3SDCA

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3sdcA01
1W2KT 2GJ6B 1I7UB 1P9MA 2G2RB 4JM2F 5M7QA 2ZCLH 1Z5LA 2YS4A 5E9DB 4AIZB 3QJFB 4Y4KC 3UYRH 4OCXH 4NJAL 1VEMA 3RWGA 1F4YL 5JHDB 1L7IH 3DYOA 4F7MA 1FC1A 1MAML 2F54D 1FYTE 4P2RB 3FN9A 5GGSB 1JPGA 5EO1B 4I2XE 2RQ8A 4X99A 2W9LA 3EO1B 1KV3A 2FEDD 3MLVH 4OGZA 5GJSH 3VXME 2VH5L 5H94B 1QHOA 4FXKB 1A7QL 1H3TA 2CLVA 2EE9A 2D9CA 1WJ3A 4XPTL 1CE6A 1J11A 3SDXF 4N1EA 4OZIB 5J57B 4XVTL 2P5ED 4Y0GA 2N7BA 4U0RC 1CDCA 2J8HA 2NY0B 4P3DB 2X41A 1FNGA 5DEFB 3O6KH 3QEQB 5KTEH 2XKNA 2MMXA 1WBZA 2GSIA 5I8CA 3WJJC 2A1WH 2J5LC 3K80A 2CRMA 2VLRA 2FZ3B 5I1LB 4Z8FH 1J1OL 3KAAA 4L8DB 5E2JA 4EUPH 2VIRB 2FSEA 3DVNB 1S3KL 4ALAH 1B4JH 1MJ8H 4G8FA 3L5WB 3SKJL 1QO3A 4NC1C 4HJGB 2ZUUA 3P11H 4O4YH 3DOSA 4YIQA 5BV7B 4JO2H 4N5EA 1RVFL 5HHMB 1V05A 4FZ8L 4V2CB 1TDQA 2I5YL 4L8BB 2EEAA 1YN6A 2FATL 5TF1H 3HNTH 1WFTA 3MJ6A 1BAFH 1CFVH 3OHXA 1F90L 3ME0A 4DAGH 3DXAA 3ROLA 4K8RL 1GZQB 4HXBL 1ZLSH 4QRQB 1NCWL 1YY9D 5J89A 4HKJA 1B2WH 1CBVH 5IEKB 1HDMA 2AK4B 4WW2C 2QHRH 5CINL 1P4IL 1BJ1H 3S96B 3N0PB 1S3KH 2J6EA 3WNKA 4ALAL 5E4EC 3IU3B 1IM9B 4WW1B 3ZE0E 3O4LD 3PDOB 1OAQH 3DRTB 4HUMB 3KYMA 4I5BB 5EOQL 2CUHA 5BRZB 3UTTB 5I6XC 3TYFA 5I1JH 4E42A 4KUCF 4Y16B 2A9NL 4NCC2 4PLKC 1TETL 3DX8A 5B39A 3BXNB 3RQ3A 2CK0L 4JO1H 2VXUH 2O61A 5HI4D 1J0HA 1JNNL 4PBXA 2YUZA 3MCLL 4Q6YA 5ID0A 5DMYA 3KR3L 3MV7A 3R1GL 5I1CH 2YC1B 5J6HB 2MKWA 1A9EA 1L0XA 4Y89A 1SM3L 4PGZA 2FRGP 3K74B 5IFJA 4WV1A 5CBAA 1L0YA 3HI5H 3SPVA 3U4EB 4XNMA 3STLB 4HGWA 1HQRA 2CDFA 3D85D 1DBBL 1DN0A 4PYHA 3P9WB 4KDWA 2ERJB 3IRZA 3GSWA 3BRGC 2AERT 4P9HC 2VERN 3CDFA 2D7TL 4XPAL 1N6QH 5KS9B 1TVDA 3TIEA 4Z9KB 1CT8A 1A9BA 5K33A 1CICC 4JFZH 3F58L 3GBNL 3VXSD 2E6PA 1N4XL 3FQNB 2JCCB 5AEAA 4PRDA 4D9RE 1SYSB 1P7QD 3VFPB 2YWZA 4ZPVA 4UDUA 4DFHA 4U1LB 4KV5E 3OBAA 1CGSL 1GJIA 3D48R 3HB3D 1NL0H 3KPSE 4QTHB 3KHQA 4X6DF 2UVEA 4LCWA 3MODL 4HJJL 3CDGB 2W0FB 5A2IH 3C6LD 4WW2A 3ARDC 1LO2L 4RMVA 5CWSA 5F6IC 1UADC 4IS6A 3BEWB 1QVOB 1Y6KR 1OW0C 2X5PA 4L9DA 4ZSOE 1FRGL 1CLCA 3ZE2E 1Q94B 4M8VA 4YEFA 5DVNA 2R69L 4NKIH 5CBEA 3FO0L 3FT2A 1FBIL 5T1LB 1I7ZA 1RJLB 3DBXB 4RGMB 1ZXQA 3HUJF 4UUJB 4LPVA 4BELD 1OQXA 4ELMA 3TBVB 5MHSE 4LSQL 1UZ8B 2CLRA 3L3HA 2P48B 1T2XA 3DMMB 4HDIB 3I9GH 1M4KA 2ZJSH 4TVPL 1A7QH 3ARWA 3V2AR 1Q0XL 1T21B 3GI9L 4XVSH 1DQMH 2B4CL 2FB4H 2H32A 2GAZA 1NBVH 3NCBB 4KJPD 4UINL 4HH8A 5D1XC 3MTRA 2DQTH 3Q1SL 3QDHA 3B2VH 5FYJH 3WHXB 1WICA 5C0FA 4JAMA 1IC5H 3K2UH 3QT2A 1ZT7B 1G7LA 2VUYA 3F65A 3U0WH 3QXDA 2P24B 5DGQA 5A2LH 1LE9A 4HZLA 5BOPA 1OTUD 1P2CA 1KPRA 2HN7A 1AD9A 5DD6A 2Q7NA 1B0WA 4FABL 3WD5H 4G6JH 3V7AE 3I6KA 1C5CL 1KG0B 1MJ8L 3SKJH 3HMXA 5DEGB 3RI5K 4F7CA 5FCUH 1QSED 3QWQB 1ULVA 3H9ZA 5IMOA 1M71B 4CNIA 5L2JA 1U9KA 2OK0L 1YMMD 2AEQH 3KNBA 5J56B 4TPRH 4MJ6B 3T2NL 1RULL 5IWLC 3N9GL 5IOPA 4PJDB 3F6IA 2YOCA 4AK1A 5HPMB 1MCOH 2Q76B 3SDAD 3U2SB 4O2EA 4CDHA 5K9JL 2BCKA 4EDXB 1FLTX 4ZNEE 5EOTA 4EI5B 4F2MA 1SEQH 2OR9H 3RDTC 1S5IL 3FN0H 4XPBL 5CEYB 3QDJA 5SWZB 1OGAD 3VMPA 5ILTL 2QR0A 2Y06L 5E8EA 1KUMA 2W0PA 4G9FE 4O02H 3Q5YA 4H88L 1J8KA 2PYEA 3D5OF 3I3DA 5C07B 4LVNC 4WU5A 3OXSA 3E6FA 1D5XA 4CVZA 4JLRA 3MRLA 3L3OA 3PWVA 3TNMB 1A7OH 3T0VA 4ZUSB 1XH3A 4JQIL 3U7YL 3QIUB 1S5IH 3FN0L 4CN1A 4NFCA 3U1SH 3S35H 1DZBA 3H3PL 3KYNB 1G9MC 1H5BC 4PRIA 3FCTB 5DXWA 4GW4A 2M1KA 5C08E 3ROLB 4URTB 2NNAA 3ULUL 4G6FB 1WEJH 4IRJD 3SE8L 5JDSA 2XG4A 3IDIA 1A7OL 5HXMA 4NZUH 1FPTH 1Q72L 3PWLA 3HZVB 4OUUB 2AJSL 2FJHA 5FKAB 1U8KA 2PR4H 2XNAB 2XZCH 4QRUB 1I9EA 3MOQA 2CJUL 3GMRA 1WEJL 3HRPA 4R7DA 1FV1B 4QHLB 5T1MB 3O0RL 4IHOA 4OF3A 1U91B 2IAND 3MV8B 1WBXA 4LKCA 4P5MA 3P77A 4RFNB 4POZC 4NT6A 4OQTH 1QLEL 4YDVA 1I1FA 2F8OA 4K55A 3HNSL 3O9WA 5F97E 5JQ6H 4LSUL 1ADQA 4HXAL 2OP4H 5BXFB 2H2SD 1I8IA 3MA9H 1RZ7L 2DLHA 3HS0A 2JK5A 4GOSA 5EO9A 1S9VA 2X1WL 3T65B 3GIVA 1QBBA 4GSDH 4PJ5A 3W9EA 3MCKA 3LKOA 3UC0L 3D25B 2CO6B 2Y6SD 4MD5A 3RBSA 3P73A 1AE6L 3HE7D 5F7UA 1G1CA 2YD7A 3QNYB 2BXYA 2AJYH 4H26B 4O2CB 1H3PL 3RNQB 2EDNA 5ESQA 3ZL4L 4X6CA 4R0LA 2VSDA 3W9DA 4E41A 3C2AH 5T33L 1CICA 3G6JE 4NO0B 2BDNH 1ZA3A 4FP8L 4RISL 1RZ7H 2L7UA 4DN4L 2Q76A 3H7BB 3VD5A 3F7VA 4L9LB 3HNSH 4P9MH 3WIHA 3ZYJA 4G80A 3FHQA 4LMQI 4XWOC 3BQUC 5SWZA 2ZNXA 4ODVL 3WFBH 1RU9L 1YEFL 4UV7H 3RWEA 4Z7NE 5MI0B 4I0PD 4YHOH 3O2WH 4KUZH 5FYLH 4P2CG 4XNQB 4O2EB 1BFOB 4LOUD 4CVXB 2E7BA 2Q3ZA 4L9LA 4YGVA 1PD6A 4MYWB 4LPXA 5HDQH 5BVPL 3DO3A 4ELMF 3H42L 5JDJA 1ZHLA 3KWWA 4KVCL 3JTSA 5CJQH 2DF3A 5DD0L 1P6FA 1TQBB 1EHAA 5E8DL 5F7LB 4EVNB 3ZYZA 1VDGA 1QRNE 5AUMA 4DN3H 5I1DA 3OKNA 1M05A 3IFPB 4DEPC 1EO5A 4EXPX 1AP2A 1BBDH 4U49A 1W0VB 1Y6NR 3TWCL 5JR1L 4IM8A 4WI9A 1FNEB 4PRAA 2MQ3A 4PRNB 1UH2A 4P5TD 5BV7L 1QA9B 3LHPH 4K3EH 5LJYH 4I48B 1AR2A 2GK2A 3T0XA 1JI1A 1ONQA 1T6VN 4EQ3A 2AV1B 5GSRB 3U6RB 3FFDB 1R3KA 4EKXA 1F6FB 5AYQA 3V5DB 3WNNA 3QUXB 1TZHA 3ZDYE 1J0ZA 2Z92B 5D7LE 4OZGA 1EEZA 2GI7A 2PXYD 3LEYH 2P8MA 4MNQD 3RVTC 3EOYG 1JPTL 4HUNB 3PWUA 4PLNC 4QXUL 4FQCH 4ODXB 2GTWA 3MUZ1 2PUQT 1YEKL 4B7IA 4P23C 3QEUA 2DLGA 3MOBH 