3SDCC

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
191
Chain Sequence
b'TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNIPEDTFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC02
5D96B 1R6VA 4OD1H 5BRZA 1NQBA 3U4EA 5DO2C 2GTZA 1NMAH 4CW1A 1ROWA 1Q9KA 1M05A 3P30H 1JWUA 4QEGA 4C56B 3TNMB 4QLRA 1DQLL 3H7BB 2R0KH 4RA3A 4UILL 2G9HA 1ZVSB 1T7ZA 5ILTL 3TBVA 5TJWK 1YMMA 4K3EL 4K7PL 4ODHL 4KRNA 1RZ7L 4S1RL 4X0KB 4S2SB 2AQ2A 4HUXB 5HGAB 3NGBB 4HDIB 3LN4B 2W65B 3GMPA 5DMGD 1FORL 5BV7H 2AXHA 1UWXK 1DQMH 2PETA 1KTDA 4JQXC 4MAYC 5C0CE 3IDXH 1CGXA 3CSYB 1CT8A 1NUNB 1AQDA 4OF6A 2IQAB 2CLVA 5T5FL 3OKLB 4YUEH 3LIZH 3DUUB 2J8UE 5AZEH 1VKXA 5LG1A 3PNWB 4GKSA 2UZXB 2FECI 3SDAD 4HFWB 4AIOA 1HEZB 3VWJA 2VZ1A 5IEKA 5IB1A 4LLVA 1RK1B 5GSRB 3UJJH 5KVFL 4LARL 1PBYA 5FK9B 3FOMA 4XGZB 4YHML 4LEOB 3W0WA 3U46B 1MRFH 4X4YB 2F54B 3RX5A 4JB9H 5IUSA 4U6TA 3HLAA 3G5ZA 3QFJA 1JGEA 4JKKA 3BESR 2FIKA 1IGIH 4NM4L 2V5RA 3OKKB 3RTQA 5ICYA 2NY3D 3PP4H 1G9EA 3DSFL 1J1XL 1G7IB 1J1PL 5B38A 1ORSA 2O5ZH 3QO1A 2H45A 2CKBB 4E5XB 4HQQL 5DRXA 4PGDA 2DL9A 4N5EC 3BEVA 5IBTH 1D5ZB 2WAHA 5D70L 2VLRA 3AXLA 5T1MB 2A9MH 1EUTA 3BUTA 3QQ9C 4QNPF 5A16B 4D9LL 2AJSL 4RAVB 1S3KL 1MJJA 3DX9B 1KTKE 1F11A 5EBLB 5BS0D 3DETD 3MNWB 5GGQH 5T33L 5IQ9B 1JCKA 3IDUA 1NMBL 3QWRA 4Y5YB 2DLGA 1DUZB 4P2RB 1PKQB 3TJEH 3NFSL 5CKAA 4DN3H 4QTHA 2DTMH 5ELIA 4OIIH 5FO9B 3IDYC 2HFGH 1AHWB 3BW9A 2MCPH 5HHVL 3RNQB 2AJUH 3HZVA 4MXVF 5FYKH 1FNAA 3IS0X 1CDCA 4KROB 3H3KA 4PD4J 3MJ7A 4WIQA 4JZOB 4PJBB 4FQ2H 2V5MA 2VDKH 4L4VD 4BQ8A 2X70A 4ZS6C 2MFNA 5IHUH 3DX8A 3DJ9A 5DZLA 4U0RB 2HYMA 1BQHG 5F3BA 1NCBH 2JIXB 3FO0L 4D9QD 1J0HA 4J12A 3HA0A 5DK2A 2A6JB 3R06A 3FHQA 5J56B 1TCRA 35C8H 1MREL 4HCRL 4IRJA 5F1NB 1Q1JL 5E00B 4RDQG 4NRXB 7FABH 1U8QA 5E9DE 4X98B 5C2BL 4YDVA 2C1PB 5HDLA 2UY6A 4PJ7E 4P2OA 1JFQH 4R2GD 4WI5A 4K3DL 3FT3B 1SY6H 2XOTA 5LCVL 2D9CA 1MLBA 1RIHH 1T83C 1AFVH 1IC7L 4Q6YA 1VFBA 2EDLA 2UZIL 4GW4A 2ARWA 2F9BT 2FX7H 2Y6SD 1CICC 2FJGA 4J3OC 4BFEA 1FCCA 5D1ZA 3UEZA 5ACLA 5DRNA 1V3JA 1HNGA 3Q3GA 3DMMC 4DQOH 1S78D 2NXZD 2Z8SA 5C0FB 4M7LH 4MB5A 2VAAA 3P2TA 1TTGA 2Y23A 2DQGL 2C1OB 3F62A 2FR4B 4HK3N 4NCC1 5CS7A 3W5NA 4K71C 4XCCH 1H8NA 2PCPA 3AGVA 4YDIL 2AJZB 3TN0A 4Z7UB 3SDDD 3MRNA 5DQJB 3CUPA 1CL7H 2HLAA 3FRUA 5L9DL 2IH3B 5KAQG 3RGVA 3THML 2OMBA 3TBSB 5CBEA 1YPZB 4MWFB 2NY2B 5DGQA 3LRHA 5TQ0L 4Z7VA 1J8HE 2BNUA 3D3VA 4HKZA 4WGVB 1FCGA 3B9VA 3MLSL 3GIVA 3CXDH 4PRIB 5CLWA 3KPOB 1F00I 4I48B 3HAEG 1NDGA 1X5HA 3HC0B 4MAUH 4GXVL 5E8NB 4MJIE 1GXEA 1A7OL 4CN1A 5IJVA 1MFNA 2N1KA 3UZVB 1GAFL 5E2TL 1I7RA 1JJUA 3SGJC 4LSRH 4OQTL 4HIHA 3UTZA 1N8ZB 3C8HA 1RAMA 3SBWA 1CD9B 2YPLA 3VFGL 4K3JH 4L8CA 3OX8B 1KB9K 2C9AA 5C0CD 4UQ2B 5LGJA 4LSSL 4FFVD 4Y4HD 2EEDA 5IJKC 4PJHA 2APTA 3WN5A 2ADGA 1FNSL 1QSFB 4HKXA 5F7WC 5TDNA 3IRPX 2HJKA 3ZHLA 4YE4L 3LKRA 3QO0B 3QEGH 5HPMA 1A7NH 5J89A 4BFIB 1DVFB 4XBGB 3FQUB 3O6KL 4XXDA 2XWJA 4M1CD 5GHWL 3O81A 2HTKD 3P77A 4L3EA 5EWIL 4IIQA 4O02L 1DQQB 4ORZC 5CHNB 4GAYA 2DRUA 1OTTC 1BZ9B 2CXGA 4KJQD 4IOIB 1IL1B 1Q9OA 1UFUA 3KXFA 4G6MH 3AREB 4U05A 1HWGB 1F6AA 2Y5TB 1IAOA 4XBPB 1U91A 4Y4FD 3RIFK 3UTQA 5T1LB 4QTIH 4AK1A 2YC1A 1U58B 1RY7B 4YHKL 1KLGA 2DQJL 1NJ9B 2XZAH 3G6JB 4ZPVB 5B8CC 4ZO9A 2QADD 1F4WH 4KKCD 4F7MB 1MIMH 1NAMB 3ETBF 1MHEB 2ATKA 1MVUA 3MUZ1 5I74C 5T1KD 4LDLB 1H0DA 1W72H 4OD2A 3EYVA 3VXPA 2PYEE 1ZXQA 1QKZH 5I1JL 2WMPA 4H25A 1BVKB 3L5JA 5FUCE 2CUIA 5GISH 4O4YH 4PJ8A 1OVZA 4P9MH 5IROC 2B2XH 5CFHA 2VWEC 2CKNA 2HT3D 1V7ML 4JG1L 4M5ZL 4X6BB 4X6FA 1MF2H 4Z95H 3DRTA 5C70A 5FECB 2UWEF 1I1CA 3JWDL 3MRQB 1P9MA 3CVIL 4ZFFB 2WWMC 3RWCB 4OZ4A 3BE1H 4QRQB 4ZNCD 3VFUA 1S7UA 1N5AB 5JXED 3TM6A 3NIGF 5FGCE 4PJIB 3HC3H 3KDMA 4ONFH 1A6ZA 3CFBB 3S37H 1LO3H 2YD8A 3TA3D 4O58L 5CD3A 2DIBA 4PD4K 3VW3H 1F2QA 1LD9A 3H3PL 2OZ4H 4FFWD 1KPRA 2BVOB 3GJEB 2JLLA 4A2MA 1NLDH 3IDJA 4ZTOL 1NPUA 4ZFZA 2JJTC 4CVZB 4JZJA 2ICWB 2F5AH 1MWAH 4U31A 3D5OF 1MFEH 3EFDH 3D39A 5KSAA 2CJUH 3WBDA 3WUWA 4F37F 3RUGE 4U1MB 5HYSB 3VFSB 3AB0B 4JQIH 4QT5B 3VFVA 1ZLSL 4LEXH 3Q48A 4OKVB 5HI5D 3STLB 1AO7E 1MRCL 3GIZL 4PGJA 2Y5EA 2XI9A 3SKNB 3MO1B 4KQ3H 1XCQA 4DN4L 1OF2B 4NKOB 3S4SA 5CJBA 1MQKH 3FFCB 1S7WA 3WNLA 5JW4N 3BZEB 3KLAA 4RGNC 2Y06L 4KK9D 1MCHA 4NN5B 4AENB 3BKML 1RJCA 3BT2L 1CD1B 3BFOA 2AJ3B 3UJTL 1HHKA 2CPCA 4KKBC 4WO4C 2A74A 3K2MC 4MD5A 5DTFB 1RJZB 2OP4L 1CGUA 3OAZK 3VWKA 3L3DA 1CL7I 1AXTH 2DQUH 