3SDCC

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
191
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 32
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC02
2D7OA 5BRZA 3CDCA 1HEZA 3MRDA 4KRMB 1QR1B 5EZLA 3PWNB 4F58L 2QJDA 4HWBL 5B8CA 1MY7A 4AIXA 2NNAB 1DQLH 1Q0XL 1S7RA 4YHLL 1GCFA 4Y5YB 1GGUA 1OSPL 3VD4A 3QFDA 5ALCH 1JWMB 4P46A 1NLBL 1XGQA 4NO0A 2VXSL 1QRKA 2FDBP 3BRFA 1AH1A 4YC2B 3WHXA 3GSWA 3N85L 4M48L 5EDXA 4WENB 3MTRA 5LGJB 4MA7L 4N0YL 2NTFB 4K3GA 3UJIH 3DBXA 1DBKL 4LSSH 5KN5A 2JJTC 1RK1A 2W9DL 1EHAA 2QQLL 4Z18A 1RFDH 2KQNA 3W9EB 1JPFA 4G6JH 3A67H 3QEUB 1IQWL 3DYMA 5CKAA 4HWNA 1DUYA 3CD4A 5I19H 4NC0B 4R4ND 1P7QB 3F6IA 4ODSH 1A64A 4S1DD 1DQJB 5FYKH 5F6HJ 2X7LB 4P46D 1U3ZA 3QZWA 4XAKD 4XX1G 2NZIA 1U8QA 2KBGA 3KYNA 3Q1SL 3MV9E 5IHZB 5CSGA 1VGEL 3CNKA 3GMOA 4OD1L 3CXDL 3OKEB 5F9OL 4P46B 4Z7NE 4NZRL 3QDGB 4LLMB 4NP4H 3ROLA 3KPRA 2ZSVA 5FYKU 5J1AA 3SJVB 1Q0YH 5DURD 3KLAB 1FNSH 3MUY1 4JM2F 1T1XB 1LEIA 1TQCC 1KSRA 2GTWB 4NT6A 2ZSWB 2VABA 4KVNL 4Y2DC 4X99A 4JDVA 4CN4A 4OZIB 4UIMA 4KKLC 5MP6H 5L9DH 1OHQA 3EO1A 4YBLC 5T3XD 1MCWW 3IFNH 5HYQB 2WWKO 3IDMA 2PYEA 4P4KB 3ROOA 2MKLC 4B41A 2JKXA 5FYJD 1V7MH 5D93B 3DX6A 3GM8A 1DL7H 1AXIB 4ETYA 1FVCA 3BOVA 4ZFOL 5I73B 4XWOD 2APBA 4MDIB 2H9GB 4J1UB 4G3YL 3VFTB 2ED9A 2AKRA 3DVFA 1I7RA 3BPNC 1MJ8L 3RDTD 4XPFL 3KXFE 3QIUC 3LY6A 2BXYA 4EUPB 1SBSH 4HXBH 4I0PD 4X6EB 4NBYB 3DX8B 4HKJA 3S5LB 3O6LH 3PQYB 3TBVB 5E8NA 1JF6A 5HY9A 4WNQA 2WBJC 5EBMA 2A6DA 2Y7QA 1D6EB 4H20L 4F7MA 3QIWC 1UXWB 3O3EB 1R0AL 1E4WH 2R56L 5CHNA 4ONHA 4AIOA 1VKXA 3T0EA 2AEPL 3N06B 3VXNA 2XZCL 3PF2A 3BW9B 5D1ZA 1JPGA 4JFPA 3HHRB 5F72S 3GSNB 1N2RA 2ZOKB 2C3VB 43C9A 1TIUA 3EDDA 4U1GC 1R3JA 4OCYL 1HIMH 2DMBA 3B2VL 3O81A 4MD4A 1FCCA 3RWCB 1CD0A 1CFTA 1JZ2A 3OPZL 3TESA 2BNQD 1FSKB 2ICWJ 3RTQA 4NBXB 3VFRA 2EC9U 1U8IB 4R4BA 2NY7H 5C0DB 1LQSR 5DF0A 5KSUA 1NKRA 5EUOB 1A9BA 4EI6B 1R3HA 2GSGB 5KVMC 1DVFA 5HDQL 5DUPH 5AUMB 3DV4A 4JFZL 1YEGH 4K9EC 2EDQA 3UTZA 1W72A 4P2RA 1TVBB 4JFDA 2H45A 1C7TA 1NFDA 1NDGA 3IDXH 1J05B 1PBYA 5D2LA 3ULSA 1Q9WB 4JHZA 3FN0L 1WZ1H 4KKNA 3V95A 4S1RL 43CAA 3OMZA 4PTUB 4MXQD 4UTAH 3Q1SH 5HPMA 5LKNA 1JHLH 3KDMB 4NJAH 2FJGA 3BZEB 5EA0L 4IRJA 2JIXA 4TVPE 4FQJH 1D6VL 1WZMA 1JGLH 3C6LD 2LU7A 3RUGB 4L4VE 5I2IA 4OCLC 1AGBB 3N1PC 3NCYS 1JHTA 3AC0A 1KCUH 2P7TA 5FCUL 1U0QA 4FFZH 4L4TE 5CZKA 1MVUA 4QXTA 5GRJH 4LCIL 1KLUB 2ADIA 2DI7A 1LEGB 3JVGA 3G04A 4YXKH 1H3WM 1CICD 5EFIB 2X4RA 3P4OB 1QVOA 5T1MA 5C0ND 1QFPA 4DCQA 4YBHA 3KPNB 1NANI 2P49B 4V1DA 4LAQH 5D2LF 3EGSA 2VDLH 2OP4L 4JJ5B 4PGCB 1EFXB 5E56A 4YAQA 3ULUH 3UYPA 2RB8A 3K4AA 3O9WD 4QRPE 2C7UB 2I5YH 4LIQL 3IF1A 1MCPH 1BD2E 1QSED 2LABA 3ARFC 2VLRD 4WEMB 5T3ZE 3QJHA 4U6XA 1I8MA 1P9MC 4ZPTB 4NZJA 1NUFA 3VRIB 3WN5B 5GGUA 2DWDA 2D7NA 1KTLB 2PYFB 2DQUL 1IAIM 1ZVHA 4WUKH 4EI5B 5FFLA 4N1EA 1Z9LA 3PQYA 1P4IH 1C5BL 4U3HA 2JCCF 4XB8A 3M17B 4XI5D 3U6RB 2Q3ZA 1KENH 2DAVA 3ECBB 3U82B 1GGBH 1I3RA 4OZGA 1IGJB 1IAIH 4GXVH 4JZNA 3L7FA 4N5UA 3BGAA 1WC7B 1PD6A 4LRIA 5FM8A 1CDIA 4PD4J 3QUZB 2H9GA 3C2AH 5JHDB 2N56A 2HH0H 4JRXA 1VFUA 3NMEA 1G1YA 5J12B 2UZXB 2V17H 4K9EH 2AJYH 2I60L 5DR5H 3VFGH 1B0GA 1CVSC 3AREC 2FB4L 4PR5B 4KDWA 4APQA 4WUKL 4BQ6A 2AJZB 3MODL 4PP2B 2F15A 4HX1B 1KPUB 5FV1L 1SVCP 1OOAA 2EIDA 3WV0A 5ESQA 4TSCH 1OW0C 2EDBA 2V7HA 5GRXG 5I1EL 4DUWA 1INQB 3DVNA 3BSZH 1PLGH 3G5ZA 4UDTB 3IJSA 3KPRB 1VADA 2OQJA 2XG5A 1FHGA 1HKLH 5GS2H 4HPYH 1II4E 4NBZB 3NA9L 4FA8A 4J23A 5DMYA 2J8UB 3GGWA 5EULV 3UTPE 4UTBH 4KWUA 4OZFH 3CH1B 3MLRL 1DVFC 1IGYB 1T1YA 4HWEL 1ONQB 1YEFL 2PKDA 4XBEH 2R0KL 1J0HA 4FQ1H 3FO1A 5L7XH 1BQHB 4XNQA 4OTXH 1K2DB 2F54D 3GSXA 3RJQB 1F4YL 3QUXD 5I1KH 3B9DA 3KPTA 3WJJC 5EO1B 4HZLB 4PBXA 4R97C 1ADQL 2UV3A 4PRDB 1N7ML 5DJ2B 1F58L 1YEIL 5CSZA 4FQHA 4JM4H 3U83A 3DJ9A 2RAMA 4O2CA 1A6TA 3M8OH 5IEHB 3JBG7 5L2KE 2BZDA 4U33A 3U4AA 1X6NA 5EU6E 4NKDB 1V3JA 1BWMA 2W92A 5GGRB 4XP1L 4H8WC 3FQNB 5EZLB 5DMGC 3GJEB 2VRAA 5EN2A 5GRUH 3EOTL 4NRZB 4CL7A 4MNHB 2B4CC 2CRIA 5SX5H 3N9GL 3G6DL 3QPQC 2IJ0C 3X12A 4I48B 3FQXA 5D7JA 3T3MF 3KG5A 4S1SH 3BESR 2XN9A 2FR4A 1MLCB 1KIUA 3MRGB 2OLDA 1MCCA 4RMVA 3BPNB 3B2UD 4HWZB 2I9TB 3UO1H 4H88L 1CDJA 1JFQL 4OZGB 3MRNA 4JM2C 1H5BC 4HEPG 4YDLC 3VGFA 5T3ZL 4H25A 2VLMD 4U7KA 5HVGB 3HI1A 4XP5H 3S4SA 1OP3H 1F02I 2Z0BA 1T66D 4CADB 4HF5L 1R5WB 2OK0L 3MNWB 3R8BB 3SE8L 2A1WL 4N0FA 1F13A 3ULVF 4X6DF 1I9IH 3LH2L 1DBBH 4CGTA 4E42B 3D39A 2NY6D 3RNKB 4ENEC 3QG6B 4JQIH 4GAGL 3HPLB 2NW3A 1JRHI 1JGUL 1QQDB 1JNLH 2NY4B 4Y89A 4IHOA 1RZ8B 5E24E 1NCAL 3L95A 1IVLA 3ZMRA 3TN0C 3UMTA 3BKYL 4Q7DA 1MFEH 2V5SA 4LSRH 4NGHL 4HC1H 4AL8L 3FRUB 4Y8DC 4DCQB 1YMHA 4U7SA 2CKBL 4HIHB 3G04B 2F8XC 2VDRL 1A8JH 2XA3A 1A7RL 3QXUA 3WDJA 1FYTB 1WBYA 3ME0A 4JB9H 5F96L 4PJGA 1WT5C 2EEAA 5F1SA 4TVPD 4PJAB 4ZAKD 3S35H 4KUCF 1RZIA 2X4UB 3BWAA 4OFYD 1T0PB 2H1PL 4GQPH 3SBWC 1HSBA 1KPRA 3R1GH 1MHHB 5T1KA 1AGDB 3CDGB 4XVUC 3C8HA 4LU5H 4EDWL 1FZJB 4X4XB 2DQTH 4KROC 1XGTB 4ZMAT 1KTDB 1JI2A 4L3AA 4N8VA 4G5ZH 4UBDD 2D03L 4HCRA 4GOSA 4L29B 3H0TA 3TA3C 