3SDCA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3sdcA01
4PJ7F 1GAFL 1KCGC 2QQLL 2ZJSL 4TTGA 1U92B 2C3VA 5GHWH 3DGGA 1QLRA 3P73A 1HHGB 2DWEB 5DK2B 2I60L 3G5XB 5I8CA 2H2PC 3VXRA 2BVQA 3QXWA 1ZLVH 3CFDA 3FT3B 3DV6B 1M05A 2EO1A 1DLFL 1UWGL 3O2DA 2OL3A 3UJIH 2PNDA 1NC2B 3MJ7B 4LDOB 1LO4L 1HHKA 1ZGLP 2XWBA 3R8BB 2XWTB 3LQAC 3T77A 3T2PA 1LP9B 4MDIA 2A9MH 4MNHA 3BYYA 3VRIA 2W0FA 4MNGA 3RWFB 4YQXL 1I9IL 3KGRA 3E3QA 3F7QA 1Q94B 3BIKA 5C0JA 5A16B 3ARGC 5BVPL 3DVNB 4FNLH 1C5BH 4BQBA 1L9MA 1T7ZA 3V6FA 4HLZH 5MERA 5IV2A 4ZAKC 5CEXB 3TO4C 3QJHB 2RR3A 5SWSB 4ONHA 4JRXA 4Y2DA 5C6PB 1IGIH 5ESAA 3NIDE 4P23D 4YHML 4QHNB 4XXDA 4Y5XB 5FV2A 4MA7H 2FEEL 1L7TH 2EYRB 1GGCH 3L7EA 5GGSA 2ICWA 1T04A 3VWJC 2YA0A 3K1DA 4KK5C 3TCLB 2V6HA 5SV3A 3SDAC 5DJ6A 1U95B 1QLFA 1I3GL 4OQ1A 1IAOA 1QFPA 5IMOA 1OAXH 2YOCA 4RGNB 5TF1H 4FNLL 3TPUE 4G6FD 2ZUTA 2ADFH 2ERJB 5F8QC 3EJYC 4OJFL 4HS6A 1DQLH 3K46A 1VGKB 1FH5H 4KXZH 4CJ1A 3TT1H 1MCRA 1MWAB 4PS4L 1IGIL 4FMFA 4XPHH 5JHDB 3O3BA 4WDIA 3W0WD 4KH2A 4WWID 3VI3E 3OL2A 1JNHA 1T1WB 5HHMD 4I0PA 5IR1B 4MA7L 5F96H 2XQYK 2WINB 3EYQC 3QP3A 2AK4D 3G5YB 5HDQH 4OCWH 4LPXA 4LMQI 4Z7VE 3LCYA 4PRAA 5L0QB 2X4UB 1IFHH 5TF1L 1YEHH 1LO3L 4JDZB 1MH5A 2CRIA 4WGVB 3CLFL 2DJSA 3SHSA 1FH5L 4AIZA 3TT1L 2CIIB 5DSCB 5ETUB 2DQFA 1QG3A 3SCMB 5DEGB 3WNLA 2LTQB 4XPHL 3QI9D 3FONA 1T0NB 4ZNEA 4R26H 4X9BA 4XPGL 3AU1A 2XOTA 5F1OB 3U7WH 4WI5A 4FABH 2JJWA 2VLKB 5E0QA 3UJTH 1ORSA 2DQUL 1U0QA 1F00I 5SWZB 5GS1B 4MQ7B 1YEHL 4CADB 1B4JH 4XH2A 4LCCB 3DYMA 1RHFA 3VXMA 4JHWH 2VQ1A 1Z0MA 4PRHD 4YDJA 3LRHA 3D3VA 5D2NB 5FF6B 1G7HB 2BNUA 3B9AA 1S7RA 2FHCA 1ACYH 1P7HL 3VCLB 2F54E 4G5ZL 1Q0YH 1Q38A 1SJEB 4ZOCA 3AROA 3RA7H 3RWIA 4Y5VB 1J05B 1AGFA 1S7QB 4XNMB 1JMZA 1XGQB 4OLUH 3HE6D 4S1QH 3MRJA 1QR1A 1HZHH 4J12A 3NH7H 1A6VH 1HQ4A 4JHWL 1UCBH 4R97C 3MUGB 3TWCH 1KGCE 2PO6B 4Y1AE 4MNQE 3OJVC 1BLNB 2JK5A 3LKPB 3MRRA 1NGQL 4KAQL 4DUVA 4GUPB 5FKPA 3EIFA 1QQDB 1Q0YL 3VXUE 5CCKL 3B43A 2CDGB 3RA7L 4QTIL 4M5YL 2NY4B 1MF2H 2BOCB 1PQZA 5E5UB 4NRYB 4EI6B 2Y23A 5J3HC 5TF0A 4FA8A 1CIDA 3IU3A 4YHIA 1A7BA 3EYVB 2PW2B 4M6OL 5LWYH 1RK1A 3DJ9A 2X4SB 3DSNA 4CN4A 4RISH 1A6VL 5E03A 1T1YB 3WHXB 3TWCL 5D93B 12E8L 5HJ3B 3RNQB 1CXHA 2EIEA 3S37L 3VRLF 1SYVA 4LLAA 2I5YH 5TE4H 3T3MF 3TIEA 4C4KT 3GJFB 5IOPA 1C08A 5HHOE 4PGZA 1MF2L 3OZ9H 1U92A 4NKIH 3QAZB 4X4ZA 5KS9E 5DEZA 1X5ZA 1ED3B 1UXSB 1HHGA 1CTOA 1W8OA 2FO4A 1S7WB 3G5XA 3GM0A 1CWVA 3OKKA 1NL0H 3D85B 5MHSE 3MRMB 5LWYL 4OZHF 4NCC2 4G9FB 1ADQH 3DV6A 1T7YA 3FT3A 4Y16B 4S1SH 4KQ4L 2P45B 5TQ2H 1D5BB 2APWA 4G6AC 5IBTL 1NC2A 3MJ7A 5TE4L 3S88L 3QIWB 1I8MA 3PL6C 5CEZD 4G7YH 1LP9A 3BJ91 3MYZA 3B9KC 2Z31B 1MI5B 1P53A 4NKIL 1Q94A 3AAZB 5DJAB 3UPAA 1ETZA 5A16A 4MGXA 3DVNA 3QHTC 1ZE3C 3JWOC 5LGKA 3BSZH 4QRTB 4NN6B 5TQ2L 1FNGB 4JZJA 3QJHA 5SWSA 4OCMC 5IWLA 3RAJH 3QUZD 4D2NA 4QHNA 4QEGA 4Y5XA 5F9DC 4G7YL 1LD9B 4AM0A 1XEDA 5DVNA 4YXHH 4FQIL 3WS6C 1X5FA 4HZLB 3TCLA 5E99L 1TNMA 1IL1B 5A43C 2VXTH 4TN9A 1LP9F 1B0WA 3L5XH 4HWBH 1KNOB 3T3PF 3OF6D 4PG2A 5I1CH 1WIPA 1VGKA 4RX4A 1TMCB 3BQUB 1MWAA 4G7VH 4CMMB 5HDOA 3RAJL 2XA3A 4PG9B 5DUBB 5JHDA 3WNKA 1P9MA 3TFKD 1T1WA 2GY5A 1HEZB 2Q3AA 2WINA 2R0WH 5FHBH 4YXHL 2NY2D 5CBAA 5JPMA 3G5YA 4JCMA 4KDTC 1X5HA 3PWPE 1JN6B 2X4UA 1OAZH 3L7FB 2DQIH 3MNVB 4X7CC 3S4SB 2ESVB 3E2HC 4KI1A 4HPYH 4JDZA 4WI4A 3BZFB 3L5XL 4HWBL 1HWGB 2F54A 3SPVB 5BRZB 1A1NB 1T20B 5DSCA 5ETUA 4GBXC 3SCMA 2X70B 1JZ8A 3UTZB 5DEGA 2EYSB 1WWAX 5CILH 1T0NA 3KPSB 5C7XL 1ZT4B 1UJ3C 3FFCE 5D7SL 2Y6SC 2VLKA 4K2UH 3IDGB 1RUAH 5GS1A 4MQ7A 5DQ9B 5GRXG 1IM9B 3ZE0F 3CC5B 5MI0C 4HPYL 4LCCA 4EUPG 1ES0B 5DVMA 4EN3C 4HS8H 2E6JA 2IAMB 3NGBB 1G6VK 3DHMA 5D2NA 5FF6A 5HI3C 2XTJE 4C59B 1G7HA 4L4TD 1QFUH 2RCSH 5IROC 5CILL 3VCLA 5MEND 2HT4C 1MFBL 1SJEA 3UAJD 2PYEB 4OGXH 2JB5H 1GOHA 4EI5B 4XNMA 2WBJB 2FX7H 2P5ED 3HMXH 1OTUC 4K2UL 1XGQA 4JFQB 1QBBA 1DBBH 5KVFL 4XX1G 4DFHA 2JJSC 4C4KO 4NQXB 2QADD 4ZYKB 1YECH 3A6BH 4IRSC 3MUGA 5T1MA 2P8MB 3RUGE 4URTB 2PO6A 3OXRB 5C6TL 1EBAA 4H1LB 5DMIH 5F9WB 1BLNA 1JI2A 3LKPA 3QRGL 4MJ6B 1BECA 4NC0B 4GUPA 4OZFG 1QQDA 4JFXB 3STLB 4TTDC 2A77L 2CDGA 5ADPL 1DQMH 5E4EC 4YX2H 2BOCA 4NFDA 3UO1H 3QCTL 1YYLH 1BMGA 3GFUA 3HMXL 4EI6A 4WO4D 3REWB 1GZQB 4JFFE 3C2AH 4HKJB 3HKFA 1DBBL 1BZ7A 1CR9L 3EYVA 3LPWA 5A2JH 3IU4H 5GGRA 2PW2A 3SN6N 4PRPB 2X4SA 1I7TB 1JTOA 3A6BL 1T1YA 4KZEL 2DI7A 3OG4B 5HJ3A 5DMIL 1QLEH 4HBQA 3KWWB 3RNQA 3MJGX 2MMXA 2WWMD 2B1AL 3QEQD 4HC1H 1NAKL 5D1QD 5DO2D 3QDGE 1DQML 1A64A 3WN5C 4OCYH 5BMFH 5EIQA 3C2AL 1M7DB 1UXSA 3KYOB 1S7WA 5C0DB 4P4KC 5JORB 3KHQA 4YDKH 3T1WA 4ZS6C 3MRMA 1CFNB 1OW0C 2XIDA 4G9FA 3MGTB 1CGVA 1D5BA 1P5UA 3CMGA 3ULVH 1U8IB 1DQTA 4EXKA 4EDWL 2F58H 3A6OA 1EEUA 3QIWA 5ALBH 4ZQKB 5JQ6H 2EDQA 4WUUB 4H88H 2HJLB 2Z31A 1MI5A 4OCYL 5BMFL 3BP6B 5GZOD 5DJAA 4OKDA 2W07A 4JY4B 3OHXB 4OCRH 4NWUH 3DOSA 5DC9B 1L7IH 3C60C 4DK3A 1DVFD 1FNGA 4GXVL 4PJ9D 3BPNC 4HHAA 1DUYB 4HIXL 4NWTH 2F58L 5IFAL 1FCGA 4PRIE 3CUPB 5ALBL 5JQ6L 3RVTD 4XPFH 2ZZUT 4DGVH 1LD9A 2ENYA 3ARDD 4KV5F 4DAGL 3UX9B 