4JDVA 3A0OA 3HG1E 2IGFH 5CILH 2EC9U 3MBXL 1H5BA 4GW1A 5GJTL 1BX2A 5D2LA 3IGAA 3U6RB 4M4RA 3EDFA 2DQEH 1FFNA 4I9WE 2C3GA 4ZPTB 4ZDHB 5I1DA 1EEUA 3B5GA 3H42L 5GRWA 4I18C 1KIQA 4PJFE 4BH7B 1LNUB 5CMAA 4UNUA 4FABL 3PV6A 1JZ5A 1T1YB 5DHYA 3HCVB 4TULL 4PY8I 5DRWA 2IPKA 1F2XK 1HQRB 3ESUF 1J8HD 3QXVA 5JW5B 4DW2L 2HVJB 3SDAA 5JA9A 1DE4A 1DQLH 5BOPA 2X4NA 1R3JB 2IALB 3UPAA 3UX9B 4MJID 1JHTA 4UILH 3PWVB 2AV7A 1TMCB 3ZKMD 4K3EH 4ODHH 4C57C 4NRZA 3ZT6A 1KXQE 1ND0A 1FJ1B 1RZ7H 4S1RH 5JOFA 1RZFL 4IBLT 2KQNA 5DDHB 3D9AL 2NY6C 3RWEA 3Q2CA 1J88A 3EO0A 1ZT1B 3IRZA 5CP3H 3SE3A 1D5MB 1FORH 1Z0NA 1DBML 1B0RB 1HILA 2EXWD 5L88L 4XPGL 4P3DB 2UUDK 1JGLL 2AP2A 1IQDA 3SGKA 1HK6A 2J3SA 4HK0B 5BJTB 1KJVB 2Z8RA 4I2XA 4KJPC 5EZIH 2PR4L 2ZPKL 2ZOKA 4LP5A 5T5FH 3ILQC 1EUUA 3QDJB 2XNAB 2SEBA 3CXHJ 5C0ND 2GK0A 5CIPB 2RJMA 4ELMF 5IF0B 1HHJB 2NPLX 1U8MB 5IW6A 1A47A 1NC2D 3WMSA 1TPXB 5E70A 4DKFL 3VRJA 3JZ7A 2AXGB 5GRXG 1QHPA 5KVFH 4AEEA 4LARH 3R8QA 3AY4A 3NMEA 4D3CL 5HYIA 3TFKD 4YHMH 4Z0XB 1XGTA 1MCWW 4F9LA 3V4VL 3CFDB 3QUYA 3CX5K 5BS0A 1I9RL 4RMVA 2V17L 3RA7L 1BOGB 4NM4H 2BY3A 2WLZA 1UKQA 3DSFH 3FTGA 1XR9A 5IG7B 1J1XH 1J1PH 4PRNA 1VEMA 4DEPC 5HHPA 1UZ8A 4JDZB 4JHWL 2P8PB 1Q9WB 2FO4A 1BD2E 1QQDA 4MDJB 4HQQH 1YN6B 3MYZA 3VCLB 2B1AL 1U93B 2PTTA 1ORQA 4WI9A 5D70H 5C0BB 4EIGB 5FYLE 4D9LH 1K5NA 3NCYS 2JELL 3W9EA 1OM3L 3O45A 1UXWA 2AJSH 1T3FB 1S3KH 4BH8B 4NO0B 4RAUB 4W4NA 3OXSB 1REIA 4U4BA 3QQNA 3PP3K 5T33H 3TZVC 5INDB 2GJ6B 1NMBH 2GJZB 3F6LA 5TF1L 32C2B 1CS6A 3NFSH 4TRPL 3SJVB 1R5WB 4XNMA 1GOGA 1QFUL 2Z4QA 3LN5B 3DRQA 1I8IA 1G0XA 5TQ2L 2YD1A 5HHVH 3H3BC 3FFDB 3MBEB 1T20B 2VAJA 2VB5A 1F8TL 5IGXL 3S98A 3WDIA 2C26A 2Z93B 3S96B 4XHJD 4EDWL 1ZHBA 4O2CA 4FXLA 2AXFB 4LLQA 4P5MA 2VLKB 1JPFA 2P48B 1KCRL 1F4XL 1NAKL 3L5XL 3FO0H 1MFBL 3QXAA 4ZFOA 2ZSVB 4P4KA 1WLHA 5JNYA 2M2DA 1NANH 1AO7D 5EBWA 3KHOA 5CP7A 3HRZB 1CQYA 5KSVB 1YN7B 3SDDA 1KN2L 4ZUVB 4NQCE 5C2BH 4YBQD 4DUVA 1F42A 4XX1E 4R7NA 4LVOB 2GTWB 3UAJC 4HMCA 1K9TA 2YN5A 3I2CL 3S35X 2BSSA 5LCVH 2V5SA 1CTOA 3MREA 2YUWA 1IC7H 3B2VL 5JO5A 2UZIH 2ADIB 2NY4C 3GUTA 1K85A 1G7LA 4UIMA 3HG1D 5I9QB 2GEEA 4LCIL 4OGAD 4NQXA 1T1WA 4KV5E 3K2UL 1GSMA 1A2YA 4NNYB 3JV4A 4ZUTB 1U8PB 5CINH 3HNSH 5I1KL 4BM7A 2P42B 1I85A 2DQGH 2AABH 5ID0A 2H1PL 4EN3D 1C12A 3V7MA 4HS6B 4L4TE 3S5LG 3T4AA 4LLUB 1D5XB 4YDIH 2UYLB 2RFXB 1BAFL 3B2UD 1S9XB 5EZLB 5C0CA 2GAZA 3MV8A 3U2SA 5C9KA 3D25B 2EKSA 2H32A 4Y4HA 1P4LA 3W39A 3BPOC 5L9DH 4FQCL 4OI8A 3L3IB 3I6LE 3THMH 3DX6B 2NR6C 1QRNA 2VXSL 3IU3B 2HFFA 4D0BB 1NBYA 3EYFA 4JRXE 2J8UA 3OAUL 3EZ8A 3QCTH 5E1AA 3IJYA 1BIIA 3MLSH 4WEBL 4X5WB 4GXVH 4OIBA 3V6OE 2BVPA 3DX7A 1A7OH 3MRKB 4QHMA 2VITA 2QSVA 3IXAB 4D9RE 3MRGB 2Z92A 3MSPA 1GAFH 3TYGL 5E2TH 3ZTNL 1WIOA 5KZCB 1WWWX 1LE5A 4OQTH 2ERJB 2P44B 3L3GA 5FYJL 3VGEA 5FA3B 3RAJL 3L6FB 4PJAB 2ARJB 5EUKA 3MRMB 1P84J 2W91A 2PXYD 4JFQB 5JDSB 5F7DA 1G9NL 2EDXA 3VFGH 1FNGA 3BVNA 3WJLA 3UYOD 4K9EL 2EE9A 5BV7B 4LSSH 3Q5TA 3SO3B 12E8L 1FNSH 3HZKB 1IAIL 4JPWL 1D5BB 4MQXC 4NHCL 3QEQE 5IMKB 1U3HB 1HN1A 5ANME 4OBSA 5KTEL 4N1EA 1JF1B 1BLNB 3FAWA 4OZFG 3JWDC 4PUBL 1NEZA 1NH6A 2AVGA 2EEAA 5EWIH 1ZSDA 2ZP0T 4JFDE 4OCLC 4O02H 1MIEL 3TH3T 4KZDH 3BMWA 4TUJA 1NFKA 3HR6A 3BJLA 4YC2C 3V7AG 4X5XB 2DLIA 4YHKH 2KQMA 4GUPB 2VDLL 1TQBC 2DQJH 2A73A 3SE9L 1AGDA 3BPNC 5GRYA 1WIPA 5DI8B 1MH5B 3UTSB 2LABA 5JPNB 3MYJA 1M1SA 2EDNA 3WDHA 4APQD 1MCKA 1ZGLM 5I1JH 3RZCA 3DECA 4MAYB 3EIFA 3VFWB 1T89A 1J12A 1JPSL 1V7MH 1YPZE 3MQIA 5FYLD 1CE1L 4M5ZH 1A7QL 4O2FA 3GZKA 4GG8A 3QH3A 1MUJA 1SEBB 1SYVA 3PHQB 3F7YB 3BZ4B 3JWDH 3PUCA 4PJCF 4WI2A 3CVIH 3FCTA 4LOUC 3EDDA 4EZMA 5E9DA 4M02A 4G6AC 1CD8A 4PJ7A 1OD9A 3DPBA 1V3MA 1WAAE 4K2UL 4NO3A 3I75B 4JFHE 4YAQA 4O58H 5EIQA 1NANI 3PWUB 1S7QB 3PDDA 4D0CB 4JFPB 4LCWA 1LHZA 3UBXA 2UWEB 2ED9A 5E2UL 3MJ8B 5C08B 3VXUB 4ZTOH 3AC0A 1JPST 2CDGB 4OGYL 3QNYB 4OJFL 5F3HB 4YPJA 2NXYC 1A6VL 4ODUA 1MCLA 4IS6B 4U7KA 3H9HA 4LIQL 1ZLSH 4LLDB 1MRCH 3GIZH 3PJSA 2VQTA 4DN4H 2A9NL 4NPYA 1MJ8L 4LVEA 4NQCD 2NW3A 4IRJC 1IAKB 1T2QL 4JFOA 3BKMH 4HUUA 3BT2H 3ZDXE 3ZE2F 1J8HA 1CFTB 2Z31C 4P2OC 4PGBB 4RRPG 3UJTH 4UAOC 4AT6A 5SX5K 2XXMB 4AQOA 1MSPA 2OP4H 5CJQH 5HD8C 1BF2A 2JCCB 1BECA 4PV8A 1YEJL 2MCG1 2E7CA 3D0VB 6FABL 2YZ1A 3HR5B 3MBXH 1JRHL 3IDYB 3ZHDA 5GJTH 3DHJA 1ZGLB 3VD4A 3VGDA 1CWVA 5D1ZC 1J0ZA 3KPRE 5J13C 2D7NA 5IVXE 4AEIL 3FHAA 3IF1B 3TCLA 4L4TD 1XAUA 1X5IA 3H42H 2HN7A 