1PAMA 4PIRF 2JCCE 3D9AH 5GGVY 5E4EC 4JO4H 4Q0XH 2FGWH 2ZNXA 1GC1H 4GRLD 2D4FA 1JNJA 1A21A 4IMLB 3PV7A 4M7KL 1QSVA 2CQVA 4LSQH 3W0WA 3BD5A 3ZTNH 4XP4L 5D5MF 1HILA 5ESAA 4MMXC 3A67L 4OQ1A 2EC8A 4FQXD 1PG7H 2ARJQ 3CFBA 3MMEB 5EUOA 3WEXB 4Z95H 3IU3A 3DSFH 1OGAD 5F3BB 1H3PH 4NOBA 4JKLA 3U7YH 5CEXB 4NQDE 2IAND 1HQRB 5JDSB 4M62L 3VFSA 3H9SE 4M5ZH 3F7RA 3V7MA 4XCNA 1AO7B 3CX5K 1FNAA 1A6VL 1BMGA 3FO1B 4K07A 1JZ8A 5HDBF 4ZPVB 2XNAB 3ARFD 4XMKL 4U1MB 5BV7B 1PSKL 4GRWH 1TLKA 5IVXB 1EIBA 3CX2A 1KCSH 5HHMB 5MI0C 4D3CL 3T1WA 1RZKC 2AXFB 2O5YL 4HS3B 3W0WB 1QFWM 2DI8A 1I9RL 2XQBH 3W11D 2DQTL 3LDBB 2X89D 4PJDB 5EOQH 3Q3GA 2BVYA 3VXSB 1OTTC 3WXVL 3C08H 3JSSA 4NN7B 1XF4B 5H35B 4K3EH 4KTEL 3S5LA 1FE8L 1YPZA 2ZJSH 1LDPH 4FQ2H 4Q6IB 1G6RL 2GTZB 2XKSA 5GRWA 3QWRA 3MLSH 5F6IB 1C1EL 1UADC 4AMKH 3WO4C 4LCWD 3VWJC 4HF5H 1SEQH 2FL5B 1DBML 1O5DT 4HGMA 3S4SG 5E7BA 5IMKB 1XGPB 3TH4T 3U1SH 3KJ6L 3PP3K 2YKLH 4AG4L 4N9GA 3U30C 3D5OF 4PGDB 5C0EA 3U0PB 1FGVL 4ZFFB 1GAFH 4M6MH 4NFBA 4S11A 2YPVH 4M1GH 3RWFB 2UYLA 3GMPA 4D8PB 3DVGB 4QRRE 1T03L 1QHOA 2RCSH 1M1SA 4PJEA 2YWYA 4ALAL 1UACH 3F7YA 4TNWK 4Z77B 4P2CG 5H2BA 3BP7B 4HJGA 2FX8L 3QXTA 4RQQA 5ITBL 2A9MH 3Q48A 4HULB 1IFHL 2BNUA 1YN7B 2X9YA 3KNBA 1YPZF 3FOMA 4ZUUB 5HI3D 3M17A 3VCLA 5H35A 2EC9T 1L7IL 3QDGA 2J6EH 5F9WC 3QR2A 5SWZB 4XP1H 4ORZC 3WSQL 1GRWA 3LEVH 1A7BA 4FTVE 3T4YB 1KC5L 4DZBA 1EAPA 1UZ8B 3NGBB 4GKOA 3SDDC 1OPGL 3V52H 5DHVH 5EUKA 4XPHH 3INUH 4RMQA 2MMXA 1KEGL 1I1AD 4GRLC 4WDIA 1W0VA 3RTQD 3M07A 5TPWL 2R2EA 3HB3D 1BX2A 1FAIH 4HJJL 5AZ2H 3U46A 2AABL 4XCFL 3MUGA 1N0LA 4U6TA 3UZQA 3WYRA 2GITA 4NWTH 4U2YA 1XGUA 3X13B 4PLKC 1NGZA 3U4BL 3NCEB 4PY8I 5CBAA 4Q6IC 3LB6C 3O6FC 4Z7WB 3GZKA 3C60C 4P59H 1ZE3C 1L9NA 2ZCKL 4JN1L 3IU3B 4JFFE 3M8OL 4LSPL 3MLRH 4EUPG 2ESVB 1S9XA 4AM0B 5DT1H 5DQ9A 1IAOB 3EYOA 5GZOC 4C57C 3U48A 3LV3B 5B8CB 5CEYB 4PTUA 1RHHB 5AG8A 4E9LA 3UPRA 1DTUA 4MXWL 3GMNB 2VZ3A 1G9NL 2BSRA 2Q3AA 2PYEE 3MSPA 1CT8B 2QHRL 3BH9A 3PABB 4P2QE 2ATKB 1HOCB 3CZFB 5HJ3B 2JLLA 1EJ6A 5CP7B 4HHAA 1FJ1B 3RWIB 4HUNB 5JXAH 1DQLL 1Q0XH 3LQAL 3P9LA 1CDYA 5GGSB 2ED7A 3JWDC 4P23D 1D5XA 3GRWH 4NKIH 5TFSL 2V2TB 5C9JB 3QWRD 5BMFH 4GBXB 3MLTB 5EU4B 1UCBH 1NAML 2WNGA 5EU6A 4JFOB 2BDNL 5L88H 3EW3B 5K9JH 3V0VA 4RWYL 2CDEA 4ZQKA 1YN6B 4YE4L 5F7EH 1ZA3A 2LAGB 2XT1B 3TIDB 3V6BR 1X5AA 2BOBB 4LRNL 1MF2L 5I15L 5KSVA 1UENA 3LKPA 5KVGH 1JZ3A 5CBEA 3T2NH 4DAGL 1T22A 4J3SA 3VXUD 4KK8C 4JZJB 4Z7UB 5GISL 2BSSA 4PJAE 1MLBA 2PF6A 1FFOB 4LLUA 4WHDA 5F1KC 4C4KT 4L9DA 1B3JA 2FX7H 3MRFB 2H3NB 1C08B 5IBLD 4U3CA 1SJXA 4MAYA 1FL6A 1BQHG 3JXAA 1U91A 3HE6A 3L3IA 5C1MB 3MACH 4WWKC 3ARZA 1MCPL 5FUCC 3DRQA 3OV6A 3E2HC 3H3PH 4MNGE 4AK1A 3JV6A 5JA8B 2CLZA 2Y36L 2YPLA 5C7XH 4QTHA 1LDPL 1CXKA 5DJZA 1FG2B 2DYPA 4P57B 3V6OE 3L3GB 3MJ9H 1Z0NA 1Z3GH 3PDOA 1VFAB 1PKQE 4LCUB 1T89A 3AS1A 3OF6D 4HC1A 5ISZA 1T83A 4O9HL 2VXTL 5K93A 2OTUA 3BWUC 2OTWA 3RVVD 3QDJA 2DLGA 4PJFF 1S3KL 4G6FB 3C8KB 3VG0L 3MRJB 1AJ7L 1H0DB 1KCUL 4WUUE 5CMAA 1IGJA 4XC3H 4YZFF 1TFHA 1CGSH 3ILPB 2E9BA 5A43C 1IBGL 3FFCE 5CZVH 3GSOB 5MENB 5I8KH 3KYKH 4C58B 5HYSA 1XR8A 1RJLB 3H9HA 4K3JL 2QHRH 1JJUA 4PJ5E 4YDIL 5HHOE 3NBNA 4FQQB 4ENED 4X98A 3ZE2E 3UJJL 1BAFH 4U6XB 1M6OB 1A6TB 1NFIA 1FCGA 2QR0A 5GGVL 1DR9A 2NXZD 1A14L 4JY6A 1F3DJ 1OAKH 1ZT7B 4JRWA 5KBNC 2NX5B 2BRRH 3DECA 2A6JB 4YR6B 2P8PA 2YXMA 1DJSA 1FO0B 1IC4L 3G5YA 4NFCA 4ZS6D 5F9WB 4S0TD 5DJCA 2FX9L 2WANA 1TCMA 1G9EA 1LK2B 2DQDL 4WU7A 4CMHC 3RWDB 4LHQB 1P6AB 1CQYA 3LEYH 4QXUL 4JHWL 3UTQA 1A0QH 5EA0H 2F5AH 4MS8C 3WNNA 3MXVH 4OSUH 3OGCB 4LKCA 5TE6L 4NKMB 1BD2A 5F1IA 4WW1A 5KN5B 3VGAB 3C09C 2HFEB 5MENA 3CSPA 4UNTA 4NCDA 1ETZB 4Y4KA 4OM0L 5C2BL 4L8SA 3VFMB 2E7HA 4I9WD 3GGWB 1WIPA 4M3JA 4R7NA 3VFUB 2H6PB 3T1FA 3B9KB 5JOFA 4K23H 1JWMA 3GHBH 3SQOH 5EPMA 4KAQL 5HD8D 2OR9L 1INQA 1A2YB 3PL6A 4WY7H 3ZE1F 3T08A 3ZYIA 5F6IC 2HRLA 2HMIC 1RZ7H 2NY0D 4F7PA 2BY0A 3BHBA 4JFFD 3RDTB 2NLJB 2WUCH 5JIKA 3S3SA 3FTGB 4MNGB 5D7SH 1MFEL 4PV8A 5DZLA 3REVA 1VCAA 2KQMA 1FFNB 3B4NA 5KSBB 3OB8A 5C0DA 3QHFL 2RCSL 1AGEA 1RJZA 3CSYB 1DSFH 5GRVL 3MRKB 1FFRA 5BZWA 4HDIB 4JKKA 5KSBE 3WXWH 4TVPH 1BREA 2YUWA 2FLBT 3TNMB 2ITCB 4KJYA 4PJDA 2HJFA 5EU3A 4G8GA 3KJ6H 1EERB 1CFQA 1IARB 1AE6H 1A6AB 2H6PA 4R7NB 5HI5C 4F33B 1A7PL 1JCKA 1QSZA 4TN9A 3H7LA 3OKNB 2C3VA 5GS0H 4R9HA 4N1CA 1JGEA 3U6RA 1E4XH 1OARL 1CLZH 1JGVL 5AAWA 1G6RH 4FQ2L 1JFQH 1CR9H 2D7TL 2F5BL 4R0LA 5K9KA 5INCA 5HGAB 1RV6X 3GJFB 4EDXB 4DFHA 4QRRA 1SVZA 1KG0A 4GT7A 1XGRB 2XWJA 3FAWA 4QHKJ 4HUUB 4P9ML 1EX0A 4BFBD 2DM3A 1K6QH 4Z0BL 4Y1AD 3GUTB 1EMTL 4D3CH 4OAWA 3VDAA 2VN4A 2LE9A 5F7WC 5TF1H 3UPCA 4OGAC 4JJ5A 3WJLC 1A0QL 3BIBX 2R0WH 1KUMA 5EIQA 4AH2A 1PSKH 2ATKA 1KIRA 3PWPA 2AJ3B 1NMAH 5IG7A 1MCHA 2VQUA 3OHXA 3CZJA 2AJVH 4KVNH 3QAZC 4M5ZL 1S5IH 3CFJA 4P2RE 1RSFA 2P48B 1UM4H 1KJ2H 4POUB 4NNYB 5LWYL 3RUGA 2VC2L 1N7MH 2EDEA 2VE6B 4ERSH 4NZRH 5ETUA 3TCLB 5E8DL 3RAJL 3DI3B 3H0TB 1S7WB 3V0WL 2X70B 3KLSA 3SKJH 1XGTA 2IPKA 3O3UN 4JO3L 3FT3B 1VA9A 4QO1A 5FKPA 3ZTJG 5IWLA 3B9AA 2V9QA 4ZUVB 1BJ8A 1OY3B 