3V5KB 3UYRL 4Q0XH 2HFEA 4ENEC 4KUZL 1IL1A 4OCRL 4WU5B 5HYJB 4NWUL 1NPUA 3OB0K 1KNOA 5C71A 2KL6A 5DQDL 5DEFB 3NBNA 4CMMA 2Z92B 2DN7A 5DUBA 5J7CC 4I3GA 5ACZA 1UA6H 4HF5H 5E1AA 3RTQB 4DGVL 3D2UB 3G6JB 1HEZA 4TSCH 1KC5L 4HKXB 1MCIA 5KN5B 4AG4H 1TETH 2DQGL 2IBZX 4OKVA 2A74A 4Q0XL 3HLAB 1P1ZB 5IIEB 3L7FA 3VFPB 3QHZH 2YUWA 2VIRB 4XGZB 2ZKHH 3BZFA 1FE8H 4Q9QH 4WGWB 2PXYD 1KCUL 4TVPE 2ZUYA 4A6YB 4I18B 1CN4A 3O9WC 3SPVA 5BRZA 1A1NA 1T20A 1YJDC 3L95B 2VAJA 2X70A 4JM2D 3UTZA 5ID0B 4N9OB 4IOFD 3KPPB 2XZAL 4HF5L 1OGAB 4M6AA 3KPSA 4TSCL 4FFYH 2B4CL 1IGFH 1ZT4A 4OZGE 2ILLA 5IVNA 3NCJH 3IDGA 5TFSH 2H41A 3GI9H 1A1MB 3I6GB 3I02A 4LL9A 4WFED 3CC5A 3QHZL 5LQBH 5IW1B 5T33H 4K9EH 2ZKHL 35C8H 2EH7L 1FE8L 1ES0A 4GMSH 2IAMA 2EXYD 5D5ME 5DGRA 3VRJB 4ELKB 3FHAA 3ZKQD 2BY1A 4LSPH 1KENH 1T7WA 3S36X 1OQXA 2HT3C 1FFPB 3MREB 4PP1D 4W4OA 2OXHA 2BSRB 2WLZA 3WXWL 1DR9A 4C56D 3BJLA 3KPRB 4Q97A 3MJ8B 2PYEA 4FFYL 4P9MH 3QUYB 4U6YB 4PP8C 1IGFL 4EI5A 2ZOKB 2AV1B 2P8LB 2WBJA 4J7RA 4RFNC 4AEIL 5JUEH 4LVHB 1YN6B 5TFSL 4JFQA 5ACMA 2HJFB 2BFVL 5DYOB 4LPVA 4K9EL 35C8L 4R90H 4NQXA 4ZYKA 5E94B 1AGBB 1HQRB 4GMSL 1CZ8L 1ZHNB 4WI8A 4KZDL 4L4VD 2LVEA 2VQUA 4LF3B 2Z0BA 2P8MA 4LSPL 1KENL 3OXRA 4H1LA 4MJ6A 1G1CA 3DXAD 3VGAC 3BE1H 2P46B 4QGTA 3NCEB 2Y9RT 5EU3B 4JFXA 2Z8RA 4RSVA 3STLA 4FQXB 1W2KT 5CLTA 3QA3A 1SY6L 1P4IH 3VD5A 1FC2D 3MV9E 3REWA 1GZQA 2YPLD 4HKJA 2G5BB 3GHBH 3PQYE 2CUHA 3BW9A 5IHLB 1CVSC 4ODVL 4PRPA 4R90L 2PKDA 5A2IH 5CZVH 1KCRH 3C8DA 1NBZB 5D7LD 5ISZB 3V7AE 2WK2A 3KWWA 3F58L 2PR4H 4U3CA 3BE1L 1JF6A 4U1GB 1D5IL 5I2IA 5I18L 1NANI 1GGTA 5FGCE 3MXVH 2Q3ZA 1TNNA 1A6ZB 2V2WB 5EBLA 1IAMA 4M61A 4PLJC 1P4IL 3LKNB 2BNRB 4JLRB 5FOJA 1M7DA 3KYOA 4YK4C 4BJLA 3GHBL 4HD9A 5C0DA 5JORA 1HDMB 4ODSH 4OLWH 1YEJL 4DOHB 4I3SH 1RURL 1U8JB 1CFNA 3MGTA 3KJ4B 2B7DT 4YBQC 5HDBF 2BY0A 1U8IA 3BGMB 3IFPB 4R7DB 2PR4L 3GBML 1K2DB 3EYSH 4ZQKA 2R15A 4F37K 4QRRE 3MLPA 3EZJB 4LOUD 3MXVL 4WUUA 1AO7B 4MS8D 2HJLA 4HBCL 4QXWA 3RGVA 3BP6A 3ILQD 3SJVB 3O6FC 3ARZA 4JY4A 4V2CB 1RK0B 2BCKA 3S35X 5GRZA 1V8HA 1EO8H 1CGWA 3RVXC 4OV6F 4JG1H 4F9LA 3O3UN 1RUMH 3ULVD 4ETYA 5JW5B 1DUYA 4JRYE 1IQWL 4KRLB 3CUPA 5T3XE 3EYSL 4O2EA 3PHSA 4QTHA 4I2XB 2P49B 2BSTB 1U58B 3V5KA 1M4KA 3ULUE 3MV8D 4JAMB 3DI2B 1N64H 2CO6B 4EXPX 2M26A 4WU5A 5HYJA 5ICYA 4I0CC 1MVUB 4PY7B 3UPRB 1N7MH 3BD3A 3TC9A 2NX5B 5EU7E 1MHPL 4JG1L 1A8JH 4OCLC 4KJPD 3BP5B 4Z5RB 4QNPF 1RUML 5J57B 5AAMA 3EFDL 2Z92A 2EDBA 4NZTH 4YE4L 4QYOB 4BSVB 4WI6A 3RTQA 2B1HH 5LBSL 3D2UA 1M7XA 3U0PB 1IT9H 4HKXA 4MCYB 3IXAB 2YEZB 4QXUH 5EPMA 3FO0L 3RWDB 2NY5C 5KN5A 4DEPB 4I4WB 4FXGB 3JUZA 4TRPL 1I1CA 1K5NB 3HLAA 2AJXH 1P1ZA 2IQAB 1ZKAA 1A02N 3VFPA 1MIMH 4XGZA 2VIRA 2YD3A 2B20A 5K59F 2VN4A 5D6DC 4A6YA 5CJBA 1LEKB 4XXCC 4NM8H 4ORGB 5H2BB 2VO5A 3FJTA 3L95A 5C0GB 1VADB 3DLQR 4HX1B 5ID0A 4NZTL 2C3GA 2CK2A 3KPPA 1QBLL 4R3SB 1IVLA 1DANU 1OGAA 1YEEH 2UVFA 2AJZB 3JTSB 4LHUG 3CLEL 1IT9L 1PX4A 5DUML 4O2FB 3LKOB 1IKNA 4U6VL 2E9BA 3X3FH 4DN3H 4DVRH 4G3YH 2AJXL 1NCUA 5HGBB 1QRNB 4FXKB 4E41A 5CD5C 3FTGB 1MIML 3G6JF 5IW1A 1FVCB 3HMWL 4XBGA 4IMKC 3O11B 3VRJA 1MCWM 4ELKA 1KJMA 4NM8L 2XTLA 4PJHE 1EBPA 2XXCB 1FFPA 3MREA 3L3OB 2BSRA 1JVKA 1ZTXL 2UUDK 3KPRA 3CH1B 3P0YH 3ZE1F 1T22A 1WBXB 3QUYA 2ARJB 5J12C 2AV1A 3K1KC 2P8LA 2VR5A 1EFXB 2Y36L 4KROC 5C07B 1GC1C 4ZFOL 1YN6A 1I8KA 4DN3L 4G3YL 4DVRL 3MLUH 4XCYB 1HHJA 3LQAH 4HJ0C 2HJFA 3WFZA 5DYOA 2IJ0C 5E94A 1HQRA 4ZUWB 1ZMYA 2AXJA 2ICWI 2H32B 4MCZB 1U2HA 5D7JA 1RU9H 2H8PB 5J1AB 5GZNC 3WKML 3DPBA 4HUNB 4K3DH 5EU3A 2WIMA 1ZWIB 3P0YL 4FQXA 1A1OB 4MJ4A 4YDVB 3RDTD 3FQTB 2E9IA 2G5BA 4M43L 2L0DA 4PJ8C 2VDPH 3ZMRA 3BISA 3MNZB 2X42A 1JPGB 4XWGH 5FUZH 2EEBA 2EDDA 1EMTH 2AGJH 1NBZA 1G9EA 5ISZA 1JBJA 3P0GB 4GG6E 4ZS7H 1RFDL 1CGXA 1YQVL 1RJLB 1F4YH 2ITDB 3UYPA 1VPOL 4JQXC 3FRPA 4N9GB 1J9CT 4RWYL 4OF8A 1H3GA 1MHEB 5K9QG 3SDDD 1A6ZA 2V2WA 4YHNB 3ORJA 5I9QB 3BN9C 3RY5A 3LKNA 2BNRA 4JLRA 3F7RA 5FB8B 5GRVK 3W11D 4RMRA 3BGFB 2VDPL 3DUUB 1D5XB 1U8JA 4X9IA 4R2GC 4XWGL 3QXVA 3RZCB 1E28B 5DTFA 3TZVC 1HIML 2ID5A 4Z0BL 3BGMA 2FEDC 1KOAA 3IFPA 5JXAH 2WUCH 4J6RH 3LKRA 2E27H 4XNXL 1K2DA 5D1ZB 4JPVL 3KXFE 2GQHA 2R1XB 4LRNL 3HG1D 2ZCKH 3DMMC 1KPVA 5I16B 3TN0B 2Q8AH 4APQB 5EWIL 5H94B 1IZKA 5IJKC 4GRWE 1XF3B 5BZDB 5GGTH 2IPKB 4U1KB 1RK0A 3EGSB 2W92A 3BI9X 1UM4L 4WW2C 3ZSSA 1F13A 2FBOJ 1JV5B 4PBWD 1QPXA 1J10A 4PREB 3JSSA 5JW5A 3F8UB 4LNVA 4W6YB 5JXAL 3PXJA 2F19L 1A21A 3TYFB 1F90L 1KEGL 2ZUQB 3CVHB 5BJTA 4I2XA 3KPNB 2Q8AL 2BSTA 5FO7A 4NRXB 4C83B 5C09A 4YDLB 3FO2A 4JAMA 3L6FB 4F9PA 3D39E 5GGTL 4GRLC 3TO2B 4FFEX 1MVUA 3BEWB 4PY7A 3UPRA 3VDCA 5LGJB 2NX5A 3C5ZC 1I1YB 5CJXC 1HXYA 5EOQH 4Z5RA 1X6LA 4K3EL 4DUWA 3RWJB 4ESKA 4Z7NF 1S7XB 1UYWL 3OAZK 4BSVA 3RVVD 3V6ZB 1T89A 3CK0H 3U4BH 4GQ9H 1MCCA 2Q87A 5B4MC 5D1XD 3MRIA 4MCYA 4NQDE 3IXAA 3RWDA 2C3WA 3GSVB 2Q7YB 4MXQD 3CH8A 4I4WA 5E2UH 3O4OC 3ULUC 4FXGA 1K5NA 3T0VA 2RJMA 3BMVA 3E8UH 4EUPB 1P69B 2XICA 4YPGB 2EDJA 3QQ9C 1K3IA 3EDEA 1ZLSH 1JI1A 5BW7A 3T0DA 4I3RL 3BD5A 5EOQL 4X8XA 4IRJA 3IFOB 