1JZ2A 4X4XB 4NO2A 4XH2B 4Y89A 3NCJL 1PLGL 4ELKB 1I1AD 1CGTA 2P45B 2LU7A 2OR7A 1XF3B 3GSXA 1FNHA 3MRFA 5FKAB 3TN0C 1YEHL 3I6LD 1WT5A 4NCC2 5EFIA 3Q0HA 4KI5C 1AD9A 4YFDB 4ZFOL 4TULH 4PG2A 4JRXD 3NCMA 2KKQA 3JTTB 1EEQA 1GIGL 3RVUC 5FUOL 1M71A 2EDKA 4F2MB 1DLFL 2PKDA 5MENB 1NC2A 4UUJA 5F96L 5B3JF 3K46A 5DUBA 1U8JB 2Z91B 4HUWA 3KNBB 1UM6L 1UG9A 4BSWA 3MGTB 5DJXB 5FYKU 5H35A 5J12C 4D9RD 5MERA 1WTGT 3MGOA 3VGFA 2EECA 1P84K 1RZFH 4ZFGH 5CEYA 1CICB 4KROD 2V7HA 5KANG 4E41B 1BMGA 4R4BB 4HKBB 4KK8C 3C5JA 5E6ZA 1TITA 1WZ1L 4X8JB 2PYFB 1A1MA 1ZLVH 1L0QA 1DBMH 2XYCA 3INUL 4ORGB 3DMMB 1WFTA 3NAAL 4XPGH 5E8OA 5L88H 1JGLH 3LZFH 1AKJD 4FTVE 1FGNL 3SBWC 1S5HA 1HHIA 4Y5VA 2PR4H 1RFDL 2ZPKH 4QCIB 3EGSA 4R0LA 3QG6A 2PYEA 5E5RB 4K71B 1I3RA 1WFNA 2CGRL 1WZKA 4M4PA 4KDVA 3FFCE 4XC1L 3QEQD 3DROA 3S36X 2D7OA 2H3NB 1QO3B 3KWWB 4DKFH 4JFDD 4X7FC 4MXWH 5LAXB 5ICXB 3OPZL 5AD0A 1B6DA 4D3CH 4IIQC 5KG9A 1FN4A 3CMOL 3V4VH 4O5LL 3QZWB 5K33A 1I9RH 2V9QA 4GJTB 3NBNA 4Z77A 4JM2D 1P5VA 4KUCD 1NCUA 3W82A 1UM5L 2V17H 4ELMB 1I7TA 4IJ3C 2KUTA 3P4OA 4PB9L 3TVMD 1WWBX 1UJ3A 3QCVH 5GGSA 3FRPA 1A4JA 2ITCA 3CFCH 2EE2A 3T0DA 3MOQA 3L7EB 4ENED 2J12B 5I71C 5D1QA 1W72B 1N2RA 1J10A 1N64L 3HPJA 2B1AH 3UJIL 1IGYA 4FQHB 1J0IA 4OUUA 5C8JA 2NY2D 4PJ8C 2EDYA 3RUGA 4XPTL 2VZUA 1FH5L 1RJYB 1AO7A 5DF0A 4Z76B 4WI3A 2NX5E 4X99B 3T0BA 3TYFB 3TIEB 4S0TD 1UYWH 4MVBC 4NM8L 5TF1H 1P9MC 4GRWF 2W0KA 4TRPH 4WI7A 1U8NB 2OJEB 3T77B 4JFHD 1QFUH 5IIEA 3V8CA 4Y5XA 1JNJA 4BFBD 3CFKA 1UENA 3C09C 3F7VB 4YXKL 3DGGA 5FO7A 5F44A 1ERNA 3QDMB 1F8TH 5IOPA 4PS4H 1P7QA 2LQRA 4L3CA 4QHNA 3BWAB 5B8CB 5IGXH 1RHFA 5GS2H 3SDYL 5CEZL 3HG1A 4XMLH 5H37G 1K4DA 1W0VB 2EIZB 5I74B 1BBJB 3QDJE 4KUZH 4QXGL 4LGPB 3PWJB 1GGYA 1KCRH 5HGHB 1F4XH 1MWAB 1AQKL 1NAKH 3L5XH 4UQ3B 2BC4B 4JZJC 4XVTL 4EN3A 2WP3O 4IOSD 2DWEA 4YGVA 3PIQA 1ZHKA 3QUXD 1A4KB 5KSAC 2VUYA 1AI1L 5JTWA 4PJFA 3VDCA 1BFOA 5JHDE 1RZKL 4XNUH 3VXNA 5DC9B 5TE7H 5T5NF 1YZZA 3HI6H 1KF9B 2OYPA 1H8OA 3E6HB 1O7SA 3VXQB 4ZXBD 1IZKA 3L3OB 3WL9A 3I2CH 5GGUA 4ODXA 5T3ZE 4M1GH 3B2VH 4WFEE 4OZHF 2CRYA 3MNVB 4XCFH 3H9ZA 1EJOL 5F1SA 1QUNA 1KBGL 5HTSA 3CDCA 1HI6B 4LCIH 2NZIA 4P4RA 3VWKC 3K2UH 4XRCB 4XP9H 3V9FA 4P2QE 1G9NC 3KPRD 1H5BC 3ZDZE 5I1KH 2BK8A 4K9EC 2H1PH 3VFOB 4ZQKA 5ERWA 5F93C 5DRZA 4FRWA 1BBDL 4H26A 4ZTPL 1H15A 3DO7B 1BAFH 4KHTL 3C5SA 1I1FA 4KJYA 5DMGC 1CLOL 4FQCH 2QL1A 5K93A 4L1HA 1A6PA 1CVSC 5ENWB 5CEXA 5I8EB 4XXCA 2VXSH 2NW2B 1FAIL 2GJ6E 2DI9A 3OAUH 3NPZB 3I6GA 5IKCB 1FBIL 4EUPA 2VDPL 4E42A 2OCFD 1ZLUK 2VISA 4JM4L 2YA0A 4RGNB 3SEPA 1II4E 4WEBH 5FFLA 3SDAC 1ITCA 1C5BL 1RK0B 1IEBA 4JFYA 5GGVY 2AJXL 3TYGH 4WO4B 2C4FU 3GSVA 2AV1B 3HS0A 1XIWA 3D69B 5FYJH 1M7XA 3RAJH 4PY7A 4KI5F 1DN0A 1CLYL 2XFXB 5FIEA 1G9NH 1T0NB 2YXFA 2CDEA 3DURA 4K9EH 3SE3C 1T21B 1ZT7B 4Z0BL 2R39A 12E8H 4F7EA 5HYQA 5HDQL 2R1YB 2NY3C 4NNXA 3DTXB 4F3FA 3SGKC 1CK0L 1CF8H 2OR9L 4APQA 1IAIH 4JPWH 2X4UA 3FFCD 2XN9B 1BD2A 5D8JL 4NHCH 1GC1L 3ILPA 3BDBA 1MPAL 3HNTH 5KTEH 4GXUM 2A38A 5J6HA 4PUBH 2NY0D 3M1BB 1AC0A 2HT4C 3MRHB 3SKOB 2CR6A 2AEWA 3CAFA 5HYJB 1S9WB 4ZUUB 5D7IF 3WO4C 4O00A 4W81A 3AY4C 4P48A 2YUZA 2LVCA 2VDLH 2X4QB 5E7FA 1XGPA 4Q74A 1NGYB 4F9LC 3SE9H 1Z5LA 3QUYC 4J3TA 3DETC 1ZA3B 3QQ4A 4PJ9A 1HH6B 3IXTB 4LPVA 4EI6B 2NY6B 3MJGX 4YHPA 4OZIF 4FXGB 1PSKL 2YPVL 3QXWA 4WI4A 2LU3A 3LS5L 4HWBA 2WBWB 1IGJB 4YXHL 2G2RA 3R1GL 5LJYH 3PWNB 4R96B 2IH1B 5DS8B 1JPSH 3G6AA 3NIDE 5GJSL 4Y16A 2HWZH 4HWZA 1EV2E 1A7QH 3FO1B 2ICWJ 3OKNA 1JZ3A 3V0WH 2X10A 3PWLA 3MLRL 1CLZL 3HZMA 3FN3A 3ULUE 3QA3A 4UNTA 4CU7A 2NX5D 4GAGL 2NY7L 5HPOA 2YRZA 4NQCA 1VFAB 4N9GB 1CVRA 1GZPB 1A8JH 4LNRA 5EOCJ 1AGFB 2HVKB 1I9IL 1ZVYA 4X9IA 3PHOB 4PJAE 4HC1A 1D6VL 1G1YA 4R2GC 3RWIA 1QEWA 5F7NC 4JLRA 1OPGL 1RURH 2EDHA 4X7TA 5E7BA 1CBVL 4PR5A 1AGBB 4X6DF 5E2UH 2Y6SC 2K9UA 3ARDD 4XP1L 3QDJD 2JTDA 1T7XA 4OGYH 5BXFA 2Y7QB 4DEPB 1O7VA 1EO7A 1IGFL 4PJDE 4OJFH 3LD8C 2XKUA 4CGTA 2Q6WB 1X3DA 3L3JB 1S78C 4L4TA 4U1LB 5HGBB 1QLRA 1KPUA 5FHAL 4LIQH 5EULV 2DI8A 1GRWA 4JFXA 4C83A 2A9NH 1MJ8H 4JZNA 1HSAA 3SDDC 3S88H 4I77L 1T2QH 4QRRB 1MFCL 5T3ZD 1CTNA 1M6OB 2IPTL 2ZKHL 4WFED 3TZVB 4RQQA 4PBWD 3QPQD 5DA0B 5C7XL 4MX7A 1EHAA 2CIKB 2IMNA 1J0YA 1YEJH 3GSNA 4JY6B 3V6OA 4Y0GA 3ZTJG 1JRHH 3ZDYE 3FB7B 1PZUB 2MJWA 3NACL 4JG0L 1HHGB 4P2QD 2C7UB 1AD0A 1DEEA 2Q1EA 3JUYA 4FFZH 4JGUA 4AEIH 1R3IL 3QXTA 5F89A 1P4IL 1LK3L 1NDMB 4QHUA 5C0BD 5DD6B 3S34L 3VXRE 