3SDCC

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
191
Chain Sequence
b'TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC02
4ZOEA 2HVKA 12E8H 4JO2L 4KZEH 5ILTH 5IFHL 4H20L 4PRIB 5GRYA 4JO4L 4TQEH 1BF8A 5D1XD 4C83A 1FGVL 4M43H 2VLJB 3L7EA 1ZHLB 3MRPB 5C0FB 5I1LB 1QEWB 2W0LA 4NUGH 3MGAA 3FRPG 3ARGB 3V52L 4MAYC 4XZUB 5IEHB 1KCVL 2VKXA 2UY6A 3BD5A 4IRSD 4PJFE 4OIIL 5D7JA 2IPUG 1FZOA 5IVZB 2R4RH 2F54E 5E2TH 3UTPD 1A9EB 1A1OB 1AKJA 3WN5C 3T2NH 4LVHB 4YNYB 1BVLB 2EDJA 3DRQB 3MRKA 4EI5D 3P4LA 4TTDC 4PJGB 2BVOA 2HKFH 1QFWM 1ZVSB 3IFNH 1DN0A 3I3BA 1RZGA 4S0TD 4U6XA 5EC1B 2J4WL 3C08L 5B38G 3OGOE 2P5EA 4DN4H 1QO3A 3AREB 3WIIL 1U8HA 1FCCA 4PP2A 3VWJA 3V5HA 1RD6A 1Y18B 3P0GB 1MPAH 5HHME 3VGHA 2NY1B 2EH7H 2XPGB 4H1LA 4M93B 4XHQA 3BKYL 3G6DH 4XCCL 3JUZA 3VD4A 2EICA 3ARGC 5JOFA 5BV7H 1EZVX 5C0GB 5EN2B 3MSPA 1XGPA 4TNWF 5DC4B 2H2PD 2C26A 2ESVE 1PKQB 4HX1A 12E8L 4KZEL 3ES6B 5ILTL 2B5IB 3BHBB 1FP5A 4LVHC 1A6TA 1BM3L 3MOQA 3E3QC 1SEBA 4TQEL 2FO4B 4PRIE 1UEMA 4NO0B 4U6TA 5TE6H 3VXNA 3DARA 1DBJL 3D48R 4M43L 1I8LA 5MENB 3MJ7A 5INDA 5HD8D 2VLJE 4ODXA 3KPNA 1OHQA 4NUGL 5D7LB 2XWJA 5CCKL 3QPQC 1PQZB 5MHSE 2VZ3A 2ZUTA 3RI5K 5TFSH 3AREC 3RJQB 1G9MC 2R0KH 2R4RL 3ZYJA 1I1AA 5EU3A 1FDLH 5AYQA 3T2NL 2NY1C 4IIQB 5GISH 4M93C 1A6AA 4OF0A 4P2QA 4UUJB 3E3QE 5H2BB 1FFOB 1NLBH 2H3NA 3DSNA 4PJGE 1KPVB 3IFNL 4P57B 4MVBC 3BUYB 4NM4H 4P46D 3VU2A 2ITCA 4RQQA 1QLRA 2GJ6D 3OKKA 1ORSA 4K7PH 2B5IC 4DN4L 5F9OH 2V9RA 1TMCB 5DJ2B 1BF2A 5D9SA 2BNRD 4X4ZA 3FFCA 4BUGA 5F7UA 4E41B 1MPAL 1YPZF 1BPVA 1FPTH 1HDMB 4PJIA 5KSBB 2EH7L 5B38B 3TBSB 3G6DL 3HRZA 3GSRA 1FNEB 5BV7L 2BVPB 3X3GH 1F4HA 4FQQB 1PKQE 3RA7H 1HINH 4IIQC 4WWKA 2IGFH 4K55A 3L3JB 2ZPKH 2X1QA 4YE4H 2X4OA 3LDBB 5DMKA 1N6UA 3ZO0A 2ZUWA 5TE6L 5J6GB 4XAKD 4YAQB 4Z7NE 5JDSA 5MENE 1WWWX 5KANI 4EQ2A 1B9ZA 1A7PH 1QRNA 4JAMA 2BRRH 4GXUM 5D7LE 1XR9A 1Q9WB 3HE7D 4OCRH 3KPPA 5TFSL 2CLVA 3KYAA 3MRLA 4NQXA 2OTUA 2R0KL 5CIPH 4IEFB 3EYUL 3PV6A 3FB6A 4L8BB 5K9QG 1FDLL 4PGJA 5GISL 4HFWA 1M7IA 3BP5A 4H26A 4IRJA 4D0DB 3TO4B 4J7RA 1BREA 1JHTA 1NLBL 1I4FA 4QHNB 4OZHB 3TESA 4NM4L 2AEWA 2C3HA 1S7XB 5HDBE 4YR6B 2XXCB 4QRUA 4QRRB 4R7DB 4QGYA 5DC9B 4K7PL 3SGEI 3C5ZA 2EXWC 5F9OL 3GO1H 1R5IB 3EO0B 5I0ZA 4FABH 3KLHD 4PJHA 1L0XA 3LDBC 3OAZH 5BQ7B 1FNGB 4YGVA 1U3HD 1IGTB 3SCMD 3MRGA 1FPTL 2YPLB 4E41E 1U58B 5KSBE 1S9XB 2Y7QA 3ARBB 5CINH 4V2CB 4Z7QE 2NYYC 4NFCA 3HN3A 1JTOA 1G7PA 4NCC1 1KOAA 3W2DH 2OJZH 4FQXD 3X3GL 4G9DA 4NDMB 1JL8A 3O4LB 1CIDA 4DJMA 3T0WA 1YEIH 4HIJA 3QG7H 3RA7L 1RIVH 1HINL 2IGFL 4PG2A 2ZPKL 3ZYZA 2E8YA 4YE4L 4CVZA 1JPFA 1EO7A 3A6OA 3TO4C 3MNWB 4XGZB 4P49A 3EFDH 1JYVA 15C8H 3CLEH 4MD4B 4H25A 1A7PL 3O9WA 2BRRL 3F5WA 1BFOB 1G7MB 3VRIB 3VG9B 1INDH 3MC0A 1KN4H 3HS0A 2EDFA 5E8EA 5FKAA 2FEEI 3MRQA 4OCRL 5F21B 4UT7H 1WZLA 3DO3A 5C92A 2BOCA 3B4NA 4X8JB 3WFBH 4KTYA 5CD5C 4E42B 1XF4A 3ARBC 4P5MB 5F7HA 2R39A 3DURA 5GXBB 1JWUA 3E6HA 3EKCA 4Z77B 4OZHE 5E8NB 4QY8A 1K8IB 2EIZA 1WC7B 2DQHH 2BCKB 3GO1L 4FABL 2FZ3A 3QH3B 1Z9MA 2QQLH 4YDLB 5DDHB 4EI6B 4GG6A 3P9MA 1P7QD 3TA3A 1X5LA 3V4VH 2Z31B 5CINL 1KTRL 3VG9C 4WW2B 4UV4H 2FX9H 4Y1AB 3W2DL 2OJZL 2CKBH 1J8HB 3DROA 4HDIB 4JRXE 5AZ2H 4HJ0C 1AO7A 4FFYH 3RVTD 5IB1A 3GKWH 1MCIA 1ZLWK 1YEIL 1DEDA 1CE1H 2NLJB 3O4LE 4XNMB 1IMHC 3QG7L 1RIVL 4G8EA 4S1DC 5JW4R 1MCWW 4LLDA 4QRSA 5GZNC 3T1WA 4PBXA 3C60D 2A0LD 1EHNA 3W11D 2BC4B 1LE5B 3QBTB 3EFDL 5DMIH 3QZWB 15C8L 2OSLA 3CLEL 3V8OA 4EZMA 3EJZD 1X7QA 4MJ4A 4RISH 1W72B 1INDL 1R3LB 1KN4L 1NBYA 2Y72A 4IOFD 4UT7L 3EYVB 2ENSA 3WD5L 5E8PB 3MUGB 4YDLC 4HUVA 2JJTC 3P30H 3HB3D 2XXMB 4OZGE 3WFBL 3VXTA 1U8IA 1QSFB 4I0CC 1NFIB 2EC8A 2Z31C 1T1XA 3D25B 4WW2C 1EEQA 3SQOH 2NTFA 1HYSD 1QD0A 3DNKA 2WMPA 3RWFB 5FM5M 2YPVH 2NY3D 1H15B 1U6AH 3QJFA 3EIFA 2DQHL 4NNPL 4OCLC 4U1KB 1YMMD 5T1KA 4LSRH 1YJDH 3NZ8B 2QQLL 3S35X 4W6XB 5ERWA 4NQVB 5DK0B 3DXAA 3SDXA 1T0MB 1BX2B 5D5MB 3V4VL 1XIWB 1XGQA 4AY0A 4UV4L 3CJJA 2FX9L 3WIHA 4KXZI 3S4SB 5GGUB 5C0CD 2CKBL 1UQSA 4GAFB 4P5TB 4Y1AE 5AZ2L 1J8HE 4KMLB 4FFYL 1F3RB 1UZ8A 1XGTB 1CFQB 2CUHA 3GKWL 4EXPX 1NCNA 3P4OB 4NN5B 1CE1L 4ZFZB 4KI1A 2YD1A 4CU6A 5A3ID 4MXVF 5JHLH 3KPMB 1G9NH 4RNRB 3GEWB 4B7LA 2EEDA 4NJAH 3VE0B 3LN9A 5K9JH 2LQRA 3DVNB 4QXTA 5E6ZA 5DMIL 5CEYB 2PR4H 2H32B 3DX6A 4W4NA 4N68A 3GJFB 1DE4A 4RISL 3WXWH 1KXQE 4EUPH 2AP2A 5F96H 3QUKA 2YD3A 4ALAH 3U4AA 3VRLF 4NO3B 1QUNA 3ETBF 1WBZA 3BXNB 2FEEL 3P30L 5JPMA 2YA2A 4L8DB 1AD0A 4WW1A 5HYEA 1RMFH 2J8OA 1QSFE 2I07A 2RCSH 1XIWC 3ULVC 5IW1A 3QEGH 1Z5LB 1RJYA 4J8RA 1KIRA 3SQOL 1X6NA 2RGSA 4P5TC 3ULUH 2CDFB 5K9KA 4LOUD 4ZFOL 3BD3A 3RZCA 3MNZA 5B8CB 2YPVL 4NN5C 1U6AL 2AXJA 1HXMB 1UB6A 1IM9D 1SVCP 4LSRL 1U8KB 2YKLH 2OR8A 1UCBH 4QRPB 4UDTA 3UTQB 4PS4H 4BSVB 2YEZA 1F02I 1FL5B 5FXCH 3HZVB 5D5ME 4AH2B 3ULVE 4IOIB 1RHFA 2VSCA 4JDZB 3MBEA 4XP5H 4YHPB 3RIAK 3UTTA 1S7UB 3PIQA 5IB2B 5KS9B 4O2FA 4CNIB 3U4EA 3P9WB 1LO0L 5JHLL 1H8NA 3CXHK 1G9NL 4YPGB 3O6FD 4U3XA 5K9JL 4XNQA 1KIUA 1CGTA 1GSMA 1A6ZA 2PR4L 2DOCA 3UBXI 2B4CC 3WXWL 5B8CC 5F96L 1YEJH 5DA4A 3TN0A 