GKOA 4OD3H 4X5LA 1R3HB 1ZSDA 4TNWF 1UZ6E 5HGAB 3S4SA 3W81A 5EUKA 1W0VA 2B2XH 1XF2B 3QCTL 2DQEH 2P44B 3FCTB 4NKMA 5CJQL 4ZTOL 1Y6NR 5I1AB 5HPMB 2I26N 1QBLH 4MXVF 4OZHF 3LB6D 1GPOH 3QFJE 3R4DA 4JFEB 1MH5B 2ADFL 3ZKXC 1WBYA 5GGSY 3VI4F 5IWLC 2FO1A 4S1DD 4X99B 3VW3H 5CEYA 4GKSA 4ZUVA 2BSED 3QDJB 1CGYA 1GHFL 1RJYB 3KXFD 1F3JA 3F7YB 3V0WH 2YZ1A 4LSSL 3BP7B 3QDJD 2BVYA 4R7NB 1PDKA 4GLRH 2UWEA 4WUKH 3Q0HA 3QEQE 4KAQL 3W5NA 3J7HA 2EDKA 1U8PA 1YEJL 5BOPA 1T6VN 2YMXH 1KEML 3EYVB 2DBLH 3P73A 3HI5H 4R90L 4LSUL 1I1CA 1DEEA 2AW2A 4GKZA 4LASH 4KFZC 4V1DD 5KTEH 3T0EE 4DUXA 1NAKH 3KVQA 3BQUA 3EOYG 2ID5A 3V5KB 5KSAC 1HDMB 4DN4L 4OI9A 5CWSB 3IKCA 2OL3A 4BSWA 3SGKA 2LABA 5T3ZH 3VD7A 2PO6A 5DA0B 4JDVA 4YHML 2P5EA 3MMEB 2OJEA 1JGDB 2P8MA 2BNQA 1U6AL 5EZOH 3VXRD 3ET9F 4TVPH 5JHDE 3OWEA 4UILH 4P2OA 1J18A 3VGHA 4PJFF 5DRXB 2IGFL 5MP6H 4LOUC 3A6OA 4J6RH 3O6ML 4AMKL 2QSQA 2FX9H 5DVLA 5I9QC 3P4MA 3VFRA 5FECA 4Y2OA 5SV3A 4AM0B 2DMCA 4F9LA 5C70A 5HHQA 3WNKA 1CDHA 5FUCE 4JPKL 5KN5B 3OXRA 3W5MA 3UTOA 2BFVL 4EIGB 3A6CL 3T09A 1V3JA 3QZWG 5D93B 1LK3H 4LMQE 2FLRT 1W0WB 3GO1L 3VI3E 1FG9C 4ONHA 3FB6B 5L2KE 5GS1A 4YBHA 2LVCA 3GMOA 4U1GB 4LLYB 1SY6H 5I17B 5CGYD 4PREA 3RVUD 4L4VA 5E4EB 3SO5A 5J3HC 1CL7L 2VZSA 1U0QA 1A7BA 1T89A 2D2OA 3VXNB 4OCSL 2CXGA 5BV7B 1I1YB 4CNIB 1UKTA 3O3DB 5D96C 4M93C 4LHJB 3QXWA 3SE4A 5J6HA 1UXSB 1CDYA 4Z7VF 1G84A 1J0JA 1A22B 3HPJB 1FFPB 2FX7H 4OM0H 2OL3L 2X1PA 3W9EA 4XCNA 3OKNA 4HS3A 3VXSB 1H3VA 3BPCA 5DMKB 1EV2E 1I3VA 5AG9A 1DQDH 3CFBB 4DEPC 3K2MC 3QHFH 3CXHK 4FMFA 1ADQL 2E8ZA 4FFYL 3P4OB 2X1OA 1AXSB 4NQUA 5DURD 1MAJA 3REVB 3DRTB 1DBKL 3I02A 2W60A 3SKJH 3IDYC 1JL8A 4KRPB 3FKUS 3NCFB 1HI6B 5KSAA 3CSYB 3O41B 4YDIL 1LP9F 5T1KA 1UJTA 2GK0A 1RK1A 1N8ZB 1I8IA 5GGTL 4JFFD 4PJAF 4OTXH 2VXVH 3ARUA 3IJSA 4Y4FA 3UBXG 