3BH9B 3NCJH 1PLGH 5L8KB 1BZQK 3GM0A 3CH1B 2VABB 4PPTA 1AKJA 1MVFA 1JNNL 5I1GL 2D03L 4RBPH 3U0TA 4D94A 3RNKB 4FMKA 3GI8L 5CSZA 4NO0D 3BP7B 2HKFL 5EO1B 4FFVC 3FB6A 4Y4HC 5MP6H 4HWEL 2GFBB 3QEQA 2GJ6D 3DLQR 4CVXA 4R8WL 5ANMA 5DEGB 5FUOH 3SJVD 1RZIA 1DLFH 2FGWL 4OLVH 3BEWA 4NHUA 4NBZB 2E6JA 2OSLB 3HUJE 5D2LF 4JFDA 5KJRL 1CGWA 1UM6H 4PRPB 4M1CC 1U42A 3MBED 3PABA 2HTKC 1IAII 3RWFA 4I0PD 4ZUWA 2R15A 3FJTA 3QJFA 4LF3B 2ATPA 2NY4B 4KJQC 5HVHB 4NFBA 3ARFD 4JM2A 5EIIA 4U6YA 4K07A 3P9LB 1UVQA 2OTUB 4QWWD 4ZNEE 3C6SB 4OTXL 3TVMA 4HKJB 5IVZB 1BQUA 1FGNH 1FL3A 4NSKA 1KTRL 2QADC 4POZD 5HYEA 2UZYB 1RFDH 4KKCC 4YQXL 1U8HB 1UKSA 4S11A 3WJLC 4QRTB 4LLMB 5EO0B 2CGRH 1FNEA 3GMMA 3CDGB 4W68A 5D7KE 3BPOB 1DCLA 2NMSA 2H32H 4U6VL 2R29L 2W0FB 3IDMB 3OPZH 4PGEA 4WTZG 1QOKA 2HT3C 4LPWA 4YBLC 5BRZB 3U4EB 5L7XL 2JCCE 2GTZB 3CMOH 4CW1B 1KCSL 1I4FA 2F5BL 1CGSL 1Q9KB 1M05B 3UYRH 4EJ1C 1JWUB 2GIYA 1WAAA 1UM5H 2R1XA 3H9YA 2BCKA 2YOCA 3ALWA 2HP4A 3QEHB 4Z7QE 4WFFE 2G9HB 3TBVB 5EOQH 1YMMB 1DSFL 3TA3C 3MJ9A 2F74A 1MLCA 3WKML 5HYSG 1HXYA 1N64H 5JOEA 1S7VA 5J4MA 2A6KA 3GMPB 3GSWA 3JV5A 3RZCC 1WTLA 2WW8A 1OSPL 2JJUA 1KTDB 4KU1A 5HGDA 4F9PA 4P46D 1AQDB 3JWOC 1T89C 2CLVB 5CUSL 2YD3A 4XPTH 3QUXA 1FH5H 2NZ9D 3LOWA 1YECL 4QOKB 1U2HA 4PLNC 1BFVL 1NLBH 4DK6A 4JQVA 3GI9L 4PJ5A 4GKSB 5DMIH 4NM8H 5HI5C 5FYLL 5B39A 2QHLA 3PWPE 3VWJB 4DFIA 2RCSL 4OZGE 4ZXBA 5E99L 5IEKB 5KZCD 2NNAA 5IB1B 4DZ8A 4LLVB 3PDGA 4G6JL 4KY1L 4LLYA 4YC2B 1CE6A 3V52L 1IGTA 1AGEB 3DUSA 4KK9C 3FOMB 2DN7A 4YXKH 1TQBB 2DJUA 5DUML 4ZS7H 5EZOL 3W0WB 2LVEA 4TNVK 1K2DB 3BP6A 3BPNB 1UB5A 5CEZH 2Y1VA 3QIWA 3G5ZB 3QFJB 1JGEB 1TJGH 4NUGL 4QXGH 2FIKB 3R8BB 3RTQB 4NOFA 5A40E 5ICYB 4RAHA 4JVUA 2D4FA 1K3IA 5IVXA 1AQKH 4PJGA 1U3HD 4XVTH 1ORSB 3GSQA 1TVDA 3QO1B 1AI1H 2ZG1A 1LE9A 1JYVA 1JRHI 1U8KA 5DRXB 4PGDB 5IB4A 3NFPA 3T65B 2H6PA 3BEVB 1FLTX 1P69B 3UDWA 2DJSA 2VLRB 3AXLB 4P9HL 5EOTA 4WHYG 5HDBE 4EQ2A 4ONOA 2VLJA 4L9LA 1QSEB 1J05A 2IG2L 3I6KA 3N1FC 3IVKA 1MJJB 5FGRA 3O3EA 1F11B 5HVFB 1EJOH 1KBGH 3EJZD 3FOLA 5F1IA 3MROA 2V9RA 3HKFA 5ESQA 5E5UB 5DURB 4J6RL 4M7ZB 5DR5H 5JMOC 4QTHB 1WBZA 3ZZ1A 4HC1L 1EO8L 2COQA 5BVJA 5IBUB 1NL0L 3BW9B 2A6IA 3ZKMC 1IKFL 3HZVB 5JPMA 2BXYA 5CJOH 3BMVA 4ZTPH 1R5VA 4M8VA 3BPCA 5J7CC 4FTVA 5KS9A 3MJ7B 3UTOA 4KHTH 1UCBL 4NJ9L 2AJVH 1GC1C 2EXWC 5D6CA 2J7LA 2NXYB 3IDGA 1CLOH 3DX8B 3GHBL 4BK4A 3CSPA 2BNRE 3EO1A 5F3BB 2JF1A 1FAIH 4KI1A 5DK2B 3TCXA 4WWID 5KVDL 3G9VA 3R06B 1DDHA 4X7DC 1FBIH 2VDPH 1TCRB 4IRJB 3TIDA 4JM4H 5DVOA 1DR9A 1U8QB 1MHHA 4YDVB 2XACC 4LK4A 1C5BH 3LEXA 3PGFL 4P2OB 4KKLD 4UAOB 2AJXH 1DTUA 2DI7A 1MLBB 2CUMA 5F9AC 2X4TA 1FP5A 2OQJA 1X5LA 3TFKC 3VXUD 5CKGA 2QR0A 3VJ6A 1VFBB 4GW4B 1CLYH 5IWLC 2FJGB 43CAA 2YXMA 4YNYA 1T66D 1JWSA 5D1ZB 4B7IA 4MA7L 3MRDA 1FNFA 5DRNB 4Z0BH 3KYMA 5J13B 3ZE1E 2FCBA 3QIBA 5E8DH 4LVHC 3VE0A 4N5ED 4L3AA 1LEKA 1DFBL 5HDQH 5C3LD 3CSGA 1CK0H 2VAAB 2OR9H 3T8XA 2DD8H 1LEIA 1ITBB 1FZOA 4R0LC 1GC1H 1JMZA 4R26L 5DFWH 1MPAH 4RGMC 2PCPB 5D7KD 3DNKA 1B88A 3TN0B 1RQ5A 5FUCC 3MRNB 3CUPB 3I02A 2HLAB 2DLEA 4M5YL 3FRUB 4JAMA 2XA8H 5F7LB 2CO6B 5FCUL 4YHZL 4HEPG 3RGVB 2DLTA 5E4EC 5CBEB 2VE6A 2NX5A 4X7SL 5IVOA 5ICZA 4Z7VB 4Q2ZA 2BNUB 3D3VB 4HKZB 3CVHB 3C5ZA 1J18A 3GIVB 1QA9A 5J12B 1Z9MA 3WNPA 1NDGB 5IT2L 1JNHA 3C8DA 4WFFD 4BQ6A 5IJVB 1VDGA 3KPLA 1PSKH 5GXBB 2YPVH 1I7RB 3BUYA 1UJ3C 3LS5H 2W60A 5DQ9A 4HIHB 4Y2OA 3UTZB 1UH3A 2BHUA 4GQ9L 5BVPH 4YXHH 3ARDA 5D7IB 1T2JA 3CJJA 2GY7B 5KSBE 2CLRA 1NBZA 4L8CB 5GJSH 5LGJB 3E6FA 4GBXD 4FQLL 3MLRH 4PJHB 1CLZH 2ADGB 4NKDA 3U82B 2EH8L 4HKXB 4LHQB 3HMXA 2ID5A 5TDNB 2HJKB 3PGCB 5JHDA 3N1GC 3LKRB 4GAGH 2NY7H 4AIZA 3ECBA 5GS0L 5IB5B 3PWPD 4XXDB 2XWJB 4XVJL 1J11A 4QRPE 2DKMA 1I9IH 4U6HA 5E56A 3P77B 4L3EB 4QRUA 4IIQB 4DFHA 4X9FA 4YBQC 5ID1A 3M8OL 4GAYB 1ZK9A 5I8KL 4XVUC 1D6VH 1Q9OB 3KXFB 3ISWA 1F6AB 1IAOB 1OPGH 1U91B 3E3QE 4Y5XC 4G7VL 3UTQB 4RMTA 2YC1B 1A14H 3RIAF 4IJ3B 1CBVH 1KLGB 3X3GL 4OLWL 4WHCA 4XP1H 4ZO7A 5DA4A 2QQLL 4UIKL 5I71B 4WW2A 1BWMA 4P2QA 1IGFH 2XN9E 2ATKB 1MVUB 4FQQA 1V5JA 4OGAC 1IGCL 3DWTA 1CFVL 3MJ9L 2AI0L 1H0DB 5TF0A 4OD2B 1JGDB 3EYVB 4CVWA 3VXPB 3WNOA 2VXQL 3FO9B 4U1KA 3L5HA 5E6YA 3VXSE 4PJ7F 3HI5L 4EN3C 4EOWL 4H25B 4YHNA 1WC7A 2FNBA 4X4ME 4PJ8B 5K9QI 2WWKO 3QEUB 1IAIM 3B2UC 4I77H 4I3GA 2IBBA 1X5GA 4X6FB 5HY9A 3DRTB 5ESVA 1HWHB 3UBXI 2IPTH 2ZKHH 1CLCA 4LFHG 5DC0A 4KAQL 5C7XH 3U0PA 2ENSA 3MGAA 1DQJA 