3U9PL 3H9SE 1LEKA 4Y4HD 4ORGA 5H2BA 4NGHL 3S9DB 2GTZB 1VADA 4GXUN 4R3SA 3U4BL 5AYUH 2AJZA 3JTSA 1YEFH 3NCMA 2R69H 4LIQE 3BPCB 2R29H 4NJAH 4O2FA 1OAYH 2P24B 3LKOA 5C0AB 2GJZB 1JGVH 2WUBH 2Z8SA 3HPLB 5AUMB 4S0TD 1CDJA 5HGBA 4LLDB 3E8UL 1QRNA 1WWCA 3KYKH 4FXKA 4J4PA 1PD6A 3FTGA 4V1DD 4CDHA 1ORQB 3N06B 2FZ3B 4CW1A 1FVCA 4S0SD 4G6KH 1F42A 2J3SA 5F1NB 5L2KB 3O11A 4M93C 4UTBL 5I1IH 5I1GH 1TQCC 3VXPB 1A7RH 3L3JB 4OZFB 3L3OA 4BFIB 2VWEE 2DDQL 1NEZG 4NIKB 5KJRL 3DX8B 5AYUL 1QVOA 5C08B 3CH1A 4XAKD 5HPMA 4XPBH 1CLCA 1WBXA 2C7UB 2R69L 4OSUH 4G8EB 2ZUWA 1WVZA 2ARJA 3QEUB 2R29L 4NJAL 1OAYL 4G6JL 1EFXA 5C07A 3BZEB 1JGVL 2WUBL 3B9DA 3AS3A 5E6ID 2YUVA 4BK4A 3BP7B 3KYKL 4K23H 5E00B 3CXHJ 1W0YT 4KJWD 4HK0B 4KK8C 1F4WL 5DA0B 1IC7H 4UQ2B 4ZUWA 4UI2A 3HC4H 1B0GB 4K8RL 2V5RA 2H32A 3FCTA 4MCZA 5I1GL 3QEGL 2G2RB 3C9NB 2H8PA 3LEYL 2H2PD 5J1AA 5JIKA 1A7RL 2FECI 3JWOH 4XP5H 2ITCB 3K2MC 3A6CL 1A1OA 3JV0A 4YDVA 3MRKB 2R8SH 3FQTA 1JRHH 4AEHH 5JDSB 5T3ZL 4J23A 3QCUH 1DJSA 4K23L 2HMIC 5KOMC 1MUJB 3MNZA 1JPGA 5FKAB 2BNQE 1EUUA 5FUOL 3K81A 1RJLA 1RIHH 1DUZB 1D5MB 5IT2H 3WNMA 4N9GA 1C1EL 1EERB 4PPTA 3X13B 5C0CD 1MHEA 4ZAKD 4UIKL 4O58H 3E3QC 4IJ3B 3MBXL 2H45A 3DECA 2FO1A 1S9YB 4HXAL 4YHNA 4FMKA 2R1WB 4AEHL 1HILA 3ZYIA 2EDWA 4LCWD 5FUCE 1RUPL 1WV7T 5E6ZA 5FXCH 3DUUA 1D5XA 3VGDA 5C8JB 4OZIB 4PJBB 4KK5D 3RZCA 1E28A 2AXGB 3PHOB 5C0BD 1KJ2H 3SDAD 3MX0A 4Y2DC 2ICEB 4R4FH 2HYMA 2OTWB 4XMKH 1ZLVK 1GZPB 5IT2L 2EH8H 3ARBD 2D7NA 3QXAB 2CDEA 1GGIH 5D1ZA 3EJYD 4LSQH 2AJUH 3P3YA 2R1XA 2OBGA 2XKNB 1N0XH 1WZ1L 4O58L 3EJJX 1NAML 5I16A 3TN0A 1CQKA 5DJXA 3QDJD 4Y4KB 4JEGB 1KB9J 1ITCA 3V0WH 3T0BA 1CLZL 1XF3A 3G04B 5F3HB 5BZDA 2IPKA 4U1KA 4XMLH 4YHYB 4OGYH 3EGSA 3EYQD 2KDGA 4M9PA 5DMGD 2WWKT 4AEEA 2DLHA 2CKNA 5CSGA 3FOLA 4U1LA 3WJLC 2DS4A 4MA1C 1JV5A 1KJ2L 4PREA 4EVNB 2EDHA 2WV3A 3NFSL 1I9RH 4GW4B 1TPXC 4R4FL 3UTSE 2EXWC 1W0VB 4K3GA 3F7PC 3TYFA 5IW6A 4CN1A 1PKOA 2AJUL 5I74B 2CK0H 3CVHA 4OM0H 2NY0C 1MPAH 3UROR 4FTVE 2DMCA 1UEYA 2XN9E 2G5RA 4C83A 3O3AB 2V5TA 1DCLA 1XGPB 4XMLL 4OGYL 3H9SA 2O5ZH 2YBRA 5LGJA 5H8DA 1I1YA 1YMMD 2VR4A 3KPOB 3V4PH 4HUVB 3RWJA 1EHNA 5EUOB 1S7XA 3MROB 3VWKC 5INCB 3PE9A 3V6ZA 1WICA 2IMMA 2R0LL 3ILPB 3CFIC 2YWYA 5L8KB 3FB7B 3BUYB 1HE7A 3DO3A 2AXFB 3GSVA 1NCDL 1S9KC 2X6MA 2Q7YA 5AAWA 1LO2H 1W0WB 4KWUA 4F15C 4CU8A 5HDLA 4YPGA 3VMPA 1FZJB 3BPLC 1P7QB 5FGBA 3NCFB 1JHLL 3W82A 3IFOA 3V4PL 5CD3B 2X7LB 2GTZA 1M6OB 4HV8A 4RQQB 2IF7A 1IAIL 3VXTB 4BFGA 5C86A 2DQDH 5EU5B 1DFBH 4XVJH 3BPCA 4JANA 2P24A 2IBZY 1A6TB 3I3BA 5C0AA 1AQKH 1VFMA 3HPLA 5AUMA 3AFLA 4BELD 5I75B 1IGTA 4JQIL 4LLDA 4Q9CA 3R1GH 2Y5TA 2QLVB 4OF6A 5IMLB 2FZ3A 4KTDL 3VXSB 5L2KA 5J3HD 3Q0HA 4O5LH 4XBEH 4P2OC 5IHUH 3GIZH 4K7PX 3HS0B 3VXPA 3L3JA 4OFYD 4OD3L 5ANMB 4OZFA 4BFIA 3C8KB 4O02L 5C08A 1TQBB 2C7UA 1IC5L 3QEUA 4M8VA 5DRXB 4UZGA 2GSIB 4LK4A 3BZEA 3MR9B 1BQUA 3BP7A 4ZXBB 5CP7B 1H8NA 5E00A 3MV01 3TIDB 4ODWA 2CRZA 4HK0A 3JV4B 4UQ2A 1A3LH 1CVRA 5HHMB 1J0HA 1VEMA 1B0GA 3C9NA 3GIZL 2R1YA 5E7FA 3U0WL 3E6FB 1QSFA 1ONQB 4BZ2L 3ZTNL 3ELAT 3VJ6B 3GMPB 2ITCA 4NZUH 4OCXL 3MCG1 4G6AD 5AWNH 1BBJB 3MRKA 1KN2L 3VXNB 1YEGL 5JDSA 1LE9B 1EHXA 2LE9A 3P0VH 3PL6D 4JPKL 4XZUB 5EZOL 5B8CA 3VW3H 1S78D 1MUJA 3Q6GL 3U36B 5FA3B 5FKAA 1LHZA 3B9KD 4RNRB 1A3LL 4M1GH 2VH5H 5A40E 4NC1E 3W0WE 3G9VA 3MBEB 3WJJA 4FFWD 3V4UH 4GH7B 1DUZA 1D5MA 3KLSA 2GK0B 3X13A 4Z95H 4QT5B 2AK4E 5CHNB 5FOBB 1CBVH 3K8MA 2WWKO 5GQBA 1WZKA 1S9YA 2DMBA 2R1WA 1G6RB 4HKZB 4XCCL 3BZ4B 4UBDC 4OUOA 1LVEA 3P0VL 4NNXB 4UINL 4HK3N 2XACC 5E5MB 3KPQB 1XGYH 2KQNA 4P9HH 2BY3A 5C8JA 4OZIA 4YGVB 4PJBA 4M1GL 5IVXE 3PHOA 2AXGA 4MD4A 1F4AA 5IWLC 1PFCA 2ICEA 4F3FB 1REIA 3SDYH 4G8IB 1T83C 5AZ2H 1GZPA 4Y5XC 4QHKJ 5DGQA 5GJTL 3QXAA 4X6FA 4PV9B 4JR9H 4Z95L 1L0YA 2XKNA 3T4YB 5KSAD 3FT2B 4MB5A 5DD0L 4Y4KA 3L5JA 4RGNC 1MSPA 1TZGH 2R2BB 1K6QH 5F3HA 1UC6A 5EU4A 1U42A 3EO0B 1NFDB 4LDLB 2ERJC 1XGYL 4P9HL 1HKLH 4PRHE 2BJML 4PG2C 4MXVF 4EVNA 3ARSA 4GW4A 3SDYL 5AZ2L 1W0VA 1DBAL 1P9MC 3H3KA 1KLUB 1IAKB 4OZIF 4PJBF 3LMJH 3S3SA 2FB4L 2RHEA 1WSST 4H25A 4S10A 4GBXD 3O3AA 5L0QC 3F62A 2EZ0C 1YPZE 1TZGL 3AREB 2FSEB 2O26U 3NOIA 4HWEL 1XGPA 4U49A 3ZDYE 1HKLL 4FFZH 4LPCA 4OQTH 4YHPB 1SBSH 2V9QA 3SCMC 2YK1H 25C8H 4KPHH 1KLFA 4HUVA 3BOVA 1T4KB 2LTQC 1V3JA 5EUOA 5IB5B 3MOQA 1F02I 1KYOK 3MROA 5INCA 4NHCL 1VDGA 4EN3D 5C9JB 3FB7A 3BUYA 3DRQA 2AXFA 5HI3D 4MA3B 3MGOB 4X8JB 2X4OB 5GS1C 4M4PA 3STZB 1QBAA 4RZCB 3SQOL 4ZO7A 4BQCA 2HT4D 3EOYG 4LCCC 2Z9TA 1FCCA 5E95B 4OQTL 5DFVC 3NABH 1FZJA 1SBSL 2D4DA 4R7NA 1U36A 1P7QA 3HNSH 1MQ8A 4GSDH 4M3KB 3PNWB 2EDTA 3NA9L 5D2NC 1OTUD 4Z18A 1G1YA 2YK1L 5CD3A 3RZWA 1IEHA 2X7LA 3D69B 3O2VH 5BOZG 2N7AA 4XHJC 5BCAA 3PDOB 1I9EA 3OR7B 1M6OA 4P3CH 4RQQA 1KTKE 4Y5VC 4IRSD 4JVPA 3VXTA 5EU5A 5C3TA 5IJVB 5EUOF 2VAAB 3VH8G 1F4XL 3LN5A 4JY6B 3FHQA 2R2HB 4YHLH 4YWGH 4AMKH 4TTDD 4LNRB 1TDQA 3RX8A 5I17B 5IMLA 4P23A 2UY7A 3HNSL 4F7PB 3VD3A 1OAKH 2PO6C 2DWDB 5I1DB 1DQJA 3LRSB 5F9OH 3DBXB 3HS0A 5CEZE 1MCBA 3Q1SH 5ANMA 3C8KA 1KN4H 1HOCB 2NY4C 