3QNXB 3SDYL 5INDA 5FKAA 5FGSA 5IVXB 4YHLH 3PHOA 1KIQB 2FX8H 1CLOH 1P9MA 5H2BA 3WEXA 1LE5A 4L8DA 2D03L 3QT2A 4PJFB 4LARL 4XVUD 4Z7WB 3W11D 4TOYH 5E99L 3C87A 4UTAH 1KC5H 3LVEA 3O9WA 4KRPD 5CUSH 4WY7H 3TFKC 4OZIA 4OSUL 2EZ0D 5EPMB 4BH8A 5JHDD 2YN3A 5T3ZD 2EDJA 3L1OL 4W70A 4LDLB 1C1EH 2EICA 5BW7A 1FAIH 2ZSWA 3D0LA 4OFYA 1R3JB 4O02L 2VLKA 5TDPA 1KJ2H 4KJPC 1LWRA 4QRQB 1ULVA 1TJGL 2ZSVB 5TE7H 1T2XA 4YJZL 3FMGH 4PRDA 4OZIF 2EIZB 2KL6A 3WNMA 5ITBL 1QQDA 2IF7A 3FO2B 3S96B 3ULVC 1OGAA 2C26A 5ISZA 3HMWH 4J4PD 1SJEA 1DBML 5T1MA 4OKVA 1E4XL 1AD0A 5I1LA 1MCHA 5BVJA 4UDTA 4X4ZA 4Z95L 1BFOB 3RDTA 1A7RH 3Q1SH 5HHPA 4OCRH 1WF5A 2VIRB 5IBUB 5EU5B 3OR7B 3QUZC 4K9EL 3QEGL 3PNWB 4OUUA 5D7KE 4AY0A 3O6KL 1RAMA 3L5XL 1G0XA 1XGPA 4RFOL 1N6QH 3P9MB 1B6DA 2OZ4L 2DIJA 3VDAA 4N0UB 5CMAB 2FBJL 2HG5A 3H7LA 4MQ7B 3U7YL 5F7YC 3EDDA 1KT2B 5L6YH 1A2YB 1O7VA 3GMMB 1Y18B 2C1PB 4CN6A 2HFEB 2IH1B 1GGBH 4PY8J 1NBYB 1JTPA 1JWSA 4XH2B 2HJFA 4UV4L 4NO0A 3EYQD 1HH6A 3UTTB 2E6PA 4PRHD 1KYOJ 1U95A 5ACZB 5C0CD 1NKRA 2UV3A 4OZGB 3FQXA 3QIWB 3S96A 2XNAB 1F00I 2QADD 4OZFH 1IGYA 4NGHL 1EMTH 1KENH 2COQA 1EXUB 3RL1A 1NAML 5CHNB 5HYFA 4EZMA 2IFFH 5KANG 3V5DB 5FGCB 4HFUH 1N6UA 2GY7B 1OOAA 1IAIH 4QYOA 5FYJU 1X7QB 2GJ6B 5D70L 2R1WA 2CUHA 1JCKA 3ARWA 1JHTA 3G5XA 4HWBA 1CGSH 1CDGA 5J12B 1ACZA 3PP3H 2ESVB 3KJ6H 1DQLH 2R2BB 2XQBH 2XN9A 1J1PL 1Q38A 3DI3B 5FDYA 1FZOB 5E1AB 5FGCE 2CMRH 1Q9WA 4Q6IC 1OGAE 3SDAB 5BW7C 4U1JB 5GPRA 3LKOB 4NO3B 35C8H 3NCYS 3V6OC 4YBQC 3RTQA 2VXQH 2AEWA 1A6AA 1F97A 4A2MA 5AYQA 2DLEA 3G6JE 3OB8A 1OF2A 3EO0B 4XCFH 3QAZC 3C2AH 1MCCA 3RJDA 2R23B 5C2BH 3RPIB 2Z4QB 2X4UB 2BFVH 5C08D 3C60A 4QRPE 2WV3A 1CFTB 4JRXB 1FJ1A 2H6PB 3LKSA 2J6EA 1HH9A 4YHMH 3SDDA 2Z92A 1T20A 4XBGA 4G6KH 5IK3B 1X5KA 5EZOL 1ZA6A 2RIKA 1JN6B 5JW5A 2XYCA 5JO5A 5CZVH 