4R4NC 3AVEA 4OZ4B 5C0AE 3RWJB 4YHOL 1S7UB 5F9OL 3B4NA 4OF8A 3GKWL 3C09B 5EUOE 3KDMB 1JI1A 3LQMA 1A6ZB 3NACH 4JG0H 4KFZC 5ADPL 3O9WA 4OLYL 5CD3B 2AK4A 1R3IH 2P5WA 5D5ME 3ARFA 1NCDL 4ODSL 1KPRB 1P4IH 4CJ1A 1LK3H 3O2WL 4YFEA 4C59B 3S34H 4WDIA 1A9BA 4PY8J 1ZT4A 3E0GA 3IDJB 1JNNH 3I84A 2D03H 4GO6B 2WZPD 3OV6A 4ZFZB 4JZJB 3GI8H 2BHZA 4OV6F 4TSAL 4J2XA 2BNRD 2HKFH 5KSAB 3LMJL 1HKLL 3G5VA 3KG5A 2ZG2A 4HWEH 1B2WL 3WUWB 4R8WH 3G6DL 1H3TA 3VFVB 4XXCC 3IFOA 2FGWH 3GMRA 4OCSL 3WFDL 2X42A 2ARJQ 1XCQB 3S4SB 3MLXL 5EZJA 5KJRH 3MRJA 1S7WB 4LCCA 1AXIB 5FKPA 3KLAB 4AM0A 1IT9L 3UZEA 4OCXL 5EORL 1GVIA 5I2IA 1PDKA 4RISL 1HHKB 3QCUH 2A74B 4MD5B 4U1NA 3VWKB 5LBSH 1XIWC 1FE8L 3L3DB 3O2VL 5D7SL 4JDVB 3SKMA 3OG6B 5LXGL 1H5BB 3F12A 4GW1B 1BX2B 2P5EE 5D2LB 3LQAL 5F7EL 3IGAB 4YQXH 5C0DA 1TZHA 2WIMA 1FFNB 1T5XA 4JCMA 3IJSA 2R2HA 4ZG1A 3RHWF 1XCTA 1U3YA 2Z0BA 4APQC 4I13B 1KIQB 3WLBA 5I19L 3ARBD 2O5XL 2P7TB 3OGOE 2W38A 3O3DB 4U6VH 5FM4A 2VQ1A 5CMAB 2WWMD 4P46A 5EU6E 3PV6B 2HG5A 3ARXA 8FABA 5IW3A 5DHYB 5L7XH 5DRWB 4MZ2A 4EUPH 5A2KH 1KCSH 4HLZH 4KRPD 2F5BH 1CGSH 3SDAB 3WNMA 1DE4B 2X4NB 4GSDL 3PDOA 1JHTB 2N4IA 2AV7B 3TBWA 4PJ9C 4JFEA 4NRZB 5JOFB 3U0WL 1DSFH 5LQBL 4DKAA 2YWYA 3EO0B 3WKMH 1N0XL 1HYRC 1U3ZA 2DL2A 2V2WA 4YDJA 1HILB 4EDXA 1N59A 2UV3A 4HD9A 1OSPH 2NY3B 4PJDA 1IQDB 5JA8B 1UWXH 3NCYP 4I2XB 3TV3L 2ZOKB 2X4SA 4K8RD 1DQTA 2SEBB 3D48R 1YECH 4RGND 5C3TA 4P9HC 2GK0B 1BFVH 3MLTA 3F58L 1FIGL 3GI9H 2H2SC 1Q72L 5FYLH 1UC6A 4WWKD 5IW6B 3LS4L 4WO4D 4QRPD 5DD5L 4XTRD 5E99H 3MCKA 5FYJU 2ICCA 3VRJB 4MMXC 2BZDA 1KC5H 4G6JH 4KY1H 3WO4B 2AQ1A 3V52H 4LAJH 4F8TA 1CG9A 4ODVL 4XPHL 1XGTB 1TLKA 5EZOH 5ACMA 1A5FL 3QUYB 5BS0B 4M6AA 2ZCHL 4PJEE 4Z7NE 3A6BL 3L1OH 3ROLA 4NUGH 3RUGF 2XN9D 4GMSL 1SBSL 3FTGB 1XR9B 4PRNB 4HWBH 5HHPB 3VXSD 1UZ8B 5GZND 3VXRA 3ZYJA 3H9SA 3IDIA 2FO4B 1QQDB 1RV6X 4UTBL 4OF5A 3AU1A 2PTTB 1ORQB 1A9EA 2R0LL 1I1AC 4ZO8A 3MLVL 4P9HH 2M1KA 3VH8A 4FQ1L 3HMXL 1K5NB 3O45B 1UXWB 4CBPA 3P3YA 2IG2H 3U9UA 3HUJA 3ZYIA 2B20A 3V6FA 2V7NA 4ODBD 2WUCL 5C0AD 4UT9H 1G7JB 4J6RH 1N5YH 3I85A 4CAGA 2Z4QB 4HC1H 1SEQL 4NRYA 4R4FL 3V6OC 4L5FL 3DRQB 1EO8H 1NCWH 4TUKL 1S7SA 4HG4K 1I8IB 3DV4A 4PJFF 1NL0H 3KLHC 3U30C 5DD0L 1IKFH 1VGEL 4H1LA 1BJ8A 1HOCA 4RFNC 1C5DA 2WIIA 2NYYD 4UMGA 2AQ3A 4WHTA 4ZNEA 1WSST 3K8KA 1MCPH 5JR1H 1GGUA 1IJ9A 5E95B 2I25N 5GGRY 1UCBH 1ZHBB 3LD8B 4NJ9H 4O2CB 1OL0A 4LLQB 3GHBH 4P5MB 1JPFB 3CFIC 1RUKL 4HBCL 3QXAB 4ZFOB 4P4KB 1AR1D 4MNGA 1B4JL 1TNMA 4I1NB 5KVDH 1MCRA 4WNQA 3BISA 3MACH 5EBWB 3ABZA 3OQ3B 3QZWG 5CP7B 1L7IL 3O11A 3SDDB 4UINH 4LSTH 4LRIA 3RBSA 3WXVH 2FZ3A 4R7NB 4JO2L 1JBJA 2BSSB 4DVRL 1HZHL 3CC5A 3GRWL 3MLZL 3MREB 4TVPE 3QFJE 4RZCA 5JO5B 1UKTA 1LWRA 1Q9LA 3GSNH 3QI9D 2MHAA 1OAXL 2X9YA 3O3UN 3CPLA 3GO1H 1KXVC 3GUTB 1G7LB 4UIMB 4JM2C 4Z18A 2OMNA 4WVRA 2QSQA 4NQXB 1T1WB 4GRLD 2Q76A 1A2YB 3OXRA 3JV4B 5JZ7D 1DFBH 3TVMC 3RU8L 3MRLA 2APFA 4Y19E 4QY8A 2YA2A 5ID0B 4WUUE 1C12B 4ENEC 3Q5YA 2IC2A 4R26H 3T4AB 1QLFA 5E03A 3ARWA 4JPIA 3FB8B 4BQ9A 2VLRE 4N0UE 3MRIA 2OXGA 1JI2A 2E8YA 5C0CB 2GAZB 4GBXA 3U2SB 2EKSB 2H32B 5EU6D 4Y4HB 4M5YH 3W39B 5IEHB 3QIUD 3TZVD 4YHZH 5FCUH 5GS0C 4OGXL 3BIKA 1PZ5A 5C1MB 1QRNB 4L1DA 2HFFB 4X7SH 1NBYB 3EYFB 5BCAA 2J8UB 2VL4A 4XWOD 5E1AB 3IJYB 1CQKA 3L9RA 2FX9L 1BIIB 4OZGA 1DUYA 3EZJB 3HFML 5ABDE 2BVPB 3DX7B 4QHMB 2VITB 1MEXH 1Z3GL 2NY1D 5B4MC 1FGVL 2Z92B 2ZNWA 1LE5B 3N1PC 3L3GB 1F5WA 4HGWA 1CFBA 4U1HA 4GQ9H 5EUKB 4NZDA 4KC3B 1T0MA 4UV7L 4ZODA 2QADB 3QDAA 5F7DB 1FNGB 3BVNB 5CD5D 4AY0A 1YC8A 3HB3D 3LV3A 3D2UD 4FQLH 1OHQA 2VXTL 3KPNA 2AEIT 4U3CA 2EH8H 3ALXA 4F9PC 5C09E 4KDWA 2ITDA 4CMMA 5SWQA 4LCUA 1RIUL 3QUXC 4BJLA 4PRPD 1X5ZA 5GS0H 1SJVA 4XVJH 1WZLA 1YJDL 2G75A 1NEZB 4YBLB 4OM0H 4JQVC 3VI4E 1UM4L 1ZSDB 3CH8A 3M8OH 3ULUL 3KPSE 4HPOH 5I8KH 3OKDA 5F97E 4ZXBC 4TUJB 4G8GA 5DWUL 2FD6L 3WFHA 5D93C 4HT1L 1C08A 3MLYL 5K9OA 4G7VH 3QUZA 2EXYD 3DVFA 3X3GH 4OLWH 1UGNA 2A73B 1QR1A 3RPIA 1AGDB 2QQLH 3UTTE 4UIKH 2R2BA 1ZGLP 4KKAC 2H26A 4N9OB 3MJ9H 2AI0H 1R3HA 2XIDA 3MYJB 5E0QA 2VXQH 3V5HA 3HI5H 3RZCB 2NR6D 4EOWH 3LQZA 1A7PH 1ZV5A 1H9VA 2YD4A 3QUKA 5BRZD 1RJLA 3EBAA 3ARTA 2BNRA 4UNVA 4PJXE 4RGOL 4HIIA 3U83A 4O2FB 4Z7VE 3GHEH 4GG8B 1P1ZA 3QH3B 1MUJB 2K7PA 3UDWC 1SYVB 1UH2A 2E6PA 3OGCA 1GGCH 4O51A 4KAQH 5KVGL 4NZRL 3FCTB 4L9LC 4KV5F 5J9PA 4UOW0 1TTFA 3BH8A 5ITBL 5E9DB 2VR9A 4YGAB 3TH4T 4PJ7B 1INQA 5F9OH 1NGXA 5DVNA 3GKWH 