3JWNC 5BQ7B 1KGCD 4Y1AD 2GSIA 3WHE1 3C09B 1PW3A 1QSVA 3MR9A 3OSKA 5DXWA 3GEWB 4ZXBA 4YWGL 5CP7A 4AMKL 5MEOB 3MRFA 3TIDA 3VXUD 4ALAH 1EPFA 5EZJB 1T1XB 3JV4A 4MJIB 2HLAB 4X7FC 3ZDXE 5HHMA 3LVEA 5D93C 3WCYA 2I07B 2JKXA 1FL6B 3Q5OA 4P4KD 4HIJB 4U0QB 3PWNB 5DHVH 4ZS6D 1ONQA 1KN4L 2VLLB 3KNBB 4IDJH 3VJ6A 3GMPA 2HH0H 3MQIA 1BBJA 3QAZC 4ZFGH 1L6ZA 5BZWA 3VXNA 1LE9A 4OI9A 3ZDZE 3OAUH 1G9NC 2I9LB 4XZUA 2E8YA 2E6PA 4ALAL 4Y16C 2XZQH 5FA3A 4ACPA 1OHQA 2I9TB 3QFJD 2OSLB 1T0MB 3QIWC 2ED8A 4P46B 3MBEA 5JLZA 4X7SH 2OS7A 5EA0L 3HCVB 3EHBC 3HUJB 3C60D 5L2JB 5T1LB 4IDJL 1U8HB 3MODH 4QT5A 2VZ1A 1AD0B 5FOBA 2IMNA 2Z31C 3NVQA 1MIEH 4ZFGL 3VFNB 1G6RA 4HKZA 5ESQB 5I1AB 1YYMH 3BZ4A 1DBJH 4JO2H 4X6DB 3OAUL 2R4RH 5FAAA 5E5MA 4LEXH 4HJJH 1MREL 4NN6C 2XZQL 2NY5H 4XT1C 4YGVA 4KK9D 3RKDD 1CT8B 4L5FL 4DQOL 1AXSB 4ENED 4LFHG 3RP1A 5F9AC 1JYVA 4X7SL 5F7KC 3SE4A 15C8L 1VGEH 3U9UA 3NN8B 2KKQA 4PV9A 3QWOB 4PLKC 3EYOB 2Y06H 4LLVB 1YPZA 2EO9A 2EC8A 3KS0H 4PJCE 3T4YA 5FV1L 3FT2A 1MIEL 2UY6A 1U8PB 1YYML 4WVRA 4ONFH 1DBJL 2G75B 3LPGA 2R2BA 3LZFL 3EO0A 1NFDA 4TNWF 2X5PA 3VA6A 2X89D 3OGOE 4JRWA 1QTYT 3RQ3A 3S37X 4MD5B 2J5LB 2FH6A 4YHOL 4P2QB 3BQUC 3V6OA 3U83A 4L4TE 2KPNA 4LHJB 5JDJA 2XG4A 4UV7H 3KPTA 2Y4SA 3RJQB 1YNLH 4YBHA 4I8DA 2XY2A 4CVZB 1IAKA 2Y06L 4YHKH 3ZL4H 1J0ZA 4TVPH 2P5EE 3O9WD 1PG7L 1R3IL 5EU6B 1JYNA 5E8DL 2IG2L 4EQ2A 2J4WH 3DHJA 4QXTA 1KBGH 1ZT1B 5T1KB 3AREA 2FSEA 3LS4H 5D96B 4YDIH 3TEUA 1YPZF 3PXHA 5EB9A 4YHPA 3C6SB 2YPVL 1BEYL 1FL5A 2MFNA 3ZDYF 4MDJB 1GC1H 3PWPD 3UJJL 1OLZA 1T4KA 4NQTA 5IB5A 3VFUB 2DQHH 1NFDF 1U8LB 4AENB 4YZFE 4Y88A 4YHKL 5EO9B 3ZKMD 4HXBL 4TVPL 1LE5B 2AQ3A 4POZC 2FL5B 4U1MB 1SQ2N 1D5ZB 1R5VB 3HZVB 1E27B 4MA3A 1LQSR 1FZKA 3MGOA 4X8JA 2X4OA 3STZA 4RZCA 2ZG1A 3EOTH 1U6AL 3GI8H 3QEHB 2IAMC 3NGBC 5EORH 3PNWA 2W9DL 4HG4K 1JF1B 4BFEA 4W4OC 3QEQE 3D69A 4QF1B 2DYPB 3PDOA 3ZE2E 1JPFA 3TYGL 1G7PB 3OR7A 1XF4B 4IOSD 1IEAB 4EI5C 3QHFH 2WBJC 3QNYB 1IGCH 4JDVB 5IJVA 3QPXH 2EDFA 3QXDA 2HFGH 2VAAA 1FGNL 4JY6A 1G7IB 5HHPA 1O5DT 3ARFB 4JFDD 2R2HA 4OI8A 3EOTL 4CU6A 2ZUSA 3GI8L 3MLRL 4FHBD 4LNRA 5I17A 4XC3L 3QUZA 3PJSB 5F1IB 2B39A 1L0XA 4MD0B 4F7PA 4PRDA 2DWDA 5D2LB 3FO9B 3BXNB 5F9WC 5I1DA 4NFBA 4P59L 3LRSA 1OTSC 1FORH 3DBXA 2R9HC 5AEAA 5IVZB 4LEOB 2V5YA 4PB9H 4XPAH 3CMOH 3B3IB 2BRQA 1HOCA 2RIKA 2IH1A 1AY1H 2B5IB 3GBLA 5BQ7A 3O3DB 1RVFH 5DHXB 4B7IA 1NDGB 1IGCL 5INDB 2HFGL 3OF6A 3AMLA 1RUKH 4NJ9L 4ZOBA 1WCQA 4Z6AT 1BP3B 5MEOA 2V2XA 3LH2L 3RIFK 5FO8B 3TJHC 5EZJA 1T1XA 5CJ5A 4MJIA 4PLJD 4GS7B 1KEMH 3RWHB 1A6WH 3DROB 4JFFD 1FL6A 2LAAA 1GCFA 4HIJA 2AJ3B 3PWNA 1S5IH 3SQBA 1XMWA 4YIQA 1DLHB 3CMOL 2OTPA 2VLLA 3KNBA 1S3KH 1AY1L 2W60B 4N0UE 4ODUB 3I84A 2HN7B 3GMMB 2RFXB 3SJVE 3RHWK 3QUKB 4Q9RH 5JNYB 4HUMB 2I9LA 3GSNH 3F7VB 1BAFL 1RZFH 1A14H 1TZHB 4JM2B 4OZ4B 2IPUG 1VFAB 3HE7B 3U46B 4PLOB 3PG2A 1KEML 4JY5H 2MJWA 2AJVH 1FPTH 2OSLA 1A6WL 1T0MA 2F5BH 3O6FD 4P46A 4BZ1L 3HCVA 4KJYB 3HUJA 1S3KL 1EFQA 1U8HA 3RVXD 3T0EB 4WHYG 2R23A 4U6TA 3F7YB 4DGYH 1K8DB 4XTRD 4PTTA 5ESQA 5I1AA 4L3CB 3QIUB 3QWRD 4X6DA 1MFNA 3GSNL 1LEGA 4QGYA 2HRPL 4F9LC 5MENA 4C56B 1SMOA 4JY5L 4KK6D 1CT8A 3ULUH 1AXSA 1CFQB 1NMBL 5L9DH 4GAGH 5IMKB 5C3LD 1R3HB 5FYLE 1EK3A 5ERWB 3QWOA 3EYOA 2VDMH 4JQVC 3STBA 1FBIL 2CO7B 3VFTA 4JHAL 3UTTD 4L4VB 4LCUB 1K8IB 1PLGL 5DRWB 4WFEE 2F5AH 2G75A 3O2WH 5T3XL 4XPTH 3HUJF 4JFYB 4OLZH 2DLFH 3B4NA 4WFHE 3O4LB 3HAEH 5TE6H 2JELL 1P7KB 3ROOB 2XZCL 1NC4B 4WEBL 5KTEL 4MD5A 4P2QA 4RAVB 1BIIB 4X6DF 4HMCA 2KBGA 2CKBH 4CVWA 4N1CA 4WO4A 3RTQC 4CVZA 1X5AA 2DKMA 1LMKA 5EU6A 1YEKL 4WWKB 5EBMB 3EDKA 5BS0B 2F5AL 2AEWA 1ZT1A 4XPTL 3INUH 4OCSH 4HFUL 4M1DH 2D3VA 4I18C 1T21B 2FIRT 4JKPH 4MDJA 4RFNB 5D1QA 3BDBA 3DXAE 3DX7B 1GJIA 1WITA 3VFUA 5CD5D 5CSZA 1U8LA 4AENA 4MAUL 4Y5YA 1I1AB 5EO9A 5D72H 1LE5A 4U1MA 2YD6A 1EEZB 1IKNC 3PWLA 1D5ZA 1R5VA 2YPLE 1E27A 5KSVB 2OR9H 4LU5H 2DIAA 1MFAL 4OCSL 5TQ0L 5KSUB 4H8WC 1U91B 2H1PL 4XNZB 3F65A 4WEMB 3PABB 4G6MH 3QEHA 4WTZA 5D7LE 3MLWH 3D1MC 3DO7A 4KROD 1JF1A 1J86A 3BKYL 2JCCB 1V7NH 4HJ0D 1HH9B 4QF1A 5FHAL 1L4IA 2DYPA 2DQEH 1G7PA 4N0CA 4UU9A 1FL3A 3QUYC 1IEAA 1S7UB 1T2JA 1BD2E 1ADQA 2ZCHH 3LPFA 4JPWH 2DAVA 4JDVA 3KJ6L 4LVHC 5GZND 4AZ8A 4PJ9A 4WU7A 4LU5L 1G7IA 3ARFA 3O6KH 2ORBL 4HQQL 1NGYB 4GJTB 4G6ML 1CDBA 3PJSA 1MLCA 5F1IA 2QKIB 4ODTL 3MLWL 4MD0A 5D2LA 3FB6A 3FO9A 3BXNA 2D2OA 5JW4M 1HKFA 3Q5TA 4EJ1C 4PJ8D 3GHEH 2DQEL 3BH9B 5IVZA 3AS2A 5TJWK 1GVIA 1AE6H 4FQXC 3QBTB 4JFZL 3O3DA 4WJ5B 1NDGA 4JPWL 2DLGA 1VACA 3MLZL 1OSPL 1CXIA 3X12B 3O6KL 3ARYA 2QBWA 5FO8A 3ULVE 5J9PB 3WO4B 3W5NA 5FIEA 5CWSB 3BN9D 3RWHA 3MV9D 2A6IB 1TVHB 3DROA 4L4JA 4F7TB 4K7PY 1CLOH 2M1KA 4U1GC 2AJ3A 3PQYD 1P5VA 1RSFA 3CDGB 5DD1L 1FO0L 1DLHA 1QFWL 3LSOB 3BD4A 2DQCH 2BDNH 1T5XB 5D2LF 3GMMA 1KLGB 1Y0LB 2BRRH 2RFXA 3BDYH 3MV8E 5CIPB 3VD7A 4D9QD 4HWBA 4DVBB 3QUKA 4F8QA 5JNYA 4UB0H 4ERSL 3RY4A 3F7VA 3HC3H 1NQBA 1TZHA 4JM2A 3KJ4C 4OZ4A 3DMMD 3L3IA 3U46A 1S5HB 2H3NB 3W5MA 2KZWA 1YEDB 3QRFM 3BT2H 4PJDB 4N68A 3MA9H 1YNKL 1P4LB 4GRWH 1CLOL 