1ES0B 4EI5B 5ACZA 4ALAL 3TPUA 3ILPA 3X12A 4PJCF 3TNMA 4ETYA 2EDKA 4CAGA 1T83C 2UZIH 1RMFL 2Z8VC 2RCSL 5CZXC 4Y4FA 3QEGL 1EHLH 4L4VA 4MS8D 4GMSH 1L0QA 2DWEB 3TCXA 3ULUL 3RWIB 2PTUA 1A0QH 5ISZA 4IMKA 3BESR 4JFDA 1F4WH 1CU4H 3BZEA 4YFEA 1WZ1H 2GCYB 2YKLL 3AROA 4HWBA 2GUOB 1U92B 1UCBL 2VZSA 4MYWB 1S3KH 1Y0LB 4TRPH 4PS4L 4PBWD 4C54A 4UINH 4UNUA 3OMZA 5D6DA 4R0LB 4WI9A 4D2NA 5ID1A 2DB8A 5GRVK 1KB5A 5L8KB 3H0TA 4XP5L 4KKAD 4EI5C 2XWBB 1EXUB 1HHJA 2UVEA 4GXUN 2WQRA 3HRPA 3WHE0 3QEQD 5KS9E 3PNWA 3HCVA 2Y6SC 2ICEB 7FABH 3CUPA 5IVXA 3FQXA 1NEZA 3HMXA 4N9OB 3REWA 4U05A 5TDOB 3STLA 5DTFA 3G5YB 4L8CB 3SKNA 1UH2A 1E4JA 1NGWA 1X5XA 1V3KA 3VFMA 1HI6A 3R06A 2ZP0T 2X4NB 2EC9U 3L3OB 3UTPE 3T65A 1YEJL 4N8CH 4Y7MA 1GIGH 3MRIA 3CFKA 3FO2B 1IEBA 1X5KA 2C1OA 5F44A 5C0AD 1JV5A 3F8UB 1NPUA 4O58H 3IB4A 3VRJB 4P46B 2UZIL 1CVRA 2H2PC 4G8FB 3QEHB 1YNTA 1U8QA 1TVBB 4S2SA 5JHDA 4R0LC 1EHLL 4GMSL 4U0QB 4Z78A 4PP1D 5K33A 1E4XI 4WV1B 4YWGH 1A0QL 2BNRB 4HKZA 2HA1A 1MCRA 3ARYA 4BZYA 5F8RC 2J8UF 5CZVH 4QTHB 5HD8C 1C1EH 1OTSD 1F4WL 1ZLUH 1RK0B 1CU4L 1WZ1L 2O93L 1IGJB 2O5XH 2XI9A 3GSNA 3QULB 3L3KB 5D7JD 1S3KL 2R56H 2Y5TB 4TRPL 1CXHA 2P8PB 3V0WH 4BJLA 1KLGA 2WBWB 4ZUVB 1AKJD 5I66B 1U42A 1T3FA 1U95A 4RDQG 4UQ3B 5F89B 3SKOB 1RIUH 1AXSB 3CSPA 1MHHB 2I9TB 3PGDB 1P2CA 5C09B 4FFVD 1M71A 3KXFA 3BX7C 4RGOL 3QQ4A 2GFBA 2R2CA 4ZTOH 1LGVA 4LCWA 5DD5H 4HS6A 2VL4A 4P46C 4PJ8A 1NEUA 2P5ED 1F6FB 2N7BA 3S34H 4O2CB 2QJDA 1XR8B 3QIUB 2PKDA 5D7IF 4F33B 4N8VA 2ORBH 3ULSB 4WV1C 5IMMA 1HYRC 1MFCH 1SY6H 5D1ZD 1ZWIA 2F74B 4LPVA 4RBPH 5SWZA 43C9B 2ZG1A 3MRFB 1Q9LB 4R2GD 4N8CL 1FYTA 4F8TA 5HGBA 1GIGL 2AKRA 1FNFA 2HLFD 2MCG1 3S5LG 3PF2A 3UEZA 4O58L 2XIDA 4X8XA 1FZMA 3VFWB 4OZFH 3S88H 5IMKA 5HYJA 2CSPA 4DN3H 4YWGL 1T2JA 4WI3A 3TCLB 4PRAB 2BNRE 4JGUA 1U3HB 4AIXA 5CZVL 1C1EL 4FZ8H 4M7ZB 4ODTH 2O5XL 4XCYA 1I1YA 1QR1A 3D69A 3FQTA 1T7YA 3ZKNC 1HK6A 4GRLA 2VZOA 3QIUC 2R56L 2YD5A 1N5YL 3CU1A 3V0WL 1I1AD 2BVUA 5J1AA 5LXGH 3WO4B 5CSZA 2VH5H 4P2QD 1RIUL 2EYTB 1TCRA 3C5SA 5ICXB 5C09E 3MXVH 3WDHA 4ZTOL 3QUMB 4XAKE 5DD5L 3O2WH 1W0WA 1K85A 5L2KA 4XXDA 4LLQB 3IJHA 1EK3A 3S34L 4I48A 4FS0A 3RX5A 1K8DA 3O3DA 3NBNA 1XF2B 2ORBL 3FFCD 5EO1B 1W8NA 2VZUA 3M17A 1MFCL 1SY6L 2WQ8A 5DJCB 3DIFA 1INQA 2GJZB 2VLRB 1T4KB 1FC1A 1U3HC 3ESVF 1PX4A 2FSEB 5FAAA 2HRPH 4M7ZC 1S7TA 5JNYB 2P7TA 4RMSA 2W9DH 2BMKA 5TGBB 1RU9H 1PSKH 5DRWA 1A4KA 4GKSB 1WBXB 1JNHA 3S88L 1SVZA 2VDLL 3WO4C 2PTTB 4OKDA 4PB9H 5E94A 2OTWB 3L7FB 3GBNH 3WO3B 1FL6B 4D9LH 4NOFA 3LKNB 4DN3L 5IT2H 3S5LB 4L3EA 3RP1A 3UZQA 5DRXA 2Z4QB 3NH7H 2VXQH 1P7QB 5EPMA 4FZ8L 4ODTL 3N1QC 3ZTJG 2PCPA 1MJ7H 3ET9F 1BEYH 3U0TB 3GMLB 1RZKH 4WI5A 5LXGL 2VH5L 3T2QA 1IT9H 5E7FA 4IRJD 2DD8H 3DUUA 1HSAA 4UDUB 2PETA 3OB0H 3W0WD 3QQ3B 3MXVL 5DFTA 3G5VB 1BIHA 3O2WL 4AIZB 5KW9H 3C5ZD 1WITA 3DLQR 1MCSA 1OT2A 3JVGA 5EU5A 2FLBT 3K74B 2XWTA 3ME0A 4UTBH 3JUYA 2ZUVA 1QRKA 3GMNB 5F1SA 2VLRE 3AXLB 3BP7A 4EBQL 3P9LA 2R2EA 1TZIB 2HRPL 3CNKA 3O2DH 3RI5F 4JVPA 1TTFA 2W9DL 4JRYD 5IWLA 4NKDA 1RU9L 1PSKL 3RVTC 5DJAA 1HCVA 4CMHB 1ZVYA 4X0KA 4PB9L 1CICB 3GBNL 4OZGF 2QSCH 4JQVC 4D9LL 1YMMB 5IT2L 3C8HA 5D71L 1IGYB 2A0LC 3W11C 3KLAB 4LRIA 5IP4A 5D70L 3O9WD 2VXQL 5FOBA 4Z7OE 3F6LA 1Q9OB 1KIQA 1I1CA 3B2VH 1MJ7L 1T1WB 4WEMB 4H5SA 5I1IH 1BEYL 4OZ4A 1KJ2H 3VXOB 4IOFC 1CDYA 4QRQA 1RUPH 3OKNB 4LHUG 2WP3T 1RUQH 1IT9L 2G75B 2DD8L 4CW1B 4HMDA 1E0OB 1U8NA 4HAFA 3RUGF 4L9DA 4WW2F 2DIBA 5FYKU 1QA9A 5L8LB 5JIIA 5KW9L 1A2YA 4JM2D 3J8F7 4CMHC 4NOBA 5AAMA 2P48B 1ETZB 3EDKA 4PYGA 1MHEB 1RUAH 1CICC 1NUDA 1A9BA 3MACH 4XTRC 3BI9X 1F58L 4UTBL 3DX7A 1OB1A 5TDNA 5AEAA 3WE6B 3ZDXF 5EU6A 3HNSH 1MSPA 1QFWI 1FBIH 2WLYA 2Y4SA 3WFHA 3TA3D 2JF1A 4Z9KB 2BHYA 3O2DL 4JKMA 5TH2A 3WS3A 5FYJD 4X4ME 1CXEA 1AO7D 1MRCH 4NKOA 1XEDA 5LG1A 5INCB 4F7EB 4W68A 5DRZA 3VXUB 1CDJA 3WLWD 2F58H 1OAZH 4AENA 1QBBA 5JPNA 2P24B 1AC0A 3ECBB 1ZHNA 4P9MH 3LKPA 3S96B 5D72H 3V7AG 1VADA 4M1CD 2ZG3A 2QSCL 3HI1A 3O11A 4ZSOB 4PTTB 3MRBA 3FMGH 4RMUA 1T20B 5HBBA 1YMME 4GLRI 1DQMH 2JCCA 4PRDA 4HUWB 4ZDHA 1MUJB 1CGSH 4PGZA 5IG7A 1HE7A 3B2VL 3ORJA 2D4DA 1Z9SA 4PBVC 5I1IL 4CVWA 1KJ2L 1U8LA 1CFNB 4R4FH 3EW3B 3OG4B 3TM6A 5E2VH 1CG9B 1UZ6E 3OR6A 3SGDH 1RUPL 1I3UA 3M45A 1LK2A 5I15H 1RUQL 3RWCA 3FT4B 1PAMA 2BFVH 1ZANL 2FIRT 3N1PC 2VDOH 2ICWJ 2NR6D 5I1EH 3L9RA 3OJ2C 5HDOA 2VAJA 3O6FB 1B0WA 1IAIM 1AGEA 1RK1A 3FKUS 4OF7A 3ROOB 3EO1A 3KWWA 4PV8B 1R3KA 4LHUB 4P5KB 3T0VA 2P42B 5IM7A 4PG9A 3VFTA 3L5IA 3W81A 1FYHB 5T1KD 1RUAL 3QO0B 2CXGA 4LKCB 4DGYH 3MACL 4M61A 3VG0H 2A6IA 2CQVA 3CDFA 1J7VR 3QXDB 4I0KA 3VFVA 2NY2D 1J0HA 3FCTA 4FHBD 3DXAD 3HNSL 4U1SB 1I3GH 4WHYG 1A7BA 3TIEA 5DJXB 1FBIL 2ERJB 4OF6A 5F3BB 5EU4B 1HHGA 4WDIA 4QHKI 2X89D 1D7FA 2UZYB 4NUJB 1NFDB 1LDSA 1MRCL 4XAWH 1T7ZA 4QWWD 2IBZX 3KPRB 2P8MA 3MJ9A 2F58L 1OAZL 2UWEA 1GZQB 4P9ML 5I8OH 5D72L 1NBZA 2BERA 1OAYH 4XXCC 2O5ZH 4HEPG 2YZ1A 4WO4A 3FMGL 4ZSOE 1Q94A 4FOMA 3MLTA 2BHUA 3UTOA 1DQML 4P3DA 1BIIB 3O6FC 5GGSA 2QQKH 2FL5B 3PHOB 1K3ZA 4LVOB 4OV6F 4OLZH 3HAEA 3BJ91 1CGSL 2EECA 5IVNA 4KU1A 