2YS4A 2GY5A 4LFHD 4JRYB 4GXUM 2VDQL 4LIQE 1MAJA 2PCPB 1TCRB 1JBJA 1WJ3A 4F7CB 5H8DA 2EYSA 1FBIH 1J87A 3MV7A 1KELH 5H94A 1I8IA 5IB1B 4ODUA 2F58L 3FB5A 4Y16A 2JELL 4JFQB 4O02H 1JPSH 2ARJB 1YYML 4YLQT 1WV7T 5KOMC 2VDKH 3G6JB 4PLKD 4YDIH 1L6ZA 1ZT7A 3TZVB 3S5LG 3DROB 1NLBH 1MJJB 4LPXA 4XCYA 5J0BA 4ZUUA 1U8LB 3D39B 3VFPB 3VXME 1I1AB 1YJDL 4YGVB 5C0BD 3HC4L 2BHYA 4JM2B 4RSVA 3KLHC 1U58A 4GBXC 1YNLL 5FCSH 1RZJL 5HDOA 2YUXA 1JWSB 1ZKAA 3MR9A 4HWBH 2V9RA 4JFPB 4MJ6B 2Y5EA 1ACYH 2NY0B 3BUYB 4JKPL 3GMPB 1BBJB 1D5MB 3MA7B 2J4WL 5DRNA 2VXQL 3MRBA 4U6HB 1CICA 1EEQA 4FFYH 1NC2A 1H0DA 3H9SD 3SGDI 4BFGA 2VOTA 4UV4H 5F89A 4X80L 3GJFK 3PWLB 5B8CC 4U6VL 3RU8H 1H3UA 3GMQB 4RWYH 3LKNB 1BQUA 2FZ3B 3C6SB 2RGSA 1HI6B 5IMMA 5C0CD 1P4IL 2GTZA 3P30H 1NFKA 3MJ6A 4NHUA 3Q5OA 1AR1C 4PTTB 2IH3B 3KPQA 4M7JL 2YOCA 5IKCA 3MREB 3K2MC 5FA4B 3UXFA 3CFDA 4IMKA 3RGVC 1RHHA 3O6ML 4G8FB 1KXVC 2MCPL 3ZSTA 4NO5B 1TVHA 4F15C 5FUZL 1BFOB 4PLJD 3JWOC 5DHYB 4M5YL 4QHMA 2EE3A 1G9NH 4WEBH 1MHCA 5DJDA 1JPSL 2VITA 3PWPE 5T1DL 2R4SL 4UIMB 4FXGA 3W0WE 2IFFL 5IVXA 4L8CB 4QNPF 5FK9B 3VD5A 3GIVB 3WJLA 1RUQH 3LKOA 4U1SA 3IU4L 5C3TA 3W39B 4RBPK 3V7AE 3E3QC 3G6AA 2IQAB 2BX5A 5SX4H 3I6GB 1JUFB 3QDHA 4R4FH 4NUJA 5SWSB 2VDQH 4CNIB 2MJWA 4Q74A 4OM1L 4PBWD 4QXWA 5AAMA 5E7FA 5SWSE 2X40A 1R3KA 3RL2B 5HVFB 2AEQL 3WL9B 5CAYB 1QTYT 5ITFA 1FV1A 1ITCA 1FSKC 5ENWB 5L2KB 1T7XA 3SKJL 1RI8A 3DXAA 3T77B 4JFXA 4R96B 2WUBH 5IBTL 4LPCA 4KI5F 3SY0B 1K3ZA 1EAPB 4GAFB 5AZEH 2E9WA 2EKJA 3BJLA 3BVNA 4QHUA 3WUZA 3NCFB 1TZGL 2R39A 1XIWB 4MA1C 3WIFA 3O3BA 2YD2A 4GKZB 3FB6A 1CZ8L 4HJ0C 2OJZH 4N8VB 1NLDL 3BYTA 5HGHB 4ZO8A 1P7HL 1HE7A 3QUYC 3L1OH 4OKVA 1UH2A 1GZPB 3NCJL 4U31A 5CIPH 2R1WA 1MVFA 1NDMB 4JREB 1HSBB 1TZIA 1LE9A 4CMMB 4JFED 4LK4A 3QNYA 5FDWB 1CI5A 4TOYH 3UJTH 4PV9B 3TVMC 1B0GB 2NNAA 3VMPA 1K4DA 1TJIL 4MHHG 3NCYP 1J88A 2G60L 4PRIA 2EH7L 3DOSA 4NQVA 1XGPA 3QG7H 4OLVH 1KJMA 3KJ4C 1NGWA 5E94B 4YO0A 1UJTA 5FHAL 1OPGH 3QDJD 5CINL 3U46B 1CLZL 1KCRH 4FQCH 1GGTA 1HINH 5ISZD 4X9GA 4YFDB 1FYTE 1RZ8A 3OF6A 3RIFK 1F11A 1VACB 3Q3GB 4FG6D 4HUUA 1HYSD 4M7ZB 2Q76A 1Y6KR 4OLWH 4RAUB 4RX4A 3K7UA 4PJFE 3ZT7A 3GM0A 1EHXA 5E9DA 3KR3H 3O2DL 5IBUB 5FOBA 3WN5C 4HXBL 4JCLA 4NRXB 4F8QA 1P84J 1JGEB 3V2AR 4K7FB 1LO5A 2EIBA 3DI2B 4NO0D 4EN3A 4NQXB 3RRQA 1GAFL 4M6ML 4A6YB 4BQBA 5C9KA 2OCFD 4HUKB 4BQ8A 2PR4L 5D6DC 4NJ9H 5D8JH 1SQ2N 4YH6A 4ZFOA 4NN7C 4M1DL 4RX4D 3RPIB 3MA9H 3MGTA 1YJDH 3TFKD 5CLWA 4D8PA 3IDIA 4PB0L 2OZ4A 1FORL 4B7IA 1AY1L 1YMME 3GKWH 5J1TC 1Q9LA 5IVXE 3U0PA 35C8L 3U7WH 1N6VA 3FONA 1ZHBA 4I77H 3ZKMC 5IIEB 3OR7A 2HG5A 2VLRB 5EU5B 1A6UL 2ZOLA 4N8PA 1FZKB 2FIKA 2X4PA 1MFDL 4GAYA 2ZG1A 5MEOA 4LGSB 4HKZB 2X4TA 5IJKC 4DEPC 2R29H 1QZ1A 1QYGL 1G7IB 4HUVA 4PRID 5CZXC 4KK9C 2V2WA 3MCLL 5FDWA 3DX9A 5IF0B 3TO4B 1NDMA 3HPJB 3QHZL 3UC0L 5F7FA 2I26N 1J18A 2DL2A 4M7KH 4P23B 2VLJB 3CU7A 3UTZB 4ZUSB 4L4TB 1D6VH 3BO8B 4FQJL 3LSOB 1QLEL 1A6VH 5KAQF 4JO4L 1MEXH 1UQSB 4M93C 4JFXB 1QBLH 1C8PA 3FO9A 3QUMA 1RZFH 4H1LB 4UV7H 4U1MA 2X1QA 4CJ1A 3BE1H 1JK8A 4QRQB 1X5HA 1HH9A 4K2UH 2P1YA 3GSUB 3VXRD 2JJTA 4M48H 4HWUA 1E4JA 1ZOXA 3WDIA 1P4BL 3BEVA 5L2JB 1BAFL 4U7MA 1QBLL 3IFOA 5D1QA 4JFZH 4RGND 4ISVB 4LEXL 3UTSA 5CJXC 4PRNB 4ODTH 5I8KL 4L9LA 2A6JA 4YR6A 3SO5A 1U3HA 1FORH 5FK9A 2O5XL 2QQNL 1A7RH 4PREA 3TYFA 4CUCA 3TJHD 4X5XA 3B9EA 1UKSA 4URTB 2HP4A 4KHTL 3VG0H 4Z0BH 3CIQA 3ARXA 2Y07H 3I2CH 3LKOB 3S98A 2DJSA 2V5MA 5T5NF 2VXTH 4HIJA 5LAXA 2DOCA 1HIML 4OCYH 4JQIL 2YMXL 4YNYA 3U0WL 2BY3A 1UH4A 2GEEA 4PR5A 3UTTD 4U1GB 4OLYH 2VZSA 3TIEA 1YY9D 4YGAB 3WDHA 1GH7A 3GMRB 4G8EB 4EJ1C 3PHQA 5IV2B 2FNBA 2UWEB 1AGDA 2CKNA 4JO1L 1F90L 1UZ6F 5ISZB 3RIAK 5DJYB 4LKXA 4LSRL 1CICB 4Z7VF 5HXMA 2DYPB 3LKNA 3CDYA 5B4MC 2VWEC 3BPCB 2EYTB 3TZVC 4KDTA 4RMWA 2Q7NA 4FXKA 3OL2A 5DQJB 2EXYC 1I1YB 3G5XB 1I8LC 4ZFZB 4F9LC 5EH1A 5F97E 5INDA 5I17A 5ICYA 2NYYD 4DVRH 1TJIH 4XWGL 2NY3B 3FFCA 4ZTPL 4MAYB 4KKCD 3HE7D 3ULVD 3SE8H 5IHLB 2F8VA 4OFPA 4Y5VA 3GSNL 5TDOB 3IKKA 4IRSA 3VW3H 1MH5A 3NCJH 2C7UA 1Y18A 5B21A 4X7DC 2X09A 1CGVA 1S7XA 1GOGA 5C0AB 3MXWH 1L0QA 1J5OH 3EHBC 1E6OH 5C71A 3QZWB 5I6XC 2VNCA 2P8MB 5IB1A 3IFOB 3VA2C 5EC1B 2J8HA 3GSXB 1B9ZA 4WCYH 3G6JA 1RIUH 5D2NB 5CD5D 4H26B 1JHTB 4JQVA 5IVNA 4ODUB 2W60A 5IBTH 1G0YR 3RDTC 2R69L 1F4YH 3PE9A 2NTFA 1CGWA 3NFSL 1A7OH 1S7QA 3REWB 5FGSA 3MBXL 5I1HL 1CXHA 4OLXH 1U8MA 5IB4A 1LO3H 2DQDH 4EI5D 1U92B 2GUOA 1M7IA 1JZ4A 2VLKE 4JRYA 1CZ8H 2P5EE 5ALBH 5EN2B 3TO4A 3FQUB 1AP2A 6FABH 2NW2B 4QT5B 1IGCL 4KRNA 4POZC 3IU4H 1F58H 3MBXH 4GS7B 4X6FB 3AS3A 3NA9H 3QZWG 4M6NH 4QY8A 4FQXA 4KJPC 5JA9A 3BGFC 3Q5YA 2GFBA 1S7WA 2C5DC 4YZFE 3MNZB 5DURB 1KB5A 2Z93A 3UJJH 1GC1C 3L3KA 5D7IB 1RIUL 1O7SA 3OAZH 5I1JL 3W5MA 3KYKL 2YBRB 5JXED 2QADB 3TBYB 4NQCA 5K9QI 4BZ2L 5MEOB 2AK4E 4WI4A 3IDIB 2YA1A 5D2NC 4HFWB 2I07B 1CL7H 3O3DB 4NHCH 3MODH 4F7TB 5HSFA 2WWKT 3EIFA 1J12A 4QRRB 4JHAH 1I85C 4F57H 1MIEH 3EYVB 4O9HH 1X5ZA 1RUQL 5K33A 1JRHH 2YRZA 3STZB 1LNUA 3PWPD 5ACZB 1N2RB 2A6KA 1UXSB 3C2AL 3CH1A 1AKJD 1VFMA 3R8QA 2CXGA 3QI9B 