3UTPE 4NO3B 1UQSA 3U1SL 4OLYH 2BERA 1CDYA 2B1HL 1GCFA 2YPLE 4ODSH 3O2WH 5LGHL 1VA9A 4DVBA 1LO5A 4LCWB 3UBXB 2R69L 4MQXD 1Q0YL 4PJHE 5EU5A 2F8XC 3RI5F 1A6TA 5INCA 4TSAH 1HE7A 3BDYL 1HKLH 2A1WH 3SDXE 5IMMA 1B2WH 4AEFA 1LGVA 4ODUB 4P57B 2ILLA 3G6DH 3DUUA 3H9HB 3SQOL 2GCYA 3P9MA 3VWJD 3JUZA 3BN9D 4PRAA 3PJSB 3WFDH 4OCSH 1KJ2A 4L3EE 4WV1A 3MLXH 4NPYB 2QLVB 2XPGA 5DC4B 2NW3B 1KCVL 4MA1B 1IT9H 5ECJE 3W0WD 3EW3B 2NY0C 4FP8H 4JFOB 1VEOA 4OCXH 2IMMA 4HUUB 4JO1L 1MCBA 4XGZA 4WTWA 1J8HB 1EFQA 3QFJD 4JVPA 4AT6B 4RISH 2DM4A 3AS2A 3EOTL 4D8PB 3RTQD 1FE8H 4PV8B 3O2VH 3BN3B 4L29A 5D7SH 2R4SH 1YNTA 2R0ZL 3H8NA 4MJIB 4NQVA 3OAZH 4ONHA 4M3JA 5LXGH 2X4PA 1ADQA 2XTLA 1I1YA 2CIIA 3MUJA 3QIBC 4WUUD 3WJJA 3TCLB 1F13A 1WCBA 3K3QA 2MNUA 4LAQL 5LKNA 2HN7B 1QSZA 3GMOA 5KSBA 4NO2B 2VLRD 5I19H 4JJHA 2O5XH 1SYSA 4LOUD 3GSXB 2CK2A 4Z8FL 2IBGA 2X09A 3TPUA 3MRFB 4G6AD 5EFIB 4J3UA 3VA2C 1AD9B 2ZG3A 1O5DT 4JM2F 2DTSA 4KUCF 2L4OA 1HQ4B 3QWRD 1ZHLA 1NBVL 1CU4L 1M71B 5IB3A 4WWKA 1NC2B 4UUJB 4QRPA 5DUBB 4HUWB 1H3GA 4Z7UF 4BSWB 4DGVH 5H35B 5MERB 3MGOB 4AG4L 3U0WH 5LQBH 5CEYB 2V7HB 3O2DA 4RMUA 1YPZF 3C5JB 1N0XH 4UOW1 1A1MB 1T5WA 1WF5A 3PE9A 2XWBA 2XZQL 3DHMA 4LVHB 5D71L 4LSPL 3D39E 5E8OB 5HI4C 1FVEA 3O3AA 3ARDC 1S5HB 2VXUH 1HHIB 4PG9A 4DJMA 4Y5VB 4F57L 2UUDH 3S97C 3TV3H 1KYOK 5L2JA 1T03L 4R0LB 2QQNL 3QG6B 2PYEB 4IRJD 3MRRA 4BZ2L 1I3RB 1DLHA 3VXSA 1RMFL 4PGCA 3MOBL 3F58H 1FIGH 4X4MA 3DROB 5C0GA 1Q72H 4P2OD 1TPXC 3MUGA 4W6XB 2HA1A 4OV5A 3LS4H 1H3UA 4LHUD 5DD5H 3WHXA 3BAEL 4HPYL 2YEZA 5E4EB 2VERN 4G6KL 3FT3A 2C3VA 3KPSD 1WVZA 2WM0A 2VR4A 4RFOL 5AD0B 4ODVH 1N6QH 4XPHH 5KG9B 3IAPA 1FN4B 2P8LA 2FBOJ 1RHHA 5IV2A 3EAKA 1JTTA 1S7XA 4QYOA 2AJYH 3LH2L 3QPQC 1BIHA 3O3BA 1X4YA 1YYML 5C0AA 4Z77B 1OTUD 3A6BH 3KYKL 4YHIA 2YWZA 1MCWM 4M6MH 4NQDA 5FA4A 5FGCB 5EUOA 3UTTD 3K4DA 1I7TB 3P4OB 1BZ7A 5GGSB 1UJ3B 4WGWB 5JQ6H 4GMSH 1SBSH 1EO5A 3OTTA 1A4JB 5D5MA 2ITCB 4U7MA 5BQ7A 1MCJA 4MXQD 2XTJE 5F9WC 4WW2C 3MR9A 3N1QC 5D1QB 2I24N 3JTSA 2FR4A 1N2RB 1OSZA 4YLQT 4NN7C 5FV2A 4U1JA 5H2BA 1CDJA 4ZD3H 4P2YA 4UTBH 3HPJB 1OAYL 3O4OC 3ZDXF 3RGVD 1IGYB 3D87B 2R0LH 5K9KA 2YKLL 1IKNA 1OARL 4HS3A 4QF1A 4HLJA 5C8JB 2E9WA 4OUUB 3MLVH 1E27A 4FQ1H 3HMXH 4FQXD 3ME0A 4XP5H 3RUGB 5EU7C 1ZHNA 3I9GH 4MWFA 1WBXA 1AO7B 1CDUA 4J3WA 1CXFA 2DQDL 4HS8H 4Q0XL 3UO1L 2WUCH 2O5YL 3LPGA 2CXKA 2EDEA 5IVXF 3UTPD 2GYSA 4KTEH 3VRLE 3EO9L 5IIEB 1SEQH 2BVQA 2WQ8A 4R4FH 4L5FH 4Y5XB 1VFOA 2DM7A 3L5IA 1DANT 4I0PC 3DGGB 5FO7B 1VGEH 5DJ6A 1IAMA 1D7FA 2YPLD 3O9WC 4JRYE 3V79C 5IOPB 3QI9A 5CZKA 1P7QB 1MCIA 4L3CB 4QHNB 4OD3L 3HG1B 2FEEL 3ARFC 3RQ3A 4HMEA 1K4DB 1QVOA 4QWWC 2P5EA 4GRLA 3K8MA 4DCQA 8CGTA 1IC5L 1VB9A 3AS3A 3MLWL 4HCRA 4HBCH 3IDNA 4EN3B 3IAGC 3QUML 2DWEB 4YGVB 1B4JH 3PIQB 1EHNA 4YIQA 4PJFB 1BFOB 1NUFA 4L3ED 3VXNB 2HT2D 1L7IH 3BGAA 4LLWA 1DVFA 1SQ2N 3NFNA 1A6WL 5EU6A 4LVOC 3WS6C 1FYTE 3KXFD 3QIUA 1FNLA 5FF6B 5L8JB 3MRCA 4JO2H 3WL9B 3T1FA 4LCCC 4FQPA 1IL1A 1A64A 4DVRH 4I3SL 5GGUB 1HZHH 1X6LA 5AEAA 2R8SL 4ODXB 4S1SL 3HMWL 3MLZH 4RWHA 5GS2D 2YUXA 3U7WH 3TF7C 1OAXH 3FAXA 3V4PH 5MEQA 2VLME 4P4RB 5GQBA 3RU8H 1OAKL 4UT7L 1GH7A 4HIXL 1TFHA 2QSTA 4ZQKB 5ERWB 3TO4D 2FX8L 5DRZB 1BVKA 4H26B 4OUOA 1UADC 4TPRL 3BGMB 1H15B 5LWYL 3C5SB 3RWDA 1I1FB 1SVZA 3D2UA 4KJYB 3V5DA 5F6HI 4HFUL 3EYOA 4MVBD 4X83A 4M43L 4OGXH 5AUMA 5CEXB 1CXHA 3NPSC 4QRSA 4Y8DC 4P46C 3VG0H 4G6FD 5FECA 3I6GB 3ULUC 4EUPB 4E42B 2FX9H 2VISB 2EDWA 4LCYA 1HXMA 3HFMH 3Q6GL 4WTZA 5JUEL 4H0IA 2WK2A 1RZJL 1Z3GH 1IEBB 4JFYB 1FGVH 4PTTA 1F4HA 2C4FT 1CFQA 3GSVB 3HS0B 4UTAL 1XIWB 5B38G 3QT2A 4FA8A 3V0VA 1CDHA 4PJEA 5BZDA 1S5IH 2Q87A 4PY7B 4JGJA 1DN0B 1HHHA 5F72S 4UV7H 1FPTL 3D39D 3P73A 4MNHA 2CDEB 1ADQL 3DURB 2JJWA 1LO0L 2EH7L 3PXHA 3QSKB 4PYGA 4NZJA 3V6BR 2VXTH 1EVTC 4F7EB 3IKCA 1TQCC 5HYQB 4NNXB 3K8LA 4K3GA 1H3VA 4F3FB 4RNRA 4APQB 1BD2B 3VFSA 1RIUH 4O2EA 1HYSC 3STLA 3ILPB 3DVIA 3OJVC 1KG0A 4Z6AT 5J6HB 2QBWA 3S35L 3BZEA 1UM4H 4K8RL 3CLFH 3VD5A 4GRMA 4EIZC 3T1WA 3ULUH 4M6OL 1V3KA 5T5NG 4AENA 2BP3A 5FYJD 5DWUH 5KVEL 2FD6H 3VWKD 4HT1H 3MLYH 1X6NA 4ZYKA 5IBUG 4LLAA 1G9ML 4P5TA 5I1IL 4HJ0D 1F3RB 1KIRA 4ODTL 5I0DA 2EE3A 5DQDL 1RI8A 1XGPB 4HJGB 1NGQL 1Z5LB 4K94C 3WIIL 3QQ4B 3EJZC 4PJ9B 1A21A 1KSRA 1MCSA 4YHPB 3O2DL 2XTJD 3B83A 4WJ5A 2YD5A 3WSQH 5TFSL 4PLJC 3MV8E 4OCNC 1WK0A 2G2RB 5DEZA 4YEEA 1Z9LA 4WU7A 3G6AB 1QRNE 2X6MA 4Y16B 1H8SA 2D7MA 1WUNT 4HWZB 4RGOH 