2DKMA 1K8IB 4G6ML 4X4YA 4Q0XL 2B4CC 4F9LC 5KSVA 2PO6B 2FHFA 4Z7WB 2ID5A 4KMTL 2EH8L 1IAIL 4ZOBA 3QULB 2IPUG 5IM7B 4PB9H 1IAOB 1S7SA 5E2VL 4MXQD 1T03L 4ODXA 1NJ9B 4G8GB 32C2B 4UTBH 5B38A 4NNYB 4NN5C 4Q6IB 4X98A 3AREB 1UYWH 1CFTA 2IH3B 3MOBL 1U93B 4HIHA 1MQ8A 1LHZA 4Z7OE 4LF3B 4LSRH 4LU5H 1CXLA 4RSVA 1P7HL 2WMPA 1DJSA 1OSPH 5E7FA 5ALCL 3FOMB 2JB6B 3BWUC 1ZLWK 3DX6B 1C8PA 1QQDB 3BE1L 5D7JA 1G7IA 2B2XL 1L8JA 2DQFA 2K9UA 3C5JA 1L7TH 2DS4A 4NO3B 5DQJA 2HT2D 1XIWB 3GO1L 3QDMD 1YEDB 3BQUB 4OCNC 4PRAB 3KPPB 35C8L 3A6OA 3DGCR 4E5XA 4QOKB 3H7LA 4X4XA 4HCRL 1KELL 2PW2B 5IROA 3UDWA 2VLKA 4L3CA 3UAJC 4D9QD 1ZHBB 2X4OA 4GRWB 3ARDA 5BZWA 2I27N 4OQTL 2B7DT 3MRCA 3G5XB 1C16A 1F4AA 2XWBA 2NW3A 4HIEB 4KHTL 1RIHL 4JFEB 5MEPB 5IIEB 1F3DH 2VDML 1U8QA 2BERA 2V2XA 1UJTA 1E6JH 4N0UB 2V5SA 1GGCL 5B21A 1IE5A 4G9DA 1TXKA 4CGTA 3SQOL 4G3YH 4YX2L 1OT2A 4L5FL 2Y36L 2YD8A 4ELKB 4U4BA 3RUGF 2A6KA 2AAVA 4QXUH 4L8SB 5L2KE 4WEMB 2R9HD 4JQIH 4OCXL 2W9EL 4U6XB 4BK4A 4YO0A 3JWNC 1MPAH 2W65A 1V8HA 3TESA 2YPKA 3S5LB 3I2CH 1I8KA 3T77A 1F42A 4YPJA 3C2AL 5CLTA 2AJYL 3PWPA 2NTFB 1U2HA 4EQ2A 4ZDHB 2HJKB 3EZ8A 1KENH 1EXUA 3GB7A 3VH8A 4WJ5A 3GI8H 2HH0H 1CQYA 1UCBH 5ABDE 3GKWL 2NXYD 4UQ2B 3EJYC 2GTZA 2W92A 2D7TH 2VL5B 4XWGL 1AFVH 4GQ9L 3OKEB 4CU8A 5DQJB 1RZKL 4MCYA 4DVRL 4YE4H 4Z77A 2FLRT 2AK4E 2E7HA 4ETYA 2DAVA 5BZDB 2NY0C 4N8VG 3WN5C 1SJEB 3DVNA 1PGRB 3MBXH 4QRPA 2BSSB 2ICWJ 2VLKE 3CXHK 4P4KC 5F7EH 3PGCB 3E6HA 1AY1H 5ERWA 4H25A 4NN6C 4R3SA 4UMGA 3QNYA 3QHZL 4PJFF 4Z7NF 4HWBH 2HFFB 2E7LE 2ZUTA 3ZTNH 4MJ4A 3VFUB 2AJVH 4JJHA 1F6AA 4IS6B 5GGTH 1UB5B 2QQQA 3ESUF 3KYKH 4KXZI 4YHZH 3U9UB 3S34H 1FNGB 3KXFA 3BP5A 4FQ2H 4OLWH 3MO1A 4L4TA 4LCWB 3QA3A 3LS5H 3OZ9L 4ENED 3MRQA 4R2GB 4Y2OA 2AEIT 3G9AB 5D7IF 1OWWA 4L3AA 4UBDD 4U1JB 1F6AB 3D85B 2YD6A 4ELKA 5JXED 1UCTA 3T0ED 4BK5A 4M7KH 5JNYB 4ZG1A 5I2IB 2E9BA 2V5MA 5E00B 1K3ZA 1QYGL 4MXQC 1N6QL 4JFFE 2P43B 3VI3F 2R4SL 3T2PA 5I8OL 1TQCC 4NGHH 4XHJC 4KJYA 2UWEA 3BVNB 1AXIB 4MAYA 1A6ZA 1MCWW 5DTFA 5JW5B 4UT7L 4P59H 2VZVA 3VWJC 1FNFA 2XTJD 4ESKA 2BZDA 5ITFA 3OKDA 1IL1A 4MD0A 1HSBB 4WI4A 1MCRA 3N1MC 4DTGL 4ISVB 5AYUL 1DQML 1TPXB 5D5MF 4Z18A 4C56B 1ES0A 2E7LC 4BM7A 3NA9L 4F7MB 4JZJC 2BNUA 3QFJE 4XCCH 5DVOA 4A2MA 4IOIB 3FAWA 4N90D 4JHAH 2WSKA 5I1GH 4LFHD 5TQ2H 4WI6A 3CXHJ 2VN7A 5KAQG 4ACPA 2CRIA 3WKMH 4PP1C 3SE9L 3QQ3A 3ARBC 2C26A 3VXTB 3D6GA 5I19H 4HBCH 1ZT4B 4XPHL 4JRXD 4LNVA 5KVGH 3T1WA 3AB0B 1F4XL 1NCUA 1KT2B 3P9LA 1D5IH 4NC0B 1HHIB 1WIOA 2ADJB 3DGGA 5HPOA 1W0WA 2VLLB 3IDYC 3EZJB 5ACMA 2OK0H 3T2QA 5JMRA 3KPLA 1S5HB 3MRNA 4YK4B 1BF8A 5L88H 4N0YH 4ZXBD 5HHOA 5IW6A 1YY9C 1FO0H 4MNQE 5I17A 4WRLA 3UBXB 2ITCB 3TGXA 2HP4A 1U8PA 1NJ9A 4G8GA 4LP4A 4Z0BL 3D39E 5GRVL 2JIXD 4Z95H 3S9DB 1AXSB 5CLWA 3N06B 4APQD 1F8TL 1CFSA 3TNNB 1A7NH 4FMKA 3CFCH 4JY6B 5D7KD 1CICB 3DXAB 4TUKH 3ERYA 1CFTB 2IH3A 4RMUA 4QRRD 5GQBA 1MHCA 3QG7H 1HCVA 1PY9A 3KLSA 4JZNA 4Y5VA 1S7UA 3M45A 5HHXH 5FAAA 1AGEB 3ORJA 1NMCB 3L3GA 5IFAH 2WINB 3S36H 5IR1B 1IM9A 3ILQC 2IQ9H 3RWJA 1FL5A 3BD3A 1K8DA 3GSRB 2NZ9D 1D9KD 5DWUH 5J1SC 1T22A 2DLTA 2DN7A 5DJ6B 2HMIC 2RFXB 1DN2A 3C5SB 3G6JA 3OG6B 1S7UB 3O3EA 2WQ8A 4TQEH 1FFPA 4U7KA 4X9IA 3RU8L 5IW1A 4OZFG 2A9ML 3HUJB 2WBJD 4JM4H 4N8PA 4OIIH 3TBYB 4HKBB 4FOMA 5F1KC 2OMNA 1BEYH 3GSNA 3HMXH 1OTUC 4LU5L 4W6WB 1IVLA 4Y2DA 3C5SA 1AGBB 1CDHA 4HJ0D 3BZDA 4DZ8B 1TQCB 2DQHH 3C5ZB 4EI5D 1FV1A 2PW1B 2X4RA 2EEDA 4ONFL 4FRWA 1DLHA 4N0FA 3O0RH 5DJAB 3RUGE 2ICWB 1MF2L 1P53A 3LKSA 4Y4HB 3T0DA 1I75A 2YD4A 3FTGA 1GOFA 2OQJA 1RJYB 1D6VH 1I9IL 3EO0B 3HI1B 5DK0A 3WLBA 1OHQA 1KTLA 1T7XA 4U05A 3B2VL 5FYJL 2PO6D 1F4YH 5KS9A 4JY6A 1KIPB 3G5YB 1I8KB 5EIIB 1P4LA 1F5WA 2W91A 4I3SH 1FO0L 3MACL 4KAQH 4YBLC 1I9IH 4X5XA 1NFDE 4Z0BH 8FABA 1N7ML 4M3JA 3CCHB 3TJEL 5KVEL 3EGSA 5FV2A 2NY5L 4R0LB 5EU4A 4OSUL 5EU6A 2HFEB 2VZUA 3GJFH 3WIHL 3PP3H 4JRWA 2NY4B 4JGJA 4QRTB 1VPOH 5KTEL 2DQJH 3VWKD 2HT3C 5CMAB 2GK0B 5MEQA 1HHIA 2ADJA 1JFQH 1U8OA 4PGBB 1NC2D 4ZO9A 3CCHA 4Z8FL 3QXAB 3FO9A 1VACB 5B8CB 4GMSH 5LAXB 3AFLA 3FB6B 4OLUL 1NGXA 4PGEB 1AHWA 4MVBD 4QRTA 3U4BH 4GG6E 1QPPA 1UACL 3KNBB 5DMJB 5T5FH 3SGEI 1LO2H 4LCWD 3CXDH 3DUUB 4PDCE 1UVQB 1KEGL 3HAEH 4H0IA 2X89D 2NW2B 1R3LA 4S1SH 1BZ9B 3B8YA 1H0DA 3O4LB 3VRLF 3BX7C 4XNZC 5LGJB 1E27A 1D9KB 1C5BH 3HPLB 1UEMA 1FCGA 2L0DA 3LZFL 2FJFA 2ZWLT 1MQKL 2UZXB 1N59B 5CUSH 5AYUH 3OF6D 1ZLSL 1QSVA 3ARGB 5GRYA 3BT2H 2X4TA 1S7QA 1P4IH 3OX8B 4NJAH 1A6PA 5C08B 4D0CB 4F37K 1SYVA 2XWTA 2FJGB 3TN0D 4HT1H 1BQHA 3GIZL 4NPYB 4YBQC 3FFCD 4UT6H 2YR3A 4YZFE 3GSNB 1MQKH 4PJ8A 4F15C 2Z91B 2Q1EA 3AS2A 4NKDB 1FYTD 4QT5A 4NQED 5L8KB 3LMJL 1HHKA 1DLHB 5GGSY 1YDPB 4OLWL 2HRPH 5A43C 4U6HB 2YRZA 4JY5L 4F9LA 5BXFA 3H3KA 4WHYG 5IK3B 1S9XB 2UY6A 4CJ1A 1SJXA 4LLUB 2BRQA 2V17H 2YUXA 1A22B 4I8DA 2J12B 3VGHA 2HFFA 1KXTB 3O3UN 5EFIA 3UTPE 2P45B 2FZ3A 5I1LA 3MNVA 4WY7H 3L3DB 3SE4A 3WE6B 2Q8AH 3BP7B 4HG4K 1FCCA 3ZE0F 4BZ1L 3VCLB 4S1DD 2K1MA 3O45A 5GSVA 2R1YA 4I0PA 5HHPA 3U2SA 1KYOJ 2ATPB 4P57A 2Z8VC 2XPGB 4AYFA 5CHNB 2ICES 