4HBCH 4ISVA 4OF5A 4X7TA 2I24N 1G0YR 1RFDH 1JZ7A 3CH8A 4LNVA 5GIRB 4R4FL 3MGOA 5E2VL 4MA1B 2EXYD 3HI6H 2ERJC 4KDVA 5I15L 2X42A 4JJHA 2BFVL 1EGJH 1Z9LA 2VDOL 4KV5F 5I1EL 4MJ6B 5GGTA 3ZT5A 1ZT4A 3EYFA 4MS8C 1OP3H 3W5NA 4MHHI 3HPJA 3ZE2E 3RZCD 2ILLA 3X13B 3JWOH 4JFEB 4HIHA 2N4IA 4DGYL 3IF1B 2GSGA 4XBPB 5E8OA 3VG0L 5A2LH 1D5BA 3IDIB 3VFSA 3TJHD 4LLYB 4ZPTB 1I3GL 3IGAB 2JJVA 3O3BB 4LSQH 1AGCA 4LVOC 2HTLC 3PUCA 4GRWH 3BW9A 5FYLD 5DO2D 3FO9A 3UTTD 4XAWL 1NFDE 1XMWA 4W6WB 1OARH 4C83B 1V7NH 4KKAC 3C9NA 4MA1C 1QSEB 2JE8A 4K3DH 4BH7A 4OLWH 3Q3GA 3LEYH 5I8OL 1RZIA 2GTZA 3GMPA 3OR7B 5GS1B 1RUKH 3TIDA 3AB0B 2K7QA 3FQWA 4O5LH 2QQKL 1XGUA 2HFFA 3LKSB 4OLZL 4NNYA 1CXKA 5ACMA 4HBCL 4N5UA 1PEZA 3TN0D 5C2UB 3FB8A 1S7RA 5DVOA 1MLCB 4Y2OA 3VH8A 1RFDL 1J86A 2Y07L 3SDDA 1BVKA 4HWNA 1CT8B 3HI6L 2DAVA 3C5JA 3BH9A 3QEQE 3H2WA 2EDNA 1EGJL 3V6FB 2C4XA 4L4VD 2YN3A 3S36X 2CIIB 4G9FD 5MERA 3HA0A 5DLMH 2CLRA 2WIIA 1U8HB 3MR9A 3DMMA 4PIRF 4E0RA 1UH3A 2IQAA 5ISZD 4Y8AA 3JWOL 4K94H 5D1ZB 5H35B 2W92A 5C8JA 5D6CB 1H0DA 1ADQH 3W9EA 1A14H 2ED8A 5GS1C 4XMPH 5AWNH 5IF0B 3D18B 3AB0C 5C0IA 3G5ZB 4EKXA 4LSQL 5DZLA 1A3RH 2EDDA 3ALPA 1C08A 4UB0H 3WUZA 1TCMA 3KNBA 4RFOH 3SQBA 4HX1B 3TBVA 4EUPA 4GT7A 4B0MM 5DSCA 5TDPA 1EA9C 1KT2A 4APQB 2ZKHH 5BS0A 1V7NL 1CQYA 3TP4A 4K3DL 4FFVC 1QSEE 4QHLA 4OLWL 5FM5O 3LEYL 1WIPA 3UJTH 3L1OH 4JGMA 2BY1A 1RUKL 1RQ5A 2DQUH 3OKMA 4JPWH 4LSTH 4O5LL 1MWAA 5E5UB 5I1KH 5HXMA 2ICCA 4DAGH 1IEAA 1XZ0A 5D1ZC 4KQ4H 4GS7B 3MRRA 1CL7I 2DQFA 3MRDB 2FECI 3LHPH 2ARJQ 4HUUB 2HLFC 5EOCJ 4MXQD 4RQQB 2AJXH 5IB4A 1I8IA 4WNQB 1A64A 5JHDD 2FYYA 1ORSB 1OM3H 3RIAF 4PJXF 2VTFA 1MFNA 4APQC 4LLMA 4R4BA 3HTLX 1YYMH 1I8LC 4K94L 3SKUD 1HHKA 1FG9C 5CP7A 1ADQL 2NNAA 4KRPD 1A14L 2MHAA 3GSRB 4XMPL 5AWNL 1T7XA 1KGCE 2XACC 3DRTA 2AJZB 1AGDA 1A3RL 1KBGH 4UB0L 2J88H 5IJVA 3CC5A 1U36A 3VXSD 2IAMD 4RFOL 4C55A 3CXDH 4BKLB 4ZD3H 3MRJA 2Q76B 4GS7C 5CEZE 4Y89A 4R96A 5IKCA 4Q9QH 2X4OB 2ZKHL 4HHAA 3TNNA 3IAGC 1OW0C 2V17H 4FG6D 4ZAKB 4OD3H 3S35H 4O51B 3G04B 4PJDF 4PJ8D 1HQ4A 3QNYB 4Y4HA 2DL9A 5CD3A 1L0YA 3L1OL 3OGCA 1GGYA 1VFUA 2VERN 2QV2A 2X4PB 2EDBA 4KJYA 4C4KT 5J4MA 5IV2A 1MLBA 3CFJA 1CDBA 2DQUL 5IMOA 3VGGA 4JPWL 5FUCC 4HKBB 4LSTL 3FN3A 4ZS6D 5I1KL 1GGIH 1MFEH 5SWZD 2XY1A 4M6AA 3PV6B 3RTQB 3WNLA 4POZD 4KQ4L 4PGEA 4K3HA 4QXUH 1FYTD 3IDGA 2DWDB 2KUTA 5F1KC 4OD1H 4HFWB 4MX7B 4LPYA 3WFDH 4X9BA 3LHPL 1MAMH 5SWSD 1JHTB 1OP5K 2AJXL 3W0WB 3BP4B 5HYJD 1PZ5A 4QRUB 4QHUB 3C5ZB 1OM3L 2WM0A 3RZWA 5ELIA 4MNHB 1XT5A 4PV9B 5FUCE 4YLQT 3MJ8B 1YYML 4ZAKC 1WWBX 3BO8A 1UWXK 4FMFA 4GRLD 5C6TH 3N85H 2AV1B 3G6JB 4MLSA 4U6YA 3W39A 2QADB 4YUEH 4JRYB 4G9DB 2JELH 5DHVA 4H8WC 3DJ9A 1KBGL 4KI5F 2J88L 5KSAA 5F7NC 3RTQC 1MCPH 1EO8H 1GPOH 3CXDL 4HIJB 4Z7VA 4U1HA 4ZD3L 1ND0B 5F7DB 1T5WA 5DMGC 1KULA 2J6EA 1A02N 3HR5A 4OT1H 1ONQB 4Q9QL 4KROB 2V17L 4ODBD 1OTTD 3S35L 2MCPH 1C12A 1GZPA 1GYAA 2X7LB 1IGFH 3C5ZC 1WZKA 5E8EB 5F1OB 4QOKA 2VKWA 1H5BA 4FFZH 1GGIL 1MFEL 4LRNL 5KVEH 2XN9A 3WLBA 1D5MB 1S5HB 2XNAA 3ZKSD 3I6GB 4QXUL 4EN3A 2XZZA 4LPWA 3HZKB 4ZO7A 1XAUA 2EO9A 4OD1L 1RJZA 1XF4B 2UUDH 3IJYB 4F37K 3WFDL 4OBSA 3DURB 4HS3A 1MAML 2L7UA 1I3RB 5I30H 5FUZH 2QADC 3SBWA 5J6HA 3CPLA 5TPWH 1F11B 3GZKA 3W0WE 5DZNA 3BZ4B 4JM2B 4WTZG 1P84J 5H37G 4JZOB 1JWMA 4KROC 4L3ED 2OX5A 2W38A 1Q9KB 4G6KH 4M8QA 3RVUD 1D5XB 1FNAA 3BWUC 4NP4H 5GSRA 2MKLC 5C6TL 2Z91A 2VDNH 5A43C 3N85L 3DVGB 2P8LB 1UB5B 3DX9B 3G6JE 4YUEL 1I8MB 2VAAB 4JRYE 1YMHA 1VA9A 4K3JH 5T3XL 1XCTB 5DD6A 1AQKH 4PRPA 1MCPL 1GPOL 1EO8L 5IEKA 4G8EB 4ZS7H 5FA3A 4OT1L 2JTDA 1CGWA 5BVPH 2ADGB 5SWQA 2HTKD 3BEWA 2OSLB 2MCPL 3K46A 1CFTB 4HWZA 3O2VH 1IGFL 4JM2C 5F6HJ 1KJMB 5LBSH 3WKNA 2DMBA 4LARH 5AG8A 2O61A 4FFZL 3LQZA 1FSKB 5KVEL 2V7HA 4JFQA 4Y16D 3O8XA 5E99H 3MLPA 4B50A 1UJ3B 5I8CA 3GJEA 2FCBA 4JJ5A 3F7VA 1YEDB 4JFZH 3MCLH 5I30L 1C8PA 1T66D 1PYWA 5FUZL 5DGQA 2FJFB 5BOPA 5TPWL 5CKAA 2HFTA 2HP4A 5I8KH 3WLWC 3FONB 4OI9A 2IADA 3TBYB 5E95B 5E6YA 1NCDH 4PLJC 3VI3E 1JP5A 5EBWB 5C0BA 1VDGA 3IDNB 4G6KL 4NO5A 2A73A 4JFOA 4NP4L 4ODUB 1JZ4A 5HGHB 1Z0MA 3UXFA 5EOCH 1TVDA 2VDNL 4ONGL 1UQSB 2CKNA 5M95B 4WFHE 1W8OA 1N8ZA 1FSKC 5C0EA 1BAFH 1OAUH 3OAYH 3CZFA 4K3JL 3VW3H 3KYMA 1UVQB 3QDGB 3MZTA 1D6VH 1MJ8H 1OCWH 1UJ3C 4ZS7L 2I60H 4KWUA 1E4KA 3KYOB 4FNLH 5BVPL 2D7TH 3KYNB 2NR6C 4L5FH 3LRSA 4XP1H 4OF3A 4Y4KB 5ESQB 5B22A 5I1GH 1FN4B 1A3QA 3I50H 3DX6B 5LGJA 4NN7B 1BBJA 3O2VL 4YHIB 1VFBB 5LBSL 4LARL 1S9VB 2VDMH 4N0FA 5EU6D 5F9WB 4ZUWB 5IB3B 5E99L 1YN7B 2X1WL 3FZUD 4R7NA 2WSKA 2LU7A 1F8TH 3OSKA 5DJDA 1CBVH 4XVUD 1BQSA 3LRGA 2VQ1B 3NIDF 1LP9F 1KJVA 1KIRB 4JFZL 3MCLL 4YBHA 3QT2A 5DVNA 1E27B 3P0VH 4HMEA 3MNZB 5I8KL 3QDMA 2BHZA 3S8WA 4B5EA 4ZO8A 1NCDL 2R8SH 1QLFB 1IC1A 2XKNA 1INEH 3U0PB 4NNXB 4YDIH 3TYGH 1RPQA 4L29A 4UDTB 5EB9A 2X1OA 2V7NA 4YHKH 4Y4KC 3AUVA 4NN7C 5FHBH 4LU5H 5EOCL 3ZE2F 3BYTA 2J8HA 1FHGA 1G7IA 2APFA 4G43B 3E2HB 1BAFL 1OAUL 3MV7A 3VW3L 3B9KA 4MZ2A 5F9WC 4C56B 4O2FB 3QDGE 3C6SA 1D6VL 1BQHA 1MJ8L 1OCWL 5CLWA 3SEPA 3QHFH 2I60L 2IH3A 3F12A 4POYA 4FNLL 