2GT9A 3OKNB 2VL5A 3SE4A 2H9GA 3PWLB 4O9HL 2W1NA 1JPTL 2VDNL 3HZMB 3FQXA 3G04A 4PRBA 3QA3B 4PRHE 3LAFA 2A6DA 5KVGH 4NZRH 1JTPA 3BIBX 4TUOA 2HVJA 1UCTA 5ITBH 1ZS8A 4P3WA 4M6NL 4NQCB 3RVWD 1LO4L 2FYYA 4WW2F 5CSBA 4LNRB 3ZDZF 1L7TL 4MMZC 5D1XD 5GRVK 5GS3A 5MHSE 2LTQC 3U1SH 5MEOB 3PL6A 4M48L 1N26A 4S0SD 4KKLC 2CO7B 3RWIB 4UV4L 2B1HH 1QEWB 4K94H 4V1DA 1ZLVK 3IU4H 3LRSA 4JRYD 4JLRB 1C1EH 3U48A 3B9KD 4WUKL 4X7TB 5LGHH 3SKJH 4PR5B 2R69H 1Q0YH 1S8DA 5BXFB 5H94A 1T66C 2PUQT 5AAWA 3T2OA 1UH4A 4Y19A 1TDQA 2FJHA 4WUUA 5J06A 2HT4D 4L4TB 1WJ3A 1QLRB 2RIKA 1KPUB 4N0UA 4JFXB 3OKOA 2CQVA 1FZKA 1I1AB 4C83B 1VFUA 1FYTD 4JZNB 3DI2B 1HSAB 1KCVH 2LE9A 2WP3T 4PB0L 2KZWA 4YBHA 2PO6D 3GMQA 4JHBA 4Y1AA 3RWHA 4LRIC 3QUYD 4XP6L 4JRXB 4JO1H 5I18L 5GIRA 1PQZA 4NQEE 5D7LE 4RQQB 3OZ9L 5DJAA 4RIRA 5CEZE 3EOTH 5F7MC 5FAAA 4BSJA 1QNZL 4MX7B 1RUML 3VGAC 5E8EA 5A2FA 3GSNB 1Y0LA 5SX5H 2R0ZH 2VLMD 4M9OA 3U30B 3C6LD 5HHXL 1TJIL 4RFNB 3TWCL 2ADJA 1AD0B 4H1LH 1DEEB 3RGHA 3UPRA 3U36A 1VPOL 5F89B 1TIUA 4LAQH 5DMYA 4QHUB 3LKPA 3C8KA 5IFAL 1AKJB 3ULVE 4Z8FH 3U0TB 3WHE1 3ZT5A 5ACZA 3S8WA 5CSZB 3KPQA 4GBXC 5C09A 3FB6B 2X89A 3QEQB 4CVXB 3JVGA 1NBVH 5JORA 1CU4H 5ANMB 4H5SA 1RZIB 3HPLA 1C8PA 3BEWB 4NHUB 4LHUA 4JFDB 5HJ3A 1NCAL 3KPSA 2X40A 2BHYA 4L8SA 4YDLC 3PABB 3RWFB 4ZUWB 5TH2A 3QJFB 4AG4H 1B3JA 4LCWE 2ATPB 3BYTA 4F7PA 4KVCL 3NIDF 4FQJL 2N7BA 4XMKL 3HTLX 4ZO6A 4JM2B 5EIIB 5B3NA 2VDQL 3ALPA 4U6YB 2XZQH 1UVQB 3UTTA 1GGTA 3U9PL 5L6YL 2DQHH 1NUGA 4S10A 3TVMB 2PW1A 4PREA 1WIUA 4J8RA 1FL3B 3KAAA 4NSKB 4P4KD 4F57H 2VLKA 2FLBT 2BNQE 5TE6L 1T03H 2Q86A 2QQNH 2APBA 4BZ2H 3BSZL 2OM5A 1FNEB 1PGRB 3MOBH 3A6CH 2VYRE 3VMPA 4HXAL 4PJAF 2WBJD 3ARQA 4PJXA 4HPYH 1MFAL 2XICA 4I0CC 2H41A 4G6KH 4PGEB 4FQXA 4K3HA 3RX7A 4RFOH 4KTDL 3MMEA 2P1YA 3GJFA 2YA1A 2YS4A 3ARYA 2NLJA 5FB8A 1I4FB 4PJDF 1YYMH 4R7DA 1KPVA 3P40A 3KYKH 2B8OT 2R1XB 2BCKB 2E6QA 3IT8D 4PJCE 1A22B 3BQUD 3TT3L 3F5WA 3DGCR 2X4RA 3SKUD 1E4XL 5GRUL 3PGDA 4JREC 1OWRM 1FC1A 3WUWG 3REWA 5K59E 1G7HA 2F74B 1MLCB 3MV8D 1HXYB 2G5BA 1Y6KR 4XWGL 1S7VB 4IHOA 2A6KB 1AJ7L 3GSWB 5I8CA 2WBKA 1F45A 3S4SG 2YKLH 1OARH 1QRND 5DHVA 5HGDB 1VENA 2CH8A 2V5TA 3SDXA 4D0DA 5DXWA 4S1QL 3QUXB 1XR8A 2WLYA 3ZDYF 1KFAL 4Q0XH 3EUUA 2FH8A 3UO1H 4ZOCA 2O5YH 3MCG1 3O6LL 5A3ID 5B39B 1NKOA 5MHSD 4ZXBB 2YSSA 4GH7B 2NNAB 3EO9H 4DZ8B 5D93B 3G5YA 4LLYB 1CE6B 5E24E 3KLDA 1IGTB 3DUSB 2B39A 1MI5E 3G5XA 3SQBA 1L4IA 1JVKA 1OAUL 1UB6A 3BP6B 5T1DL 1RIVL 1V7NL 2EC8A 2IANE 1UB5B 2HFEA 2HTLD 1VACA 3QIWB 2HRLA 4NJAL 2XRAL 1UZ6E 4N8CL 1W0YT 5DJYA 1IC5H 1YYLL 3KPRB 5KBNC 4C54A 5IVXB 3MLWH 4PBXA 3N06B 5C07E 3TO4A 3GSQB 3Q6FA 2VNCA 3QHZL 1LE9B 5EBMA 3MV7E 1XF4A 3LSOA 1U8KB 4NP4H 3ARGA 5IB4B 3NFPB 1A6WH 2H6PB 2I27N 1RZGA 3ARBC 1I7ZA 1PY4A 5ESAA 5EOTB 4XPFL 4AYFA 2VLJB 4L9LB 4OF7A 4XCNA 5SWZE 2R8SH 1J05B 1CFSA 4JJ5A 4S1SH 3HMWH 1KACB 4NQED 3FN0L 3I6KB 1P7HL 2AK1L 5CEZD 1RZJC 4GUPA 3LRGA 4M7JL 3EHBD 2APWA 2MQ0A 4KRPC 5DJ0A 1KELL 3FOLB 5JIKA 3MROB 4JFFE 1FZMA 3T0EE 5ESQB 5TGBA 1X4XA 1OB1A 3JV6A 1WBZB 4Y8AA 5HI3D 1PX3A 2FWOA 4TVPL 1OAKH 3ZSTA 5B3JE 3RZCD 4HIEA 4UT7H 5BVJB 2MKWA 2A6IB 4G9FE 4H88L 1XGQA 4HIXH 4RMQA 3KS0H 5JPMB 4LU5H 2FX8H 3OAYK 1YEKL 2D2OA 3ARRA 5IM7A 1R5VB 3LB6D 4TPRH 3BPCB 4FTVB 2LAAA 2JCCF 3O0RL 3ULVD 1MRDL 3IDGB 4HFUH 4M43H 4HMDA 3EO1B 1JV5A 3TT1L 5E9DD 1V8HA 4K8RC 5ISZA 3OB0K 1DDHB 1KJ2H 4Z7QF 1HNFA 3BZFA 3TIDB 5FDYA 3DXAE 15C8L 2NY0B 4KVNL 5F7YC 1MHHB 2VKXA 1G9MC 1TZIA 3Q6GH 1MCOL 2BVEA 5JUEH 3D18A 3LEXB 4WWKC 4NC0B 1RZJH 1MCNA 4XTRC 3P4MA 4P49A 3IJHA 1E4KA 4LCWD 4UTAH 1I3GL 1LO2L 2X4TB 2OQJB 2ZCLL 2QR0B 3VJ6B 2XQBL 3BPLC 3VGGA 3E3QC 1RZ8A 43CAB 5E94A 1FPTH 3SHSA 2JB6A 4YNYB 3O4LE 2V2TA 3V5KA 1ADQH 1JWSB 2DQFA 3MRDB 1LO0H 2EH7H 2J8OA 3C87A 5D6DA 3KYMB 3QIBB 4M93C 1F90H 4MNQE 1FSKC 3VE0B 3W2DL 2W9EL 1LEKB 1MFDL 2BSED 2XKNA 1JYNA 3IAQA 3T8XB 1LEIB 2X1PA 4OZGF 1FZOB 1DL7H 2ICES 3MFFA 4UOJA 5GZNC 1KV3A 3VFMA 2XKSA 2X1OA 4TNWF 4LSUL 1X9QA 4K8RH 3I02B 2IADA 3GNML 4JAMB 4M6OH 4GMTL 3B9EA 4OGZA 3EOBA 5KVEH 2VE6B 1CFTA 2NX5B 3T0VA 5ICZB 1G9MH 1UWEL 5HHNA 4OIAA 3OSKA 1TZGL 4Q2ZB 5I1IH 1GJIA 4ODWA 1KENL 5ILTH 1W2KT 1X5AA 2C3WA 5DQDH 3C5ZB 3RDTD 4K7PH 1QA9B 1E4JA 1NGQH 2R2EA 5D1XA 3L5WA 1NGWA 2YK1L 3VFRA 1JNHB 2V2XA 4JVWA 4ACPA 1FRGL 4FG6D 4U1SA 3O2DH 1D5IL 3BUYB 3D0LA 4JRYA 4OLXL 3B9KA 2BVUA 2DQIL 2W60B 5DQ9B 5TFSH 4X6CE 5HDBF 1W8OA 5IW1A 3ARDB 5DD3L 3H6JA 