2YD5A 3O0RH 5EZIL 4BK5A 5DVLA 4OFDA 1KB9K 4QLRA 4KJYA 2JJTA 5FGRA 2XKSA 5E8EB 4EOWH 1ERNA 3QDMD 1KTLB 2DQCL 4RMTA 2BDNL 1NGZB 1J18A 2BRRL 3F7YA 2FH8A 2QSCL 4ONOA 3EDDA 1BWWA 3V7MA 1K8DA 4UB0L 1HHHB 1HWHB 3QIUA 4QRRD 2OYPA 4M62H 5ADOL 1VERA 3MJ9L 5ALCH 4Z76B 2DM7A 3WD5L 4C56A 2NTFB 4TUKH 4ZTPH 4IRZL 4OFIA 2IEPA 1CFQA 2VDKH 1AXIB 1QZ1A 3EYUL 3TVMB 1T0PB 1U8QB 3O0RL 5IF0A 5IMKA 2HWZL 4JM2F 3WMSA 1R3HA 5J56B 5ERWA 5IB4A 4EOWL 3C5ZD 3TNNB 4HMEA 1AJ7L 4F9PC 1GGBL 2D03H 4L4VA 5DRWA 1QSED 2XT1B 5F72S 5E9DD 4PV8B 3SY0A 2NPLX 5B4MD 3O4LA 2A9NH 1P7KA 4P48A 3HNTL 1QEWB 2DL9A 4TUKL 2OQJB 4ZTPL 4RAVA 3ULUD 1BIIA 2VDKL 3NIFE 4KKBC 2DTMH 2QJDA 4OM1H 1A7OH 1T89C 3HMXA 4PYHA 4GOSA 2FBJL 1KIRA 3OAYK 3QQ9D 3EKCA 4L8BB 5B38G 4YC2B 3DX6B 9CGTA 4D8PB 1F3RB 1CFSB 4WWKA 4DEPC 4UT6H 3GUTB 1H3TA 4HWNA 5EBMA 5KG9B 1SEBB 1BVKB 2CUIA 3MSPA 1WTLA 5CINH 3PV6B 5HHNB 3WFHB 4MXWL 4NQEE 1ZSDB 3DWTA 3W9DB 5DK0B 2A9NL 5BW7C 5HVHB 1NBVH 4LIQH 1UZ6F 2VLRD 5DURD 4EDXB 5K9KB 3SDDB 1ZHKB 1CICB 2DTML 1JGDA 4R4NC 3S7GA 1A7OL 5GS0L 3T4AB 2ZCLH 4P3WA 3IXTB 1NEUA 1C5CH 1QPPA 2CSPA 2QSQA 3VH8B 1DQDH 5KSVA 5HHVL 2VL5B 2IAND 4J4PC 3TV3H 1E6JH 1AI1L 4F7EB 3BWUC 5KSUA 3EZ8A 1X5JA 3PABA 3GM8A 4HC1A 4LIQL 3HG1B 3D9AH 4MS8A 2JCCA 4KI5C 3MUY1 1WCBB 1JGLL 1HH9A 1LGVA 5EOCJ 4DUXA 4P2RD 2I26N 5SWQB 3FQUA 1OP3H 4KK8D 4FQQB 1LO0L 4PB0H 2GY7B 4XVTL 3UBXA 1S7UA 2P8PB 1MJ7H 4B41A 3GRWH 3RX5A 4QXGL 4WY7H 2BVOB 3SE3A 2EEDA 3SKMB 1A7PL 5GRJH 2VLJB 3E6HA 3TV3L 4F57H 1E6JL 2XFXB 4M7KL 1NGYA 2QKIA 3TNMB 3CX5K 4J3VA 1JUFB 5A3IC 5HGDB 3D9AL 3VXRD 2HMID 1XR9B 2GSGA 4PB0L 4XB7A 4KMQA 4R0LB 4K07A 4WJ5A 2Y07H 2DRUA 3GRWL 2JCCF 1XCQA 1F8TH 1INEH 5F70A 3SDCB 4D0DB 3I6LD 3X12A 2EIBA 4NN7B 1PJ9A 2CMRH 4JGMA 2W0PA 1MRCH 5CWSA 3MRLB 2Q20A 1OB1A 4G80B 2A6IA 1TVHA 5D1XB 4F7TA 3F5WB 4NYLB 1CGSH 2JIXD 3NIGE 3VXOB 3WFDH 4NZRH 1VCAA 1WEJH 1JIBA 3MCKB 3LAFA 3LSOA 2K3TA 4JZOB 1M71B 1OP9A 1Q9LB 1QRKA 5IEKA 4PJEB 4JRXD 1T5XA 5I9QC 3AY4C 1KLGA 4DVBA 3H9HB 1H3XA 3IAPA 1J1PH 5CMAB 1INEL 3M07A 1MLBB 4CDGC 3BGFC 3C5SB 3U4EA 1Q0XL 4Y4HB 2WW8A 4M7ZB 2CMRL 1XGUB 4HMDA 3RZCC 3LHPL 3IDNB 2UYLB 3C6LB 1MRCL 1S5HA 1MHCA 3BKML 2FD6H 1YEDA 4PJDA 4HUWB 1U8OB 4RRPG 1D9KB 4ZSOB 4X80L 5D1ZC 1A4JB 4N90D 2APFA 4PRNB 1WEJL 1UH3A 5E8EA 3TN0C 1J5OL 3IKCB 4V1DB 3IFLH 4APQC 2VDNL 4PR5A 4KMTH 2ADIB 2ICWJ 1J1PL 1DBKH 1Z9OA 2H2SC 2YD7A 1CK0L 4Y8AA 5I8EB 5TDPB 1F5WA 2VN7A 5EDXA 4ORZC 3KXFD 1Q9KB 3U6RB 1IE5A 4X6CE 2NY0D 1EHLH 2O61B 4OTXH 4Z76A 5J6HB 4PJIB 2NTFA 4PJGE 2EECA 3FB5B 1PYWB 4TULL 3TVMA 1U8QA 2UV3A 3P9MB 4ZFOB 2ZUQC 5DD6B 5E6IB 5IB1A 1EGJH 3BIBX 4ELME 5J11B 3UTPD 1I3VA 3TNNA 5LXGH 4PJDF 3IFLL 1ND0B 2CGRH 4YDLC 5CP3A 4ONGL 3VG9B 5J6GB 4YXLL 4I13B 3CVIH 3VWKD 3RBSA 2FLBT 4PGJA 1JNNH 4PV8A 2PF6A 2D7QA 3QQ4B 5DJCB 1BVZA 5FA4B 5C0FB 1MRFL 2AERT 3UTOA 5J13B 3EO9L 2VDQL 5DZNA 1QEWA 1KPRB 3RDTA 3HB3C 4GFTB 3EUUA 4LVNB 4X4ME 4FZEH 3VXMD 1BJ8A 3NIFF 3U1SL 1NGPL 4L8BA 1EGJL 2BVYA 4D8PA 1CFSA 5LXGL 1J8KA 3EYFB 4NM4H 4BQ9A 3GUTA 2A0LC 3WYRA 1QNZL 4N8PA 5KG9A 1BFOB 1U8MA 1SEBA 3CVIL 1BVKA 4F7MB 3K8LA 5E7BA 2J8UA 5HHNA 3PV6A 3WFHA 3KLHD 1ZSDA 1INQB 5FGBC 3W9DA 5DK0A 3GSQB 4NQDD 5C0CB 3PP4L 4EDXA 2N56A 2DKUA 3SDDA 1ZHKA 5K9KA 1JZ3A 1CICA 5GISL 4M6NH 2AAVA 4FZEL 4KTEH 3VFRB 3T4AA 4LCWB 1G7JB 1LK3H 2HP4A 3IXTA 4XHQA 2HAZA 2G9HB 2UWEE 3MNWB 2CXKA 3ARWA 3S34L 4L3EB 4P2OD 4H1LG 1WBZB 4PUBL 3VH8A 3RIFF 3GJFH 4JN2A 5C0BB 3BKCL 3I6KA 2VL5A 4TUJB 5DD3H 4UOJA 5DS8B 4F7EA 4GLRI 1GOFA 2MPAH 2QHRL 1XIWB 3ARBB 4OF5A 2V2TA 4HGWB 3DGGB 4QOKB 5C2BH 4JHBA 3HG1A 5F8RC 3OB8A 1PZ5A 5JA8B 1URLA 1W8NA 4NBXB 2J8UF 1WCBA 1B90A 4NBYB 4QRPE 1M05B 4XC1L 1LK3L 1IAIM 4FQQA 3RHWF 3SBWA 3QIBD 2P8PA 1FYHB 5F3BB 1Z6JT 3LN9A 4ODHH 1HHKB 4U1SB 3SKMA 1A22B 2VLJA 5JHLH 5GRVL 4KRPD 4MNHB 1AC6A 2XFXA 4MNGB 5B3NA 4NQCB 3V4VH 3GZKA 1JUFA 1KTDB 4ZNCD 4MHHG 2HKFH 2P7TB 3RPIB 1XR9A 1RZJL 4TPRL 1K4CB 5SV4A 4PP2B 2DL2A 4R0LA 3QDJE 1CL7H 1NC2D 5FECA 3GK8H 4ODHL 2CQVA 3HR6A 5C2UB 4D0DA 1YMMB 2ADGB 1RD6A 5JHLL 2DD8H 1JTPA 1B2WL 4E42B 1P6AB 3UPCA 3V4VL 3P4LA 4LKXB 2JE8A 3PGFL 3MRLA 1H3VA 4UBDD 1JWSB 4G80A 5D1XA 4C55A 3WJJC 3F5WA 2ZPKH 4LSVL 4QHUA 4QRUB 5FDWB 3FT4A 3TA3D 4NYLA 2BK8A 3VXOA 4HS6B 3RNKB 4ODXB 1DN0B 2X4NB 3MCKA 4NOBA 3D25B 4IJ3C 4WUKH 4JZOA 1M71A 2J6EH 4XVSH 5IFHH 1O7VA 5DUPL 3H9HA 2Z91B 4DKFL 5CMAA 5LCVH 1BX2B 4I0PB 5A2LH 3VG0H 1T66C 4Y4HA 5FYJH 3DETC 5L88H 1MFCH 3IDNA 2UYLA 3U30B 5F7DB 2YKLH 3OJ2C 3S96B 4PRAB 4HUWA 1MJUH 1U8OA 1BIHA 5FM5M 4ELMA 1D9KA 4ZSOA 5DA4A 4JHZA 1A4JA 2E7LA 3CFCH 4Z78B 3RI5K 4PRNA 3V52L 4RX4D 1N6QH 1I85A 4AIZB 3IKCA 4MB4A 1J1OL 2AJYH 4V1DA 4Y4KC 3GSWA 2NZ9C 4XVSL 3BRDA 2ADIA 5JHDD 3MTRA 5LCVL 5MP6L 1HSAB 3M1BB 5I8EA 5TDPA 4YHYC 3HZMB 2CPCA 2GJ6E 4AY0A 5HY9B 5ITFB 3JWDC 3BYTA 1Q9KA 5CJOH 3U6RA 3MV7B 5L88L 2V17H 4DJMA 5J6HA 3UXFA 5EOTB 1BBDH 3PP3H 3FB5A 2EZ0D 4HFWB 5HYSG 1MJUL 1PYWA 3EJZC 1U3YA 5E2TH 4LSRL 5I74C 4ZFOA 3P30H 5DD6A 5E6IA 3D3VB 1N6QL 1BGXH 1SJVA 1AHWB 2AJYL 1ND0A 2BNUB 3N85H 2HRLA 3UTSD 2IFFL 