1K5NB 1M7XA 3T77A 5L9DH 1TZGH 1QR4A 1NC2A 2D7TL 4EIZC 2MPAL 5EO0B 3D0VB 4XP1L 1A6ZB 1G6RH 5I1GL 5T1LA 3I50L 5IHZA 2Z35A 4U1NA 1WFUA 3MNVB 1RULH 2JKXA 5H94B 1WSST 5DRNA 2KQMA 3FQUB 4QYOA 1UXSA 2VDML 4Q6IB 5I1AB 5ACZB 1NC4A 3QSKB 3IETA 1OQXA 4MNQA 3TPUB 1JFQH 3GSOA 3TJHC 3MROB 1F8TL 1CBVL 1KYOJ 2ITDA 3V4UH 4X5WB 3CVIH 4Q9RH 2HJKB 2R9HD 4L4VB 3RVVD 5DO2C 3CX2A 4G9FB 3E2HC 3GIVA 5J9PB 4L9LB 3P0VL 4R90H 4TYUA 3QP3A 4YZFF 4NQCB 1NDGA 2VB5A 4BFIB 3MV11 4WO4D 4X6FA 2R8SL 2VLLB 3Q5YA 1INEL 3JV6A 5F6IB 1A47A 4YDIL 3TYGL 5KOVC 4NT6B 1BZQK 4YHKL 4PJFA 4I13B 1IAOA 2QR0A 1S7VA 4LLAA 3GSUA 2F54A 4LCUB 3X11A 1WBYA 5FHBL 4LU5L 4LLWA 5HY9B 4DKDC 3UJJH 5E1AB 5FYLE 4DK3A 1KB5B 4Q6IC 3CCHB 2PYFA 5AAWA 1UEYA 1HHJB 3V0VA 1JK8B 2Y36H 2JK5A 4X6CB 3HCVB 3QHFL 2SEBB 1KNOA 5L9DL 1ROWA 2L7JA 1TZGL 4OCWH 3REWB 4KVCH 1HXYA 4XPTH 4MAYA 3STLB 4KTEH 3TBTA 1G6RL 4L9LC 4WHTB 4DTGH 3V2AR 3LRHA 1WFOA 1RULL 3WN5A 5EUKA 2AV7B 4UIMB 3K3QA 1P4BH 5F6IC 1IEBB 1JGEB 1AGFB 1NAMH 1JFQL 5EG6C 4MD5B 5CFHA 1JYWA 2APWA 1MRFH 4YDJB 2Z92A 4IHOB 4X6BA 3V4UL 1D5IH 3K2MC 1PG7X 2J1KA 1IC5H 4OF8A 4HMCA 1LVEA 4L4VE 4Z5RB 4Z78B 2X9WA 4LSPH 4G9FE 4PRIA 3BT2H 4R90L 5AYUL 3DO7B 2VLJA 4NQCE 5HGGS 5HJ3B 4HZAA 3ISWA 3MRPA 5C0FA 5I1LA 1U3ZA 1QEWA 1QQDB 4KPHH 3ARGA 4XZUA 5IEHA 4FXKB 5C0RH 1AQDB 4PGDB 4HG4J 4XRCB 2XZQH 1A9EA 1A1OA 2IAMB 3VXSB 3UJJL 3BIAX 4YNYA 1BVLA 3DRQA 3MUZ1 3PJSB 3MOBL 2Y36L 4IMLB 3SDDD 5LQBH 4PJGA 2DQGH 3QQ4B 4X6CE 4LFHD 4ZG1A 1ZVSA 2AJ3B 4KKCD 1CGYA 5EC1A 4U3CA 5EIQA 2NY7H 4OCWL 1ITBB 3KPQB 4OCMC 1GHFH 3O0RH 4XPTL 4KTEL 2JB5H 3DMMD 4HUXB 3AREA 3EDEA 2V5MA 4DTGL 4P9HH 3I75B 1ZWIB 1Y18A 4PUBH 1KFAH 1P4BL 5FCSH 2X4TA 1NAML 5SWSB 1MRFL 5C0GA 4PRHD 5EN2A 5DK2A 1GGCH 4LMQI 4PD4K 4WI8A 5IMKB 1PKQA 2BSRA 1D5IL 2IAMC 1LILA 1IC5L 3SE3C 2VC2H 3BHBA 5BS0D 5DFWH 3QYCA 4LSPL 5C9JB 2LE9A 5F3HA 3NTCH 2ZUSA 3BT2L 2DJUA 4NO0A 5MENA 1U8JB 3INUH 4P2CG 2YD6A 2V2TB 4GAJH 3JXAA 2D7OA 1QR1B 4ZNEE 5D7LA 4KPHL 1BBDH 1PQZA 2EDXA 1OSPH 3ULUD 5DEFB 2DM4A 3OPZH 5C0RL 2H45A 2Q3ZA 3V5KB 4K7PY 2XZQL 5JW3H 3VXSE 5CSZB 4POZC 2OS7A 3FRPA 4IIQA 3IRZA 4PJ9B 3ESUF 4PJIF 4UUJA 5H2BA 5HHPB 5LQBL 4TUKH 3ZHDA 3GIZH 1IKFH 1FFOA 5FYKE 1KPVA 1CXFA 2IWGA 3PWPA 3BUYA 3V6ZB 2NY7L 5EO9B 1GHFL 3B9EA 3O0RL 5DURD 3U36B 1A6UH 1K8DB 2JB5L 1MFDH 3WDJA 4YFDB 5DJ2A 4HXBH 4P9HL 5GS0D 4E41A 1VACB 4BQCA 2EDTA 1HDMA 4PUBL 3RVWC 5KSBA 5B38A 1SYVB 3TBSA 1KFAL 3UZVB 1FQ9C 5J12B 2LV4A 1M05B 4AL8H 1IAII 1FNEA 2BVPA 5SWSE 4FQQA 4CKVX 1A4KB 1EFXB 5LAXB 1EUTA 1GGCL 1GGTA 4HBQA 4AG4H 3WKMH 1T1ZB 4OJFH 3PHQB 5E94B 2VC2L 3MLSH 4Y88A 1R5VB 1I9IH 3L3JA 4PJ9C 3NTCL 1AXIB 5J6GA 2IJ0C 5HYSG 1NLDH 4Y4HD 1OTTC 3INUL 4YAQA 3JSSA 1MY5A 2VXSH 2EDWA 4GAJL 1BBDL 3DVFA 1OSPL 3F7RA 5A2IH 3OPZL 3Q5OA 2R1WB 4U1JB 4UOW1 4PJHF 1J1PH 3E1F1 4XMLH 5JW3L 4L8BA 5DQJA 3WFEH 5J12C 3CMOH 5BV7B 4TUKL 3TO4A 3GIZL 2HYMA 3IS1X 1IKFL 5E56A 4QHNA 4OZHA 1S7XA 4EDXA 5IQ9B 4YR6A 5I0DA 4R7DA 4QRRA 4HC1A 2E8ZA 4JE4B 3U0WH 1A6UL 1R5IA 3EO0A 1MFDL 1A7OH 1QLEH 4HXBL 5HDQH 3LKOB 3UMTA 5BQ7A 5D93B 1FNGA 4HCRA 1ULVA 4LNRB 4Y16B 1IGTA 3D3VB 2YPLA 5AUMA 1U58A 3S9DB 1S9XA 3TLRA 5IESH 3ARBA 1CDHA 4I4WB 3OQ3B 4I9WD 3FB7A 4Z6AT 2IG2H 4AL8L 4NKDB 1V3JA 2YZ8A 5IIEB 4XHJD 4NDMA 3MYJB 3IS0X 1XF3B 3WKML 3ILQD 4AG4L 3O4LA 4X0KB 4OJFL 1RZ8B 1TQBB 1IRAY 1ZLVH 2YR3A 3MLSL 1I9IL 4DKFH 5L2JB 5BV7C 4L3EE 3MNWA 4XGZA 1NLDL 1MCJA 3BGFB 3MMEA 2VXSL 4MD4A 3T4AB 1FE8H 5BW7C 5I2IB 4QOKD 1BFOA 1G7MA 2E7HA 3VRIA 3PE9A 1YYLH 4I0PD 1S8DB 1A7RH 4O02H 2XN9D 4BK4A 3BN9C 5HYSB 2DQTH 1CN4A 4OGAD 5D93C 1J1PL 4Y16C 3QWOB 4XMLL 3CVHH 3VFPB 1CR9H 1KJ3H 1RUMH 3IU3B 4GG6F 4E42A 3CFBA 1U8NB 4R6UA 1KCUH 5DS8B 3WFEL 3CMOL 1O7SA 4HULB 9CGTA 4U0RB 1T66C 2EE3A 5K59E 1SQ2N 4Z77A 3EOAB 4HGWB 1B6DA 5E8NA 1MCDA 1K8IA 1TQBC 2QHRH 3SDCB 2F9BT 3U0WL 2BCKA 5KANG 2J5LC 1A7OL 1QLEL 2YS4A 5HDQL 3QH3A 5HHOB 1KXTB 3BGFC 4EI6A 2JJTA 2X2YA 3D3VE 5HI4C 5IESL 2IBGA 2Z31A 2YPKB 3S36H 2IG2L 1JF1B 4Y1AA 1GH7A 1J8HA 2MQCA 5DRZB 2AAVA 5CIPB 4P48A 1BOGB 3NGBC 1P7HL 3CFCH 2EIDA 4DKFL 5MEQB 5IBLD 4XNUH 1A7QH 2CD0A 2VUOA 2BC4A 3L3GB 1LE5A 4U0RC 5DJYB 1T1YA 3QZWA 4RFNB 1FE8L 4ONOA 3LB6D 3NCCB 1W72A 4FQIH 3SDCC 1R3LA 1YYLL 2BXYA 1A7RL 4O02L 4YDVB 4LHJB 1KPRB 3O8XD 4O00A 3EYVA 2DQTL 4WHYH 5E8PA 1JRHH 3MUGA 1X44A 3CVHL 5E0QA 1CR9L 1KJ3L 3SDXF 1RUML 1QSFA 1NFIA 4RIRA 1KCUL 1FZJB 3MPCA 4NSKB 3QRGH 4A6YH 1VCAA 4X99B 3MO1B 3EO1B 1FNSH 3RWFA 2GHWB 2QHRL 1JI2A 1H15A 3DHJA 3EOBB 2X41A 2A6IB 4U1KA 3V5DB 5C0BD 3UTSD 5F7YC 3TJEH 4QF1A 2JIXA 4N90E 5HHOE 4X9IA 2EDYA 4NQVA 3MA9H 4RFNC 1T0MA 4O4YH 4WDIB 1BX2A 5D5MA 5KAQG 1X5JA 4I8DA 1XIWA 4GBXD 4I1NB 4J6RH 4K8RD 2CUMA 3S36L 1JZ3A 3TZVA 5GGUA 3BDBA 2CO6B 2P8MB 1XGTA 1CFQA 4PJAA 2UWEB 3CFCL 4F37F 4ZFZA 4DUVA 2AXGB 3C2AH 1O5DT 4LQFL 4GW1B 4YBQC 3MCG1 1VGKB 5DC0A 5HTSA 3KPMA 4RNRA 4XNUL 1A7QL 4X5LA 3T2PA 3DVNA 4IBLT 1F13A 5CEYA 4E9LA 3RKDD 4ISVB 3GJFA 4FQIL 1TJIH 3E6FB 4L8SB 3AY4C 4U3HA 4NO3A 5DEGB 1JRHL 1AC6A 3BXNA 3N1FC 4HWUA 3RNKA 3ZSTA 2D0GA 3SKJH 5F88B 1BLNB 3JV4B 2R1XB 