2DWEB 1J1PH 3BUTA 2D0HA 4K7PX 5CD3A 3TGXA 3RWHB 3GSQB 1KEML 2DQFA 2Q8AL 4Z8FL 1NH6A 3AY4C 4S2SA 4HS8H 4OFVA 1NCBL 5FOBB 4M7JH 1U8OB 4PJCA 3NN8B 4MA8L 5E8PB 4TUKL 1GPOH 4FMFA 4HS8L 1PEZA 3EYVA 3PWJA 3SBWA 2HVJB 4YK4C 1F2QA 3P4MB 2GJZB 5EFIA 1YYLL 4F7TA 4X5WA 1V8HA 5EBLB 3FTGA 4MNGA 4HX1A 1KLUA 5C0RL 1CF8L 1OM3L 4P2QB 4YWGL 3EO0B 5JLZA 4AENA 4RGOH 2PO6B 2FHCA 3D6GA 1KIQB 5B22A 3RI5F 4LVEA 4OGYH 1A6ZA 4KJQC 2QTEA 2VH5H 5DHVA 1FBIL 1LK3H 2X2YA 1NMBH 4MLIA 2D31A 3K2UH 4XXDA 1K4DB 3CXHJ 3KAAA 2YN5A 3I85A 4D2NA 4XPAH 4MXVE 4LNVA 1YPZB 5KS9F 3HR5A 4KI5E 5D7JD 5J1AB 3IAGC 4Y4KB 4GW5B 1A6WL 1X5IA 1K8IB 2AI0L 5GZND 1ZGLB 3ULSB 5BJTB 3GMOB 2I5YL 4LIQH 1G7QA 3T1FB 1AGFA 5HHOA 4LSVL 3BDXA 1W72B 3GI8L 4P2RB 1KB9K 4S1RH 2EXWD 1A4JA 3LMJL 3RWDA 1DE4B 3OXSB 2J5LC 2R9HD 4M9OA 2AK4B 4IOFD 5C07D 4F9PA 2WWMC 5D7IE 1LP9A 3VG9B 4NKMA 2D3VA 3RHWK 1J0YA 2X42A 2OXHA 5TGBA 5C08D 1MCFA 4PRHD 4P5TB 3DBXB 1UVQB 2C3WA 3OAUL 1JYVA 3K3QA 5HHOD 2Z31D 2OTPA 3ZKMD 2NCMA 5I1HH 1GYAA 4X6DE 4Q0XL 4R97B 5FO7B 5TF1L 5F9JB 1JHLL 1WQVT 2BNRD 3F7VA 3OB0H 4NO0B 3ARSA 2A9NH 4NQCE 4RZCA 1TJHH 4ZOEA 3RPKA 2SEBB 3HUJF 3BAEH 4YDVA 2EDYA 3W2DH 5ICZB 2JIXB 2B4CH 4FFWD 5MERB 3NH7H 3R1GL 3DYOA 4PJHA 3RVXC 1YEGL 2F5BH 1CR9L 5SWQA 4OF5A 5IKCB 2I9LB 4N0UE 5I66B 2WK2A 3BPCA 5DHYA 1AY1H 3GKWL 3OKDA 4OCSH 4U1KA 5JPNB 4JB9L 4ZO7A 1TVHB 4K8RH 2MNUA 2DQIL 3A6CH 1F4XL 5I30H 1W72L 3QXAB 2CLZB 4R26H 2AKRB 4DGYH 1P1ZA 4MDIA 4KPHH 2UWEA 1U8HA 3HUJB 2R8SH 2X1OA 3QFJB 3JWDL 2IQ9H 3ZKNC 3HRPA 3PDOB 4LCUA 4PJCE 4RWHA 3H3KA 3L5IA 1P4LB 2FZ3A 2YPKB 4GAGH 3QCVL 4O2EA 1H3TA 5E2WH 2VDOL 3JWNC 3L9RA 3MCKB 4G3YH 1CE6A 5C2UB 2I9LA 4AY0A 1MCQA 5IM7A 4OLZH 2A77H 3NIGF 3D48R 3IVKA 2ZSWA 3HE6B 2LAAA 4K8RL 3QSKB 3WFCL 3IFLH 1E4WL 2R56H 4UB0L 1QLRB 4RA0C 4NM4L 1I9EA 4MDJB 5I18H 4MDJA 5CINH 1AXSA 2BVPA 2BSSB 3CFKB 1VKXB 1U2HA 4ZS7L 3CVIH 4Z76A 3PQYD 1JZ7A 4Q2ZB 4XMLL 5ERWB 3FZUD 5EU6B 2KH2B 3NIFE 1AO7E 4ISVA 4NQCD 1F8TL 3IJYB 3TM6A 2VDPH 5HY9B 3MV7B 2IALB 1CE6B 2F53D 3DMMA 5IW6A 4O51A 1N0XH 4TNWF 2E7LA 4YXHH 3LZFL 3TWCH 4TOYL 1LD9B 5I1IH 1DFBH 2FCBA 2HTLD 3J8F7 4Y4FC 3HUJA 4ODSL 1QRNB 3HAEA 2OXGA 4U6YA 3TPUB 2R23B 5GSRA 32C2B 4XNYH 3K1DA 3QDME 1EXUA 2PCPA 2D0FA 4P23A 4H5SB 4MX7B 2DM7A 4WI2A 5HYQA 5DK0A 3CVHH 1J0JA 4JDVB 4HUWB 2V2WB 4OD1H 2VZVA 4G42A 4NZDA 1E27B 3EDJA 3C6LA 5IROC 5GJTH 1H8NA 4LSVH 4JPIB 2X4TB 1RPQA 1SEBB 3X3FH 3HNSH 2HT4D 2HFFB 4IS6B 1URLA 3B8YA 1XZ0A 3HS0A 1U36A 1VPOL 3F7VB 4NNYA 4XPAL 5FEBA 5I0ZA 5LQBL 3F7PC 3HLAA 1NBQA 4P9HL 1KIQA 3LCYA 4XC3L 3HKFA 1UYWH 1IMHC 4JFEB 5J9PA 4WHCA 4G6FD 2DIJA 4PJHE 2OJEA 1WFNA 3I3DA 5I16A 3P4MA 4I1NB 1G9MC 1QFUL 4F80A 2C9AA 1UZ6E 3O8XB 4OAWB 4X7FC 4GMSL 3HE7A 4C59B 2WBWB 25C8H 2HLAB 4G6AC 3QXDA 5D72H 2CGRH 5E2UL 4DTGL 3VGHA 4GUPB 1MCLA 1A6WH 5LXGH 3LPFA 4NUGH 3QYCA 4TSCL 5FECB 3CGTA 3TYGH 4ODWA 3CU1A 3SKUD 3N1MC 1GIGH 2FWOB 3RZWA 1WSST 3QI9A 3UYRL 5E6IC 2CDGA 3MQIA 5HVHC 2EE9A 5HI3C 3SDDA 5F7HA 2P5WA 3HR5B 4WJ5B 1B4RA 4B5EA 1IZJA 3AM8C 3EJJX 4I5BA 5LBSH 3QQ4A 2IWGA 1MF2H 4JLRA 3ILQD 1ZV5A 4WTZA 3UPAA 3T0WA 4CDHA 3BISA 4OT1H 3PWVB 4YX2H 1KENL 1REIA 2K7PA 2M1KA 1JRHL 3MACL 1JTPA 1T80A 4HH9B 4U1JA 1A2YA 3K0WA 1I1CA 4KUZL 4DUXA 1RY7B 3O6FA 1GGIL 3AU1B 2K1MA 2ZUVA 5DGQA 1X5KA 4WFGE 4X5WB 4XVSL 3OR6B 5FO9B 3PNWA 4KK9D 3VXQB 3TYGL 5K9OA 3O41A 4R2GB 2F19L 4YPGA 5EBWB 3SDXA 2GK2A 4Z7QE 4JZNB 3GO1H 5BS0B 2XPGA 1ND0B 2UUDK 1I7ZA 3T2OA 1FDLL 2YUZA 4U1HB 1AC6A 4NCC1 4PJ7A 4U1KB 1U3HD 3ZDXF 4HG4K 1J8KA 3RL1A 4H0IA 4OB5H 5HYJE 1XT5A 4XZUB 1OAXL 5I71C 2ITDB 1F3RB 2NX5E 3O3AA 4HG4J 3PWUB 1T21B 3WD5L 3FAXA 4PG2A 4PJXA 5EUOF 3BGMA 4W6XB 3K4ZA 1MIEL 2V5RA 4JHAL 5GRJL 2X89A 5IB4B 3Q5TA 1QSFB 2ZNWA 3LN4B 5DRXA 4NHCL 5HGDA 4DZ8B 1MFBH 3O2VL 3RVUD 4PLOB 1IAKA 1TPXC 1INDH 2ZCKH 3O8XA 5KW9L 1GZQB 3KPRD 5KVDL 1N4XL 1UM5L 4HCRH 3NACL 2A0LC 2Z92B 4J3TA 1DBJH 1FLRH 2H26A 1FNGA 1U93A 3VFSB 3MRPA 1MFAL 1M6OA 5EZIH 2F8OA 4QOKA 1CWVA 4KUCD 1ZA6B 3VXUE 3GHEL 1VEMA 4LNRA 1TNMA 3NACH 3CFBB 5EIIA 2EZ0D 3R4DA 5KANG 4PS4L 5FB8A 2PXYD 1DE4A 3OXSA 1RUML 3AB0C 5IFHL 4HIIA 4ZTOH 1MI5A 1IEAA 3R0MA 3VXSD 4QHKI 1X7QB 4RDQG 2X6MA 1FZJA 1XF3A 5JQHC 3HE6C 3ULVE 5D2LB 4NNPL 2UVEA 4O4YL 2R69H 3DRTB 4LVNC 1HKLL 2WIIA 4YIQB 5TDPB 4YXHL 4AIZB 5ILTH 3ZE0E 1YJDC 3EKCA 1MREL 5DXWA 3CMGA 4NZTH 1MUJA 2MCPH 3GBML 4M6AA 4BJLA 2OI9C 1KEGH 3ZSSA 1FGNH 4G8EA 1S5HA 4N0RA 3LIZH 2GT9B 1G7LB 4W6YB 1FVEA 5E5RB 1PFCA 3WO3B 1EGJA 7FABL 3L3GA 4IJ3C 4RAVA 4ZO6A 1Z9SA 4TTGA 2A83A 3BUYA 1HWGB 1OF2A 3LN5B 2J6EL 3IFLL 3QBTB 4LLUB 3LEXB 4P9HC 4X7TA 3RY6C 3WUWB 1QOKA 1JWSA 5T33H 4PJFB 3T0EE 4HIJB 3MJ7B 5DRWA 3MRMA 4NC1C 1T22B 3OKKB 1ZLSL 4B0MM 3CFKA 1YQVL 1CK0L 1FG9C 5CGYD 5MEPB 3L3JB 3GBLA 3B9VA 5D7LE 5IFJB 5TDOA 2BFVL 1VSCA 2IQ9L 1PYWB 4PJBA 5FUOL 2XQBL 4AEIH 3MOBL 1EK3A 1G7LA 5MEQB 4P5KA 2CRYA 3ISWA 3DTXA 4JFOA 2NTSP 1GGCH 4KRLB 1XF5A 3I3EA 4DN4H 1D5XB 1YY9C 5C09E 3QNZB 2DJUA 2ADFH 3P9LB 4WI3A 5GGSA 4X9FA 2CPCA 3ZZ1A 2YPKA 1IKFH 2CDEB 2E7BA 4LSUL 5DO2D 1RUAL 4TUOB 5DJ0B 1DQDL 3BDYH 3GHBL 