2FEEI 3MUJA 1HHIB 5J6GA 2MCPL 1CTNA 3V79C 3NCYP 2OMNA 3QQ4A 1AGFB 1J8HB 5CJOL 5C0FA 3VDBA 2VXVH 5E2WL 2VLKD 2V9TA 1HSBB 1K85A 3OKOB 1KPRA 5SWZD 4WV1B 3V5HB 1EEQA 3UZQA 4UV4H 5E2TL 3P30L 1AXTL 4LP5A 3TJEL 2BHUA 2D7OA 1AC0A 1V5JA 4DKEL 5JR1H 4G8GE 4XHJD 5FKPB 5L8JB 3SE9L 1BFOA 4O51B 4F7MA 1MCKA 2X9WA 3GMNA 4FS0A 1JHKH 3GSQA 5JOFB 5K9QI 4GMTH 5C0CA 4OCNC 3UZEA 3P9LB 5I30L 4HULB 4CN6A 3DURB 3L9RA 1UM6H 4LVEA 5J06A 5I19H 4R96B 4UV4L 5E70A 3V7AG 3VFRA 4NP4H 4LCWA 1G7JA 3L1OL 2G9HA 3QCVH 3MRDB 2AK1L 2PO6D 3MNWA 4LLYB 3KLAA 1IC1A 2LVCA 3RIAK 1SYVB 4L3EA 3S3PA 5I75C 2ED9A 5C0BA 2Q86B 3A0OA 2IFGA 5DS8A 2NY4D 4JPIB 4LCYB 3OWEA 1JGUH 1XIWA 3ARBA 5K93A 4OGAC 4I9WD 4HGWA 3PDDA 4GMTL 4QOKA 8FABA 2FO4B 5CLWA 1NAMB 2J7LA 3OKKB 1UM6L 3P2TA 5KSAB 2WAHA 2X4PB 5I19L 1S8DB 3QDJA 2D7PA 4WW1B 5HTSA 3MRQA 1WFNA 1TQBC 2CLZB 2HTKD 2VUOA 3QCVL 5F3BA 1OD7A 4YGAB 1QYGH 1I8MB 3CIQA 4U1SA 5CEZL 3GSOB 4QRQB 3IJYB 4ZXBC 1KJ2B 3SDXE 4NUGH 3FRPG 4R6UA 5FCSH 4WIQA 4FQJH 2GIYA 2UZXB 1SJXA 3TPUB 1UM5H 1JGUL 5GHWL 4GKSB 4NQCA 3NFPB 4LAJH 4BQ8A 1ETZB 1SVCP 1KTDA 3M8OH 5JW4R 3D85D 2XPGB 2N4IA 4G9FD 2P7TA 3RPIA 4Y16D 1Z3GH 4JJHA 5D7IE 1K4CA 1LDPH 4PP2A 4JZJB 5GGTA 3FQRB 3UJIL 3PGDA 1NCWH 1EXUB 1H3UA 4OLXH 3QIWD 2FYYB 1YMMA 2ADGA 4P99A 4KTYA 2R56H 2A9ML 4Z7VB 3S5LG 4AM0B 5B22A 1KIPB 4FQJL 1CE6B 1XH3A 3L5WB 4E42A 2Z31D 4K94H 1UM5L 1MI5D 1H5BB 4MAYB 4LKXA 3JTTB 2O5XH 1JWSA 1WUNT 3MBEC 1C5BL 5FDWA 1H8SA 1J11A 4QRUA 5CFHA 5IW3A 4ZUTB 3T2OA 3RNKA 4ODXA 1DN0A 2X4NA 3UDWA 5HYEA 2LQRA 3D25A 5DVKA 3V8CA 3UP1A 1NCWL 1TITA 4OLXL 2Z91A 1FZMB 1BX2A 1MAKA 1L7TL 1GGCL 4PLKD 5JPMB 5CBAB 1RULH 1QO3A 1TIUA 4K94L 1FLTX 2OI9B 4IHOB 2Q7NA 5F7DA 3S96A 2Y72A 4HGKC 1FNSH 4KU1A 1OAXL 2O5XL 4RAHA 1P84K 1FRGH 3SE4C 2F53E 2ADFL 3J7HA 4NCC1 1DQLL 4Z78A 2F54B 1JF5A 3REVB 3MJ6A 3WEXA 3CFJA 5DWUH 3BQUD 1FNEA 1PKQE 3QUXD 2HT2C 1FNHA 1HSAA 3M1BA 5F96L 3HZMA 1MCPH 4P2YA 1P4BH 5FYJD 5HY9A 5ITFA 5HDQL 3MV7A 4OCWL 4LAQH 3V6OC 3WUZA 1FNSL 5GGVY 5EOTA 2NYYC 3HI1A 4YXKH 1IFHL 4F58H 4HFWA 2ESVD 4Y1AB 5I76B 1NCTA 4MNQB 2QR0B 4H8WH 1FNFA 4LMQE 3MLSH 5B38B 1WBYB 2G60H 2GEEA 5FO9B 5BRZD 1I7ZB 2QV2A 1AHWA 2D9QB 2BSSB 3U4AA 3VXUB 1C12B 4JFOB 3HRZA 1WAAA 3AREC 2DM2A 4U0RB 1HHIA 4WHTB 4POYA 2YRLA 3P4MB 4R26L 1CYGA 1P4BL 5J1SC 4WEUD 5GGQH 3U7WL 1J8HA 4FABL 4POZD 3UJTL 1GHFH 1HSBA 3U79A 4W6XB 3OKOA 2AQ2A 3WNPA 4WV1A 3V5HA 1B4JL 1IM9D 2VISB 2CR3A 1B88A 2A38A 5FYKD 2D0GA 3WFBH 3MLSL 1A9EB 4QRSB 1TXKA 3S36H 2G60L 4RDQF 2VLME 5T1MB 4K55A 5HHOB 5DF0A 3CJJA 4ZO6A 5IB2B 5DRZB 1ACYL 3MZGB 1MCOH 4O51A 5KS9B 4Y2OA 3F6IA 2PYED 4NO2B 1RZGB 2OX5A 2DM4A 3O8XB 2WBJD 5AZEH 5JOFA 1X3DA 4OLUL 1WAAF 4S1QL 1BZ7B 2V7NB 3KYMB 3P9LA 3DURA 5GGRB 1HZHL 4R96A 3NH7L 3WFBL 4BH8A 1OPGH 1UCBL 4KVCH 2EDRA 3MRDA 5GPRA 4LLYA 1RZ7H 1XF5B 3WS6A 1OTSD 3GDBA 2Q86A 3DV4B 1DTUA 3RL2B 4JPIA 3WKNA 4GW5B 4LCYA 5KANG 1TTUA 1PZUB 5AZEL 3QFJE 5KVEH 4HUKB 4JREB 2YSSB 3T65B 3KG5A 3WIHH 3BESR 1NAMA 5KSAA 3C2SA 2X4PA 1S8DA 4KY1H 4RISL 4WW1A 3TJHD 2CLZA 1OPGL 4UT9H 4D9RD 4JFHE 1RZ7L 2Q76B 3C09C 5IB3B 2I5YL 4NNPH 5FCUH 1UQSA 3GSOA 4QRQA 3IJYA 4A2MA 1KJ2A 5K9OB 4NO3B 3OZ9L 3TPUA 5KVEL 4GKSA 1IGJB 3ABZA 3NFPA 3WIHL 2HFTA 1NL0L 2MHAB 2XPGA 1ADQL 3H7BB 2H9GA 4S1SL 1RHHB 2BVEA 2X10A 5KAQF 4HHAB 3FQRA 1A0QH 4HT1H 1EXUA 5FCUL 2FYYA 1UJ3A 2BOBB 5I8KH 1OAQH 3CPLA 2GT9A 3PWPB 3F6LA 4U1HA 1BM3H 3NIDF 4Z7VA 5I1HH 1KIPA 1CE6A 4XMPH 3L5WA 1H5BA 5IG7B 4MAYA 2HFEB 4EN3A 3JTTA 1FYTE 3S35H 4P46C 4ZO8A 4PRBB 3BSZL 4ZUTA 1OL0A 1TFHA 3PF2A 4MVBD 1CU4H 1R0AH 4PTUB 3MOBH 4NO0B 3VE0B 4AQ1B 3O6LH 1A0QL 3H2WA 3RL1A 1OAQL 5ACZB 3FFCB 1FZMA 2ENSA 5E1AB 1BM3L 2FLRT 3H8NA 5FYLH 1YUHB 2GHWB 4UNUA 3VI3F 2OMBA 1N5AB 2OI9A 4IHOA 1F4HA 2APXA 1IQDB 4OKVB 2A74B 1IGMH 3NZHH 1G7QB 3S35L 4YFLF 5GRYA 2Q6WB 3MYJB 1L8JA 2VXTL 2FR4B 4RFOH 5HYJD 4Z7VF 1SMAA 2XTJB 1XGTB 1KV3A 4OB5H 3KR3H 3ERYA 5I1CL 1F6FB 3RVUC 1R0AL 3U7YH 3LIZH 3REVA 2GW5A 4G7VL 4M1CC 2WIIA 1FFNB 2D4FA 4O00A 2NY3B 3RTQD 3I50H 5FYLL 5D70H 3ZT6A 2R0WL 5FHBL 1AR1D 2J5LC 1R3LA 2DF3A 3UBXI 3TP4A 3I02B 1OAZL 2DQIL 1SHMA 3RUGB 4Y1AA 5I76A 4MNQA 2YR3A 2QR0A 3KR3L 5B38A 3PIQB 3U7YL 4KKAC 1WBYA 5GIRB 3WE6B 5FO9A 4U3XA 5SX5H 1I7ZA 2BSSA 3VXUA 1C12A 2NXYB 4JFOA 5IM7B 1FSKB 4DCQB 4AIXA 3VI4E 4JFDE 4WHTA 5JZ7D 1GSMA 5D96C 1LK2A 3P4MA 3I50L 2WWMC 4K7FB 1CGYA 4JFFB 5HGGS 3MFFA 2AP2A 4NSKB 4GW1A 4Z9KB 1OW0A 1A47A 4NUJB 4OLYH 1RUAL 2X44D 1INDH 2VISA 4PY8I 4HS8L 1A9EA 4B50A 4QRSA 3BWAB 4FFVC 4I48B 4ETQB 5HHOA 2W1NA 3QDGB 1QFUL 5IB2A 5DRZA 2RCSL 4WENB 1MCFA 3VFVB 5KS9A 1IARB 1UWEH 4OGXL 3QA3B 3QUYD 1RZGA 2JB5L 4I77H 4NO2A 3QFDB 3O8XA 5SX4H 2FX7L 1XT5A 1RZKH 5FK9B 3TGXA 3H3PH 4ZO9A 2N1KA 5JMRA 2V7NA 3KYMA 3SOBH 3BW9B 1TTGA 1NJ9A 5EUKA 5GZOC 4N0CC 1X5YA 1YECL 5KZCD 3JZ7A 1UT9A 1BZQK 1HINH 1U8NB 1XF5A 3VD4A 3ARFC 5I2IB 2AKRB 3DV4A 4AT6B 1JPSH 5EIIB 2GYSA 4FQXD 3RL2A 3BZDA 3RFZC 5EBLB 4YX2L 4GW5A 5KOVC 3UO1L 3WHE0 4M61B 1YYLL 4WHCA 1HI6A 3IRPX 4N0FA 1RZKL 5FM5O 4P5MB 2YSSA 3H3PL 3T65A 4LLUB 5KS9F 3IU4L 4YUEH 