1Z5LA 2R9HC 1ZT4B 2NY0D 2CKBB 3QRGL 5F72S 3RVVC 4A6YL 5HVFB 4HF5H 3HPJB 5CZKA 2J12B 5HI5D 1IGCH 3QDMD 4MD0A 1FNSL 2LVCA 1HH6B 3ZT7A 4CJ0A 1HXMA 1MFAH 3AAZB 4D9QD 1ZEAH 2XA8H 1U8KA 3TJEL 1MCHA 3U1SH 2AQ3A 4QRPA 1MJJB 3NCEB 1XH3B 2W0FB 5FDWB 2DYPB 2N7AA 1AGCB 4BSVA 4O4YL 3KLSA 1FL5A 3DBXB 3HZVA 5I6XB 4J6RL 3FO9B 1IVLA 4IOIA 4L3CA 4NRZB 4L8SC 3MV7D 4JDZA 3AFLA 4YHPA 1S7UA 4NQUA 5IB2A 3HR6A 2GQHA 1V3MA 1OD9A 2D7NA 2UWEE 4CNIA 1RZIB 3G9VA 1NC2D 1TJGH 5ETUB 4YPGA 5CGYD 1KCLA 5T1LD 1XGUB 3Q6GH 3KS0J 4ZFOB 4LSDA 1BVZA 4KK9D 4NNYB 4XCEB 1EDQA 3QI9A 4XPAH 3NN8B 4G6FD 3RJDA 3PWLB 1C5DB 1ES0A 1JGDB 1IKNC 1TJIL 4L4JA 4MNQD 2XQYK 4EI5A 1DQDH 2KDGA 3BUTA 2W65B 4ZUTB 1ZAGA 2UYLB 3SKJL 5I6XC 2F8XC 2HJFB 4NZRL 5MERB 3M8OL 1MCQA 3IVKA 2WIIB 4HF5L 2DWEA 4IS6B 1DUZB 3V6OC 3RWIA 2GK0A 1IGCL 3LY6A 1C7SA 3HNVL 5IHUH 1BD2B 1MFAL 3OX8B 4WIQA 5BMFH 1ZEAL 2XA8L 3IDJB 4DKEH 2GCYA 2GUOA 3ZDZE 5IVXF 3U1SL 2ZJSH 1U92A 3MRHA 4N5ED 4PRHB 2Q87A 1C16B 4MB5A 3V4PH 1J10A 2NX5B 4MQSB 4EUPB 3GUTB 4R0LA 5TDPB 4ESKA 4M3KB 5BS0B 1YJDC 3V6OE 2E6PA 2XWBA 3BP6B 4WCYH 3BH8A 1KXVC 3H9HB 1LO2H 2ZSWB 3G08B 1TJGL 2ICEA 1RURH 4MAYD 1LK3L 5K93A 3BDYH 2R29H 5TDOA 1LO3H 3G5YA 4L8CA 3Q6GL 4KJPC 3CMGA 4R4NC 4Y19B 3AM8C 4XPAL 5JZ7D 2X4NA 3L3OA 1U2HA 2GI7A 1SEQH 3D0LB 2YXFA 1UKSA 1R5WB 1G9NC 3CLFH 1DQDL 4TTDD 1J5OH 1Q8MA 1OGAB 1TQCB 5IB4B 3VRJA 2DMCA 3MTRA 4G8FA 3QEHA 1Y6MR 1TVBA 2D31B 5DURB 5FK9B 4WV1A 1JPST 3DX8A 2VLJD 2BNRA 3QCVH 1LDPH 4MQXC 5IHUL 5CP7B 1BD2E 4NWTH 4QTHA 1RK0A 4GW5A 2MHAB 3TVMA 1B0RA 1IGJA 4DKEL 3ARGD 1EBPA 3UBXG 4KK8D 4GJTB 3PG2A 4PJBA 1N0XH 1QVOB 2ZJSL 3QULA 1DL7H 3ULUC 2Y5TA 4ZFGH 1MAKA 2P8PA 3UROR 3CC5B 4GXVH 4PRHE 3V4PL 4ZUVA 3GSQB 5I66A 2NX5E 4UQ3A 3CFEA 3FOLA 5F89A 5KN5B 5DVLA 1PY4A 3EDFA 2FEDD 1AXSA 4HHAB 4QCIB 1MHHA 3A0OA 5BS0E 4JCLA 4WCYL 2I9TA 3PGDA 5I76A 5C09A 3IDXH 4L1HA 4EJ1C 1TQCC 1HQ4B 1LO2L 3ZDYF 2HJLB 1MLBB 3QPQD 3T4YB 2CIKA 1RURL 4O2CA 1XR8A 3ARED 3QIUA 4F33A 3BDYL 2R29L 3D9AH 1LO3L 3ULUE 3ULSA 2IEPA 3MCKB 1AD9B 5GJTH 4HFUL 5L8JB 4U6VH 4OBRA 4XI5C 4PGEB 4Y19E 1Y6KR 2NY1D 4P23B 43C9A 1SEQL 1Q9LA 1NCAH 3CLFL 3GI8H 1J5OL 2MJWA 1CLCA 4MVBD 1GOFA 3FT3B 3QXUA 4PFEA 3VFWA 1VFAB 1KCRH 2GSIB 3LQMA 1WZMA 3RRQA 4KKNA 4OFVA 1MCLA 5D1QB 2JJSC 2BVEA 3UPRA 3QO1B 5MEND 5L88H 3PWVB 3GDBA 2ZUQB 3QCVL 3TCLA 1LDPL 4PRAA 4CADA 1J87A 4NWTL 3X14A 1D6EB 1QKZH 1N0XL 4U6YB 3SE8H 2FLRT 1DL7L 2LAGB 1MREH 3L5HA 4ZFGL 5TF1H 4GXVL 3L5XH 1JMXA 4X4XB 3P2TA 3MRCA 1C5BH 2FWOB 1CIUA 4OZFG 3FT2A 4P23C 3IFPB 3U79A 5CEXA 4OSUH 2H9GB 2F5AH 1F97A 2VXUH 1MVUB 2YUWA 1S7WB 3IDXL 3PP4H 4YHOL 3PWPD 5BO1H 3U6RB 5ICXA 3CXHJ 4GUPA 2AEQH 3QFJD 4LLQA 4JFFD 2X5PA 5C08B 3QISA 4I0PB 3D9AL 4NC1C 5D1QC 3OG6B 2VXVH 1XF2A 3IXTA 3QCUH 2ARJA 1U91A 2D9CA 5EO1A 4U6VL 4JO1H 1NJ9A 5DJCA 2ZUQC 4E41D 2BZDA 2VLRA 2GJZA 2UY7A 1T4KA 1U9KA 3N1MC 4X7EC 3EOTH 5L6YH 1NCAL 2FSEA 3JWDH 4XBEH 3T8XA 5EWIH 4HS3B 3GI8L 5JNYA 4XP4H 3THMH 5JA9A 1FGNH 5TGBA 4OAWB 4XHJC 4GKSA 2FATH 2UVFA 4OCYH 3ZKMD 5KVDL 1KCRL 4MWFB 2EXWD 3T1FB 3KS0H 2PTTA 1OOAA 4M4PA 2X4RB 2OTWA 1JWMB 3L7FA 3SOBH 1FL6A 3LV3B 4HPYH 4NC1E 3LKNA 3S5LA 5L88L 5GPRA 1QFUH 4M7KH 1IEHA 2RJMA 4NCC2 2AERT 2Z4QA 1BZ9B 5B4MC 4HD9A 4Q2ZB 1T22B 2YC1A 4Q74A 1QKZL 3SE8L 2R2HA 1NCBH 4S1RH 4I0PC 4I9WE 4Z7UB 1MREL 3U0TA 1KSRA 2XZAH 5TF1L 3GMLA 5KTEH 1S5IH 3L5XL 1C5BL 3R1GH 1JGLH 2M8XA 4M5YH 2DQDH 4J3SA 5FA3B 5EUOB 4RA0C 4JQVA 4OSUL 2F5AL 4UDUA 2VXUL 3PP4L 5BO1L 4KKLC 3GGWB 3QQ3A 4OZFB 2AEQL 4HWZB 4QRRD 4AIZA 1FAKT 1UM4H 3EUUA 3LQZB 5C08E 2VXVL 1B0GB 5D2NB 4WJ5B 3QCUL 3CGTA 2GITB 1CQKA 4JO1L 3GMNA 2YPLD 3BEVB 3I6KB 4RFEA 1ZLWH 4RAVA 1IGIH 3AXLA 3EOTL 5L6YL 3JWDL 4XBEL 1TZIA 3GMMA 3H3BC 25C8H 5EWIL 4MCZB 3HZMB 2NY4B 2FH6A 4XP4L 3THML 1FGNL 3B3IB 3B2UD 2Q8BH 2DM2A 3O4LD 2FATL 4OCYL 3VXMA 2IADB 3BZFA 5A40E 1YN6A 3SOBL 1CICA 2C1PB 1ZGLB 4HPYL 3UTSB 1IGYA 1QFUL 4M7KL 5IBLC 4NO5B 3KLAA 4K23L 4WFGE 1CYGA 2YD9A 1Q9OA 4P4RB 3WL9B 1PG7H 3NIGE 4NBXB 4GBXB 3TWCH 1NCBL 1T1WA 4S1RL 4HJ0D 4JG1H 5C0EB 4FXGB 1K2DB 4Z7UE 5D2NC 2XZAL 3VXOA 2E6JA 5KTEL 1SMAA 1MIEH 1S5IL 1CF8H 3R1GL 1JGLL 4M5YL 2DQDL 2ENYA 4F2MB 5LVEA 3OKNA 5GGVL 4S1DD 1MI5B 3EZ8A 3K8KA 5EUOE 2G75A 4CW1A 1TFHA 2NY4C 4MSWB 1NUFA 5C6WH 1UM4L 1X5ZA 1MHEA 2AGJH 3KPSA 5FO9A 4CN4A 1V7MH 5D2NE 3N50A 3T08A 4WTXA 2BNQD 5EZIH 3RGVB 3WE6A 2DI7A 1T6WA 2JCCF 1IGIL 4RWYH 4FFWD 25C8L 1P4IH 1EZVY 4Y1AD 2BY0A 4GBXC 2NY0B 2Q8BL 5INCA 4F7EA 3VXUA 4OUOA 1NKRA 4S10A 4DGIH 2P24A 3ECBA 1OP9A 3S96A 4JFPB 3WS6A 1JNJA 2YN5A 4ZSOA 4NPYB 1T20A 3UTSE 2ZG2A 2APXA 1MUJA 1IFHH 4GAYB 1U0QA 3MGTB 3RKDC 1PG7L 3EOYG 3TWCL 4JG1L 1CFNA 3MV7B 1MIEL 3RGVC 1CF8L 3BE1H 1CG9A 1IC4H 3NMEA 4S11A 3ZTNH 1NGQH 1QSVA 2DLIA 3FT4A 4XXCA 2OL3H 2ADJB 3MODH 3O6FA 5EIIB 1MQKH 3IAPA 2NY0C 5T3XD 5T1LB 3ROOA 4PJ7B 2Z35B 4GKZB 3DECA 4PV8A 4LHUA 4P5KA 5HI5C 1CE6B 1RZKC 4UT6H 4DFHA 1S9KC 4XVJH 3RWDB 2AGJL 2MQ0A 4K9EH 5BXFB 3QO0A 2VL5B 5T5FH 3ARQA 2JIXD 3IETB 5EH1A 3QXDA 5FUOH 1V7ML 5EZIL 4U1SA 1TTGA 4JQIH 5DJXA 1FFPB 4MGXA 1MCBA 2B1AH 