1AR2A 5HGGS 1QSEB 4IBLT 2JELH 1I1RA 4XH2B 5IV2A 3RNQB 3T0DA 5EORL 5GGRA 4YDLB 4PG2C 3I6LE 5EC2A 3ZT5A 3LSOA 2IGFH 3TBYA 2BMKB 3ROOB 2W9EL 3L6FB 1T1WA 2XIDA 3VDCA 4HIIB 1MCKA 3RWEA 5FV2A 3OKOB 2ICES 4GKNA 2QSQA 3CH8A 2JJSC 3NFNB 2QQNH 5E5MA 4Z7UF 2X44D 3ARBB 4HUVB 4P5MA 2NXZC 3NPSC 1ZA6A 3WE6A 1UKTA 5ID0A 5JOEA 1OTUD 1RUKH 5FIEA 5F9AC 4NQEE 4GAYB 2WM0A 1U93B 3ZL4L 3D9AL 4LHUG 5KZCB 5AD0A 3RVUC 1OD7A 3B2UC 2IANB 4ONFL 2VAJA 1U3HB 3MUJA 1QSEE 4H0GA 4CU6A 5IHUL 4MAUH 4HZLA 2HT2C 1MI5E 2DL9A 5JHLH 2LU3A 3F58H 3LKQA 4RMSA 5IJVB 1S5IL 3AXLA 4DZ8A 4NOFA 3MGTB 1A6UH 3GI8H 1INEL 3SDAA 1UA6H 2C3HA 2A6IB 4TTDC 2MHAB 2VR5A 1QFOA 3SE3C 4QTIH 1Z5LB 1T21A 1ONQA 3N0PB 5CJQL 1IGYA 5FUCE 4YQXH 1KYOJ 2B2XH 1UQSA 1BM3L 2X4QB 3OPZH 2AJUH 2GSIB 4PB9H 1NMBL 1N0XL 1BFTA 4D9QE 4NGHH 4LDOB 2VSDA 4MA1B 4F33A 1A5FL 3BP7A 3T8XA 3HPJA 1A9EA 4XVJL 1CFSB 3FT4B 3AU1A 4OF8A 5C8JB 1NGPL 3FOMB 2CK2A 1S7RB 4CRPA 1LGVA 4TRPH 3HAEG 3BRDA 1UT9A 1N3NA 1PZ5B 2OK0H 3P77B 5CEZH 4JRXE 4JY5L 4YO0B 3O11B 4ZFZA 4GJTB 1QR1A 1FZKA 1MUJB 2A38A 2PO6C 4GMTH 4UT9L 4PP2A 1T5WA 4NWUH 2XI9A 5F88A 3FONB 4LASH 2XN9E 4F7PB 4AIZA 2FX7L 4TNVK 1NBVL 2RR3A 4PV9A 4Y2DA 2BP3A 3TN0A 4W6WB 4WIQA 4APQD 3C9NB 2VL5A 1E28B 3U4EA 5HHQA 3V4UL 5KSAD 4OIIL 2EH7H 4UDUA 4LLQB 4I3SH 2OL3A 1RQ5A 5SX5K 2DWDB 4HK3J 1WWAX 4YE4H 4G6ML 1ZLWK 5HGBB 3SGDH 3QIWD 2AQ3A 1XIWA 4FQIH 1X5FA 1ZHKB 1WGOA 5GPRA 1HH6A 3BQUA 4M7LT 3DX7B 3L1OL 3LRHA 4LNRB 1P7KA 5DZNA 4YUEH 5J8OA 4WW2B 4H88H 2KKQA 1CL7I 5I16B 1FGNL 3OWEA 4DK3A 4X5XB 3WLBA 2EIZA 1C5CL 2IMNA 4LVHC 3DXAB 3EYUL 1EFXD 4RFOH 3LKQB 3NOIA 4OM0H 1JTOA 1WWBX 2VN7A 2BC4A 4XCEA 5FF6B 1EFXA 1RIVL 1HK6A 4P2OC 4MXWH 3IDYB 5FO8B 4XTRD 3SJVD 3O9WA 3TT3H 1FZOB 4XX1E 1OCWH 1A7NL 1BEYL 3M45A 4FQLL 4JY6B 4UILH 1JUFA 3WLWC 4J3OC 3LN4A 5KVFH 4L1HA 1HQRA 4IRJB 3MROA 1N5AA 1JGDA 3K4DA 3SE4A 3KS0J 4IMLA 5C6TH 2HKHH 12E8H 4DKDC 1AQKH 1U8NA 4K8RC 1WVZA 4QGYA 5D7IA 4AQ1B 12E8L 5T3XH 1ACZA 4OIBA 1DDHB 1PEWA 5DK0B 2DRUA 8FABA 3AVEA 2AERT 1ADQH 3NFSH 4GBXD 1UEMA 4Z78B 1YEDA 3C8KA 1KIPB 4IRJD 5FO9A 2VXUH 5JZ7C 3CDGA 1QBML 2HVKB 3DX9B 5IF0A 1X44A 3MLWH 4HZAA 2ZPKL 4QHUB 1CYGA 3BGFB 4L29A 4OCWL 3T2QA 3O6FB 5CWSB 4KI1A 4WCYL 2H2PC 2H8PA 2V7NB 5EU7E 1YNKH 4JN2B 3LD8C 1C5DA 2NXYB 3TLRA 2VLRE 5T3ZD 3MRCA 1R5IB 1XCTA 4PJGB 1G7JB 5CJ8A 2IALA 5L8JB 2ORBL 1OP5K 2FB4H 4JVWA 4R4BB 1JF5A 3BMWA 4JHBA 4TSAL 5I74C 2DLFH 2HN7B 5CJOH 1A7QH 1CFTB 4OZGE 3QO0B 5D1ZB 4PJ5D 4IRZH 3I6GA 3GMMA 4OZIF 1OGAE 3QG6A 1T0NB 2R2CA 1QLRA 1KACB 2VR4A 1WIUA 2NPLX 4JZJA 4KKLD 1SY6L 1N26A 1U58B 1UACL 4CW1B 4PJFA 2J4WH 1AO7D 4F7MB 1D6EA 3WFEL 1MHPH 1AGCA 5E99H 1C5BH 1DLFL 4JG1L 5ADPH 4QXGL 4FFWC 5JPMA 5DJDB 2R2HB 4KZEH 2XA8L 3QXDB 4MA8H 1GGIH 2FGZA 4N1HB 4K7PY 1YUHA 2O5ZL 4NO5A 3SGKA 1KCVL 1HYRC 1B4JL 3O3EA 3S36L 1OL0A 4Y16B 1CE1L 2X1XR 5LXGL 2QV2A 4BFIA 1I1YA 3G5XA 2HTLC 3BP4A 3KPOA 3P40A 3DETD 5E2VH 3GB7B 2I25N 2VKXA 3TC9A 4F37F 4F7CA 4OJFL 3MC0A 4JFEE 1QEWB 3MRNB 4LAQL 4OKDA 5F7EL 4OBSA 1Q9OA 5JPNA 5CJOL 1T20A 1IZKA 4LLVB 4YBQC 1T7ZA 2CUHA 3ZE0F 5K9JL 4XCCH 3VGGA 1TMCB 1TVDA 3UPRB 1HYSC 3STBA 4WTZG 4LMQE 4Y4KD 2EDKA 1T89C 4L5FH 2MKWA 3Q6FB 5JXAL 5T5NG 4BZ1H 5IB5A 1CFSA 1DQML 4MJ6A 4DTGH 3UTOA 3MLWL 4X4MA 5EBGA 4QF1B 4FABH 3M1BA 1P53A 3NIGE 4HJ0D 3HUJE 5DVMA 3HC3L 3LS4L 5DD6B 4KK5D 2Y5TB 3H42L 3HZVA 4LF3A 2ZSVB 3OHXB 1MCBA 2Q86B 3VGAC 3O3BB 1DLHB 3RTQC 2XQYK 1NCDH 3CPLA 5FHBL 1ZT1B 5CUSH 3OAYH 5L0QB 1WCBA 3EJZC 2BVQB 1RJYA 1YQ2A 4OGXH 4L9LB 5JZ7D 3PGFL 2X7LA 3ULVH 1ITBB 2UZIL 2H41A 3G9VA 1BZQK 5DFWH 3T77A 2QQKL 5IVZA 2DQJL 1UFUA 4NQED 1ADQA 1XGRA 2R0WL 4R3SB 2ENSA 1LHZA 2CO7B 3RVVC 3WHXB 4Y19E 3IRZA 1AGFB 4HMDA 5HHOB 3QUXC 1PX4A 1KB5L 4HV8A 1AXSB 4HJJH 1FAIL 5AZ2L 1VADB 1NCCH 2OQJB 1HNFA 4NFDA 1M05B 4PFEA 3B2VH 2NY6B 1GSMA 3W39A 4TSBL 1UM4L 5I1GH 1T83C 4IOIB 3RA7H 2E7CA 4NQEB 1IC5H 3HA0A 1VDGA 4WO4C 3HR6A 1JGVH 5HDQH 1J5OL 35C8H 1MI5D 1V7NL 1G7MA 2W65A 4G9FE 4PB0H 2PO6A 4FZ8L 3WKNA 1R0AH 3KXFD 4N9GB 3CFDB 3LZFH 3REVB 4AL8H 4QCIA 3MOBH 5JXEA 4JLRB 4MD0B 3MV9D 4AH2B 1PJ9A 3LHPL 5FYJE 4CVXB 3V4UH 2DF3A 3FMGH 2Q8BH 6CGTA 3QNZA 4KPHL 5HYJB 5J6GA 2Q7YB 4N0CC 3SDXE 4D0DB 3MRQA 4PRPA 4OLWL 3TBSA 3KPOB 4N0UB 3VXSA 1F42A 4DKEH 2A1WH 3WNMA 1JZ6A 1XF5B 1Z2KA 2DQFB 4MB4A 5BVPH 1S9VB 1Q8MA 1F90H 1P2CA 1EHLH 1DUZB 4JY5H 3NTCH 3QFJD 4XPTH 1MCJA 3RY5A 3VFNB 2EE2A 4QOKD 4EI5A 5FHAH 3U0WH 1UH3A 3OKNA 1NKOA 3T0VA 2EO9A 3FMGL 3VRIA 1CLYL 3WN5A 3MGOA 3A6BH 3MJ7A 5DRWB 5DD3H 4FP8L 3LVEA 1Q0YL 3VFPA 1U8LA 2X4RB 3P4OA 3P0YL 3OB0K 3I2CL 1IQDB 1MHEA 1D9KD 4ZYKB 1WBZA 5EZOL 5BZWB 4RAVB 4Y4HA 3EGSB 3MOAL 4ZSOA 3BKML 4WY7L 4ETQB 5JW3H 3CFIC 4NKOA 5CEZE 1MCIA 4LARL 4LBEB 3IFNL 3WMSA 2QQKH 3FQTA 3IS0X 1WEJH 4MNQA 3PP4L 1R5IA 1XCTB 4GQ9L 1X5XA 2QLVB 1DN2A 3WNOA 4BQ9A 3UJIL 4WUUA 1NGYB 1BVLA 2C1OB 1TZIB 1LE9B 3UTPD 1BQLL 3O4LE 1G7PB 1LEKB 5E1AA 1R5VA 5GS1C 3TJHC 5JOFB 4DWHA 1BZ7B 4KRPC 1YEDB 5FYLL 2FEEL 1DVFD 3ARGA 2WUBL 1KTDA 2WINB 4TYUA 8FABB 2VDNH 4NQDB 2B5IC 5FYJL 1T04A 4ZDHA 1CXLA 5DMGD 3WIFB 3GIZH 2VXVL 1AI1L 