4HK3N 3R8QA 4ZUVB 5L7XH 4YBLB 4JY5H 1ZEAH 4QRPD 5T3ZE 5FDWA 1J8HB 2WQRA 3K4DA 1Z0NA 3U4EA 3VFWB 3EYUH 4KMQA 1YY8B 1DBKH 5I74B 4ZS7L 3W5NA 2R9HC 4BA8A 3V6OE 2GK0A 2IADB 3DXAD 1GSMA 2D0FA 4RISH 4DN4H 4OM0H 4Y1AE 2DQUH 1XGPA 3VG0L 4R90H 5KSBE 4PV9A 3G6JF 5E08L 5H37G 5F1IA 2QSVA 3G08A 2QADC 3NBNA 1FG9C 4QRPE 5I66B 4BJLA 4X4MA 3LZFH 1S7VB 3VRIA 1DBML 1KXQE 2MCG1 4YR6B 3VWJD 1NC4B 4QF1B 1IM9D 2HKHH 2YKLL 1BZ7A 5GZNC 5JZ7D 1LO3L 4X6FB 5I1IL 4WV1C 2X4OB 3HCVA 4NIKB 3F5WB 3MFFB 1G9NH 5ANMA 1FGVH 5I0ZA 3CVHA 4XP5L 1CL7I 1J0KA 5D6DA 1A1MA 1DEDA 4JKPH 2CMRL 4V3EB 1I3RA 3DMMD 5FEBA 3ULVH 3D2UA 3TIDB 2VDLL 4NRYB 4ZFOB 1EV2E 3CSYA 3ECBA 5GS1B 1D9KC 4LSVH 3MUGA 4G8GD 4A6YH 3I50H 4PRHB 4RGOL 3SDXE 5I30H 3ZYOA 2C1OA 2DQIL 4X6FA 5HI5C 5ETUB 2XXMB 4FMFA 5KZCD 4GKNA 2PTUA 5I75B 3RGVB 5C0BA 5E6IC 1S7WA 3CFEA 2F19L 25C8L 5CSBA 4I4WB 4K9EL 4KH2A 5TDOB 4M6ML 1TJHH 3OTTA 4NQEE 1LE5A 1I1YA 2NXZC 3D0LB 2DJUA 1SJHB 3CZJA 3U0PA 4HPYH 3QQ4A 3PV6B 4I2XA 3ULVL 3CFEB 3GHEH 2O5YL 2LVCA 2Y06H 4U1MA 3HZYB 1AXTH 3MCKB 3TLRA 4J12A 4TVSa 3TNNA 4QHKJ 3O3DB 2F5AH 3QDMA 1ORSA 4FFWD 1CDUA 5KOMC 1ED3B 5ID1B 2AK4D 1HHKB 2FBOJ 3GBMH 1VEOA 2A6DA 3ARFB 1CFQA 2EIBA 2BY1A 1PX4A 5DC4B 2D03L 5EZJB 3BIKB 1UJ3A 2UZIH 2ZCLL 1PYWA 3U46B 4U1IA 2MPAH 3BPNC 4PJ7B 2OM5A 1UH3A 1YJDL 3K2MC 4LIQL 4MQSB 3BH9A 5DJCA 5F3HB 4HW6A 2HVJA 2DM3A 3JUYA 5DA0B 2LFGA 1IQDB 1X5JA 5FYJD 5IFHH 2VLRE 4JDZB 5J6GA 1CD1B 4RFEB 3MLYL 4GXVL 2FH8A 3GBML 4H25B 4R3SB 3RAJH 4OCRL 5FIEA 3X14B 4YHZL 1A3LH 4JDTH 4OLVL 2Z35A 4UOJA 4KQ4L 1FNHA 3QWRD 3BKJH 2CSPA 2YSSB 4OCWH 4OFDA 4W4OC 4N8VA 4GBXD 1D6EA 3W2DL 4V1DD 2AEQL 2V2WA 3JV5A 4I3RL 1Y18A 5LQBL 2C9AA 4N0CA 4NQCB 1BM3H 4MXWH 4KKCC 2HLFD 2XY2A 1ZHLB 4RWHA 2GW5A 1W0VA 4OGYL 2NW2A 1KTDB 1NGQL 3WFDL 1JHLH 1QR1B 4IEFB 1RZKH 1V7ML 4AQOA 3DUUA 3QDJE 4OZHF 1JE6A 5HJ3B 2YD3A 1JZ8A 1J8HE 3L3IA 4MDJB 5JXEC 3RVXD 3CX5K 3EO9L 2MHAB 5EC1B 4PRPB 2BNRB 5BMFL 3FQXA 1T2QL 2D4DA 5DYOA 2AI0H 2AEWA 2VLJE 3O11B 3WIIH 3DRTA 4FZ8H 5KN5A 1N3NA 2DQGH 1CLZL 1NGPH 1YEJL 3L9RB 2ILLA 2XZAL 2QQKH 4UOW1 4YDKH 3IAPA 4R96B 3PNWB 3UZVB 3VRJA 1IAKB 1Q8MA 1JV5B 1SMOA 3BXNA 5EC1A 1C12A 3UX9B 3CVHH 5FA4A 3NCFB 1YPZE 2VLKB 4H8WC 1NAKH 5F7YC 1IAII 1ZANH 2BOCA 2X2YA 3MLWL 4QT5B 2AS5M 3KJ6L 1F4HA 3LS5L 5IMOB 4L4VE 2MCPH 1NPUA 4HUVA 4NN7B 4GJTB 1X5GA 5TJWK 2H8PA 5D7JC 5EIQA 1GGBL 4Z0XA 2XTJE 4HMCA 3MROA 4FP8H 5FGCE 4AEHH 1EHLH 1LK3L 4JFYB 3HUJE 4AMKL 2PR4L 1TTUA 2VQ1B 4HQQL 5J3HD 4TUOA 2D31A 1YJDC 1CD8A 3RWDA 5IK3A 2YPVL 4WFFE 4FQ1L 1KEML 4TYUA 2D0HA 1I8IB 4HUUB 1MY5A 4NQDB 5JUEL 1ZGLP 4AQ1B 1R3LB 1CICD 5CGMA 2WP3T 2EDQA 4NKOB 2UWEF 1KCVH 2AP2A 3RWDB 2P1YA 5DJ0B 1EFXA 4OZ4B 4UIKH 1IAMA 4TVPE 3LMJH 4C56D 1KLFA 5DA4A 3WN5B 3FOMA 3H42H 4UU9B 5D7LD 3FT4A 2NX5D 3CMOL 4PD4J 3FZUC 2N7AA 4UQ2A 5DFTA 3M1BA 1VACA 3DETD 5D6CB 1DFBL 1A6VL 1IT9H 4LEXL 1XGUB 3QXUA 2UYLB 4PJ7A 4HH9B 4FHBD 4BSVA 2VLJD 3G6AA 4KZEL 5HD8D 4WFGD 3MLUL 1UC6A 5JA8B 1GGIL 1K8DB 3NH7L 1UVQA 3WJLC 1MCCA 1AGFB 3LH2L 2A38A 4HIEA 4WI8A 5EOQH 3UROR 1I9RH 3K8KA 4OLEA 2F5BL 4OIAA 3FOLB 2JJSC 4M7ZC 4OAWA 4ZFOA 2V2XB 4G7VL 2UVFA 4XPGH 4MWFB 2O5ZL 3BGFB 3QRGH 5CZKA 3IAGC 4TN9A 4KROB 1K4CA 4G42B 3QEGH 4GG6B 1KSRA 4U6XA 1ZWIB 1DR9A 2C1OB 3QO0B 2VISB 2EDBA 4NDMA 1OP5K 5D7IB 5D71H 3LQAC 4KK8D 3S3JA 4J3VA 5IF0B 2A77H 1AP2B 4Z78A 4ZPTA 4QXGH 5B3JF 5KSUA 3NZ8A 5C0CB 4G42A 1Z3GL 2Z31A 4R9HA 2ITDB 1LO0L 3V4VH 3MLRH 3RY5A 1E4KC 2VNCA 1DQLH 4JAMB 2ADIB 1WTGT 2HG5B 5I30L 3PL6C 3FQUB 4BFIB 4P2OC 3MRPA 4NNPH 2E6JA 1LE9B 3SDCC 3VRIB 3TO4B 4DK3A 4MQXD 1DVFC 1GGUA 1KBGH 3IDYB 3RWHB 1N5YL 3L95B 5FGBC 4KUCD 3RVVC 4MXVE 2H41A 5C9JA 3G5ZB 2VE6A 2ZUQC 4PJIA 1BQHG 2AJUL 3BIKA 1J0JA 1KTRL 1YEKH 3RIAF 2R2EB 4LLDB 1IQDA 2Y6SC 4W6YB 1XGRB 1V3KA 5IWLA 2M2DA 4KZEH 4JQXA 1QBLL 4KMTH 1EIBA 1ZGLM 6FABH 4PJ9C 2NMSA 2BNQE 3QXWA 5DRNB 4MJ5B 3QCTH 3AU1A 1PKQA 3UBXA 1FNEA 1S7RA 3GMNA 4ODUB 1J1XL 3GSQB 2P7TA 5LGKA 2EO1A 2XTLA 3UTZA 3BPLC 2BC4B 1MI5E 3JWDL 1JZ2A 2FD6L 2VSCA 5EZLB 3O8XA 3WUZA 3V0WL 5A40E 4NYLA 4UNVA 5J11B 4KU1A 4FFVD 5C08A 4D0CA 4NM8H 4HLJA 3TYGH 2GJZB 5GS1A 1QBAA 3ARGA 5KSBA 4U1SB 1QSFD 1TMCA 1DQQA 1OTTC 4ZAKB 1N64L 3HZKB 3L3GB 2OL3B 4PJ8B 3H9HB 4HS3B 5ETUA 1Q38A 5IQ9B 1WISA 3PWUB 4FXGB 1BQHB 4TSBL 2OP4L 4P2QD 3QI9A 1J0IA 5TH2B 3BO8A 5L9DH 1DSFL 5DQ9A 3BKJL 1U6AL 4AEHL 3SDDD 5E6YA 5IBTL 3C60D 1NSNH 4GBXA 2NY2B 4O00A 2V5RA 1NLBH 4ONHA 5DS8A 5EUOB 3BZ4A 3SKOA 5J6HA 4NCC1 3ELAT 4ZTPL 1DN0B 1JYNA 5D2NC 5T1LD 1CE6B 3O2DH 3P3YA 3WFEL 1RSFA 3T08A 3ZDXE 1IM3B 2A6KB 2OLDA 2AJSH 2VISA 1E28A 4ZFOL 5KG9A 1WWAX 4NWTH 2Y4SA 3L6FA 3IETA 1DBJH 4YAQA 3VI3E 1E6OH 2VDPL 4KY1H 4JRXE 5EU4B 3P4MB 4JREC 1MWAL 4FG6C 5J4MA 5HYQB 3TO4D 1VKXB 3QJFA 2RAMA 4L8SA 3PWVB 3TNMA 2QHRL 5CINH 3UTPD 3QDME 1XR9A 2NTFA 4LARL 1J8HA 1OLLA 4GRMA 1HI6B 4X7CC 2DM7A 5D7IE 2P46B 4B41A 4QRSB 5DFVC 4ZUVA 2DLIA 1DUYB 2I07B 5C2UB 3B5HA 5D7LB 1ZA3B 4KKNA 4JKKA 4XP9L 1A4JA 3OKKA 1EVUA 4RNRA 1YY8A 5AAMA 1WCQA 5F89B 1KPVB 5T1DL 3U36B 1A02N 1I7RA 4MA8L 5C8JB 4X6EA 1IGFH 