4ZPVB 4RWYL 5F3BA 4LGPB 5EU4A 3ULVD 1XIWD 4JEGB 2CUIA 3NCYS 4UI2A 1P4IL 4ONFH 5JO5B 3TZVD 4NUJA 3C8KB 2YUZA 1NFDA 1J8KA 1KJ2B 1URLA 1WFNA 5FF6A 5FA4B 3KPRA 5IROC 4DGIL 3OHXA 1GZQA 4HV8A 1Q38A 1WK0A 4X6FB 1ED3A 5TQ2H 3WNPA 2MSPA 3A67H 3QNXB 5B3JF 1ITCA 5ID0B 4ENEC 5CBEB 4NN6B 1BIIA 1X4YA 4MJIB 1DQJB 1IAOB 2QR0B 3VFUB 2FL5A 3PHOA 3W82A 3X11B 3BKCL 1WBYB 4AYFA 1IFHL 3FN9A 4LLWB 4GG8B 4KK9C 4MNGB 2O5YH 1FG2A 2K7PA 3RAJH 5GIRA 3MV7E 3VI4E 3BE1L 1IC4L 3ZTNL 1UKTA 1RZJH 4HAGA 1NGQL 4WFED 4OI7A 3QDHA 2I5YH 1F4AA 2OL3L 1Z3GH 2RAMA 2GY5A 2IPUK 4MJ6A 1NANH 3MODL 1MQKL 4J4PA 4M6OH 2OLDA 5HVHB 2ADIA 4YIQB 5E2WH 4PJ7E 1A6WH 2Y9RT 1OVZA 2E5EA 4UT6L 5DGRA 4JFEA 3X13A 3ZE1E 4XVJL 2VN4A 2RFXB 4K9EL 4XBPA 1T21B 5T5FL 5FUOL 4QRPD 2NXYD 3IDIA 3QIWD 2ZOLB 4NN6C 4LLYA 4ZPTA 4X9HA 4D8PB 3IGAA 3O3BA 4JQIL 2V2XB 1GOHA 4JPKH 2B1AL 4N5EC 4F9LC 2DQJH 5CZXD 3L95A 4N9GB 1ZT1B 4KUCD 4ONFL 2DQEH 4AQ1B 1X5YA 1NCUA 2XTJB 1Q1JH 4BH8B 4L1DA 1CS6A 1QSEA 1G6VK 1YECH 2KQNA 4P0DA 3GHEL 3FL7A 5TQ2L 3OR7A 3CSYB 3X3FH 3A67L 5KG9B 2RBLA 5GS1A 3UC0H 4ZO9A 3IFLL 1SJVA 3O41A 4A6YA 5CP3H 5HVHC 4MJIE 3LKSA 1YEKH 3QI9D 4LPUA 2NW2B 4FTVB 5JZ7C 3BYYA 1MLCA 2O5YL 4MNGE 1XF5B 2VISA 3DWTA 4BQBA 4DUWA 1UYWL 1CT8A 1RZJL 2Y6SD 5SX4I 3SJVB 5FO8B 1OQOA 5DHXB 2I5YL 3V6FA 5LJYH 1Z3GL 1EFQA 2CIIA 3JWNC 1MCFA 2XTJC 4M6OL 5KBNC 1YEHH 5E2WL 3KHQA 3K4AA 4N0RA 1QBMH 1A6WL 4DZ8B 3WHXB 4CDHA 1BHGA 5D1ZA 5H35A 1KG0B 2DKMA 5D6CA 1FO0H 3RQ3A 1KPUB 5EZJA 5GRVL 2X4TB 2GEEA 2K1MA 1MNUH 5IF0A 3D18A 4KK8C 3G5ZA 5DK2B 4JPKL 3MLRH 1M6OB 2BSRB 1BFTA 2DQJL 4MQ7B 2DQEL 2J7LA 3K7UA 4TTGA 1Q1JL 4WI6A 2EIBA 5F3HB 4APQA 2FEDC 4UIKH 3L5WB 2VABB 2YMXH 1YECL 4G7VH 3FO0H 3X3FL 4MHHG 2VDKH 3UC0L 3KGRA 5E6IB 3SO5A 3LMJH 4RMQA 4UOJA 4QEGA 5D2LB 4P4KB 1YEKL 1KCSH 3LPGA 5E2TL 5HHNB 5IK3B 2DLFH 3O3UN 4FTVE 1FNLA 4XPFH 1TIUA 2X4SB 5FM8A 3MRDA 1OW0A 2HKFL 4HUUA 4KJWC 3MV8D 3PWPB 5F70A 3SN6N 4HH8A 1I3VA 4GRWB 3H9ZA 3SJVE 3L3HB 1VHPA 2W60B 3HI5H 4WNQA 1Q0YH 1J12A 3QFJB 1LO5B 4JFFB 1P9MC 1YEHL 8FABA 1QBML 2R1YB 5C0DB 2QL1A 2X1XR 5DMYA 1MAJA 4X5XA 2DM3A 4NCDA 3TVMD 1FO0L 4NZDA 5IOPB 4CBPA 4MA7H 4QO1A 1MNUL 5E6IC 3H3KA 1BJ1J 1A4JB 4X6DF 4M9PA 1X5AA 2AJZA 3H7BB 3MLRL 4P4KC 4CN6A 3JWOC 2X9YA 4BKLA 5HI3D 4H0HB 2Q76A 3OBAA 3S6CA 3OKYA 1MJUH 4UIKL 5C09D 4JHAH 4ZAKA 2YMXL 3LSOB 4G7VL 4O51A 3G04A 5T5NG 3EYQC 2EIEA 4U7SA 3QNYA 3FO0L 3VGAB 4NJ9H 2X4PA 3ZKND 4MJ2A 4PJEF 2VDKL 2DLGA 5TE7H 2VLMD 3QIUD 1LWRA 2DQCH 3LMJL 4HKBA 1BECA 2DBJA 5I1HH 5D2LE 2Z93B 2DLHA 4U1GB 5E1HB 1KCSL 3CH1B 4DUXA 2I26N 1NH6A 3HUJA 1T7WA 3RTQA 5GQBA 5HYFA 2DLFL 5DQJB 2DWDA 3FAXA 4LASH 4MX7A 2IANB 2PXYB 4XPFL 1FFNB 3LKRB 1S7SB 3Q48A 3ARFB 3PWPE 3W0WA 3BP4A 4JFYB 4GRWE 4EDXB 3HC0B 2Q6WB 3HI5L 1Q0YL 4QHUA 3ZKMC 5TF0A 3G5XB 3MA7B 4Z7VF 3QFJE 1YY9C 4MNHA 4PV9A 2BSTA 4JFFE 2Q7YB 3GK8H 4BQ6A 3MJ8A 2WAHA 1U8PB 4M1GH 2Q8AH 5AUMB 1L4IA 3VGAC 2DJ4A 2F8VA 1KTDB 1FV1A 3FB7B 4MA7L 2AV1A 3G6JA 3KJ4B 1I8KB 1II4E 3LCYA 4JRYA 2P1YA 4U1GC 2XFXB 4K94C 1PG7W 4QLRA 2AK4B 1H3XA 4MXWH 5IFAH 4G6AC 1J0KA 1ND0A 4JG0H 5F7DA 2QBWA 1KV3A 4LCCB 1ONQA 4BZ1H 2PXYC 4DVRH 1MJUL 4JHAL 3VD7A 4WU5B 5I17B 3MMEB 3BIKB 3GSVB 3ARFC 1HNFA 1CDCA 4NJ9L 4FZEH 2X7LA 5TE7L 2DQCL 2WUBH 3CFIC 3SY0B 3BSZH 5I1HL 1JGVH 3Q5TA 1QZ1A 2D3VA 3GJFK 2EE6A 1D5MA 2VLRD 1VFOA 1AH1A 4I3SH 1ZK9A 4UOW0 1S5HA 3I6GA 4OCXH 3HZKA 4LASL 3CFBB 3IJYA 4ELMF 3AC0A 4JN1H 3WJJC 2OK0H 1OGTB 3KJ4C 3C87A 1I3RA 2ICWB 5E9DB 3B2UC 2VN7A 1F11A 2VWEC 3BZ4A 3EYSH 2EZ0D 4JM2A 4QRRE 1N6VA 2BOBB 3M1BB 4JZOA 2HLAB 4LCCC 3BFOA 3OF6A 5LCVH 3GK8L 3SGEH 1CFSA 3VFNB 5I8EB 1Q9KA 4PR5A 4M1GL 1FAIH 2BNQB 2WWMC 2Q8AL 1D5XA 3FB5B 1ZA3B 2YPLE 3AU1B 4LEOB 4XCNB 2UV3A 2NY6B 4G8IA 5F7LB 2G5RA 3D1MC 1EEYB 2AW2A 1KTKE 3DVGA 2P8LA 1UB5A 3DX9A 1I8MA 3X17A 4WU7A 1P5UA 2VAAA 5EDXA 1XCTA 4QXGH 4NHUB 2VWEE 5IFAL 4MXWL 2AK4E 4JG0L 2WBJB 3RWJA 4BZ1L 4DVRL 3N1GC 1GJIA 4BQ8A 2ADGA 3HAEG 3WCYA 4LPTA 5DZOA 3H9SD 5CS7A 1AIFB 1T1YB 3WEXA 1JZ2A 4FZEL 1CFTA 4A2MA 4WENB 1KJMA 2WUBL 4MZ3A 2FJGA 3EGSB 3BSZL 4LCYA 4TVPH 1B2WH 1K4DB 1AP2B 4I3SL 1TDQA 3TC9A 3K4ZA 4HH9B 1UJ3A 4OCXL 2J3SA 1A1NB 2NY6C 1BP3B 3LPFA 4RIRB 4GSDH 4H88H 2N56A 4FFWC 4JN1L 2OK0L 5JW4M 1YEDA 2O26U 2QSQA 5JORB 2FJFA 3BWAA 3VXMD 3S98A 3NOIA 3G6AB 3LKQB 3EYSL 3FONA 1CICD 2KH2B 4XTRD 2PN5A 3TBYA 2WBJC 3HC4H 5ESVA 4QF1B 2JIXB 5LCVL 1U2CA 5EBWA 4QNPE 3IDNA 3K0WA 4YO0A 2W9LA 1FAIL 3FHAA 4K7FB 2BNQE 1F4YH 4ODUA 1DLHB 4OZIB 2OQJB 4WTZA 3GNMH 3GSXB 3B9DA 4Y5XB 5HGHA 3PWUB 1MHPH 2EKSB 3TZVB 2X89A 4ZNCD 1CLZH 5C1MB 5GGRY 1U93B 4PJAB 1UVQA 4NFDA 3QDGA 4QXGL 4JDVB 3H8NA 3I2CH 3OKEB 3KYOA 5BZWB 1A22B 2XV6B 3KYNA 5DA0B 4H1LH 4Y4KA 5ESQA 1FN4A 3DTXA 1PW3A 1BJ1H 3KPSD 2WLZA 5JQHC 4YHIA 1VFBA 3IJSA 1S9VA 1J1XH 4TVPL 1B2WL 1RV6X 2Y5EA 5F1IB 2HT4D 2XZCH 4OUUB 4ZUWA 5IB3A 1J11A 1YN7A 4JFHE 4J12A 3RNKB 4Y5XC 5CSBA 4GSDL 4JZJB 2VQ1A 5D96B 2FHFA 3P4NB 3TZVC 1F3JB 3IKCA 3VXUD 35C8H 3VXPB 1E27A 4PY8I 4MD0B 5T3XE 4JKWA 1C7TA 2YA0A 3ZE0E 3OKLB 2Y1VA 5C07B 3VGDA 4BZ2H 4RGNB 1QLFA 3M07A 3HC4L 3LQAH 