1Z3GH 2J8HA 1JF6A 3VXQA 3T65B 3QWRD 1B0WA 1A8JH 5AZ2H 4WHDA 1FNGB 4TOYL 1G7HA 3TO4C 4CVUA 1MIMH 1HYSD 3NH7L 4HC1A 3ZKQD 3VWKA 1RZKC 4GW1A 4WWID 3TBSA 4NKOB 3WL9A 2BVUA 3VFSA 4A6YB 4ZXBC 1BJ8A 4JPKH 1TETH 1AO7B 4Y16C 2VL5B 3O8XD 4YNYB 1QLFB 1KG0A 3VFTA 1KCVL 3SKMA 4WWKC 4B41A 4PJ8A 3FQNB 4MWFB 2BHUA 2PTVA 3O8XB 3QIUA 3V5KA 2YMXL 5JW4N 2EDLA 3AY4C 1G7JA 2XTJC 5E2WH 2YXFA 3ZDYF 4JKLA 3ARBC 3AC0A 4F7MA 3AROA 1JK8B 3BW9B 4EUPG 3FOMA 3VD5A 4X4YA 4YDIH 5FUZL 1S5IL 4WHYH 3BGFB 4KH2A 5CZXC 5D1QA 5DRWA 4X5WA 1YPZB 1FNHA 1A1NA 3W39A 1BREA 2Q76B 5HI3C 1DQTA 2VWEE 4RQQA 3RKDD 2X42A 2X05A 3IDIA 3NCJH 3QQ3B 3DV6A 3M17B 4OM0L 1G7HB 3D6GA 4MD4A 4OLEA 1OP3K 3QEGH 2ZCHL 2Y72A 4HHAA 1EO8H 1INQB 3DETD 4AM0A 5FHAH 4JJ5A 5HYQA 4IOIA 2HMIC 3S35X 1K85A 4HCRH 4F3FA 1I1FA 1NCWH 4G42A 2YA2A 5DQJA 3MRDB 4I4WA 1KC5L 4OCXH 1ZVSB 4GBXC 4G9FA 3SDXB 4G80B 5IGXL 2Y6SD 3CU1A 3OQ3B 2AJSH 5CAYB 1PG7H 4OJFL 2FD6L 1SMOA 5DJAA 3I6KB 2KZ1B 1WFNA 2GEEA 3NTCH 3MRPA 1KTDB 3MUZ1 4LSPH 3U79A 4PRIB 2MCG1 3VFUB 5ERWA 4CAGA 3MUGA 4KV5F 4P2OC 4UT9H 4ZPVA 4NYLB 4HK0B 1WVZA 2D0FA 3HZMA 2J88L 2L7JA 2V9TA 1NFKA 1NCAL 2GHWB 1H5BB 3QCUH 4XI5D 3NCCB 4MNQB 2R2HB 4LCCC 3TIEB 5F8RC 2J2ZA 4LLUB 3QIBA 3BESR 5CUSL 2DLIA 1QFWI 4HHAB 5L2JB 2FHBA 1MLCA 5I18L 3RKDC 4P48A 4YK4B 3UPRB 1NGPH 4ZUTA 4Y16A 3QDGD 4GRWE 4MCYA 2FH8A 1D5BB 5I8OL 3VD9A 2IAMD 2DI8A 1UACL 1INDH 2X4QB 4OF3A 4UT6H 3B3IB 1PLGL 3CPLA 4X6DE 4EXPX 5GGUB 2D31A 5BXFB 3P30L 2ADGA 3D85A 3LHPL 3UZEA 5LQBL 5ALCL 5F9WB 4WTZA 4HEME 1T21A 4X6CE 3WS3A 2GCYA 4KAQH 5C0IB 1IC7H 4RGNE 1FVDA 3FMGL 4V3EB 4WEMB 3HMXL 4R90H 5J06A 2IANB 3RVVC 3PL6B 3O2VL 2EYTB 2WBJB 2Z93B 5D1QC 7CGTA 1YYMH 1IAII 1IARB 5FM8A 3LIZH 5DURB 3K3QA 3LMJH 3C60C 4KMQA 2E7MA 5I75B 4JKKA 5GRWA 3DX7B 4JEGB 3DHJA 2B1HL 4MD0B 3BD5A 1A6ZA 2HT2D 