4JE4B 4X83A 5DEZA 2GSGB 5M94B 2DM2A 4KRPD 1HHJA 1N8ZB 3HC4L 4HAGA 4RGMC 4K8RC 3CLFH 1CZ8H 1JTOA 3ZKSD 5ICZB 5DD3L 4HBQA 3L7EA 4C54A 3L5JA 5IIEA 5F9WC 5MEPA 1G9EA 4Y19A 4GMSL 3V79C 3LCYA 3EYSL 3MC0A 4PJ9A 1IKNC 5I1GL 3KXFE 2ESVA 3CIQA 5EUOE 1VFMA 2LAGB 3KYOB 4Y5XB 2D7MA 1AO7B 2AKRB 3EOTH 5BRZA 5IQ7H 3O9WB 4D0BA 1G6RB 3ARXA 4Y19B 3DV4B 2Z93B 4P9ML 3Q6FB 5DMIL 3HHRB 3VD4A 3QFDA 4RGND 3RP1A 1OGAB 3TVMC 3WFBL 5HYJE 3IDXL 4MAYC 4NGHL 3BP6B 3PHOB 5IBTH 3P9MA 4G6AD 4H1LB 5FUCC 1RUAL 2VR5A 4P2QB 5EC2B 3K0WA 3ZTJH 2ZCKL 5H94A 3S6CA 3KLHC 2EYTA 2BNQB 3CX2A 3GB7B 4X99B 3QNXA 1IEAA 5FUOL 4F7PA 3D0LA 1CFNB 3GHEL 1UB6A 3QUYA 1NEZG 3H9HA 2PCPB 3I02B 5HVFB 3CFDB 1RUAH 1JWMB 1BJ1J 2OSLA 3G5VA 4LGSB 5CZXC 2P5WA 1EA9C 2Z31C 3L3JB 4K3DH 1F2QA 1VHPA 4XP1H 4J7RA 1FBIH 4H5SA 4PRPE 4V1DB 5TE6L 3I6LE 5CJ5A 1ACYL 4PY7A 3NIDF 5ELIA 2JTDA 4IRJC 3KPRB 5J1TC 1MAKA 4LAQH 3QQNA 5ITBL 2XKNB 2V17L 4ZUWB 1B90A 4XPFL 5DI8B 5IV2B 1CXKA 5F8QC 1DLFL 4AH2A 5C86A 3CX5J 4Z7VF 2IQ9L 3RPIA 5FYLD 43CAA 4F58H 1PW3A 5CGYD 3VD9A 3LVEA 3FO1A 3RIFF 5HI3D 3MBEC 3OXSB 3CUPB 5JLZB 1OGAE 4HJJH 3REVB 5IG7B 5D5MB 3BRDA 5A3IC 2P5EA 4Y4FD 4MS8D 2X1OA 1OSZA 3MRJB 1YZZA 4HF5H 4UZGA 5ENWB 3C8KA 5JW4M 1OAUL 5EZOH 1ZGLA 2IALB 4AENA 3D3VD 3W39B 1YMHA 4NQEA 2HFGL 4HKZB 4D3CH 3QZWG 4UT6L 3KPPA 1DQLL 2X1XR 5D96B 4WGWB 2NY3B 3W5MA 3V5HB 5DMIH 1F8TH 3C5JB 1KGCD 5F1OB 4P23D 5D1ZD 1W72A 1KFAL 4PJBA 2YXFA 1JWMA 5E8NB 4MVBA 2KH2B 3WS6A 4G8EA 5EA0L 1DBBH 2EECA 2R2HB 4QHMB 1BECA 1ZV5A 2DMCA 2J1KA 2J8UF 4V1DA 1GZPA 3DETC 5CIPA 3C08L 3SGKA 1J18A 5FCSH 1XZ0A 4Z7WA 2ICWI 1AQKL 4HUWB 5GPRA 1QLFB 2BSRA 2ARJB 3WHXA 2FHCA 2Y5TA 5I1AA 4U6VH 5IGXH 2SEBB 3HS0B 5C0AD 1FG2A 2NXZB 2VR9A 4TUJA 4UUJA 1IEAB 2NX5E 1QFWI 4U2YA 3D39D 4NUGH 3LKPA 1OQOA 4LQ1A 4CMMA 2A6DB 1AD0A 1NL0L 3GSUB 3ZT7A 1VFBA 2OX5A 4QHNA 4GMTL 4F57L 2AXGB 3T4AA 3BH8A 3T1FA 1IC5L 1CG9B 3K2UL 4XMLH 3S35L 2XIDA 43C9A 2HAZA 1CD9B 1I8MB 2AV7B 4KZDL 3LKOB 3QIBA 2VAJA 4LHUD 3QEHA 3RZCA 4I3SL 4MNGA 4PJHE 3PV6A 5DD5H 3ULUE 2DJSA 1TJIH 2JCCA 5C09D 1JNHB 1E4JA 1S8DB 3VWKC 3N1GC 3HNVL 4JZNB 1NGPL 3LEVH 1QLRA 3VFMA 3ZDZF 4LAJH 3FONA 1NMBH 3BEWA 3V7MA 5D6CA 1LEGB 5I8KL 5CEZE 3KJ4B 2EXWC 4HLZG 4OF8A 3D87B 4X6CE 3E6HB 3HLAA 4NUGL 4YXLH 2A6JA 2DBJA 1NC4A 3MZGB 4HIIA 4QF1A 4CVXA 3MRGA 2HWZL 3WLWC 1I7RB 2ATKB 3VFGH 3DPBA 5LGHL 1EX0A 5CZVL 1TQBC 1A1MB 5EWIL 3KPRE 1ACZA 5I1CL 1OTTD 1BVZA 5ANMB 3OJDB 5CSGA 1UM6H 4ZUUB 3H9SE 3RZWA 3ARDD 1G0XA 4GQPH 4PGEA 1CDJA 4JHWL 1OP9A 1MHPH 4OCWL 5DSCA 2V5YA 1NCAH 4XWOD 5B8CA 4DUXA 4Z7UA 1BZQK 4O51B 1MCQA 1TZIA 5FGCB 5CZVH 3RX7A 2J4WH 2O26U 1JF5A 5B39G 1H8SA 1R3HA 4M5ZH 2FX7L 4YGAB 1XGQA 1NCBH 3BZEB 5HSFA 3HR6A 4C59B 3T3MF 3PXHA 3B4NA 2QADD 3UYRL 2DLFL 1YPZF 3GHBH 5C0EA 2A83B 4F7EA 2XZZA 2G5BB 1X4XA 2OZ4H 3TF7A 4XVJL 2EDLA 4MZ3A 1YNLL 4GRMB 1FL6A 2X4QA 3VFTA 3P2TA 2BVEA 3BT2L 3IDGA 3VE0A 3VFMB 4OFPA 1OARH 2W1NA 4N0YL 5C71A 3BDXA 2WIMA 2LU4A 3WFZA 1YDPA 1RV6X 2K7QA 4LP5A 4PJBE 1AD0B 1G6RH 4HFUL 1D5MB 4NKIL 4PJ7E 1RZ8A 5FA3B 4FQQB 5EPMB 1SM3H 1S7TB 3AREA 3AXLB 3W11D 1RZFL 2DQEL 4PJXF 2RCSL 3JWOH 1DQDL 2DWEA 2APFA 5IB5A 3C6SA 1KJ2B 2DYPA 4LLQA 2VL4A 3MRDB 4JDZA 1RZIB 4OZIA 3LRHA 3P40A 3RX8A 3OR7B 5CCKL 1H3PH 5CJ8A 2BY3A 2E8YA 3WKML 1S9YA 2BHYA 1K5NB 3PQYB 4P3CH 1BBJA 2QJDA 3MV01 1AE6H 1KPUA 3FMGH 5D1ZA 5IFHL 2PYEB 4JRXA 4LVOC 3X14A 4YDLB 1INQB 2ZKHL 1IRAY 3GMOA 3SY0A 5AD0A 2JF1A 5HHNB 3QIUA 2WY3A 4J4PD 4XTRC 1CTOA 4YH6A 3GSQA 5IMKA 3MRLB 1MFDH 3NTCL 2IGFH 4IRSD 1ZK9A 2BJMH 3MZTA 2UY7A 3OKOB 1I7UA 1OPGH 4FQHB 1HHJB 1N8ZA 2VWEC 3SJVA 5BV7C 2HT3D 3ARBD 4OCSL 5GRVK 4DQOH 2G5BA 4CVUA 3GRWA 1AQDA 3IDIB 1A1OA 1M7IA 1CU4L 2OBGA 4P99A 5J06A 4HKZA 1UKQA 1NFIA 3O6FD 4PJHA 5GGUB 2NNAB 5HGDA 1M6OA 5E8DH 4AENB 3LN5A 5GZOC 1T2JA 5EO1A 2DI9A 4PRPA 4D9LL 5CSZB 1IGIH 3M07A 3ALXA 4O5LL 4OFKA 3G5XA 4PJEE 4O2FB 3MLSL 4WEBH 2KZ1B 4X0KA 1BX2A 4RQQA 5HDBF 2ZSWB 4OZHA 3HR5A 4BH7B 1KJ2H 4A2LA 4WI7A 1CL7L 3R1GH 3U6RA 4WCYH 2R1WA 1PG7H 5F9OL 3JTTA 3CVHB 2EDYA 5DS8B 5DF0A 3SDXA 3MGOB 1RK0B 3KPNA 2EKJA 2CRYA 4NBXB 4LPYA 4HBCL 3ZKNC 4ZODA 4W68A 4FZEL 2ERJC 1YQ2A 1JL8A 2EDJA 2GQHA 2Q20A 1KCUH 3LIZH 3JTTB 2B2XH 4JFDE 4KPHH 4OZIF 1T83C 1T89A 4LGRB 3DVIA 2BNRE 1Q9OB 3BP4B 3WL9B 1WAAF 4QEGA 3T0EC 1LMKA 1UWEL 1IKFH 3SBWC 5EZIL 1WV7T 5D1QA 3RDTA 5CBAB 1WZ1H 3RWFB 1MCPL 3WLBB 4YDIH 4TRPH 4GG8B 3C8KB 2LU7A 4X98B 2CKBH 3DX9B 2IFFL 2CLZB 4JFQA 1FVEB 4IOFC 1HQRB 2BSTA 5D7SL 5FYKU 4ZPTB 4YR6A 5D8JH 3PV7A 3RWJB 5IW3A 1D6VL 3U9PL 3K1KC 3TO4C 1A1OB 1M7IB 2JELL 4Y1AD 1CG9A 1YECH 2DLEA 3PP3K 2HTLC 2RIKA 3WSQH 1FYTB 4P2RE 3WFHA 1TVBA 5B22A 4GUPB 4LPCA 1GAFH 4U1NA 1LO5B 4Y16D 2V7NB 4E0RA 4U1GC 1MVUA 3D0VA 1LD9A 2APVA 2I60L 5K9QI 5KSVB 2ZUQB 1YC8A 2GJJA 3BGMB 3CK0H 3RWIB 5MERA 2Z31D 3BDYH 2YD2A 4M5ZL 1I8LA 3VFUA 4YFLI 2WAHA 1S7RB 4G59A 5FHAL 2YMXL 2R1XB 1BQSA 3V6ZA 32C2A 5B38B 1W8OA 3CZFA 2FYYB 3OXRA 2H9GB 4I77H 4PRBB 5F70A 1U8MA 3RWCB 3ARPA 1MJ7H 5D1ZB 1H8OA 4PJ9B 4TQEL 1YJDH 3ARZA 1EK3A 1WIUA 4R7NA 3LV3A 3ULUF 3REWB 1K2DB 