2HFEA 1NFDB 3EZ8A 3E1F1 4WI6A 4YDJA 4K55A 4D0CA 3SCMB 5B3JF 4K71B 4A6YH 3CFJB 5SWZD 2B39A 1AJ7H 3EO0A 2QQLH 1N5AB 3IDYC 1A02N 3UBXI 2M26A 2CKBA 4HFUH 2XWBA 3JV6B 1NCDL 3DMMB 3OKYA 4I2XB 2E5EA 1ERNA 4CVZA 3PJSA 4LP4A 4OGYL 5LVEA 4Q2ZA 5ERWA 3QIWB 4KMTH 4XHQA 4UU9B 3RL2A 2R4SH 2AJXH 3RTQB 3VFRB 5JDJA 2DDQH 5HHVH 2Y9RT 1CVRA 2JJUA 4YDKH 1S9YA 2YD3A 2DS4A 2Q6WB 4CNIA 2Z8WC 3QULA 3U7WL 4G6AD 4Y5XB 5E2VL 3GO1L 1MLBB 1AC0A 1OSPH 2XWJB 3DARA 5IUSA 2J8UE 4OCNC 3ZKXB 1M4KA 3HCVA 5BO1L 4NJ9L 5D8JL 1RJLA 3ZLQC 1WWWX 3ARDB 1NCTA 2BOBA 4PRPB 1X4ZA 3VRJB 2NY1C 2BFVH 2X4NB 3P4LA 1TTUA 1QHPA 3QFJA 1ZLUH 4LCWA 5HD8C 3QEHA 4UOW0 4IRZL 5BS0E 5C9JA 4Z7WF 2GW5A 1HXYB 1PKQA 3MRIB 5JNYB 3DX6B 4PGBA 4DKFL 4UT7H 3OG6B 2IC2A 5DJ6B 4F57L 4GRWE 4J8RB 4LGPB 1GPOL 2LQRA 4Z7NF 1PKOA 4P46C 1ED3A 2GJ6A 7FABH 2N1KA 4KH2A 1RU9H 5CIPA 3MLYL 3VXRB 5LG1A 3QEGH 4DGVH 4G9DB 3QG7L 4G8IA 1Q1JL 1BWWA 3TPKA 1TJGH 1BBJA 1D5MA 2VDKL 3OKMA 2VDLL 4PJGE 5E2JA 4DJMA 2V2XA 1BHGA 1T7VA 3QQ9D 4OCXL 1EUTA 3JTTB 3C5ZC 5ANMB 4PRDA 1ES0A 2F54B 4P4KC 5GGQL 2XFXB 5C70A 3QQ3A 1NCWL 4PRNA 3FN9A 3L7EA 5GZNC 1NAKL 5J1SC 3UX9B 5A1AA 3L3OB 2H2SC 3WNKA 5JOPE 1UYWL 3X13A 2DM2A 5E70A 1BVKB 1NBZA 3ARTA 4X8JA 5C0JA 4XPGH 2P4AB 4KI5D 2F53B 2F53A 5CLTA 5KAQG 3UTQB 4J4PA 3MLTA 3HNSL 4KJQD 1KBGH 4OCWH 3QUMB 1LK2A 4OD3H 4MJ5B 1J86A 1ZANH 1P5UA 3JVGC 1MCDA 3RQ3A 3BZFA 5TPWH 2VZTA 4QF1A 3BPOC 5LWYH 2RHEA 1HQ4A 2XQYG 3BH9B 3F5WB 4RFOL 1Y18B 1XZ0B 3HS0B 5TDNA 2V2XB 5DVKA 2BSRB 1N4XH 2VQ1B 1MIML 3NAAH 1I3VA 5FM5M 2QR0B 4N90E 4OM1H 1JL8A 3IJSB 4LF3B 1EZVY 4Y5VB 3RUGE 2KPNA 4HIEB 1PG7W 1AQKL 3PXJA 1KC5H 2J7LA 4Z5RB 4TNVF 1T3FA 5DQDH 4XXDB 5F1NB 1G9ML 1E27A 3EOAA 5I1AA 4XNXL 4AYFA 1KN4L 4WHTB 4M3KB 3QO1B 2ESVA 1SM3H 2MQCA 2V5TA 4HKBA 4HPYL 4ZAKA 2IAMC 4X4YA 3WD5H 2CO6B 2Q20A 4J8RA 5FGBA 2IG2H 3Q6FA 4ZFFA 1W0WB 2OR8A 1MRCH 2BMKA 1RJCA 5F44A 2X1PA 1QG3A 5C0AD 1J0ZA 2VDML 4PRIE 3SDYH 3WIHL 1Q1JH 3LQZA 3QUZA 5EBLA 3EYUH 3O6MH 2B1HH 3TVMA 1KIRB 3JUYA 1OT2A 3MBED 3V52L 3QNXB 3L7FB 4MXVF 5KSAB 5F7LB 5CJBA 3W9DA 1YUHB 1ZK9A 3LEVL 4G8GE 2PTTA 5I1CL 3TT1H 1CU4H 5DVNA 1X3DA 4S2SB 3AS0A 3S3JA 1B0RB 3DTXB 4CKVX 1UZ8A 4Z76B 1U91B 3MO1B 1OTUC 2NY4D 1FE8H 2IH1A 2VERN 1CD9B 1BPVA 2PN5A 2Z35A 4ZODA 3MYJB 3QHFH 2VLLB 4IIQA 1X5YA 2YPVL 2DIAA 4HMEA 5A2KH 2B0SL 5D7SL 4RQQB 3KPNA 3LN9A 4Y7MA 3T0EC 3LKPB 4AG4H 1W72H 3WFBH 1QVOB 5T1MB 1AO7A 1EGJH 1EO5A 2R9HC 5C08B 3JWOL 4FMKA 2EKSA 3MJ8B 3JV0A 2E6PA 3B9KD 3L5JA 2GK0B 1AGEB 1RJZB 5L9DL 1AD0A 4PJ5A 3DVIA 1G7HB 3SCMA 3QNYB 5TJWK 2DDQL 4H8WH 3NCCB 2XTJB 5HHVL 3RA7L 1P4BH 3N1GC 4H0HB 4NQTA 4W4OA 4OKVB 3MBEA 1UG9A 3S96A 3SN6N 1H3PL 5DA4A 3U7YL 3C60D 1JVKA 4Q6IA 2AV7B 2YEZA 2EECA 1PY4A 2F53E 3CXDH 2RFXA 5E6IB 1T2QL 5E2TH 1BM3H 2R1YA 3MXVL 4OSUL 1IM9A 1CFVL 1KCSL 1VPOH 2HLFD 3Q6GH 5CEYA 2UZYB 4J7RA 4IOFC 1M7IB 3GIZL 3KPPB 3S3PA 2V5YA 3O4LB 2LV4A 3OAUH 5LGHH 4KTYA 3PHOA 3DUHA 2IANE 4X6BA 3SKOA 4LVOC 1KPRB 2P8LB 4QWWC 3EYSL 3BP5A 5MENE 2HG5B 3OR7B 4ETQA 3CMOH 1G7HA 3GJFH 4PJ5B 3CCHA 4GRWF 4L4VB 3ZHDA 4WFFE 4Y4HB 1JGDB 1MELA 3BE1L 1D9KB 4KRPB 5CBAB 3DSFL 4HW6A 3VMOA 4OZFB 4N68A 1UWEH 4G7VL 4PJEF 4JO2L 3RBSA 5L8LB 2P8MA 3BKJL 3ELAT 3MV7D 4ONGH 4XXCC 5JUEL 4ZFGL 5F96H 1YZZA 1LO5B 3EFFB 1U2CA 1NC4A 4ODVL 3H9YA 3P9MB 1KCLA 5A2LH 2W0PA 5SWZE 4X6BB 3L5WA 4YHPB 1DFBL 1M7DB 5D70H 3KPRE 2NW3B 3HPLA 1S7VA 1EMTH 3MCLH 3QUMH 1AKJA 3T65A 1T1ZB 2CSPA 5GRYA 4OLUH 1UXWA 4YHZL 2J2ZA 4FNLH 3SGJA 2A6DB 2WW8A 1J8HA 1JGUH 3QUZC 4HGKC 2C4FU 3WFDH 4ZOAA 4WWKB 1YN7A 5HVWA 1SHMA 1ZLSH 3QUKB 3FN3A 4M8VA 4FS0A 1CLOH 5HHMD 3GMQA 2WWMD 2PXYB 2CMRH 5H2BB 5EZJB 3FZUC 4JRYD 1I7RB 4LLQA 1EHLL 2YK1H 1YC7A 3QDJB 1L0XA 2XN9B 1SYVA 1BZ9B 1K8DB 3DVGA 3BN9D 4LCYA 1ULVA 5T3ZH 5EG6C 1F4HA 3GMRA 4Q9BA 3P77A 1JYNA 3EOBA 1NC2B 3UO1L 3D39E 1G7MB 1J8HD 1T2JA 1UB6A 4MJIE 4PJAA 1HHJB 2R15A 3H8NA 4JPKH 1NCAH 3K81A 3EO1B 1TQBC 3QCTH 3DHMA 1RVFH 2XZQL 3GJEA 4O58L 5GRZA 5JW4N 2BVOB 5I8EA 5ID1B 2BVUA 4YJZL 5HYEA 1HSAB 1JF1B 3JV5A 1ZWIB 5SX4I 1C08A 3FB6B 2C26A 1F00I 4OUUB 3C5SB 3E6FB 4ODXA 3ULUC 1KJ3L 4IDJH 2BDNH 5J4MA 4KAQH 1U3HC 4J3WA 3BZDA 1R3IH 2XYCA 2XKUA 5ISZE 2ZG3A 2K7QA 5IFHH 4I9WE 3O6KH 1ODAA 3NAAL 1RZKH 1GJIA 5E6ZA 4IDLA 1N64H 1FV1B 3ESUF 4U0QB 2IMMA 4ZQKB 1MREH 3IS1X 4GS7C 3ARED 2OL3H 3JV4B 3SKNA 3SDAB 5BW7C 3DGGA 3EOTH 5DC9B 4JDTL 1BF8A 3CFCL 2XTJD 1G9MH 3VFVB 2X70A 4XPGL 3BEWA 1DEDA 4AEHL 2FX9H 4GG8B 4HS6A 4Z7VE 3NFNA 2ICWB 1VERA 4PS4H 5IB2B 4P59L 2E8YA 2X05A 1HILB 5ESAB 1L6XA 1NAKH 4JFYA 3OJDA 1QBBA 4P0DA 4UILL 5J3HC 3ARBA 3VA6A 3SDCD 4EQ2A 5EZIL 5DJAB 3EHBD 4NDMB 4OZFG 5FYLE 5CCKL 3OKOA 1SJHB 2JCCB 3V5KA 3VWKA 1NEZB 5DJ2A 5HYJD 2IADA 2KDGA 2QQQA 2UWEF 5DD0H 1Q9OB 1SY6A 5LJYH 2EYRA 3N50A 3IT8D 4OZ4A 1UM5H 5FGCB 4DGVL 4HUXB 3P11L 2R23A 3NIFF 5GSRB 2YC1A 2YR3A 3ILQC 2GCYA 4I3GA 1A3QA 4PJ9A 4ZFOB 2GITB 4F58H 2EDTA 1KG0B 1Z0MA 5DMIH 2W0FA 3IDGA 4O2FA 5F3HA 5T5FL 4ZO9A 4HBCL 1UB5A 5GGQH 3GSRB 4QRPA 3KYMB 4XPBL 2HH0L 2OBGA 1Z3GL 4G43B 4KY1H 4Q6YA 1ORSB 1W0VB 5MEPA 3T04D 3HN3A 1QPPA 5C7XL 