2HFTA 4K3EH 4OV5B 2Q8BL 2H1PL 3CH8A 1FYTD 3I9GH 1KJVA 3K1KC 4NJ9H 1NQBA 3V52H 4J3XA 3L95A 5DC9B 2R8SH 1WEJH 4NQXB 4HJ0D 1AGBB 4HXBL 4KQ3H 5DJCA 5KAQG 5FOBA 3G08B 4PJIE 1AGEA 2GSIB 4ELKA 4MJ5A 4AH2A 2NY2C 3U2SB 2ED9A 1JZ6A 4XZUB 1ZS8B 1A14H 2Y5TB 3U0PB 4OFPA 3D0LB 4C54A 5EBLB 5LWYL 3VXUE 3UX9B 4RX4A 4MZ2A 1K8DB 3O6FD 1ZHBA 4U1SB 1MEXL 3NZ8A 5JIIA 1XMWA 3MRFA 4GRMB 2X09A 4XPBH 3TBTB 5CFHA 3VG9C 4QTIH 3PV6B 2YHGA 4AG4L 2BNRE 4WFEE 4KKLD 2NTFB 4HKBB 3EO9H 4ODBD 4F57L 1BZ9A 4HWZA 1RZIB 3RHWK 5L8LB 5EUOE 3S35H 2PYFA 4TTDD 1T5WB 3B9VA 1OM3L 3AY4A 3AS3A 4NHCL 3EOTH 3ULVL 2OQJB 4XNMA 1MPAL 1YEFL 1IAIL 1NMAH 1J1XH 3KLDA 2ZNWA 4UB0L 2A9NH 5IMKA 1R5IA 3WKMH 1J87A 4XBPA 1RIUL 2FB4L 4QRUA 3J8F7 1MAMH 5F7HA 5JW4R 4E5XA 3CFEA 2PXYC 2X4OA 3TH4T 2Z35B 3GSNB 5EUOB 2IEPA 2KH2B 5KOMC 5BCAA 3HCVA 5JW4Q 2CUIA 3ARPA 2P48B 4LVHC 2AK4D 5HHMB 4M00A 2ADIA 4UOW1 3TLRA 5CD5D 2JKXA 5AAMA 3TZVC 1K8DA 3EYFB 3MRHB 1EUUA 5I1DB 1HH6B 2V6HA 2UY7A 3BP5A 4M1GH 1IILE 5JOPD 4MXQC 3NZHL 2AJSL 4DJMA 2A6KB 1CG9A 2MOVA 2W1NA 2MJWA 5GJSH 3O3BB 3CDCA 4UQ2B 4I0CC 3MLYH 1C5DA 1W8OA 4WNQA 5B38G 1D9KC 2F19H 3QB7C 3I6GA 4LMQI 5I1GL 2C7UB 3HG1D 5F6IC 3BH9B 3MA9H 3IU3A 2QTEA 5E7FA 4XBEH 4KUZH 1QTYT 4LPTA 3QH3B 5A3IC 4N90D 4NFCA 2QJDA 1EMTL 4HGWB 4BYHA 2OI9C 3D39A 3RIFF 5DI8B 1S5IH 4K8RH 5F89A 3FT2A 5I1IH 5KSBF 4QOKA 3PQYE 5IMLB 5MP6L 1B4JL 4UIMA 5BZDB 1MJ8L 1NFIB 5IB1B 1YUHB 2ZKHH 3KPSE 3QO0A 1S3KH 1QLRB 2D0HA 4QF1A 4P5KA 2QR0B 2A1WH 2VRAA 4JN2A 1BFVH 4YWGL 2NX5E 2VLKD 1LGVA 3CFJA 4XX1E 4ZFOB 5T3XD 1YMMA 4D9LL 3FQUB 3DO7B 1CFSB 2YD5A 3O6FA 3OGOE 3QNYB 4GMTL 4U4BA 3TYGH 5DS8B 5EO1A 1CN4A 1I7ZB 4GOSA 3HE6B 4HS8L 1EVTC 3MRMB 1FE8L 2H9GB 3B9KD 5LGJA 1KTKE 1XCTA 3FB5A 1JHLL 1G7QA 1F3RB 3I50L 2EDQA 4E42A 5E00A 4KTDH 2PYEB 3QPQC 4MA7H 5F3BA 1S78C 