3NCJL 3AC0A 3MLSH 3LD8B 1EGJL 3SKNB 3AMLA 4NNXA 4D0BB 3UTSE 1M05B 2B1HH 3IFPA 5INCA 3SGKC 5FB8A 4EBQH 1YN6B 1U3JA 3VXRB 1JGUH 5F44A 1HXMB 3ILPB 2WUBL 3QIBD 3IKCB 4OV5B 3LKNB 5C0JB 5D1XB 5DHVH 3F6LA 2BNQD 3BW9A 3RNKA 1Q9OA 2XQBL 1GVIA 3FFDA 1C08B 2FJGA 3JXAA 3P9MB 1A6AA 3D69B 1MFEH 4AIOA 4NM8L 1X44A 5IF0A 3MJ7B 5H2BB 4FFYH 4NWUH 1IAIM 3VXMA 3LY6A 1P1ZA 5D1QC 4HWZB 3MRMB 1FP5A 4LDOB 4PGCA 2KL6A 3NCJH 3A6CH 4P46A 3DGGB 4GAYA 5T3XL 3QG6A 5KG9B 1A6UH 4JJ5A 1QBMH 3MV7B 3L9RA 3C60A 1I9JL 3LRGA 2QSTA 3GDBA 3A67H 2X4QB 3VFTB 3MREB 4RIRB 4ZTOH 1S78D 5CAYB 4WTXA 2EXYC 7FABL 3WXVL 3O4LE 4JRYB 1JCKA 4ZTPH 4PRHD 3ARTA 4Z0XB 1CZ8L 5E8EB 3O2VL 3P0YL 3LH2H 1R3JA 4XNMB 4HUVB 4PJAE 5C07A 4M48H 2IAMB 3PQYD 4OCSH 4DQOL 2FGWL 3D25A 4WI5A 5FUZL 5BS0B 3ZTNL 4YK4C 1HKFA 2BJML 1VGKB 5INCB 3WUWG 4KRMB 1JFQL 5IOPB 5JHLH 2ATPA 1YNLH 5F7HA 3BP5B 3MV9D 4OB5L 4XGZA 1B4RA 4WW1A 4ODTL 1H5BB 5EIVA 5IB3B 1SY6H 4B53A 4MA1B 3FB7A 1ZTXH 2VLRD 3GMPB 3B9KD 5DYOB 4Y4FA 4H20H 1JGLL 5E99H 1FAIL 1JHKL 4K3DL 3IU4L 4Z76A 1G7PB 4XMKH 1UXSB 1GRWA 4YFLF 4F9PC 2ADGB 1JRHH 3U48A 1T80A 2EDDA 1DBAL 2WUBH 4JQVA 3U7WL 1DQDH 2ZNWA 5ANME 4JPIB 3QUKA 5MP6H 2OL3A 3I2CL 2XZCL 4Q97A 2J88L 3OPZH 5FM4A 1DQQB 2A9NH 2FGZA 4FXKA 3FRUB 1G7JB 4K7PL 2IWGA 1HWHB 4NFDA 5EUKB 4OV5A 2ZSVA 1YPZB 5CBEB 1R3IH 2QKIB 4U3HA 4LLMB 1E4KA 3FB5A 4XMPH 4LK4A 4G7VH 5KVDL 4M1CC 3GMMA 1Z9MA 5AZEL 1JTTA 1FHGA 1LO3H 3RGHA 4ZDHA 3ULUC 3A6CL 4TUOB 2JIXB 4Y4KD 4XXCC 2IPUK 1L0QA 1FG2B 4LASH 3QDGA 3T77B 1N5AA 2R4RH 5KANI 5D72L 3OKYA 3BGAA 1OLZA 4PJFA 4OBSA 4GRWF 1RZKC 1SJHA 2CDGA 4XXDA 1MFNA 5HDOA 1ZVHA 1F4XH 4K23L 2XA8H 4ZXBC 3LQZB 3QDJB 1M1SA 5JHDD 4M8QA 3MJ9L 5KBNC 3KPOB 3TBSB 3ARBA 3HB3C 8FABB 4GAGH 1XGTB 5DEFA 3KPLB 5C3TA 4JFPA 1S7XA 5HGHA 1ED3A 3K3QA 1MI5A 2F19H 4FS0A 2AV1A 1OP5H 5GRJH 4ZUSA 3EYQD 3EGSB 2LTQC 1QUNA 4NRZA 1F97A 2Q87A 1T04A 3PWPD 1U8OB 1PEZA 2R4RL 3PDDA 4IRJB 4XPFH 4JJ5B 1TLKA 1NFDB 4C4KO 4JM4L 4S0SD 4YBQD 5EOCL 4G43A 1DTUA 2ADIA 1Z0MA 3CPLB 5A16A 4JFOB 1FN4B 1NBZB 3ARRA 3BIAX 5I71B 5F3BB 3V4PH 3HG1B 4HG4J 2AJ3A 3BPCA 4C57C 1FRGH 3O6FC 4LSPL 5DGRA 2E8ZA 5ENWA 3VFVB 4GO6B 3PDGA 1EGJH 2UUDK 3U0WL 1MELA 3NN8B 3HLAB 3SO5A 4GH7B 2Q6WA 3OB0K 5IEHA 1HXYA 4G6JL 2EIEA 4P4RB 3HE7C 1UM4H 4Z7UB 1TCRB 4MWFA 1E4XI 2Y07H 5MHSD 2JB6A 2MPAL 1ZWIA 2XFXB 2Z35B 3EYSH 3KPNB 4UIMB 1MEXL 5IW1B 1PLGL 4R4BB 3ZHDA 3M17B 4ZUUA 2NX5A 2C3GA 4XVSL 1GCFA 3Q3GA 4NO3A 5DUML 1RPQA 4JFFD 3LPFA 1RY7B 1LGVA 1C1EH 2VLMD 3GO1H 5HYIA 4UINH 4XRCB 4WHTB 4ZMAT 1ES0B 1YUHB 3BIBX 1OAKL 4UQ3B 3VDAA 1XT5A 3RKPA 1YN7B 5D2LB 1NKOA 1P69B 4RBPH 2QQLH 1YPZA 3RVUD 3VXUB 2HKFH 3EDFA 1HQ4B 1TVHA 1WBXB 5GGRB 5SWSA 2PYED 4U6HA 1NGQH 5KSAD 3IFOA 3S5LG 2Z4QA 1U8JA 3HAEB 5DJ8B 5I8EA 3VH8G 2Z9TA 4OD2A 3E3QE 1L9NA 4LNRB 5D1QD 2P8PB 2XOTA 5C0RH 2A73B 3BH8B 4A6YB 1K6QH 1RFDH 3OKEA 3T0EE 4HWNA 4IRZL 4ETQA 2VE6B 5JOPD 3V95A 3QNZA 4XX1E 3LSOA 1OAKH 1JZ7A 4C58B 1CQKA 5GHWL 3O2WL 4KUZL 3DUSA 5C70A 2UZIL 1ZANL 5LBSL 3TIEB 2YPKB 1VFAB 1IFHH 4MNQA 4G9FA 2LTQB 4ORZC 4M02A 4WHYH 4ENEC 1VFUA 1FIGH 1UB5A 1OGTA 1PBYA 4Q6IC 1N2RA 4ZFGH 3AREC 4M6AA 4JY4B 2IALA 4QRRE 5ACLA 5E03A 2GTZB 4M6OH 4G80B 2Y7QB 1MFDL 3NTCH 1A6WL 3GRWL 5D7KE 1BZ7B 5E0QA 1NQBA 4UB0L 3QQ9D 4FQJL 5JO5B 5HD8C 2OTUA 3GMPA 4MXVF 4NJ9L 4K7PY 5E8PA 1H3UA 1OGTB 3QEQE 4XGZB 4WDIB 5DT1L 2EE6A 4I3RH 3O6FA 3BKMH 1XF2A 5FYKD 4JCMA 2R2BB 4PJEB 4UTAH 5GHWH 3BRFA 1B0RB 3WUWB 4YXHH 1YNTB 3VDBA 1HZHH 2EH7H 1FIEA 2IPTH 1EAPA 5CJXC 5C6TH 4LGPB 1ERNA 2BVOB 3LAFA 1HILA 4XAKD 3H9YA 5J13B 3O6KL 1KG0A 3TYFB 5EUOA 4YO0B 3MODH 2H6PB 3CLFL 4RIRA 4U2ZA 5T3ZL 1PG7L 3R06A 1OAXL 4Y19E 4MCZA 3DURA 2NW3B 2OXHA 3GRWH 4BH8A 3TZVB 4F37F 3W11C 3P4MA 1M7DB 1OB1B 4YQXL 1KTLB 4KJPC 4NJ9H 1P4LB 3QR2A 2RBLA 3CJJA 3MXWH 3RNQA 5LG1A 3MV8A 3VXOA 2EKSB 3QUZD 4S11A 3U30C 2XN9A 5GJTH 3MRIA 3ROOB 1SEBB 4P23A 4M43L 1URLA 1CFQB 3MLZL 5F9AC 4NPYA 1A4KB 3U1SL 3KLAB 1AD9B 1BAFL 1CFVL 1UWEH 3B6SB 4OZFH 4QHUB 5INDB 4OIBA 3QDMB 4GMTH 1NC2A 3EFFB 1XGYH 5KJRL 3IGAB 4K3GA 5DJZB 3BDBA 2ZJSL 4XMLL 3IFNH 1ZS8B 3CAFA 4QYOA 3SCMA 4M1DL 1YEEL 1L7TL 1A0QL 2FB4L 3ULSB 1PYWB 1HINH 2YA1A 4LRNL 3KYNA 1UJ3B 3EYUL 5ITBH 1ZHKA 3A6BL 3MV9B 1KCRL 1OAZH 25C8H 3AROA 1Q0XH 4JM2B 2LABA 1KCVL 4PP8C 1KB5A 2F53B 4LLYA 2JCCF 4WTZG 1ZEAL 1EJ6A 3BGMA 3T4YB 2YK1L 1JPTH 2A74B 1JTPA 4HLZH 4FQ2L 3QWOA 1T6WA 1JNNH 1NBYB 3PL6A 2PTTA 3SDAB 1AHWB 3PWLB 4F9PA 3TT1L 2F54B 4FNLL 3OWEA 1VADB 2HMID 4YDLC 3UEZA 3QFDB 5EA0H 4ORGB 4WUKH 5HHOB 3ULVE 2YBRA 4EUPA 2G60L 1A1NB 2M8XA 3FCTA 2UWEE 3GSXA 2RR3A 2VDOH 4M7LH 3RY6A 2HJLB 4NO5A 4Y88A 1XGQB 1DBMH 4KRNA 1F11B 3NIDE 2B5IB 2DRUA 4LL9A 3MUGB 2GY7B 4OZFB 1JZ5A 2I9LA 5FF6A 1E4XH 1FGNL 1FFNB 4JZJB 4OLYL 5F7WC 5C0GA 3W39A 2O5ZH 2FX9H 3O41B 4OZHB 3CGTA 1QPXA 4GXUM 2BNRA 1MFCL 2QTEA 5CEXA 5GGSA 1YECL 3OL2A 4Y7MA 3FJTA 5DR5H 3IJYB 1DVFD 3WS6C 5C0EB 5F7FA 5CJXA 2ZUSA 4JR9H 3K4AA 1A3RL 1ZT7A 3KPSD 1C16B 3C60C 1MLCB 2APBA 4HS6B 2VLJB 4R97B 3CDYA 4HZLB 1HSBA 4MB4A 3IT8D 3PHSA 4D9RD 3HMXL 1UACH 4FN0A 5ICXB 