1F97A 1E4KA 5LBSL 2PYFA 3FRUA 3OJVC 4R90L 5I1EH 4J2XA 1YNTB 1G84A 3RFZC 1CFQB 5EU3B 3QJHB 3WUWA 5DD1L 1ACYL 1I3UA 1MCWM 4XCYB 1OF2B 3LN5A 2EDLA 4DQOH 2VUOA 3TZVA 4EBQH 2EEBA 3RKDC 3RZCC 5CD5C 2BNUB 4YAQB 4DQOL 5F7DB 1HSAA 2DQCH 1DLFH 4JG1H 5B39A 3VXRA 3VXSE 4CADA 1SEQL 3O45B 5SV4A 3BMVA 1ED3B 2GJ6B 2FBJH 4ZS6C 2UYLB 4H25B 2ZJSL 4JJHA 4L8BA 5DLMH 3IDJB 3LKSB 1AXTH 1U8JB 4O02L 4WFED 1FRGH 2ATPA 5TDPA 1LVEA 1OAYH 3NCMA 5CWSA 3SGEI 5BZDB 3MV11 4TSAH 3TBTB 1K85A 1BLNA 3PHQB 5D7JB 4BA8A 3UYOD 5HGHA 3GRWL 4NKIL 5TFSH 3BKCH 4YQXL 3I50H 4BH8B 2YHGA 3NABH 3FJTA 4GKZA 2DMCA 2PW1B 1NBYA 4LLWB 3D25A 3AB0B 5KVEL 3BKJH 1U8NB 5D6CB 1FIGH 3OGCA 4LKCB 3O2WH 4R8WL 3S37X 1X7QA 1NPUA 2CIIB 5FYLH 2ZKHL 4K3DL 5IOPB 1E4XI 4M62H 1Q72H 3R06A 1KT2B 4JKWA 3HFMH 4K2UL 1DVFB 5A3ID 5IR1B 4YHMH 2ADJB 5DS8A 2DYPD 3STLB 3O9WB 4E41B 6FABL 3OKLA 2XNAA 2BRQA 3TJEH 3KLDA 4V1DB 2YD5A 1FP5A 2AJVL 1D9KC 4MQ7B 5D1QC 3QDMD 1LEGA 3ZDYF 3ZT6A 4OI7A 4XXCA 2EIZB 2CKBB 4EZMA 4MAYD 1NFIB 4YPJA 4KROD 1GC1L 4BK4A 3IB4A 2YWZA 4XP6H 3FB8A 2Y4SA 4XBPB 3CCHB 1V3LA 3B6SA 5GJTL 2FJFA 5JW5A 5EOCJ 1P7KB 5I2IB 5E9DD 3WEXA 3JZ7A 3MMEA 5EB9A 2IF7A 3D25B 3GFUA 1NBYB 4LLWA 3VFNA 1IGFH 1MHCB 3Q0HA 4ORGA 3IYLW 4X4ZA 4PJ7B 4BH8A 4RRPA 2CIIA 2NZ9D 2VLJA 5CMAB 4OI8A 3I6LD 2WIMA 4HGWB 5A2JH 3MV7E 4MXQC 1R5VB 1HXMB 1X4YA 4N0UA 1Q9WA 5I18L 2YRLA 5E8NB 5I1DB 3MXWL 2DQHH 3TN0B 4MQXD 4PUBH 5DMJB 1VFAA 1LE5A 3HI6H 3ARDD 2XOTA 4U1JB 3THML 1AE6L 3MA9L 5BS0A 3QIUA 4H20H 5K9OB 5DWUL 2X4PB 1U9KA 1WLHA 3OR6A 4ZTPH 2FX8H 3BKYH 4P9MH 5F89B 2NY5C 5DK3A 1E4KC 3BHBB 3QIBA 5DEGB 4BUGA 3BWAB 1OSZA 1JNLL 5F7DA 3RIFF 4HH9A 3ULUE 4YHNA 3WUWG 3IGAA 1RUPL 3LB6D 3O6FD 1P5VA 4EIGB 2LVEA 2ZUYA 4R7DA 3ZDYE 4L4JA 4GW1B 5TF0A 1J1XL 5AEAA 1V7ML 4NNXA 4NT6B 2GTWA 3MYZA 4GRWB 5KSAC 4IRSC 1I1AA 1V7NH 3DYPA 4YGVA 4PGEA 3TT1L 3NCBB 3VFMA 5I1CH 1W8NA 1A3LL 4MCZA 3S37H 3TP4A 5K59E 3PGDA 4TVPL 1NGPH 4E42A 3GSRA 2AK1H 5CJ5A 4LCCC 1B88A 3EDEA 1G0XA 5KG9B 3FB5B 5C2BH 4XPFH 3BT2H 1I8IB 2AJSH 1CDUA 4PJ7E 2V2TA 5L6YL 5F1OB 5J6GB 3AXLB 4XAWL 4KHTH 4X6EA 4NNPH 5D71L 1VB9A 2I9TA 4M7LH 1IGML 4OV6F 9CGTA 3ZKND 1MY5A 5M7QA 1C16A 1F6FB 4QCIB 4ODTL 1L7TH 4YEEA 1IC4H 1RK0A 1AFVH 4NQCB 1YMMD 4TTDD 4U1NB 3FB7B 3SQBA 3QWOB 1Q94A 2IBGA 4G42B 3V6ZB 4AM0A 2CXKA 4L8DB 4CMMA 1BOGA 4MHHI 4GXUN 3QFDB 3ARBC 3EYSH 4K8RD 3L6FA 2LTQC 5HYIA 1T3FB 4E41E 4GO6B 2NXYC 3MUZ1 2FJGB 5C07B 1PZUB 1YEJL 4X6FA 1MEXL 2ERJC 3OJDB 3BPOB 1DQTA 3UTSE 3ZTNL 1NGZB 1JNNH 3E2HB 1VENA 3AREA 4GLRH 3FQUA 5DUBA 5BV7L 3FHAA 2OTUB 4M9PA 5IHZA 1HEZB 4PJGF 3DWTA 3OQ3B 1FFPB 3I50L 2EDFA 3TJEL 2R2BA 1A47A 2E3VA 2W9DH 1I8KB 5AUMA 1S7QB 1OAZL 3F7QA 3PP3H 1IM3B 4YHIB 2AXGA 3HZKA 5ITFB 3EUUA 1FNEB 1QRNA 3VE0A 3LMJH 5KSUB 4JVUA 4TVSa 1KPVA 3W9EA 3UDWA 2BVQA 4QHNB 2ESVE 4OJFH 2NX5D 1PLGL 3PGDB 4R0LB 1DQDH 3MRFA 2ZUSA 2V6HA 2F54E 5KOVC 3TNNB 4UINH 4LHUA 1OGAA 1AHWC 4Z7UA 5D5ME 3AMLA 3QQ3B 4PRPD 3DMMD 1EGJL 3GIVA 3QB7C 3M1BB 3MRMB 2XXMB 3MLPA 1LILA 1NANH 1IGIH 4IOSD 2PR4H 4KJYB 2XA8H 3ARFA 4L3EB 3LKRA 5GS2D 2FYYA 4UT6H 4XCCL 3D85A 4Y5YA 5ESVA 1YN6A 4JANA 5KTEL 5H37H 4WEUD 5CHNB 1A1NB 5KVGL 4Q9QL 2WP3O 3KR3L 4GRMB 5KSBA 5ID1A 5C0FB 2EDDA 2NY1B 4MLSA 4UZGA 4WNQB 3C87A 2E27L 4PJDE 4RMUA 2DBLL 2IH3A 2VO5A 4QYOA 1MWAL 2DTMH 3MRRB 2VLME 3QQNA 2B7DT 4MJIB 4L3EE 2BY1A 1P4LA 4XT1C 2D0GA 3TF7C 4K94C 5JHDD 3BH8A 2VZUA 3OKDB 2O5ZH 5ACMA 1YEHL 3D18B 3K8LA 5I66A 3VFTA 8CGTA 1K4CA 2HVKA 3WLWD 5AYQA 4GKSB 2OR7A 3CLFL 3P11H 1YEKL 4HGWA 3QXAA 1MPAH 5C0NC 3QUKA 5DFVC 4LFHG 1D5BB 5DD0L 4OCRL 2YA0A 3TV3L 2QADD 3UTTE 2ZCHL 4I4WA 2Y72A 4QWWD 3V6OC 5DSCB 4LLAA 5SWSD 5EOTA 3VXMB 3KLAA 2HKFH 1XCQB 4GRLB 4KVCH 4JFDE 3PGCA 1MAML 3O0RH 1X5LA 5B38A 3BP6A 3X14B 2NXYD 3LRSA 4P9HH 1DN0A 1BIHA 3ET9F 4L8SC 2EE6A 5IQ7H 3UBXB 1I7TB 2YD8A 1GZQA 4E41A 1HZHL 4PJ8C 2BSTA 4BSVA 1SMOA 4YBQD 1DQJA 3CVHA 5D1QB 1P84K 1EVTC 1S9WA 4NWTL 1B90A 1T66C 5IR1A 2MPAH 4OZFA 1DUYB 4UTAL 4MWFA 3T3ME 4APQC 4E5XA 2AABH 4XCFH 3VD9A 1MJUH 1RIVH 4M6NL 4KKCC 1BQLH 5DRZB 1J0IA 4WO4A 4Y19A 1KB9J 1NEUA 3FHQA 1HHHB 1N64L 1QSFE 2FH8A 3QISA 2QSVA 1KJ2L 1HH6B 3BQUB 1H3VA 3GKZA 2R0KH 2AK4A 4JRYE 5GXBB 5KW9H 2L7JA 3VCLB 2Y6SD 4NQUA 4NQDA 2FRGP 3MZTA 1YEEL 3PP4H 2P5EA 3H7BB 2QHLA 3KDMA 5F93C 3GNML 5I71B 3DV6A 1C7SA 1VFBB 3I02B 1LO3L 5DJ8B 2PW2B 2R4RH 1W8OA 3PV6A 3CFCH 5IK3A 3VXQA 3KWWB 4POZD 3U4BH 1T5XB 3G08A 4L3CB 2P5ED 1CBVL 3QA3A 4HPOL 1HHKA 2B5IB 5IVXF 5E1HB 3MV8B 5BZDA 4WEBL 1L9MA 5C0EB 4PGDA 3ZE2F 3QIBC 4F7EB 1CFBA 3DRQB 4TUJA 4WI9A 1YEKH 4GG6A 5D7LD 3PWJB 2DM4A 1N3NB 5GHWL 4CAGA 3BN3B 3OZ9L 3MFFB 2ZP0T 3P73A 5I9QB 1OARH 3S37L 1A6PA 4HXAH 4NQSB 4YHKL 5ESVB 1T6WA 3KHQA 3MYJA 4N5ED 2IPUK 3NGBC 3SDDB 3WLBB 4OLEA 3WHE1 3CSBA 1CCZA 4J12A 1T4KB 2X4SB 4W70A 2E27H 2AK4D 3MLSL 5F8RC 5BVJA 1XR9A 3C5JA 4RNRB 1FYTD 4PJIB 5ICXA 2DMKA 2ZOKA 1U8PB 3H6JA 4RFEA 3MRHA 1DSFL 4WO4D 4Y19D 3TNNA 1F4WH 1ZS8A 5CS7A 4PG9B 1Z5LA 4JKPH 3EYFB 3WS3B 3ZHLA 3QUZD 1FGVH 2NY0C 5CD3B 2O5YH 1G6RB 1IGIL 2Q76B 1A3RL 2AJUL 5BV7C 5EU4A 4PJ9B 1WTGT 3MRGA 