4PJFE 1PG7X 5JA9A 4PRIB 4DN4H 2B5IC 4Q6IB 1Y6KR 3ARPA 2APVA 3TCXA 1HINL 3PUCA 5ISZD 1QLEL 2Q76A 2X89A 1OAUH 5IB3A 3AGVA 4HC1L 4Z7UE 4X83A 5K9OA 4O9HH 4YNYB 5IHBA 4NO3A 5BV7H 1YMHB 5DFWH 3RGVB 4GS7C 4RA0C 3R06B 3NCYS 1IGJA 2EEAA 3RI5F 5J0BA 3OV6A 2K7QA 4YDKL 1UACH 3MRHA 2BCKB 2K9UA 4Z7QE 2MHAA 2WANA 3SGEH 3H7BA 1RHHA 3X17A 4UT7H 3ULVL 1MHHB 3HC0B 3RRQA 3UTTE 1OAUL 4M6MH 2BOBA 4O2EB 1MEXH 4WNQB 2YZ1A 3PWPA 3MCLH 1R24A 4JM2C 4QTHB 5BV7L 1AO7D 4H88L 3HE7C 5GGSY 3NMEA 5KSBE 5AD0B 5IG7A 1RJZB 3SJVD 3B2UC 3RY6A 4RRPA 2I27N 4K3JH 1WIOA 1U3HB 1UACL 5ICYB 4PRBA 1L7IL 1D6VH 2NXZD 1QFWM 3RWGB 3T0EC 5E8PB 2DLTA 4PTUA 4NN5B 4NO0A 4NWTL 3VE0A 2WBWB 1M1SA 4OQTA 2EXYC 4PFEA 4OZGB 4V3DB 3QIUC 4M6ML 3FFCA 4XPFL 3MCLL 1YUHA 5C1MB 4PP1C 5LG1A 5EPMB 4FQCH 4G43B 5C92A 1N5AA 1MCSA 4UQ3B 3O45B 3S98A 3LS5H 1IQDA 4X4YB 5ENWA 5E8NA 5HYSB 4PJXE 3QH3A 1G7QA 2BP3A 2Q6WA 3CDCA 2NLJB 3MYJA 5D5MB 4EUPH 2FR4A 1SYSB 1XGTA 1D6VL 1J0KA 2R0ZH 3O3EB 2NX5D 4ZUSB 4D9LH 4PJAE 4XP6H 4JFDA 2XY1A 5I15H 4WTWA 3SGKA 4JFPB 3BN3B 1NUGA 1JFQH 3MMEA 4KKBD 1FFNA 1IGYB 1UA6L 1T03H 5FYLD 4ZPVB 3CSYB 1NCCH 4AG4L 3BKJH 1TETL 3LS5L 4W6WB 4M48H 5C0RH 2NY7H 4U7MA 4ZTOH 5IEHA 2D7TH 4E41B 3RUGA 1FGVH 3CZFA 3RIAF 4Q9QL 1MRDH 4WFHD 1J7VR 4XBGB 3SKNB 4NNYB 3BO8B 3PIQA 1QHPA 1UADC 5GIRA 3WE6A 1KJMB 4WWKC 3T2NH 5DQJB 1FAKT 5IM7A 5HSFA 4R4ND 4DCQA 2DLEA 3QISA 4KKCC 4DKAA 3LKSB 1RJYB 3MV9B 4K7FA 4JFFA 3VFOA 1T22B 3VI4F 1H8OA 3PQYB 1RIUH 4NSKA 1BFVH 3NZ8B 5ACLA 4NUJA 4G42B 3NCJL 4M48L 1I8KB 2NY7L 4BSJA 3GI9L 1HHJB 1QRND 5I1LA 4NHUE 4J4PD 5LQBL 5T33L 3EOBB 1TVBA 1MRDL 1I1AC 5DMKB 4JFEE 1NCAH 1NMCB 1GIGH 3BWAA 4I48A 3TBWB 3DNKA 4ETQA 4GG8B 2YUZA 5D7JB 4M5ZH 5T5FH 5FGCB 3QDGA 4R4BB 3MLYH 4KI5D 2UZYB 4CBPA 3RUGF 3IVKA 1MFEH 3VFVA 4XNZC 1CXFA 4P9ML 2YD1A 1FAIH 3BPOB 5DHVA 3FMGH 3QFDA 4JKKA 1EFXD 5C07D 5JUEL 4F2MB 5FK9A 2F8OA 5B39A 4MS8C 2BMKA 4J8RA 3VGEA 4NT6B 1E4XH 3OKLB 3LV3B 3QWRA 1GIGL 5DR5H 3GSNB 2OK0H 4QRRB 4D9QE 3DUHA 1HN1A 4M5ZL 5A3ID 1U8NA 5GRWA 3SE3C 1G9MH 3EAKA 4PJ5E 4V3EB 2IADB 4Z7WE 4RMSA 1MFEL 2AKRA 4AT6A 3VGGA 1JZ4A 5EIIA 3X11B 4FQLH 3SO5A 4LSUH 5E5RB 3OMZA 1YEIH 1BD2D 4P5MA 1YQ2A 4J2XA 2E7BA 3QG7H 5FDYA 4LLUA 2Q1EA 4JRYB 1DQQB 3QDHA 4PRIA 3QDME 5CZVL 5DTFB 1KCRL 2IWGA 4Q6IA 1C16B 3GKWH 2EDOA 5IQ7H 4ZOAA 4KJPC 3LKRB 1OP3K 5L6YH 3S5LB 1YNTB 3FQXA 4H0IA 4YNYA 1KPVB 4B0MM 1A7NH 2DJUA 1YMHA 4LSUL 4BUHA 4KFZC 3PWVB 4J3TA 3WO4C 1KELH 3R06A 2W38A 2QSVA 4KRNA 5D6DA 4ODSL 4OLWL 2R0KH 4XXCA 4I3SL 5K33A 2ZNXA 5F88B 3D48R 3RZCD 4LARH 3K3QA 4FQ2H 3GO1H 2B2XH 1MHHA 5IQ7L 4S2SB 4Z77A 4OT1H 3HC0A 1QSEE 3ZTJG 2E7HA 3NTCH 4OLEA 5E9DE 4WNQA 1A6AB 5BJTB 3Q3GB 3J8F7 1PY4A 1I8IB 3TN0D 2D31B 4N5UA 4EZMA 5FO7B 2AW2A 4APQD 5C09B 4ZUUB 1EH9A 1KELL 3FO2B 5AD0A 1RJZA 2B4CC 2H2SD 1MCNA 3FRUA 1U3HA 1EO8L 1J88A 4BSWB 4KGJA 3RWGA 5E8PA 1HXYB 5F7FA 1X4XA 4Y8DC 1OWWA 4NQSA 4OT1L 4MX7B 5AYQA 4OZGA 3NTCL 1PX3A 4Y4FD 2EYTB 2P5WE 4P2CG 43C9B 5MEQB 5D71H 3AUVA 3MRIB 2VLRE 4G43A 4UQ3A 3O45A 4U3HA 4YHZH 4EKXA 2RB8A 4X4YA 5JW4N 2AEPH 5GS2D 1N64L 5HYSA 3TVMC 3IDIB 4XNUH 1EHAA 2NLJA 5D5MA 2EKJA 4OAWB 3QJFB 1SYSA 4JO1H 4PJ7E 1N7ML 4PJHB 3O3EA 4ZUSA 3HFMH 4IRJB 4K9EC 3UC0H 3EDJA 5T5NG 4JFPA 1KSRA 5I0ZA 5HHXH 3HB3D 2IANE 2XV6B 1IGYA 1HK6A 2VL4A 1QR4A 2EDNA 2O5YH 3KLDA 3LDBB 2B1HL 3GBNH 5KVMC 4ZPVA 2JLLA 3EOAB 5E2VH 3CSYA 4QXUL 4PJ8A 4NHUA 4U4BA 4JO3H 2GITB 4KUCF 3W81A 2NY6B 5ESVB 2A0LD 4TOYH 4OZGF 3U0TB 1OSZB 1OVZA 2FWOB 1JZ7A 4XNUL 4P2RE 4YAQB 5F89B 4CW1B 4OF3A 1TJGH 4ZDHB 5F6HI 4YC2C 4WI7A 1JMXA 4XCNB 3SKNA 4NNYA 3BO8A 4JQXA 4Y19E 1Q8MA 5DQJA 3FL7A 1KCLA 5D5MF 4U33A 5I73B 1CDHA 3R0NA 3VMNA 2O5YL 3LKSA 1QVOB 1RJYA 1YEEL 3GBNL 3MV9A 5HPMB 1GPOH 4GAYA 4N5EA 2JIXB 5FEBA 5HVHC 3PQYA 1A5FH 1FO0B 4JO3L 2HG5B 2HLFC 3TBYB 3NZ8A 5C0AD 1KXQE 4G42A 3SDDC 3X3FL 3VXRE 1CICC 4TOYL 1K9TA 4WI3A 1FFOB 2D0HA 2ZP0T 2FIKB 4NQED 5F71A 3EOBA 3WXVH 4GG6B 1T3FB 5DMKA 4C58B 4LPUA 5L2KD 1U3ZA 1HNGA 1QD0A 4K7PH 3QO1B 3TBWA 3FCTB 2EIZB 4GG8A 2HVJA 2PN5A 1BJMA 1O0VA 3CU1A 3I6LE 1DSFH 4R4BA 1MJJA 3MFGB 4MNGE 1C7SA 2APBA 5C08D 1GPOL 3E3QE 4F2MA 4HLZG 4X6EB 1YC8A 3QDMA 3MLUL 5F7EH 3K4ZA 3LQAL 1XFPA 1B9ZA 4NT6A 4CVUA 3PWJB 3Q48A 1N4XH 5GGRY 3IGAB 3OKLA 3LV3A 5JIHA 4JRXE 3GSNA 4K7PL 4D0CB 2CXGA 3KXFB 4QRRA 1D3CA 1RU9L 1D7FA 4D3CH 2IADA 4K3DL 3BAEH 2R2EB 4YFDB 5I66B 1IBGH 1QUNA 3X11A 5J8OA 4GRWB 3D87B 1XCTB 4R9HA 1G6RH 1HILB 3GJFK 1VFOA 2GAZB 3HI5H 5CJXA 2BX5A 3SGDI 4HJGB 5I1EH 4N90E 1Q72H 5DJDB 4JRYA 3FAXA 3G6AB 1DQQA 5FUZL 3NACH 4R0LC 1EMTL 2AGJL 1C16A 5E9DA 2YD4A 4CJ0A 2QL1A 2BERA 1EZVX 2VNCA 4ZS7L 3HI6H 3SDCC 1F4YL 3BAEL 2CDEB 3S5LA 1YNTA 1IBGL 1OCWH 4NN7C 3P77B 3D39B 2Z35B 3HZYB 5DJXB 3EBAA 3RVVC 3PWVA 3MRGB 5D1XC 3HI5L 2Y7QA 4AQOA 4RMWA 1NCBH 5F88A 3DETD 1Z2KA 2Z8VC 4M02A 4W68A 3FOLB 4GRMA 4U1LB 3UTPE 3MV11 2VE6B 4S2SA 4XBPB 3HAEA 3H0TB 1A6UH 2WUCL 4NQDB 4J6RL 4J3UA 4ZNEE 2VLRA 2E27L 1HYSC 5IW6B 1JE6A 1N6VA 4Y4HC 1OCWL 1A6AA 2NY1B 4M7ZC 4YJZL 3Q3GA 2ZCKL 4X99B 2EE6A 3NCBB 1I8IA 2E7CA 1LO5B 2D31A 