3U0PA 1YJDL 4NNXA 4PGBA 2NXYB 3QIWB 4MQTB 4YHLH 1F4YL 1KB9K 3DUHA 3OB8A 4RSVA 1I7ZB 4X6EB 2X70B 4OZIE 1MHPL 1FCGA 3DPBA 3RKPA 4L3CB 2B1HH 3I02B 3P0YH 4G43A 3GB7B 4IDJH 1Z9OA 1WQVT 4Z0BH 4C56A 4PJAE 4KXZH 4WGWB 1N3NB 2QLVB 3I2CL 3T3ME 2HG5B 3N0PB 1K5NA 2DTMH 4JZJC 5D96C 4NJAL 5EO0A 3D0VA 3J7HA 3ARPA 4LHUD 3QXTA 2KZ1B 2WINB 1HILA 3QI9B 1JN6B 3FQRB 3MNVA 5H94A 1WAAE 4RGNC 2EDEA 1VEMA 3FQUA 4Q6IA 1FVEB 5I1AA 3AMKA 4KRLB 2XZCL 3FQNA 2NXYC 3QIWC 1I9RH 3MROA 1G7JB 3H9YA 4PJFF 3GFUA 1ZXQA 2Y25A 4ZTPH 2MOVA 5FV2A 1HKLH 4WFEE 4X5WA 3PABB 1NDMB 2HJKA 3IVKB 4G9FA 3KPRD 2GK0B 35C8L 3C09B 4Y2DB 4L9LA 5J9PA 4XC1H 4L3AA 2W91A 1BZ7B 3RY5A 4NQCA 4M8VA 4BFIA 2I27N 5C07E 4BZ2L 8CGTA 4RGNE 4I2XB 2VLLA 4JHZA 3LQAL 4C59B 3T2OA 4NT6A 3MRHB 4QRPE 4YHLL 3IDMB 2HTLD 1J1OH 4EXKA 3WIFB 2XG4A 3PWJB 4L4TB 5GGRB 4MCYB 1JVKA 4LCUA 4QTIH 3QI9C 2UZXB 4EVNA 1PFCA 5HY9A 1N2RB 5D8JH 1JIBA 4M62H 5A1AA 5E1AA 2B1HL 3P0YL 4EQ3A 3CCHA 3OJDB 4IDJL 1JK8A 1R6VA 3BH8B 4Z0BL 4X6CA 4OV5A 3V79C 4P2RA 5DUMH 2NPLX 1ZA6B 2SEBA 1JPTH 3MJGX 2DTML 2YWYA 5BJTB 5FECA 4J4PD 3T3PE 2XQYG 4PRBB 3C09C 4Y2DC 1OSZB 4WHTA 4ZODA 5DJ8B 1LQSR 3V6BR 4P2OB 4JFED 5F7EH 1Q0XH 1N59B 5HGAA 1AI1H 3RX8A 2AV7A 2IH1B 4UIMA 1JGEA 1AGFA 1FH5H 4MD5A 2OCFD 1I9RL 4YDJA 4PYHA 2BY2A 3MV8B 4IHOA 3Q1SH 1X4XA 4ZTPL 1HKLL 3IFOB 1LNUB 2EYRB 1GC1H 2XQBH 2QTEA 4W70A 4Z5RA 2CRMA 4NO2A 4F7CB 4I18B 3MQIA 5HHVH 2A74B 1QSED 3B43A 3DX8B 4XC1L 3U48A 4C58B 5HYQB 3DO7A 4KY1H 1DN2A 4LL9A 4PJGF 5HJ3A 4OKVB 2PW2B 4GW5B 3TVMB 4PTUA 1B0RB 4ZNEA 5CAYB 1QQDA 4I2XE 4PJBB 3GMQB 1NQBA 2BY3A 3JBG7 4BFGA 1T0NB 1G6RB 4AEIH 3FO1A 1J1OL 4FXKA 4UINL 1AQDA 2MNUA 2P5WB 3FHQA 4F57H 4P2OC 4PGDA 1OTUC 2WW8A 4QTIL 4XRCA 2N1KA 3F7QA 2IAMA 3CFEB 3QWRA 3VXSA 3FOLB 5D8JL 3SE3A 4HLJA 4M62L 1WJ3A 4YHZH 3PJSA 4NC2B 4F7MA 5I76B 4IMLA 1WWCA 2P45B 4N8PA 1JJUA 1NMCB 4GRMB 6CGTA 1QOKA 5DUML 2AJ3A 7FABL 1JPTL 1YPZB 2CIKB 3G9AB 5HGDA 3KPQA 4GMTH 4HUXA 4I18C 4ZOAA 5F7EL 1Q0XL 3ZZ1A 1B4RA 3TH2T 1B6UA 1N0LA 3I75A 5FYJH 4C57C 2M26A 4Z7NF 1F3DJ 2ED9A 3R4DA 3TVMC 1KGCD 4K71B 2LU3A 2CDGB 2M1KA 1KLUB 4ODSH 3LS4H 1FH5L 5ESAA 5SWSA 4P99A 3CSGA 3MV8E 3Q1SL 1EMTH 3QUXD 1WLHA 5CEZD 3OJMB 2BXZA 1GC1L 2XQBL 1UXWB 5HI3C 4APQD 4WFFE 3UPRB 4FQHB 5C9JA 5HHVL 4CADB 4KY1L 1NMCC 1U8JA 2V2TA 1E4XH 3BRFA 1BOYA 3X14B 1F2XK 3HG1B 5HDBF 4TUJB 1S7QA 4N1EA 4PJBE 2C3GA 5DEFA 5FM4A 4AEIL 5F9JB 1DDHB 4BSJA 1OP5H 4NRYB 1GRWA 3MRCB 4F57L 2P5WE 4F9PA 3V5KA 3FT2B 5CEXB 3AS2A 4NQED 3NVQA 4YHZL 4JDTH 4K71C 4PJ9A 5KSBF 1NAMB 5HHPA 4Z7QF 2X6MA 4GUPB 1ZS8B 3QA3B 5F93C 1DVFB 3V6ZA 1AE6H 1EAPB 1YPZE 5EO9A 2DIAA 3U36A 1MFBH 2VLME 1MCOH 3IXTB 1SBSH 4GMTL 2ARJB 1U91B 5JUEH 3ZLQC 1NJ9B 3QQ9D 2AXFB 3WIHH 5FYJL 5JW4N 1VACA 1PX3A 1P4LB 3T8XB 4LDEB 3SGJC 1SYVA 2E27H 1WUNT 4ODSL 3LS4L 3LEXA 1M05A 1EJ6A 2VSDA 1EFXA 3MV9A 5LAXA 5ICZA 2VLKB 5FGRA 1EMTL 1KYOK 1GGUA 1T1ZA 3PHQA 1BWWA 2IBZY 2IPTH 1R5VA 4JANA 4HK3N 4QT5B 4ZAKD 3NFPB 5E2JA 5SV4A 4RAUB 2DRUA 2GYSA 3CDCA 4O2EB 1E4XL 4OB5H 2YC1B 1D9KD 1DVFC 2OR7A 4OZHF 1YQ2A 2PW1B 4XNZB 3RDTB 3REVB 2R2HB 2DKUA 1NGPH 2FH8A 2R1WA 3FTGB 4RRPG 3RTQD 4U1JA 2DBLH 5DMGD 5KZCB 1QNZH 2YBRB 4U49A 4JDTL 1AHWB 1X3DA 1NAKH 1SMOA 1DP0A 2VR4A 4KJQD 3RVXC 1CTNA 4X83A 3FAWA 4HZLB 3H9SB 2A6JB 1EEZB 2GTWB 1ZV5A 4OLEA 3P4MB 3LZFH 5BW7A 5IQ9A 1AE6L 2CRYA 4QHKJ 4IM8A 2EZ0C 1MFBL 1MCOL 1SBSL 1JPSH 4XH2B 5JUEL 3CDYA 3LKOA 4ZUUA 3RNQB 4B7IA 4F3FB 4RFEB 3L3IB 4Y16A 4LNRA 4RAVB 5EBGA 5FYLH 3WIHL 3D3VA 3WYRA 3GMMB 2E27L 4I4WA 4N1CA 4XNZC 3RDTC 2QADD 5CUSH 5IIEA 2XOTA 4KMTH 2Q7NA 3DI3B 3MYJA 4P9HC 3VXMB 3FOMB 5IHBA 2VLKE 1LEIB 1XF3A 3BZFB 1RZ8A 3HPLB 1YN6B 4XWOC 4KROD 4OI8A 5CGMA 1AHWC 3SE4C 5I19H 1ZGLM 5L2JA 1D5ZB 3KLDA 2AQ1A 2DLTA 3NH7L 2YUVA 3T4AA 4OB5L 3VJ6B 2R23A 4LPXA 5I2IA 1XGRB 2FIKB 1S8DA 3BMVA 3S3PA 1NGPL 4V1DB 4M7LT 5HYSA 5C0ND 3C6LB 1RZKL 1P7KB 2DBLL 4ONHB 3QWOA 1QNZL 1T89C 3VFPA 4X9FA 1VGEH 3IU3A 3ARVA 3AMLA 3D2UA 1NAKL 3T0EB 2KZWA 4EEEA 5DS8A 2RR3A 3T09A 2X4QB 3P3YA 3QRFM 3H9SE 3B83A 2OXGA 3QUYB 3EOAA 1NKOA 3LZFL 4HWBH 4HGWA 4RMTA 3KPSB 5T1MB 3SDCA 2I9LB 2EDHA 3OF6D 5FO9B 1JPSL 4YBLB 3P73B 4UU9B 5HHOA 5FYLL 4GH7B 4DQOH 2M2DA 4WFHD 3QIBB 2YPKA 4W4OA 4PD4J 4HQQH 5CWSA 1Z0NA 1JF1A 5CUSL 4KMTL 2IC2A 3S3JA 5CIPA 4JY6B 3C6LC 2GT9B 3HMXH 1KTLB 1BOGA 3VXME 5I18H 4OFIA 1BJMA 4PLJD 5I19L 3T0EC 5MEQA 1F3DH 2OBGA 3L3GA 3HLAB 3KHOA 5DJYA 4N0CC 3QUYC 1DBAH 1WWAX 2D0HA 1WGOA 1I7RB 3LVEA 1WT5C 2GKIA 4YDVA 4YBLC 2VZVA 4TOYH 1KPRA 4V1DE 2E7LC 3U46B 2HT4C 1FFQA 2VOTA 1AR1C 1IL1A 4KC3B 2DM7A 5DJZB 1MCCA 5EOTA 1VGEL 3KPOB 5D5MF 5DJ6B 3QIBC 3T0EE 1NUGA 1FZJA 3ULVF 4NSKA 1GAFH 1J0ZA 1JTTA 1EHAA 4XNYH 4X99A 4JKLA 3MO1A 5JQ6H 4KDTC 1B3JA 4ORGB 4JFXB 4HWBL 2JJUA 3GSNH 5JIHA 4PJAF 3EOBA 3KPSE 2YK1H 3PGFH 4U1MB 4TVSa 3WS6C 3TBWB 5IFJB 3BISA 4PGCB 3V5DA 3OKDB 2B20A 3AY4A 3F7YB 2A9MH 1IQDB 2X44D 3SO3B 1TZHB 1MVFA 4DQOL 2P46B 4P3WA 2FB4H 3VGFA 3BPCB 2PYEB 3P40A 3TPKA 1QFWH 4HQQL 4U2YA 4MXVE 1W2KT 1I7UB 4J1UB 5FF6B 3QDGD 1IE5A 3D85D 4RA3A 2YRPA 3HMXL 3VXUE 3VGEA 