3U1SL 2HTKC 2I07A 1W2KT 5I8CB 2MWCA 4NO2A 2R2BB 3U2SB 2EYRB 3D3VE 5DZOA 3U0TA 4EVNA 5GGTH 1MCEA 4X4YB 1SJHA 5C0BB 1N8ZB 5I1GL 4HWBA 4NQVB 3WXVH 4AJ0A 2CR6A 3LQZB 1U6AL 2RIKA 5IB3B 4YFEA 2YPLD 4FQXB 1LMKA 2ARWA 2FO4A 1TJHL 3EYOB 5I76A 1HHIB 4Z95L 5IEHA 2YSSA 3G5VA 3HMWL 3HE6D 1BJ1H 1D3CA 1OAUL 3L3KB 1EO8L 1CIUA 2FLRT 3HZYA 4L3CA 5HI5D 1ZLWH 4Z7OF 5J06A 2R1WB 1U3YA 3SDCC 4KK5C 4L8DA 1BGXL 3DGCR 3PV6B 4K94L 5IK3B 3NPZB 1TNNA 3D85D 4QEGA 1H5BA 2G9HA 2GFBB 1UM6H 2XTLA 4PGZA 5EO1A 4U1NA 4Z7WA 3UCRA 3X3FL 3SJVA 3EJZD 4PJXE 4XH2A 1XGUB 3ARVA 1RFDL 2MFNA 3VMNA 3Q2CA 1QSEA 2ZZUT 4X0KB 1D7FA 5D2NA 4XGZB 4Y4FB 3HB3C 1TDQA 3EDKA 3IDNA 1JN6B 2P47B 4POYA 2CRMA 1AFVL 3VI3E 5EU6D 4NO3A 2EDHA 4FABL 4MB3A 4Q9CA 4X0KA 5KG9A 1I7TA 3UBXA 1NMAL 4H26A 3NZHL 1IKFL 4LSUH 3QUXB 4F2MB 4PYHA 4PJBB 2Z31C 1PYWA 1FN4A 2NYYC 1MCSA 2OZ4H 2BVPB 4MCYA 5E0QA 4ODXB 3VXUA 4ZD3L 3U9PL 4CN6A 2HFTA 2XZAH 2IQAA 3ULUF 3HZVB 5C0AE 3TWCL 3RNKA 5FKAA 4PP1D 4MB5A 1NQBA 1S3KH 3DVNB 2Z9TA 3BXNB 1S7UA 4G8IB 2GJ6D 1F8TH 5E4EB 1CGXA 2DKUA 5A16A 1E6JH 4Y5YC 3A6BL 4JZOB 1F4WL 1OTSC 3P2TA 2A83B 5C08E 3IGAB 3VXRE 4XNMB 1FL3B 4YFLI 5DJ6A 1FVEB 1E4XL 2GT9A 3S34H 1JI1A 3D87B 4N90D 4YHOH 1RZGB 3V7AG 3KPMB 4PY8J 3MREA 1VHPA 2Y25A 3FFCD 4U1LA 5FYKE 2EYTA 3ZYJA 4OLZL 4NHUB 4N8CL 1A3RH 3VWJA 5E4IA 4EQ3A 3X12B 3O6LL 1I3RB 3FQWB 2VDOH 4P3DB 4MJIA 4XMPH 5DD1H 3DRTA 5D93C 1HCFX 4M1CD 4B50A 1BFSA 1HXYA 2KZWA 4JFHE 4U1LB 1XMWA 3GB7A 5ECJE 5I1DA 4HD9A 3DUUA 2ZCLH 4S1SL 1J8HB 2YN3A 2GI7A 4LCWB 4XP9L 2GAZB 4OD2B 1H8SA 1VGKB 3N9GH 4FFVD 2WUCL 4FXLA 1KFAH 4UQ2B 2UUDH 4JANB 1F6AA 3A6CL 2PTVA 4YDVB 1CXFA 1M7DA 3L5WB 4YHPA 1EJOL 3TYFB 4L3EA 4Y5XA 5DK2A 4UQ3B 3QULB 1YMMA 4XP5L 2BNRB 1EVUA 1KGCE 1XR9B 2CIKB 2E6QA 5HDLA 4HQQL 1W0YT 4CN1A 2HT3D 3SDDD 4G6KH 2Z31B 1R24B 3D2UD 4MSWA 5DI8A 5JR1H 3P0VL 5LCVL 3LEXA 4QRTA 2NY3D 2B4CL 4PYGA 1MVUB 4QXTB 4NQSA 2G60H 5AZEL 1Y0LA 2FEDC 3KYAA 4X4ME 3T0AA 5CCKH 4I2XE 3OKLB 3ES6A 1NSNH 5GS1B 3LS5H 4NN6B 3V79C 1LP9B 1NUGA 1MCRA 4TUJB 4OD3L 5IGXH 2F5AL 2FJHA 1CBVH 4Y4HC 2XWBB 2WQRA 1WWCA 5E95B 1D5IL 3L3HA 1EDQA 5L7XL 4L3ED 5CP7A 3QDGD 2ZUUA 2WBJD 1FFPA 2HA1A 4Z7VA 1ZT4B 4OZHA 1J10A 3F12A 5TH2A 5BS0D 1G7PA 2ITDA 4XZUA 3AS2A 3AREB 3EFDL 3GRWA 5E00B 2CUIA 5DJ8A 3RKDD 1RULL 4AT6A 4MNQD 3RZCD 1CN4A 3U30B 1KN2H 4I0CC 3S96B 1MJUL 5CFHA 4X9IA 1ZANL 5I1KL 2YRPA 1MFAH 3RI5K 3AGVA 2DD8L 4N8VG 3VWJD 3FCTB 3QIBD 2BERA 4JFFB 5H37G 1HHIA 4LHJB 3F62A 1HZHH 2X4UA 2ATPB 1DQMH 2APWA 3QWOA 5JLZB 3FL7A 4UIKH 4HKZA 1A1OA 4F3FB 4XPHL 1CGSL 1V5JA 2H26B 1WAAE 2FIKB 3RWGA 1YDPA 2R0LH 3K2UL 4GW4B 4MD4B 4KVCL 1YMHB 4KUZH 4EKXA 2OI9B 4N5EC 2HVJA 3U0TB 3QQ4B 4PJDF 4HKXA 3P0GB 2AJYL 5DR5L 5KS9E 2CLVB 1RIHL 1MWAH 2DTML 3NN8A 3QI9C 4ODBD 5I8CA 1FVDA 1FRGL 3SE4C 2JB6A 3RPIA 3E8UH 1BECA 3T0BA 5EOTB 3VXMA 4DVRL 4RA3A 3SPVB 3TBWA 4EDXA 2VXQH 3MNWA 4PY7A 4JPWL 5FGBC 4ZXBC 3CXHK 3PWUA 4M1GL 3WFHA 4PJBE 1ZVYA 3OBAA 3TBSB 4PRBB 1ZMYA 4QRPB 3ZDZF 3V5HA 4OQTL 1I7ZB 2YA2A 1Q9KA 1IGTB 3QNXA 4OV5B 2W0FB 4O2FB 3WFEH 4B7LA 1X9QA 4YHOL 1I3GL 1P69B 1UWXK 3TNMA 4R90H 2PO6D 4J1UA 1C1EH 4DAGH 3T2NL 5HHQB 1PY9A 25C8L 4EXPX 2AVGA 3OJMB 3VD7A 3GK8H 4XRCA 2A74B 3P73B 2OP4H 5GGSY 5B3JE 1QFUH 3FQRB 2IADB 4NN5B 2R0ZL 1AGBA 5FA3B 1KJMB 2ICCA 1MNUH 2Y23A 3EOYG 1JZ5A 3RUGF 2VISB 4UI2A 3X3GL 2XG4A 5BO1H 1PZ5A 4A6YL 4FRWA 4HIEA 3LQAH 4LRIC 4RIRA 5IQ9B 1EEYB 2CLRB 1QO3B 4UIKL 1XF4A 2LTQB 4P2OA 2VQ1A 1J05A 2VAAA 4S1QL 2Y1VA 3KWWA 4NQEA 1EAJA 2ZG2A 4AQOA 3GSVA 3DHJA 2AXFA 1WZ1L 5JW4Q 1ZTXL 5JIPA 5CGMA 4LLYB 1LO2L 4EI6A 1CTOA 1A9BB 3CMOL 3QEUA 5DT1L 2P42B 3JV4A 3SKNB 5F71A 4K7PL 2VLKA 1XF2A 3T3PF 3IETA 1ZLVH 4ZUWA 2JB5L 4BQCA 1ZT1A 1QLEH 1IM3A 3L3DA 4YHIA 5BV7H 4DUVA 4F15B 5BQ7A 5JDSA 3SGKC 4P48A 1XGYL 3CVHB 1JP5A 1D5IH 4HAFA 1I1FB 3TZVD 2Z31A 3BKMH 2VSCA 1FO0A 1CFVH 4R0LC 3V8CA 3MGAA 5SV3A 5ANMA 3V0AC 5CKGA 1T2QH 4QOKE 3RAJH 1JPGB 1WBXA 4M61A 3BW9A 2H32H 3ALWA 3FN0H 2BOCA 4CU7A 3HE7C 4QHMB 1KT2A 3ULVC 1WAAA 4C56B 4ELMF 2HT4C 3VWKD 4RIRB 2GY7B 4XMLH 5IQ9A 5DD6A 4UQ2A 2G75B 4XNZC 4L9LC 5ID0B 2EDJA 1TITA 5C07A 3WE6B 1OAQL 4LPWA 3O6KL 2BHUA 2ZUXA 1RMFL 1YY8A 5KS9A 3ARBD 5HYSB 3FOLB 1E6OL 1OT1A 4R6UA 3C60B 1X6LA 1T20B 4ZG1A 1HHJA 2YD4A 5I8OL 2EDRA 3C6SA 1E0OB 4OBRA 2HMID 2C3GA 4G8FA 4XRCB 3S9DB 3RNQA 4XAWH 3PWLA 3WXWL 3FFDA 5FYJU 2VDPL 1GGYA 4Y4FD 4XNZB 2H32A 4OIIH 4FP8H 1QD0A 1Q9KB 1FL3A 3LHPH 3MRBB 4JPKL 1NCNA 2AK1L 4ELMA 2R8SL 1U8KA 3MA7A 5DRNB 1YQVH 3QI9D 4YNYB 4EXKA 5JPMB 4BFIB 4DN3L 1WITA 4NWUL 5LAXB 3CLEH 2AEPH 3DPBA 1RZ7L 2HRPH 5A16B 5K9QG 5B39B 5MEQA 3HNTH 3IFPA 5GJSH 4PUBL 4CDGC 4G9FB 3QWQB 2WP3T 4LAJH 5IVOA 3D85B 4HAGA 15C8L 3LKRB 3ZE1E 3QDGE 2Z4QA 1NC4B 5D1XA 1F45A 2E6JA 1IC5L 2HN7A 4R2GC 3T4AA 2X4OB 4K3EL 2CLVA 4KTEH 3NH7L 4M8QB 1U8QB 3KYNB 1H9VA 3QUXA 1LWRA 2Q8BL 2CK0L 5DEFB 4JM2A 4N0FB 1Z9OA 3IVKB 1A5FH 4M93B 2VIRA 4X7TB 4U3XA 1YDPB 3GMMB 1I9JL 3L9RB 3MCKA 3QUML 2VZ1A 3G6DH 4KK6C 1S78D 4PB9L 3MRCB 5JO5B 4RFNC 4ZXBB 5TE6H 1A1OB 4OGAD 1JPFB 1F4XH 5I30L 4QHNA 1C5DB 4ZSOE 2APTA 1T0MB 3VXTA