4K7PX 1IC4H 3STLA 5JXAL 1LP9E 2Q8BH 2FBJH 1ETZB 4KTDH 4P5TA 4XBPB 4DVBA 1KB5B 2DQHL 2F53A 4U0RB 4FQ1H 1E6JL 2H2SC 4PJ9D 3SHSA 5F88A 3MYZA 5C6PB 1EMTL 3BEVB 1P2CB 3QHZH 1ADQL 2PF6A 2A2QT 3FTGB 5IG7A 1E28B 3GZKA 4NN7C 4P57B 3F7YA 4KGJA 2BVUA 3RVWC 1Z9LA 3MLTA 4JKLA 5EOCJ 5D7JB 2R1YB 1PAMA 1GHFL 2Q86B 4CJ0A 2FBJL 3S3PA 5FDWB 3OAZK 4XH2A 4XVTH 5L0QC 3GMOB 2NY1C 4MJIA 3SY0B 1XGPB 1ZE3C 5TPWL 3E1F1 4NO5B 3EBAA 3N50A 4APQA 4KI5C 1X5AA 3KPMB 3OGCB 4L4JA 5JNYA 2FEEI 1A14L 4HIHB 3CU1A 1ZHNB 4PTTB 5IHZB 15C8H 3I75A 3H0TA 5M95B 1CYGA 1ND0B 4ZXBA 3TJEH 5KVEH 3AY4A 2NY2D 2R4SH 4OCYH 2BOBB 5EN2A 4NKMB 3U9UA 1BREA 1H5BA 5BVJA 5TGBA 2R0WH 4K7FB 1BVKB 2CXGA 1UXSA 3MLPA 2FJFB 3DSFH 2X4SB 5FOBB 2VLME 4IMLA 4OT1H 5MEND 5ALBL 1QR4A 5TF1L 4NKQB 5T5NF 2Q8AL 3U79A 5BRZE 5JDSB 5FFLA 1MFBH 1EEZB 4JG0L 3D9AH 4J4PA 5BVJB 5F7EL 2DM4A 3L5WA 3CH1B 1R5WA 3D3VA 3ZDXF 9CGTA 4LRIA 5I1AB 1FZOB 2AK1L 1XF2B 1I3UA 5ECJE 4POYA 3GSOA 2DB8A 1XF5B 3S97C 1AY1L 4OGAD 3T8XA 1MJJA 5KVMC 3F7YB 3GJFK 4IRSA 4WCYL 2FIKB 4IOFD 4LKCB 5I1JL 1ITBB 4M4PA 2DYPD 4LCIH 4LPUA 3UYOD 1QSFA 1ZTXL 3EDKA 2VDKL 4XH2B 3T3PF 3MJ9A 1MHEA 4BH8B 2IANA 1UA6H 5DK3A 4O02L 1JMZA 4OT1L 2VITB 4JFYA 4JKMA 5IVXF 2EDHA 1WFUA 4R97C 4KVNH 4IDJH 3M8OL 3QUXD 2HKHL 2HVKA 1NGZB 3J7HA 4OCRH 1ZLWH 5EU6E 2C3VA 5C3LD 2ZCHL 3RWGB 3VMNA 3KHOA 1NUDA 4DN3L 2R56L 1U3HA 3S4SG 5SWSE 1Z5LB 4DCQA 2RB8A 5I8OH 2FO4A 1BJMA 1TENA 3GK8H 1YEDA 3BQUA 4FFWC 3W0WA 3FB6A 1FQ9C 4WDIA 3PABB 4AMKH 1Y0LA 5E94A 3P4LA 3QXDB 5GGQH 3I85A 5FM5M 4I77L 4U6YB 3EYQC 4BQCA 3IF1A 1FZMB 1ROWA 3GGWA 1RIVH 4KK5D 4P2OB 1U8MB 3OAUH 1Y18B 5F7KC 2IAMC 3O6MH 4HCRH 4N90E 4M61A 3S34L 1RHFA 1MIMH 3V6ZB 2I60H 4CW1B 3LRSB 4IDJL 1CWVA 4JY4A 3SKNA 4K71B 3DWTA 2O5YH 4NQCA 4NNXB 4NBYB 2PTTB 3SDAA 3O8XB 4UDTA 5KJRH 4N1CA 1JUFB 4JFFA 4XP4H 3B83A 4HSQA 4DK6A 1U8LB 5EN2B 2P7TB 2VZ3A 3IDMA 4IBLT 1T7ZA 3HI1A 4TSCL 5GS0D 3MLVL 2WUCL 3GMLA 5EZLA 5F1NB 4TUKL 2AJZA 4MNHA 5D2NE 1FDLL 3BPLB 4HV8A 3WLWD 1IMHC 2W9EH 1EXUB 5B3JE 4WU7B 4HWUA 3MUJA 4KPHL 5AWNH 3HN3A 4XRCA 2GJZA 3BN9C 3QCVH 1JWSB 2YPVH 3SOBH 1UKTA 4J8RB 4MA3B 3H2WA 3O3EB 1IEBB 2WBWB 1NGYB 3MROB 4MMZC 3QRFM 2H2PD 4XMPL 1P5UA 2HLAB 2ED8A 2BSRB 1NC4D 5CEZL 3ZSTA 1RMFH 5EULV 4JDTL 5HI3C 4WU7A 5GRZA 1B6UA 3TIDA 4CRPA 3RVUC 4RX4D 2LE9A 4ODBD 4XAKE 1KIUA 2APXA 4EN3A 5GXBB 3EAKA 3G6DL 1QFPA 4YZFF 4MS8C 2HTKC 1AXSA 2P8MB 3IYLW 4JREB 2R0ZH 2XYCA 5JW4R 3EJJX 1ZVSA 1FLRH 3UPRB 3NA4A 1ETZA 5H37H 1GAFL 1RFDL 4NQSB 3F58H 2X4UB 4GKSA 5DQDL 4KKBC 4MZ2A 2VKXA 3BESR 1PQZA 1A14H 3VFOB 5LWYH 1BD2E 4OFYD 3C8HA 4LHUG 4K2UH 3GM0A 2JB5H 1H8NA 4HGWB 3AS3A 5FO8A 1Y6MR 3WNLA 2NXYB 3BMWA 2NY0D 1RUML 2CKBL 2PN5A 5L8JB 2B39A 3BP4A 5T1DH 1MWAA 4MAYD 3UTSB 2QADB 2H26B 2ITDA 3NIGF 4J3SA 3DI2B 3SDCA 4GG6F 5BW7C 1B3JA 2VOTA 3LKQA 4KV5F 5C0GB 3C6LA 5B4MC 2EDFA 1EH9A 1I1AB 3CC5A 3DLQR 3V8OA 4C55A 3B43A 4HCRA 2X4PB 5ALCH 5JO5A 4DZBA 5LXGL 1QEWA 4JPKH 5ESQB 3G6AB 4Q58C 5IROC 3UDWC 1CT8B 4KZDH 2P42B 2EDRA 3RIAK 3J8F7 3DHMA 4NZJA 3RVXC 5J6GB 5ADPL 2YBRB 4N8CH 1FORL 1IILE 3KWWB 4PJDE 1CDBA 3DECA 2R0KL 4U1HB 3VGGA 4OKVB 1Q0YH 3TVMB 4A6YL 1VENA 1NFDF 4PGDA 1A6UL 3QIWC 3VXTA 4Y8AA 3WDJA 3EHBD 4PBWD 1T0PB 2AGJL 3H9SB 2NYYC 2OI9A 3MNZA 2PNDA 3FT3B 5T5FL 3SO3C 2Z93A 3BVNA 5JW5A 1FORH 3GJFB 4N8VB 3TBYA 3S37X 5ESVB 3C8DA 3PIQB 4MNHB 1PX3A 3ET9F 1KN2L 5C07E 3ZT6A 3UTTD 3WFDH 4XP9H 3QNXB 3T65A 3IDMB 3C08H 3EYFB 1MUJA 3MBED 3TBVA 4OZGB 5A1AA 4JG1L 4MS8A 1D5ZB 4JFDB 5TDPB 1F3JB 4MCZB 3MXWL 4K3HA 4UIKL 1DL7H 2CKNA 3TP4A 2OSLB 4I3GA 3WDHA 4HGKC 3KDMB 3HAEA 3DXAE 1T7VA 4HS8L 4UILL 1SEBA 4YLQT 3QUYB 1FVCA 4NQVB 1N7MH 1SQ2N 3AMKA 1I1YB 4MD4B 3UP1A 2JJWA 4F7EB 4LLVA 4LLUA 3KPSA 4KKLD 2G75A 2FX7H 3F62A 2DOCA 4M7KL 5IVZB 3IGAA 1LD9B 4XXCA 3CSPA 1KC5L 2H45A 4LSQH 3TV3L 3CDGA 4WWKC 1JV5A 1MCSA 4QHUA 5INDA 5GS0C 4U1NB 2VXUL 3MNWA 2ZG3A 3QCTL 3MPCA 4ZQKA 3VE0B 1KB5L 1RURH 5E6IA 1HI6A 4M1CD 1HQ4A 2R1XA 2F74B 3BAEL 1T0NB 3VGDA 5BVPH 5J1AB 1RJZB 2V6HA 1WBZB 5EPMA 2CQVA 1IBGL 3OMZA 1RVFH 2Z4QB 3W0WB 4GRLD 1CIUA 4P46B 1D9KA 3HZMB 3EYVA 3VGBA 5HHQA 4EI6A 4WENB 1G9NL 4FQXC 2AW2A 4G5ZH 1REIA 1RUQH 1ZHNA 5AG9A 3D39B 1T0MB 4HJGA 3H3PH 2WBKA 3JVGA 4K8RH 3QXAA 5T33H 3UYPA 5E94B 1J1PL 4N0UE 3C6LB 4ZTOL 1EERB 2VDQH 4X6DB 3MA7B 1QSFE 4YGVB 2Q7YB 4RZCB 3GSVA 2IF7A 1N0LA 1GOGA 5FECA 4OGXH 3M17A 4IOSD 1QEWB 3WEXA 2PW2A 2IAMA 1KCSL 3PWJA 2NR6C 1V7MH 2EYSB 2IH1A 1RJCA 2ARJQ 1FAIH 4LDEB 3JTCA 3D18B 1EAPB 4WFFD 4LKXA 5K9KA 5E2UL 2Z0BA 1KENL 3S96A 1A6VH 4P3CL 1DFBH 1QSEE 1FGNH 1A6AB 3MJGX 4S1RL 5IEKA 1IL1B 4MD0B 4HWZA 2ENSA 4YHPB 1XH3B 3HZKA 1AGDA 1EEUA 4OB5H 4X7DC 4U1SA 3N1PC 4E9LA 3BWAB 3KPSB 5K9QG 2PW1A 2X4RB 1QLEH 2ZSWA 1GOHA 4JGUA 4Y2DB 3GBLA 4FFVC 4P59L 1QSZA 4LCWE 1TVHB 2D7NA 5I1EL 1A7NL 2R8SH 4XB7A 1NMAH 1QRKA 2IEPA 3FO2B 3KYMB 4MQ7A 2MSPA 2VQUA 2CO7B 4HEME 5I1IH 5DEGA 4F7CB 1T7YA 2OJEB 4WWKD 3EO0A 1GGBH 1WAAA 4BH7A 2FWOA 3MRCB 3VGFA 1TNMA 1U92B 5TQ2L 4L8DA 4A6YA 5TDNB 1IQWH 4MJ6A 5D5ME 5T5NG 5BQ7A 1KIPA 1TZGH 2PO6C 4OF6A 4O58L 4JB9H 