1JN6A 1T1ZA 4L4TD 4LVEA 4OCSH 1ZGLM 4PGCA 1MJJA 5BOZG 4CGTA 3CXDL 4GRLC 1G9NH 1QR4A 1LO0H 1TITA 4P3DA 2BSSB 2D7TL 4XVUC 1TCRA 4N5EC 3ZT5A 4KHTL 3QUMA 5D7IB 5J6GB 5E08H 1UB6B 3RWEB 5DD3H 4ENEC 3W0WE 2D0GA 4GXVH 1U92B 2FRGP 1HIMH 5F93C 2FLBT 1J0YA 2VUOA 4FP8L 4JN2B 3OJVC 1OW0C 2BDNH 1MCEA 4J6RL 5I2IA 3H7BB 5F7EL 4OM1L 1YEKL 1TZGL 3R06B 1LILA 4X8JA 1D9KA 4P99A 1MHCA 5EG6C 3LCYA 2P47B 3L7FB 5INCA 3JTSB 2EIEA 2DYPD 2HLFD 4OZ4A 4LCUA 1QRND 4I1NB 5LKNA 4QCIA 2J8UE 2Y7QA 4J3UA 4W4OA 3PIQA 3QDGA 2V5TA 5CGTA 4UQ3A 1GZQB 1LK3L 1YPZA 4NRXA 4HPYH 3SDYH 1N5YL 1ZANL 4GSDL 3NN8B 3DMMB 5J9PB 3RBGA 3PABA 3BISA 3B5GA 4BFIA 4D9QD 3FAWA 1T7YA 4FNLH 1BP3B 2FEDD 4ODVH 3O2DA 1XGTB 1AXTH 4PJ7A 5ILTH 3KPSA 1WAAE 5F7WC 3WV0A 3V6BR 3MV8D 4K23L 1NGPL 4ELMF 3PQYA 4QRPA 1QRNB 3ILPA 3DGGA 3C09C 3EO1A 5CCKL 5K9QI 2WAHA 1GIGL 1NDGA 3ARFC 4Y5VB 3BRGC 3R1GH 3ZZ1A 1WTLA 4KVCL 35C8L 3VJ6A 1JVKA 1N2RB 5KS9F 4CJ0A 4YPGA 3UJIH 4PG9A 3Q48A 3NFPA 3V6ZB 1YNLH 4NKDA 4U31A 3C6LB 2HJKA 3IDXL 4HKJB 2AJZB 1NFDA 4IRZH 1KTDA 2CIKA 3ZYIA 1G7PB 5E6IA 4D8PB 4GKSB 4LLQA 4ZUVB 1LEGA 3MUGB 2OSLB 2FD6H 4POZC 4HBCL 4B7LA 4HULB 3G6AB 3CUPB 2GT9A 3SPVA 2HKHL 1TQBB 4IOFD 2DWDB 2OJZL 4WI9A 3QXUA 5F21B 3ARDB 4GUPA 2GFBA 3FRPG 1X5GA 2P46B 2IQAB 3QI9D 4R3SA 4PTUB 3S3PA 2X1WL 1CS6A 1VFMA 3NIDE 3P9LB 3PHQA 1OSPL 5J12C 2OI9A 4QLRA 3IDNB 4DGIH 2XWJA 4O51B 4DW2H 1BAFL 4NQEE 4JRYD 4LEOA 3O81A 1BQHG 5GQBA 1ORSA 3G9AB 2VH5H 5DHYB 4NWUL 5M95B 3IDJA 5DD0H 5LGHL 1KJMB 4PGEA 4ODSL 1DSFH 4L8BA 1BQSA 3VFOA 3HN3A 3ROOA 3G5YB 5I1EH 3OAZH 5C6TH 5L6YL 4YHIA 2Z8VC 1AKJD 5KS9B 1CVRA 2AKRB 5BS0E 4M1CC 5DJDB 2BJML 3W0WD 3QAZB 5CLTA 5SWZB 3ZL4H 1IT9H 2XWBB 2PW1A 5IFJB 1J1OH 3MV8E 1A6UH 5T5NF 2VQTA 4IRSD 1BVLA 1ZHLB 5J11C 2YPLB 4N5ED 3RZCB 4KMTL 4Y2DC 2ZZUT 3UTSE 4RDQG 4HUKB 5H94A 