3C6LC 5CS7A 3P4OB 4Y4KD 2NZ9D 4ZUUA 2ZOLB 4U31A 1D9KC 2J88H 3D0VB 4HH8A 3H9SB 3ULUF 3VXME 1NCBL 2E7LC 2YBRB 3D3VE 4BSWA 2FX9H 1IMHC 4HDIB 1I85C 5HYQB 2IANA 1GAFH 1M7IB 4MX7A 2ZJSH 2DQJH 3UTQB 2M2DA 3OKNB 3H9ZA 2EYTA 4QHKI 43C9A 5MEQA 1WT5A 1JRHI 3G08B 2ATKB 5DD5H 2FCBA 3VRLE 1DLFH 3T3ME 1UWGH 2J88L 4XVUC 5JIPA 3QIBB 3IDIA 3VD9A 4OAWA 4K3HA 3QJFA 1WF5A 1LO4H 5E6IC 1RIVH 4P4RB 4PJHA 3ESVF 5J11C 2CRMA 4KRPB 4HH9B 4YQXH 1I9IH 2DQJL 2VDOH 3V5DB 3VG9C 1P6FA 4HV8B 4OZHE 1CGUA 3CK0L 3TF7A 5BVPH 4GQ9L 3AS1A 5E2JA 3BRFA 1JK8A 3CDFA 3EOAA 2IH3B 4V2BA 2BC4B 5J13C 4JANB 2HKHH 3W2DH 5DD5L 2GITA 5ESVA 5E2UL 2VYRE 3FZUC 7FABH 5C0IB 1IGTB 1OSZA 3U0TA 2PETA 2FWOA 4LVNC 1NUNB 2Y5TB 5TDNB 4YAQA 5F89A 5CGYC 3ETBF 3LD8B 4OLVH 4YHMH 1P7QD 1RIVL 4J1UB 4ZDHA 4WTZG 1ZLSL 4G59A 2EDLA 4XCNA 2ZSWB 2ED7A 3PP3K 1JZ6A 4HIIB 1XGRA 1W72H 2A6JA 2VDOL 4L8SB 5JXEA 1I3GH 4P5TD 5I71B 4PJHF 1YEFL 3X14A 1R5WA 3TA3B 2JIXA 4E0RB 1EA9C 4OJFH 1FO0A 2HKHL 3W2DL 2HG5A 2VDLH 3TBTB 3CGTA 5TDOB 3TBYA 1A3QA 7FABL 3IDJA 1KB5H 2F74B 2BNQB 1FFOA 4PS4H 4XNQB 4AIOA 2FNBA 4LPWA 4ODWB 4OLVL 2FIKA 4YFLI 4G6KL 1F3DH 2I25N 4GG6A 1T3FA 5CUSH 3VXSD 4P3DB 4ZMAT 4OGAD 1NBQA 5DLMH 3QO1A 2R2CA 2EIZA 5I1IL 5CJ8A 1R6VA 1W72L 2R1YB 4PGCA 1QSFB 2VXQH 1LP9E 3ARVA 3T3PE 1MCDA 1LO3H 2VERN 3D5OF 4XPBL 4ZFFB 4X6BB 1XIWC 3ARBC 4OSUL 4KHTH 2VDLL 3CLFH 3DSFH 1CD0A 4YPJA 4GO6B 1KB5L 2HFFB 3BDXA 4N8VB 2C4XA 4X6EA 3WJLA 4ZXBD 5B8CB 2DQTH 3PWJA 4GKOA 5IK3B 3NPSB 3AM8A 2R39A 1IC7L 3IGAA 5CUSL 2MQCA 3B83A 2AI0H 1ODAA 3HC4L 5IVOA 5SWSE 4XPGH 3RU8H 2W0LA 5DLML 5DMGC 4D0CA 3KXFA 2YC1B 3ARGD 3QPQC 1Q9WB 2VXQL 3MJ9A 1IAII 3JWOL 2DQUH 1OF2B 2R2EA 2IC2A 5I66A 4XP5L 4GG6F 1NLBH 4QRPD 1CG9B 3TO4D 4KHTL 2ICES 2R8SL 1JRHL 1XCTA 3DSFL 4P57A 4RGNE 4CU7A 2YRPA 2GAZA 3QCUL 4QY8B 4HJGA 2DQTL 4MJ5B 3UTSB 3R4DA 3DYOA 3B8SA 5DJDA 1NGXB 3VWJD 3G6AA 1ULVA 2AI0L 4G5ZH 3VWKA 4MD4B 3RU8L 1FN4B 2Z8WC 4BYHA 5JHDE 1PBYA 3MBED 1KIUA 4FTVB 3ZE0E 1RIHL 1MFDH 4XWOC 3H42H 2XN9B 3VU2A 4X6FB 1NLBL 3P77A 1X7QB 3D39A 5JO5A 5J4MA 2Z35A 1G84A 1N2RB 1KUMA 3HZYA 1OARH 1QA9B 5DC4B 5EZLB 1T2XA 3MRGA 3N1PC 1OT2A 4FQHB 5IBLC 5EU4B 2GJJA 3GGWB 3RKPA 2AVGA 4HCRH 1NGQH 4KAQH 4MMXC 4GRWF 3UDWC 5HD8C 1KPUB 3IS0X 1I8LA 3G9AB 5CCKH 2YD2A 4QTIH 4M5YH 4L1DA 2VE6A 1KCVH 1U2CA 3FQNB 4XBPA 5HPOA 3H0TA 4XMKL 1VEPA 4NQDA 1MFDL 2EH8L 2XXMB 4I0PC 4F33B 3H42L 1EJOH 1GGIL 4LSQL 1BPVA 2FJHA 1N0XL 4X99A 4HAFA 4M6OH 2VLKE 1LO5A 4OFKA 3U30C 4H25B 1DZBA 3P4OA 1OARL 5I6XB 5L7XH 2V5MA 5SWZE 2ZOLA 3V0WL 1ZVHA 3BRGC 2HT2D 12E8H 3D0VA 3O41B 1X5XA 3QR2A 3S37H 4HCRL 4P2OA 3ZSTA 3KPMB 4N1HB 2P43B 4HDIA 5D2NE 5HYQA 4OZHA 1I9RL 1KCVL 2NYYD 1M7IA 4YBLB 1I1RA 5DHYB 1DE4B 1ZHLB 3UTQA 3GMLB 4NKQB 1EJOL 3B9VA 3OKNA 1YN7B 1HNFA 2CK0L 4I1NB 2FHBA 4OM0L 3DRQB 3G08A 1MPAL 2ATKA 1CD8A 4KMLB 2HVKB 1U3JA 5L7XL 3OG6B 3PV7A 1NSNH 4KQ4H 4Z8FH 2EDYA 2O93L 3ARED 3QIBA 5CZKA 3FO1B 5IBTH 4Q6YA 4G8FB 4OUUB 2O5ZL 4CGTA 4R7NB 2GJ6D 4M00A 3S88H 4P4RA 1KIQB 2IPTH 1AHWC 2YD8A 3MXWH 5TGBB 4HH9A 4UUJB 1X5IA 4B7LA 1E4WH 4MZ3A 3TESA 3V5DA 2SEBB 4K8RC 4POUB 3N9GH 2DWEA 4LHUD 5DK2A 4HLJA 1NH6A 5F1KC 2IH3A 3DI3B 2BC4A 4I9WE 4ZODA 5FGSA 1LO2L 1F11B 5C9KA 1NSNL 4Z8FL 3LN5B 4WV1C 2H26B 2DJ4A 5D7KD 5C0IA 5FM8A 3FB8B 5TDNA 3CD4A 3GRWA 4IMLB 5HBBA 4P23B 3DX9B 4J1UA 4H0GA 2XWTA 2IPTL 4OFVA 2YHGA 2UVEA 3PHQB 2ZSWA 3MXWL 2VTFA 1S78C 4TUOB 4HIIA 3RWFA 1DQJB 3QDAA 4FQIH 1E4WL 3JTCA 5HVFB 5E99H 4L8SA 3MO1B 1G7MB 4X9GA 3N9GL 1OTTC 4FFWC 4KKLC 4Q2ZB 4G6FB 3TA3A 2DQDL 3UBXG 1DFBL 4XVJL 4E0RA 3QYCA 3TBTA 3D6GA 5TDOA 1AQKL 4XAWH 2F74A 4G8GD 2BNQA 5CEXA 4G9FE 3R1GL 2WNGA 4XNQA 2NW2B 3MRFB 1NFKA 3RBGA 1T83A 1UXWB 4KV5E 3W0WB 1TVDA 2LU3A 4P3DA 1ZGLM 3HPJB 4O5LL 4F37F 2EYRA 4XBEL 5DDHB 5IHUL 2AK4B 4J3OC 1DL7H 1F2QA 1PDKA 1U95A 1UGNA 3ZKXB 2E6QA 4ZFFA 1MI5E 1PGRB 1S9WB 4X6BA 3HRPA 3OX8B 4M03A 3GJEB 5BZWB 1JHTB 2COQA 4XAWL 4DZ8B 1XAUA 2HFFA 4N8VA 5IVXB 5KSAC 2OJZH 3QUXB 5IK3A 3OKYA 3QI9B 4MJID 1BF8A 3TLRA 5IR1A 3QWQB 5C7XH 2YC1A 1Q9WA 5JLZB 5D7SH 2P47B 3TH3T 1DL7L 4ZG1A 1OF2A 1HYRC 4UOW1 5HVGB 4NZUL 1CG9A 1I4FB 5AWNL 1RPQA 5F6IB 4PRHB 4U1IB 1F3DJ 4QY8A 2CIIA 1KG0B 3VW3L 4MJ5A 2OJZL 3QXUA 4LVOB 3UTSA 4RMUA 1NGXA 4S1RH 1MFBH 1TJHH 4JZJC 2VH5L 1KJVB 3TT3H 1FN4A 3CSBA 5HI5C 4P46D 4LQFH 3V4UL 4X7DC 4FTVA 1C5DB 3U9UB 3HE6B 2XN9A 2F8XC 5FYJE 5SWZA 5T1LD 5KVFH 1X7QA 1YPZB 5GJSH 4CADA 1AGCB 1CBVL 1LQVA 1N2RA 5IBUG 1FJ1B 1H5BC 4MAYC 1YJDH 1QA9A 5EZLA 5JW3H 3B8YA 1GL4B 1EGJA 4FQHA 2ESVE 5C6TH 3HA0A 3GGWA 2QSTA 3BVNB 3QRGH 2VJXA 4S1RL 5F44A 1KPUA 1TJHL 5CZXC 5BRZE 1UZ8B 3TT3L 2A77H 5ADPH 3VFSB 4Y5VA 2HTLC 2VZSA 4X0KB 1J05A 3FQNA 1S7QA 1TTFA 3QCTH 4WFGD 3AB0B 4LQFL 4KRMB 3KPSE 4F33A 5ELIA 2CIKB 1CR9H 4JR9L 5E6YA 5GJSL 4OD2B 3RVUD 2LAGB 2OI9C 1YJDL 4M1CD 5JW3L 3GMRB 3ME0A 4QXTB 4KZEH 1VHPA 4I5BB 4X98B 4TYUA 1K6QL 5FYKE 3O41A 1CFVH 1X6NA 3EO1B 3NFNB 4U1JB 4LPYA 1FL5B 2B1AH 3KPMA 1NAKH 2C5DC 2Y6SD 4P2QD 1ZLWH 4LSTH 4ZD3H 4NRYA 1DE4A 1ZHLA 5DHYA 4YFEA 2F53D 3GMLA 4M7LT 1J87A 2PYEE 1RY7B 1YN7A