3IVKB 1QRNA 4BZ2L 4X5LA 1BOGA 5HVHB 1OARL 3IDJB 2ZOKB 1B6DA 5ICYA 1NAMA 1JJUA 1BLNA 1OAQL 3U9PH 1YEFH 1N4XH 1UQSB 1JNHA 3BZFA 3BN3B 3P0GB 3RWFA 1RK1B 1SJEA 4Z7UE 3QIBB 5LXGH 3RZCC 1LILA 3M1BB 3MRHA 4L3EE 1I4FA 2YPLE 4ZOCA 1TJGL 4UDTB 4XXDB 1YMMA 1U3ZA 1EO8H 1V7NL 3EYOA 4GW1A 2BSED 3TCLA 1UXWB 5D93B 1UEYA 4Z6AT 1K85A 4F80A 1DP0A 3HE6D 4XB8A 1OM3L 2KKQA 3AM8C 4OFIA 3VFPA 5EU3A 5HHMD 3JUZA 5DJZA 3HRZA 4LBEA 4KFZC 2W0FA 2Q8BL 3KYOA 4PB0L 3GSRA 5EUKA 5F7MC 4M93B 4BSWA 1MRDH 4I9WE 5IR1A 4LSVL 1MREL 5C0BB 4KGLA 3KPTA 1XR8B 4XCEA 5DZNA 3QZWB 1E0OB 5I9QC 2H3NB 1WC7B 2NXZD 2ADFL 1ZLVK 4BUGA 3HCVB 1BP3B 4XNQA 2MKLC 4OM1L 5C6TL 3K81A 3REVA 1I3RB 3H9SD 3RWEB 5FYKH 4MX7B 1FJ1B 4KK5C 1ZOXA 4D9LH 3R06B 1OSZB 3MRJA 2FX9L 4ODSH 2OL3H 4J3TA 2Q6WB 3R8BB 3NCEB 5DJDA 4PJFB 2BFVH 5FO7A 4KY1L 4JM2D 2FX8H 3MLZH 3JTSB 4M1GH 3PUCA 3I6GB 2F53D 1KCLA 1RIHH 3T3PE 4XT1C 4YPGA 3LN4B 1MCWM 2Y07L 3STBA 1F11A 1OOAA 4M3KB 1WVZA 3OKNB 4LRIC 4O58H 3NPSC 4OM0L 1MCBA 2NY6B 1S9WA 3DRQA 4OLXL 1JHLL 5E56A 5GRJL 1NFDA 3MRMA 5DLMH 5E95B 2V9TA 4QKXB 2GT9B 1B9ZA 2E7CA 1G7LB 1EUUA 1FNSH 4NDMB 5IMLA 2OL3L 1DSFH 1UH4A 2D7OA 5SWQA 3VW3H 2YK1H 5I76B 5FYKL 5DK2B 3L3DA 1F4WH 2CDFB 3SKUD 1VSCA 4WHDA 4MAUH 4QLRA 5CCKH 1NAMB 2CRZA 4KTEH 1EUTA 5HVHC 3TJHC 3TT1H 2BVTA 3RX5A 4PJAA 4P4KB 1QACA 4LVOB 2N56A 3N85L 4NN6B 1ZHKB 5C1MB 5FK9B 2A9MH 4KKCD 5LCVL 2ZOKA 1NBYA 3PL6B 3QIBC 3MRKB 3E3QA 1P6AB 2NTSP 5IB4B 4ZUTA 5DMKA 2C3XA 1QO3B 4H0HB 4D0DA 5E99L 4GW5A 12E8L 1RK1A 4HS8H 2AXGA 2HRPL 1I9RL 4NQDA 1Q9LA 1GPOL 5LGJA 4HKXA 2X1QA 5I1KL 2FATH 1GC1L 2R0LL 4ZO7A 5T3ZD 4OCYL 3TA3D 3OHXB 2VAAA 4MNGB 4OGAC 3HPJB 3NCYP 4XVJH 3WD5L 4YBHA 3OG4B 3HC0B 3LS4H 5BZDA 2FH6A 1JUFA 4JFFB 1NGWA 5DVMA 12E8H 3LDBB 2F5AL 1OD7A 3ARVA 1JZ3A 3B2UC 4MQXC 4XCNB 4C4KT 4RX4A 3F7RA 1U8IA 4X6EB 2DL9A 3VWJB 2OJZH 3GJEB 3L3OB 1R3IL 3TVMA 4U1MB 3TEUA 3D2UB 5FYKE 1KPVA 5TF0A 1A7RH 1IBGH 3PWJB 2R29L 2CD0A 3Q5OA 4V1DE 1LK2A 5DURB 2XI9A 2C4FU 5GGRA 1FZKB 3EOAB 2R39A 4LCYB 3D3VE 2XA3A 5ISZE 2A83A 3MRFB 3RHWF 2G5RA 1LEIB 5ESVA 4KKAD 4P5TB 4DVBB 3O6ML 4GRLA 2D31B 1E4WH 3C09C 1N3NB 3IJHB 4KRPB 3TBTB 2ZUVA 3WBDA 5C0RL 3BHBB 3TN0B 3I6GA 2J4WL 5DT1H 4P2YA 2DIBA 4OUUA 4ZAKC 1A9EB 3PQYE 3SGEH 2OTPA 5CJQL 5CD5C 1JYVA 2WBJA 2W9DL 1HINL 4QO1A 4XNUL 3L5XH 3VW3L 1JPFB 3B9AA 3THMH 5HYQA 1V3JA 5ADOH 1JVKA 1R0AH 4GAFB 4NQCD 3OJ2C 4H8WL 2QR0B 1FFRA 2ORBH 2VLLA 5E1AB 5SX5K 4QRSA 4IRSB 1T1ZA 3PHQA 4JO4L 2Y25A 5HHPB 5JOPE 2NY5C 4X7SL 5EO0A 4D3CL 4PREB 1J12A 3QFJA 4NQCE 4J6RL 4JKWA 3DX6A 3F12B 4BUHA 2JJVA 2F58H 1QLRB 4OJFH 4PUBH 4U1GB 2NZ9C 1U2CA 1NLDL 4HXBH 3TPKA 5E5MB 3FONB 1T04B 2WV3A 3MJ8B 3X11B 4HAFA 1TIUA 1X6NA 3U0TB 1INEL 4HK0B 4M6MH 4JFOA 2BVQB 1V5JA 2IBBA 2R23B 3MRGB 5HY9B 3WJLA 4E0RB 2LQRA 4AIXA 2CGRH 4LEOB 2EE2A 2OCFD 4KTYA 5DD3H 3S37H 5KSAB 3OKOA 3HE6C 3NACH 5FM5O 3EDDA 5TGBB 2DQDH 2NPLX 3LD8C 1DLFH 1HHGB 5JIHA 4DWHA 2ORBL 3N9GH 3SDDB 4F58L 5DD0H 3QI9B 4YNYA 2H9GA 1TITA 3MV9A 1BWWA 1PKQB 2XZQH 1FE8H 2R69H 4TSBH 1CXFA 5FHBH 4JFEE 2WIIB 3UTZB 1KPUB 4X6BB 2ICWA 4ORGA 4OKVA 5E2TH 4R7NB 3U7WH 4PJXB 4MJ5A 5BQ7B 2CDGB 2AQ3A 5D9SB 2MQCA 3KG5A 1G7QB 1AGBA 1CGXA 1E4WL 4L4TB 4PRHA 1UWXH 2E5EA 4Y5XC 5EU5A 35C8H 3SGDI 2BY0A 2NYYD 1A21A 3GM8A 5HVGB 2JE8A 2Z8WC 4I2XB 1CLOH 1G6RA 4K94H 3Q3GB 3RGVA 3TJHA 1N0XL 4R2GD 5KZCB 5GSRA 3OJMB 1UM4L 5K9OA 1T22B 4XNYL 1MIEL 3O3DA 3ULUH 3LN4A 1T4KB 3HZYA 2YMXH 3TA3C 3V5DA 1QFUL 5CIPB 1BGXH 2WANA 4HV8B 2ICEA 2EDXA 3CK0L 1D5MA 1BX2B 4RQQB 2GTWB 3C6SB 2R2HA 4QHMA 1DUZA 1P4BL 4AH2B 3MGAA 2QSCH 5FV1L 4DGVL 3NGBB 4UAOB 3GGWB 3ABZA 3NOIA 4K9EC 1KEGH 1HHGA 2NY4C 4P4KD 3KYAA 3ZKMD 1BHGA 2DKSA 5IVXA 4Z7QE 4PJDA 1RHHB 5BMFH 4P2OA 4Q2ZA 3LPWA 3IF1B 4EN3B 4PP2B 1MLBB 4NM4L 5K9JH 4U1LA 1AGFA 3UZQA 2YD5A 3UTOA 1MOEA 1G9NC 1T1ZB 4CW1A 1ZVSB 5MI0C 1S5HA 5AD0B 2EXYD 3UMTA 3EYVB 5HHQB 4EVNA 1X5IA 2Q7YA 5GRUH 3IU4H 5CKAA 4UOW0 2D7PA 3CLEH 1PQZB 4X6DA 5DLML 5CZXD 2NY3C 4N0CC 3V4UH 1S7VA 4FQXD 1IGTB 4LARH 3BKCL 3OAYK 4KJYB 5DTFB 3MYJB 4ONGL 4U0QB 1MWAH 1GIGL 1D5BB 5KSAC 2VDRH 1T5XA 4Y16A 4N5ED 4L5FH 2BHUA 3HC0A 4M5YL 3SDDC 5E8PB 5L6YH 3O3AA 4ZS6D 2VABB 4DEPB 4NKDA 2N1KA 2MOVA 3QI9C 4E5XB 4AG4L 1F90H 3ZYIA 5CGTA 1KN4H 3DX8B 5B39B 4XVUD 3DMMA 4HDIA 1MI5D 1XF4A 2VDMH 4E42B 2A6JB 4HIIB 4JG0H 3WMSA 1BF2A 2IQAB 1IEBA 3V4UL 1FL5B 4R7DB 4GRWE 4W4NA 2YA0A 3B9VA 3S8WA 3UO1L 3VWJA 5HVWA 4YHLL 1GC1C 5KW9L 1U8KB 2XNAA 2XY1A 1WFOA 3MRRA 4NT6B 4AZ8A 3MX0A 1AO7A 1CR9L 2I24N 3T0BA 1WWWX 5KVFH 3GSUA 1LK2B 3SE3C 2F15A 4RA0C 4X9BA 4QHLA 5T1MA 4WGVB 1I1FB 3QXTA 3TPUE 5IB1B 4YXHL 3QUXA 1J10A 1HNGA 1NAML 3P77B 43C9B 1Q1JH 4IJ3B 3WSQL 4L3ED 3S5LA 1SY6L 3GIVB 2I07A 1U92A 2XWTB 4MJIB 3S7GA 4DGYL 2BMKB 3CFJB 5IP4A 1MFEL 5E8OA 4G7YH 1DE4A 3ZKND 5C7XH 1S7TA 4X9GA 1UFUA 3FZUD 5EBWA 5MENE 3RTQC 2DQCH 2Z91A 5F1SA 1SYSA 4NKOA 3EYFA 3V52L 2GFBA 3PJSA 4JEGB 4ZXBB 2AQ1A 3GMQB 4HX1B 1AIFA 3SEPA 4K8RD 3CSBA 3RFZC 5IKCB 3NGBC 4UAOC 3ZE2F 3VH8B 2J6EL 4P4KA 1FYTA 3BOVA 1L7IL 2VDNL 2VITA 4RDQG 5DMGD 1I1AA 4K3JH 1H3VA 