4ELMB 2HT3D 1MCDA 5JPNA 2AJXH 2AV1B 2CQVA 5GS0H 2EDRA 4PJDB 1AQKH 1EZVY 4YXHH 5LJYH 5DLML 1OAUH 4JFPA 4H5SA 5DD6A 1MCOL 4Z0XB 4OAWA 3SEPA 3UJJH 4PRID 1JZ7A 3FB6A 2BNRA 3HPLB 3U4EB 3FB8B 1I9RL 2P42B 4OD2B 1DQLL 4R7DA 3RWDA 4RNRA 3HAEB 5E6ZA 4YEFA 3LN4B 1I7RA 4GS7C 4L4TE 4JFYB 1IGIH 4LLWB 3KPRD 3L3OB 2FZ3A 3HFML 4XPHH 1MFBL 2NZIA 1ZHKB 4UV7H 5IW3A 3WDIA 4XWOD 4FFYH 5C6PB 1WQVT 4DVRH 3R0NA 4F7EA 4POZD 1F4XH 4TVPE 3X11A 1IL1A 3ZKMD 3MV7E 2XKUA 2GJZA 3ARBB 3LN5B 5A2IH 2CK0L 1NL0L 1FG2B 4O4YH 3VGAC 1JNNH 5E8NA 1HKLL 3QUXC 3H9YA 3CD4A 2BOBA 3QWQB 2DQTH 4YHLL 2E9WA 5GS0D 5K9OB 3PF2A 2YK1H 2R56H 1WBXA 5CJ8A 1RY7B 3VA2C 3B43A 3MYZA 4DQOL 4GO6B 2APFA 3RHWF 5EO9A 1ED3B 3KXFA 4KPHH 4QXGH 3C60D 3HAEA 3V8CA 3ZLQC 2PNDA 2VDRL 4PV8B 4ZQKB 2Q87A 2XPGA 1F2XK 1TTUA 5FA4A 4YWGH 2VLJB 3CFBA 1DL7H 3WUWA 1XGRB 4MSWB 1HDMA 1AH1A 1CGUA 3WIHA 2EDOA 1K6QH 4R26H 2BDNL 2YUWA 1J8HD 5GZOD 1RUKH 3BWAB 3JWDC 1HHKA 1IM9A 3ZKXB 1PW3A 5GSRB 5C8JA 5ALBH 1WWAX 4WTWA 4XPTH 1H8NA 4PP1D 5L0QC 3OB0K 3EJZC 4XCCH 5JO5B 5F6HI 3C2AL 5CBAB 1EIBA 4YHOL 2FDBP 2I9LB 4Y4FB 3VWJB 3OZ9H 1EGJL 1B0RB 2B1HH 1ETZA 2UWEF 1ZEAH 4YFEA 4RMQA 2VN7A 5C0IA 4XNUH 1U8JA 2ZWLT 2BNRD 3Q5TA 4NJAH 5CZXD 1NEZA 2VXUH 1H0DB 1NAMB 2JIXA 4ISVA 1KB5A 3DURB 3KR3L 2B4CH 1KG0B 1A21A 3L3DA 4MXQA 2HT4C 1NCWL 1G1CA 3BUYB 1MCLA 1KXQE 1YA5A 2BMKB 1XGRA 3QDMA 1QLEL 5EOQH 5EPMA 2JB6A 4DGYH 1IEBA 4AT6B 4P23C 4BSVB 5LGJB 2DDQH 1XCTB 4PB0H 4K71B 3GI9L 4I0PD 1KFAH 1RK0A 3WJLA 3B2UC 1CE6A 3GSQA 2DBLL 5FUCC 5J7CC 1EHXA 2HFGL 3MRGA 1YC7A 1NDMB 3GKWH 3AS1A 1F6AA 1L6XA 3CLFL 4OIIL 1L7IH 1NMAL 3ROLB 5GS0C 1RZFH 3U48A 4X6CB 3CK0H 2VISB 3F7QA 2VSDA 1KGCD 3K1DA 5EBLA 4UB0H 1CTNA 1I9IH 3ARGD 1MCOH 5SWQB 5EBGA 3C5ZD 5ENWA 3GJFB 4CVXB 3JV4A 1EFXD 4TQEL 4MZ3A 4P2CG 2J12B 4JY4A 1EEYA 4XVTL 1LO0L 