3OHXB 5I18L 4HV8B 3CVHB 5D4QA 3NACH 2JB6B 1ED3B 2WANA 2AXGA 2OJEB 1JPGB 4GW1A 1VGKA 1X5GA 1AGBA 5JMRA 4OM1H 5C3LD 4Y4KD 1N5AB 1WVZA 5CMAB 3VRLE 4X7FC 1K4CB 4GLRH 4PJCB 1YDPB 4JN2B 3LOWA 2E6QA 1FG2B 1XCQB 3E6FA 4L8SA 4U1LB 4KH2A 4TOYL 3R0NA 4N0UA 1OD7A 1JWSB 5DEGA 3SO3C 3MRNB 5JIKA 2VJXA 3VFRB 5FFLA 1H8OA 4OQTH 1EVUA 5F88A 1JZ5A 2VXTH 5CJBA 1DCLA 1YNKH 2ICES 1BLNA 3JV4A 2R1XA 4KRMB 1CLYH 1GAFL 2CKBA 1G7LB 2NXZD 4KUCF 4XNYL 5JQ6L 2ADIB 5EIVA 5MEPB 3Q2CA 4CU8A 3HNTH 4PB0H 3GSNL 3EZJB 5DQ9B 5DJ0B 4J3OC 1HH6A 4FQPA 5KS9F 1YUHB 2YK1L 3PGFL 3AAZA 3ZMRA 1EERB 1IKNA 1NGZB 4AJ0A 2A9ML 2DMKA 5F7FA 2ZCHH 1MJJA 1XH3A 2W0FA 5FDWA 4NYLB 2DYPA 3DGCR 3DETD 2FB4L 3L95B 4HK3J 3DBXA 2PYEE 1VFMA 5IHLB 4Q7DA 1QFWL 3Q6FB 4NRZA 3V6OA 5EBMB 1N26A 4C56D 5ALBH 3KPRE 1LD9B 5BZDB 1BM3H 3QUZB 1DANU 3NACL 2E9JA 4G8GB 3FFDB 3SDAA 1OAYL 1DZBA 2O5ZL 1DBJH 5ETUA 4OM1L 3O41B 4J4PC 4A6YB 1A1MA 4ZFOA 4LKXB 5CCKH 3KPLB 4XCEA 3EFFB 4Z0XB 3V7AE 4PJCE 5I9QB 4MA8H 3NN8A 4CUCA 3ZKQD 3PWLA 5GZOC 1C5DA 1JGDA 4BFEA 2VISB 1ZHBB 4NBZB 1QPXA 4OFDA 3BQUA 5SX5K 2W65A 2ZUUA 4OQTL 4ZUTA 1JZ8A 1KENH 2UYLA 2J8UB 2NW3B 2VXTL 1YNKL 4M6NH 1CLYL 1LEGB 2HJFA 2YA1A 4IS6A 1DUZA 3U9PH 5E08H 3RWHB 3O81A 2HWZH 3HNTL 4NQCD 4PB0L 4CL7A 4JFEE 3AM8A 3QUZC 5B39G 1BD2A 3OX8A 5EZJB 3IDJA 4F7TB 2DDQH 4LAJH 2ARWA 3PDOB 1MH5B 3GBLA 1KUMA 2ZCHL 4PRHA 1C16A 1MCKA 2NX5A 3GUTA 3D5OF 3QUXB 5I9QC 3RY6C 4DCQB 2WK2A 1OARL 5D7IB 5ALBL 3BP6A 1X5HA 1UKQA 1ZT7A 4P2RD 3UO1H 5EZLB 4M6MH 1PLGH 3RBSA 4Y5YB 3H9HA 3DV4B 3GMOB 2ZSWA 4MJ5A 3QEUA 4G8GE 1WEJH 2H26B 3G08A 5HHQB 1AY1H 3MV01 5C7XH 4NRXB 1FJ1B 3JV0A 4GKNB 1XFPA 3O3EA 1G7QB 1HSBB 1F6AB 2C4FT 4LIQH 4AT6B 3EJJX 4Y19A 1CCZA 2DJSA 4MA8L 3D0LA 4NQEB 3QG6B 1R5WA 2IFGA 3EYUH 2FR4B 3UZEA 4P59H 4PJBF 2WIMA 1OGAA 2BVYA 3MUHL 3QFDB 4FQ2H 1EBAA 1KENL 4WEUD 3L3DB 3QUXC 3W5MA 4X7DC 2J8UE 3ZSSA 4M6NL 2D31A 5DMJB 1QBLH 4I5BB 5DLML 5FK9A 1N7MH 2H8PB 5JOPD 4JKKA 3U9PL 2IMMA 5E08L 4UNTA 4WI7A 2HWZL 4DZBB 4F8QA 8FABB 1HKFA 4X5XB 4Y5YC 3ARDA 2HAZA 3QJHA 1I7TB 1P1ZB 3DI2B 2DDQL 2ATPA 1QVOA 3VFGH 3QWRD 3QXAB 1RJLB 5B39B 3GSQA 2E3VA 2HFEB 4UILH 4BUHA 3BVNB 5KN5A 2JJSA 3I85A 4OD2B 4QCIA 1UADC 1UACH 1VEPA 5FYKD 5D7IE 3TO2B 3UO1L 4M6ML 1PLGL 3LIZH 5HDLA 1UWGH 2P47B 2HJLA 4AEHH 1WEJL 1CGXA 5E5RB 1AY1L 2R0WH 1D9KB 2YWZA 3T4YA 5C7XL 1YEEH 2AQ2A 1HHIB 2XYCA 5DD3H 3AS0A 2AK1H 3MCKA 4DAGL 1AD9A 4LIQL 3RX7A 3UYOD 4R26H 3HUJB 1FZKB 3QQ9C 1F4XH 2CPCA 1MY7A 4P23A 1FVCB 2CLZB 4NQEE 4JPIB 4XB8A 4P59L 3FT3A 1CL7H 4JY5H 1EUUA 1VESA 4FQ2L 1VFAA 5GRXG 1FVDA 2GSIA 4OLYH 1QBLL 2BSTB 5D1QA 3F65A 1N7ML 5KVFH 5ACLA 3QO1A 3PWVA 1TLKA 5MI0B 1ODAA 3RVWD 1D6EA 1FV1B 4RDQF 2VITA 1D9KC 4XT1C 3DGGB 3RL2B 5IBTH 1T5XB 3VFGL 1DEEA 5JR1H 2L4OA 3BKMH 3LN4B 4LQ1A 3RFZC 4X4XA 4UILL 2FWOA 2BNUB 4JRXB 3IFPA 2NMSA 3DV6B 1DQLH 4PJ9D 2ZOKB 2BK8A 3UBXA 4ETQB 5KSVB 3QZWG 1E4WH 1UACL 2H9GA 3F6IA 2NCMA 4OD3L 3U6RA 1MVUA 1S7WA 2CO7B 2G9HB 2LVEA 4KJQC 3LIZL 4PLKC 1UWGL 2C3VB 4AEHL 2IMNA 2R0WL 1YEEL 3B9VA 5EBLB 4DW2H 5DD3L 1VERA 5C08A 2F53B 4I0PA 2VE6B 1YC7A 2AK1L 5LGKA 2A1WH 4R26L 3K2UH 1RHHB 1R3IH 2ADFH 4KI5D 5A2JH 5MI0C 1F4XL 3HUJE 3CDGA 1DBMH 3QDJB 3WD5H 4Z7OF 1U8MB 3MJ9H 3NCMA 1HWHB 3BGMA 4J3VA 4YH6A 4OZGB 3JTSB 1EFXD 3MV9D 4PRNB 3AGVA 3EHBD 4OAWA 1CL7L 3O3AA 4JY5L 3BPLB 4DEPB 2FECL 1NBQA 3OJVC 1H3PH 4MWFA 3T1FA 4OLYL 3VMOA 1M7DB 2X4RA 3HAEH 1PY9A 4AZ8A 5KVFL 3LV3A 1HEZB 1CFSB 4NNPH 3QCTH 4PR5B 5GGVY 4NQDB 1BZ9A 4Q2ZA 3S4SG 1T22A 4G8IB 4LLVB 4OFKA 4YC2B 5DHYB 5IBTL 1QP1A 2Z0BA 2JELL 4Z7UA 4WU7B 5JLZB 5JR1L 4W81A 4KK6D 3LN5B 3BKML 1TVHA 2E7BA 3K1DA 1SY6A 5FKPA 3RUGB 4WUUB 5GGTH 2NY5H 5C0NC 1JF5A 2FRGP 1DQLL 5EUOA 3RWJB 5J89A 1TETH 3P77B 4AK1A 1E4WL 1ZOXA 1I1RA 1I85C 5FV1L 3WEXB 1WIOA 3A6CH 3IKKA 3GGWA 4QRTB 3BPLC 4DEPC 4OZFA 5ADPH 4ZXBB 3TFKC 3GMRB 2FJGB 4MA3B 4DW2L 3BN9D 3MLZH 2W1NA 1OL0A 4LCYB 2F53E 1B0GA 5D2NA 4WJ5A 4NM8H 2A1WL 2GITA 3K2UL 2ADFL 1R3IL 3L6FA 3SPVB 3D3VD 5JA8B 3BEVA 3I6KA 5K9OB 1IBGH 4YC2C 1DBML 2JLLA 2VIRB 5BRZA 3MJ9L 3QDJE 4MCZA 3HZMA 3O6KH 4AQOA 1R0AH 5IJKC 4POUB 5TJWK 2DQIH 2QKIB 3BWAB 3B3IA 1DJSA 2Q20A 4DVBB 1V5JA 1H3PL 5CHNA 1UZ6F 2C1PA 1JE6A 1ZGLA 5ESVB 3UTSA 3QCTL 4YO0B 5HI4D 3H3PH 3MUY1 4NQDE 1T6VN 4WVRA 4ZXBC 3WJLC 4P4RA 3WL9A 4LK4A 1IQWH 4GBXA 3VXQB 5GRWA 4FXGA 1K2DA 5EFIB 3EYOB 1AQKL 5GGTL 2NY5L 1UENA 3RUGE 5JXEC 3D85B 4WUUE 3L5JA 2RB8A 4F2MA 2X9XA 3OKOB 1MI5A 3D2UD 1TETL 4X4YB 2EDRA 1IM3B 4MSWA 1SJEB 1SJHA 5DYOB 1LO0H 3A6CL 3I3DA 1UG9A 2HN7B 2ZWLT 3DTXB 1W0VB 5ADPL 3ZDXE 5DQDH 1W0YT 1LHZA 3SDCD 4XPGH 3IJSB 1PJ9A 1CD0A 3MLZL 1F45A 4PJ5B 5E00B 1WV7T 1HOCB 4N90D 4NM8L 5HHOD 4CDGC 3ALWA 1IGMH 3RGVA 2WZPD 1IBGL 4R9HA 4ZMAT 3NABH 3PP3K 4ACPA 4KK5C 4R3SA 1EO5A 2FDBP 3ZHKA 2D2OA 5DR5H 3O6KL 4GQ9H 1R0AL 5EORH 3NA9H 3IKCB 4WEBH 2DQIL 1YC8A 3V9FA 2NXZB 5GS3A 5E5MB 5C70A 5ENWB 4K3GA 5E03A 1NCTA 1MWAH 2VR9A 7CGTA 3JWDC 4CMMA 2C7UA 4JFPA 4NPYA 4PGBB 3H3PL 3EJYC 3UP1A 1IAMA 4GAYA 3MGTA 3TT3H 1CD1B 1IQWL 1EX0A 1H3GA 4TUOB 2H6PB 2D9QB 3ZYIA 5IROA 1DQTA 2ZUXA 1F5WA