5LBSH 3X13A 1LO5A 3QG6B 1RIUH 2R0KH 2F8VA 4X8XA 1D3CA 3VWKB 4PJGE 4JLRB 4GS7B 2GSIB 4ODVH 2FO4B 5FYLE 2GCYB 3QUZB 3ILQD 1U8QB 2AJ3B 5MEQB 5CEZD 1YQVH 1NLBL 2EYRB 5I71C 2NY1D 3BUTA 3EJZD 5SX4I 3DTXA 5GRWA 1FZOA 4R90L 4KI5D 1WC7A 5GGTA 3O2DL 1OWRM 3TN0A 2ED9A 2HRLA 2I9TB 2A6IB 3LKSB 1UGNA 1ACYH 2WBJC 3GIZH 4EDXA 1XR8A 4L29B 4X9FA 4MX7A 4WO4A 5D1XA 1BJ8A 2DBLH 2PXYA 2VDNH 1YEHH 3DTXB 2MQ0A 1JHKH 2V5TA 5DRWA 1AGCB 3GSXB 4CMMB 5HHXL 3WYRA 1FFNA 4JZJA 5LWYL 1WZ1L 2EZ0D 1JF1B 3C5ZD 3TWCH 1CXEA 4F33A 4P46D 3ZDYF 3T1FB 4L8SC 3QO0A 1MY7A 3FO0H 4HKJB 5D9SA 3ZSSA 3HI6L 4PGJA 5HI4C 1XEDA 3QBTB 5F7DB 2FR4B 2IG2L 1LP9A 4LLVB 4C56E 4EDWL 2GUOA 5DD5L 1HK6A 5F1NA 4P48A 1S9KC 4NSKB 1CFNA 4G8IA 1E4XL 3MJ9H 2HN7B 5D2NA 5DD6B 1CL7H 4AEEA 5C0DB 1NGYA 1J1XH 2D7QA 3MRRB 3NAAL 1MJ7L 1VESA 3QULA 5GGQL 2ARJA 1TETH 2PO6A 3VGAC 5FHAH 1F3DJ 3QPXL 3RVWD 3VXNA 1JMXA 4KQ3H 4DOHB 4WW2F 1PDKA 1S7SB 3BPOB 3GMMB 1MH5B 4PB9L 4PG2A 2BSTB 2HTLD 2B20A 4TNWF 1I4FB 2Q86A 1Q0YL 5SWZE 4KKAC 1EJOH 4R4FH 4JVUA 3WO4C 4LSTH 4NQEB 5DUBB 1JYWA 3VFSA 5LCVH 4YHNA 4EN3D 2VDRL 2NLJA 4APQB 5J7CC 4Y5XA 4Y2DD 1CFSB 4MLSA 2P5WD 2BSSA 4E41D 3SGJC 1T2QH 2J88H 3OPZL 5JIPA 4RFOH 3OKLB 2X9WA 5I17B 3T09A 5FYJU 5H35A 1RZJC 4X80H 4YHKL 4I18A 5C07D 2EIZB 4TULL 2NY5H 3TH3T 4IMKA 5B38G 3VXUE 3WFCL 1B4JL 1II4E 2VZSA 3FQRB 4K2UL 1FNSL 4NP4H 4F33B 3GI9H 1GXEA 2VDPH 5JPMB 5E5RB 1RUMH 2JJUA 1Z3GH 4M93C 1LDSA 5JORB 1FAKT 1T1YA 3B9KC 5J13C 3G08B 5DURD 2I9TA 4ZO8A 5SWSD 1I1RA 1B0RA 4YHPA 3WUWA 1DL7L 3UO1H 4D94A 1IAKA 4U7MA 5BZWB 2VMFA 2VC2H 3O4OC 5ACZB 1MCEA 4OZIE 3B2UD 3O2VH 3P0YH 2P5WB 3WDIA 5C6WH 3V6FA 5GGUA 7FABH 4PR5A 2CR6A 5IFJB 3H3BC 3WE6A 1GGYA 5D6DC 4ODSL 5JIKA 1C12B 3VFGL 4G3YL 4Y19D 3SQOH 4J4PC 4XTRD 2FL5B 4XCYB 4RMQA 4ZSOA 3VXSB 1F6LL 4ZUWA 4KDTA 1KNOB 5HHOD 2IANE 2D2OA 2C5DC 3IJHA 4YHIA 2NQCA 3O2DA 3TA3A 3GSOB 3GSWB 3CFDA 5BS0E 3R4DA 4GAYB 1NCCH 5DDHB 1J5OL 4HF5L 5I1HL 3QUXC 4O2CA 1XGTA 4H88H 1NDMA 3TZVC 1G84A 2XN9D 1BFTA 4S0UC 1NUGA 3I9GL 3I6LD 2IBGA 1X6LA 3UAJD 2HH0L 3I3EA 2C3VB 3U30B 2ZUWA 4ZFZA 3UC0H 1IC7L 4M03A 1F3RB 3FT4B 1ZLUH 1YMMB 4GW1B 3SGJA 3P4NA 5I1HH 1XF1A 3MRHB 4N9OB 1K3IA 3RL1B 3WS3B 1KIRB 3VI4F 4EUPG 4I0PC 4LLYB 1JIBA 5C2BL 3E0GA 2CIKB 1CDYA 1A47A 4S1SL 4L4VA 1F45A 4Q9BA 4UU9A 3HI5L 4KXZH 1XCQB 2GFBB 3PJSB 4HIJB 5EZJA 2YD1A 5E6ZA 4QRPB 5EBMB 4XZUB 2A73A 1IFHL 4KC3B 3RIFK 3QIUD 2CJUH 3REWA 5GS2H 1KLGA 1LVEA 4JM2C 4TVPD 3AU1B 4N0RA 1K9TA 5HTSA 1IGCL 3U46A 3C2SA 4DGIL 1G1YA 1KB5H 1NGWB 1A6TA 1RURL 4OZGF 5DZOA 4G8FB 1KJ2L 4HUWA 4WFEE 5TE7L 2CR3A 4X6BA 2A0LD 5ICZA 3DNKA 2IMNA 2WIIA 4G8GE 1S78C 1P7KA 2BVPA 4NUJA 3B9EA 4M7ZB 4L4TD 4AEIL 2DQGL 1BIHA 3HC3H 5AWNL 1YN7A 2QSQA 4J6RH 1LE5B 4TTGA 3ARGD 5DVLA 3FRPA 4PV8A 5MENA 3X17A 3U83A 5IB3A 1DBJL 2RGSA 2X70B 5E4EB 2PYEE 2A6IA 1D5XB 2B1AL 4UILH 1QP1A 2H6PA 2PXYC 1LO4L 1O0VA 4H8WH 3WIFB 1WT5C 4Y4HC 2B5IC 2W07A 2C1PB 1W72L 2IPKB 5K9KB 1MLCA 2XQYK 4HS6A 2V2TA 4J3UA 2D4FA 3NA9H 3HNTL 3NFNB 5SX4H 2GT9A 2WK2A 4GG8A 1JF1A 3LHPL 4GBXB 4UNUA 5DJ2A 1M71A 4BQ6A 1IGCH 4CNIB 5L2JB 5L8LB 3MRBB 3FQXB 1W8NA 2FL5A 4FNLH 4XCYA 3QRGL 5J0BA 3WNOA 4XI5D 3C09B 2L4OA 1MCFA 1DDHB 1RK0A 4UI2A 4CVWA 5ILTH 3VGEA 4MDJA 2HFEA 4GLRI 2IFGA 5D2LE 3TN0C 4BZ1H 5HYSB 3DIFB 4B0MM 1ADQH 2HWZH 2E27H 5I18L 4CN4A 1JF6A 2BCKB 3FAXA 4H0GA 4MJID 5MEOB 5HDBE 1MAJA 4NRXA 4PJEF 5HPMA 1BQUA 1ZT4A 3B8SA 3PGFL 1WITA 1OM3H 1YA5A 2VZ1A 1HKLH 4PJ5D 3HZMA 1K4CB 2DQEH 3ETBF 4UV4L 1PG7X 4PGCB 4JO1L 3NACL 2E7LA 2ZUXA 3TT3H 1RU9H 4MAUL 5HGBA 1KFAH 2FHBA 1UT9A 2Z8RA 3A0OA 4WEBL 4IRSC 4GKSB 3KLHD 3CPLA 2YD9A 4FA8A 2W0LA 3L3KA 3OV6A 5B8CC 3ULVD 1VFAA 2NY4D 3ZKXB 5JHDE 5FM8A 2DIAA 5D5MA 2JK5B 5J8OA 3AVEA 5AZ2L 3T0AA 4JO4H 3RTQA 1JGDA 5C0AE 2H26A 2DDQL 1N0XH 4I0PB 5I0DA 2F58L 2NY1B 4XAWH 3PE9A 3SE4C 2RHEA 1AGEA 3IKCA 2XRAH 4ODHL 6CGTA 2IMMA 1NUNB 1JPSL 5HGHB 3V0AC 2HA1A 4Y5VB 5CS7A 4LSDA 4XNZB 5DRNA 4WUKL 3TBWA 4XC1L 1IKFL 2HLFC 5J9PA 5IB2A 3VI4E 3TC9A 2OTWB 2X6MA 5IJVB 4G6FD 4JCLA 3TH2T 4R6UA 4ZD3L 4PJHF 3VA6A 4I18C 2DJ4A 1A6TB 1YMME 2FJHB 5FKAA 3TCLB 3MA9L 1CGUA 1VGEL 1OAYL 3TBWB 1WFNA 1HYSD 1FE8L 1ZVYA 5HDLA 1U36A 3Q6FA 4PJ7F 4PJ8C 2VABA 4PJBF 4LLDA 4N5EC 1GZPB 1JRHI 3O81A 2JLLA 3DI3B 4PIRF 2X9XA 4QCIA 2EO9A 3UTQA 1FFPB 5T3XD 3UBXG 2R29H 4EOWL 3FT3A 5DHYA 3F5WA 3MFFA 5D2LA 4LAQL 3GNML 5E9DD 4H1LA 3IXTB 4NHUE 1A3LL 4JRYD 2XFXA 3MFGB 2BNQA 1QLFA 4FG6D 1MSPA 3DMMC 3AXLA 5F21B 4GKNB 5I8KH 1U8HA 4HWEH 4GRWH 1JGEB 2IAMD 4MJ2A 2VRAA 3W81A 3FQTB 3EJYD 3KLAA 4JFQB 4L8CB 4K23H 3MGOA 5T1KA 2J8UE 5FO9B 5JHDA 1A6WH 3RUGB 4NZUL 1OT1A 4OJFL 4I4WA 5J3HC 1IGMH 3P9LB 5E6ID 4QYOB 4PRDB 4PG9B 1O5DT 4XX1G 1TJGH 1INDL 1OPGL 4KHXL 3KLDA 3PWNA 4Y4KA 1EFXD 5FKPB 4YX2H 5TE4H 4FTVD 4U33A 5GRXG 4WUUA 3V5KB 4FTVE 1YYML 3U0TA 4X7SH 3QHFL 2LV4A 5D7IA 5EDXA 2P4AB 1HHHB 1QYGH 2EDKA 3LQAL 4HPOL 3PABA 5F89A 4MB3A 5AAWA 4DOHE 4Y4HD 3L1OH 3ARSA 4KQ4H 2H3NA 4WFGE 3X13B 5I16B 1IGJA 1T5WA 5HGDB 1XF3A 3VU2A 1MCJA 1FZMA 1CR9H 1X3DA 4MLIA 5GGRY 5HHNA 2H2PC 2KDGA 2W0KA 4DKEL