4Z78B 1CDBA 3RDTD 1N59B 4U1GC 4O58H 5L2KB 4HX1A 3FTGA 4DKFH 4KJYA 3IXAB 3TZVA 3TNMB 4FQXA 4YHKH 2CRMA 2ZUUA 4K55A 4NQVA 2IAMC 5F7EH 2ORBH 3X13B 2VZUA 4KKBC 5EC2B 1U8OA 1CQKA 4G8GB 1NGXA 1BBJB 3LEYL 3DX6A 1V8HA 1QO3A 4PGDA 4I3GA 1UCBL 1R3HA 1ZSDB 3S4SB 1KXTB 2Q6WA 3PDOB 2XZZA 3MODH 2VDPL 3TZVD 1MLCB 2AJVL 1H3UA 4XAKD 4EOWH 1BGXL 2DAVA 3CFKB 2VDQL 5HJ3A 4KRPC 4YXHL 5I1IL 1BJ1J 5C0GA 1CLYL 3ELAT 2VH5L 4NIKB 1UZ8B 2EH7H 4NC2B 5FA3B 3EFFB 5E2VL 3TJHD 3UTQB 1S7VB 2HN7B 1T7XA 4CADA 1MNUL 4TSCL 2Z92B 2BY0A 3TZVB 1JZ3A 4P2QD 2O5ZH 2PUQT 4M1DL 2PTUA 4XMLH 2J6EH 4HAGA 4UMGA 3OAYH 4JO1L 3WJLC 1F8TH 1P6AB 4ZFFA 5ID0B 3FQWA 4L8SC 4JFXB 1LEKA 5T1MB 1JPFB 4G8IB 5CIPH 1AD0B 3WDJA 1FLRH 5T1DH 5ALCH 3E3QC 3GSVA 3DUHA 1FV1A 43CAA 2ITCB 5ESQB 5DJ0B 5C0EB 1DANU 5GS0L 3FFCA 3IF1A 3VH8B 1OD7A 1M1SA 4OQTL 1M05B 1ZK9A 2F8XC 1FIGH 2G75B 4PGBB 4ACPA 2D7MA 2X41A 3BP6A 2DLFH 2NY4C 4ELKB 4WENB 5C0AA 5IWLA 2YPLD 1OARH 1U6AH 4YAQA 1KV3A 3MRLB 4KHTH 3TBWA 2XIDA 1QVOB 3VXRE 3HC3L 5EFIA 5E9DB 4NUGL 5DD3L 1J05B 4ZYKA 1S8DA 2JELL 3PWPB 1P4BH 2IAMA 3LH2H 1KPUB 1TQCB 1RFDH 3V5HA 4GQ9H 3I84A 4OQTA 4DN3H 3T04D 3BGAA 5LVEA 4PRAB 1N7ML 3RU8L 4X0KA 2WWKO 1IGYB 1OP9A 4V3DB 1EXUA 1CGWA 3HMXA 1A4KB 4U6VL 1PFCA 3ZDXF 2Q7YB 1JWSB 2DKSA 4Z9KB 4BUGA 2F15A 3MPCA 1NSNL 4EQ3A 4XXCA 3DTXA 4HH9B 4EVNB 3UPAA 5DQJB 1U92A 5E8PB 2R39A 3MV9B 3KLAB 3QNZB 4WDIA 5CSGA 4NHUA 3G6JB 1JJUA 5D2NE 3OJDB 1C8PA 4U2YA 4IOFC 5HHNA 1HXYA 3CAFA 2G9HA 15C8L 4L3ED 4ZPTA 1H3GA 3L7EA 4GG8B 1EERB 1QVOA 3AGVA 3UO1H 4J1UB 1YN6B 4QHKJ 1RZ8B 1U2HA 4ZYKB 4D0CA 1YNTB 1QOKA 1RUML 1KEGH 3QDJA 4PD4K 1S9YB 4PJ5B 43C9B 1R3LB 4RGOH 3S7GA 4NJAL 1PBYA 2BK8A 5MI0C 5FO7A 4HIEA 4OZIE 1I8LC 2R2HA 1FJ1B 3E3QA 2XKNB 4JM2A 4V1DA 3INUH 2AXGB 1FE8H 2VC2L 4LKCB 3G9VA 2GTZA 3HNTH 1X5ZA 4LHUB 3QEUA