2NYYC 1FIEA 4RBPK 2CLRB 1NBZB 1AE6L 2VDRL 4JO3L 1L0YA 3E6FB 3DARA 4MA8L 3PQYE 4EQ3A 4O9HH 1X7QA 1IKNC 4JDTL 4NKDB 2VDNH 4P23D 1GHFL 4Z9KB 5E2WL 2XWTA 5JHDB 2FEEI 3RPKA 1T1ZA 1BF8A 4AIZB 3VGHA 1AR1C 4HK3J 4M6NH 3ECBB 1LO4H 1FYTA 5GGRA 3S3SA 1U8JA 4MSWA 1L7TH 2PO6A 4U6HB 1OP3K 4QRUB 1EFXD 5ID1B 1ZVHA 4E9LA 4M48H 3BZDA 4UV4H 1MI5D 3R4DA 1KXTB 1CR9L 2GUOA 3V6ZA 4WUKH 1DP0A 2IAND 4DTGL 4BKLA 1P53A 3NIFE 2V5YA 3QI9C 1FC2D 2PYED 2J6EA 3C6LA 5F9WB 4JKMA 4WW2B 4P2QB 4LKCA 4FQQB 1OGAA 1YC7A 3GSOA 4GRLC 5I17B 4M9PA 3N50A 4NN7B 1FO0B 4Q6IA 2GHWB 4NN6C 5C07D 5IESL 1NCNA 5JZ7C 1R24A 3O4OB 4U1KB 3MV7D 4LPTA 4YHNB 2W0PA 1UEMA 1WC7B 4DOHB 1OLLA 5LVEA 1I7UA 3HN3A 1H3WM 4DGIL 4PGZA 1BM3L 4PB0H 3BRGC 3WFCL 3QR2A 5SWZD 5I18H 3QIUC 5HY9B 5ESVB 4NBXB 4FNLL 3DSNA 3OZ9H 3EJJX 4JEGB 1XF5A 1T7VA 1QNZH 3ZE1F 3EDJA 1P6AB 2A77L 3P30L 5SV3A 3U0PB 3B43A 4AIXA 1C5CL 3KVQA 1DQJB 4XWOC 4JFFD 3T0ED 1U8OA 1FL5A 1SBBA 5F7FA 5D1QD 2R23A 4I0PB 3QG7L 1EEZA 3QXDA 1TJIH 3O9WB 4JCLA 3TWCH 3X12A 1VADA 3FQRA 2NY1C 2AK4B 2P5WB 5CJ8A 3ARFB 2V9TA 1JTOA 1YMHA 1FL6A 2RAMA 4L8DA 4WFGE 4WDIB 1A9BB 3ZL4L 1ZT4B 1ZANL 1DBJL 1NEZG 5C0JA 4JN1L 5CD5C 3QJHA 1TJHL 1MREH 4HCRH 3HB3C 1Q1JH 3G5VB 5E5MA 1EVUA 3ZHKA 5EIVA 3S3JA 1O0VA 2GQHA 4XVUD 3IFOB 4K3DH 3GKZA 3GMRB 2WBJA 5J0BA 3DXAD 4GS7C 5EZJB 3MRJB 2D31A 3AM8A 4NKIL 4OBRA 4LCCB 1NCAH 1U6AL 5FKPB 4AM0B 4EVNA 1P7QD 3ARUA 5HVHC 3WNKA 5EC2A 4KVCH 4FQJH 1MRFL 4XMKH 5CAYB 2WQRA 1Q94A 2VDQH 4R97C 4U1NB 1KNOA 1G0YR 3O4LD 3VGBA 5L6YH 3U9PH 4I9WD 2EXYC 3SKMB 3X13A 3BQUA 3F12B 4MNQD 4JY4A 2QEJA 5C71A 4ZAKD 4BELD 5C0DB 1TZHB 1LP9E 3BSZH 1T5XB 1BJ1H 3IJSB 2R2HB 2ZOLA 5I1AA 4F58L 3B9AA 1XCTB 3BXNA 3MRBA 3RIAK 1I9JL 5JW3L 4NZUL 1T1XA 3WLBB 4OCMC 4OZIE 4QXTA 2DOCA 2VQ1B 4G8EA 1MFAH 3FONA 3NPSB 4JANA 5TQ0H 4P46B 1B0WA 4R4ND 2HG5B 2A9ML 8FABB 1P4BL 4KTDH 4PRHA 1EEYA 5HHME 4UBDD 2ZUUA 4MJ4A 4IRSA 1RUPL 3FN9A 4F7TA 3UBXG 3PDOB 4LPYA 4M3KB 2ZNXA 4M8QB 2YBRA 3TT3H 2AEPL 5C6TL 3IB4A 3NZ8A 3TBWB 5GRUH 4JFEB 2GW5A 5HHOE 4WHDA 1P7KA 2DKSA 2HFGL 2PF6A 5DMKA 3CXHK 1FVDA 4OFIA 4XWGH 1AJ7H 2V2WB 4YDJB 4EDXB 1N59B 3SDCD 1TQCB 4PJDB 4YE4H 4X7CC 4B41A 4YPGB 3FQTA 2X9WA 5H8DA 4X6DE 4S1QH 2X4SB 2K7QA 1CIDA 1NCBL 3O6KH 5GHWH 1OLZA 3SE4C 1KFAH 3MLTB 5EUOF 3VWJC 5DVMA 5L8LB 3BN9C 3O6LH 4ONGL 4U6XA 5KN5A 5M94B 5D5MF 3N1MC 3MCKB 2LU4A 3BX7C 1XIWD 5JQHC 1UACL 3VXME 4CNIA 4NQEA 5D7LA 4P2CG 1CG9B 2PTUA 5I6XC 1OAUH 5T1DH 1V7NH 3ZE0E 1RUAL 4QXUL 4XCEA 3RTQC 2IPUG 3ROLB 4NJAH 2XRAH 5I1EL 4N8CH 3SPVA 1JGVL 3P4NA 4R3SA 4CKVX 1YYLH 1BD2D 3UCRA 2OXHA 3GSUA 2MQ3A 4M7LL 1KCKA 2CLZA 2ENYA 2AKRA 1X5XA 2IPUK 2VOTA 4I18A 5F9JA 3V8OA 2DKUA 1R3LA 2AERT 3VXRB 4JG1H 4XVSL 3IDIB 5DUPL 4I3RL 2BOBA 3VFTA 3AU1B 1A9EB 4LBEA 4OFVA 3ARPA 3VH8B 3C2AL 2YD2A 4XPFH 5KOMC 2B5IC 4KMQA 2CMRL 2HRPL 3NVQA 3U9UB 3RHWK 2WWKT 4PJ9D 1XH3A 1HSBA 4M7JH 3HUJB 4W4OA 2GITA 3V6FB 2V7NB 1KELH 2LTQB 5I76A 3NTCL 4FN0A 4M7ZC 3ES6A 2C4XA 2ED7A 4NC1C 3H3PH 2P8MA 5I1CL 4ZOBA 4NRYB 4TVPH 4QXWA 2CSPA 1S7SB 5E08L 3DV4B 4K7FA 3R0NA 4H88H 4H1LB 1J87A 1HOCB 1C5DB 1YEKH 2WIIB 2XQYG 2Z9TA 3ROOA 4WHTB 4WFGD 4Y16D 3FQWA 1T4KA 3O0RH 2QHRL 2J6EL 1J7VR 5E4IA 4N8VA 2BNQA 5C9JA 1ED3A 2H2SD 1ULVA 1ACZA 2XQYK 1WV7T 3TT1H 3KJ4B 1HKFA 4PJ5E 5FOBA 3AROA 4MNGB 4ZSOE 1WICA 3LKOA 2OS7A 3E8UL 4WNQB 2Y06H 3QEGL 3O11B 1IM3A 4N9GA 1A7NL 15C8H 1GZPA 3JVGC 1ZMYA 3VI3E 2HVKA 1JF5A 4HUKB 2FZ3B 1I8MA 4N90E 2VZSA 3C60D 5J11C 3NCBB 3SY0A 3FRPG 1E6OL 1I3GH 4L8SC 3VGAB 3CC5B 3VDBA 1LO2H 1OP9A 4F80A 4OI9A 2ZCLH 4RZCB 2ZWLT 2XQBH 4QTIL 1Q9LB 5DJ8A 3RDTA 4BQBA 5GZOD 3SOBL 2MHAB 1ES0A 4PJCA 3CPLB 3S3PA 1JN6A 4ALAL 1YUHA 5CGYD 3MUHL 1OTUC 5C92A 4PJGE 1EAPA 1MIML 2Q76B 3OXRB 3W2DH 5C0EA 1QPPA 4N0CD 3D6GA 1MFDH 3MRLB 5CJXA 3L3JA 1W72L 4QY8B 1QD0A 1OT1A 4MXQC 4FABH 1QLFB 4EXKA 1WWAX 4JPIB 5GISL 3MRIB 4N0FA 2EDDA 3LY6A 1K3ZA 2VLJE 4GBXB 4LSUH 5ITFA 3RGVC 4CADA 4DW2H 3GNMH 3X11A 4GMTH 3MA9L 1S7RA 4P23A 5GGSY 4PJEF 4Z7NF 3MOAL 3BIKB 5T3XE 3RVVD 1PZ5B 2OR8A 2VUOA 4TTGA 5HHMD 4ISVA 4FQXC 1UWEH 5GSVA 1KENH 3L9RB 3PWPB 3KLHD 4OZGB 4YDLB 4I5BA 1DUYB 3I3BA 1EFXA 2YK1H 3D9AH 3UC0L 5KW9L 1FLRL 3HC3L 2EYRA 1YQVL 2J4WL 1FRGH 1MI5A 5HHOD 3DVNA 2C7UA 1D5IH 4OLXH 4BZYA 3MFGB 4OAWA 5D2NE 1YY8A 2IANA 4HGWB 5KS9E 2OZ4L 4M1DL 4U1HB 3V4UL 1DBBL 1T0MB 5DD3H 2A0LD 1KN4L 5JLZA 4L4VE 2VDRH 1A02N 3WN5C 5JW4Q 4MA8H 3LV3B 1KUMA 3KPNB 3L3HA 1IM9D 1JUFA 2CJUL 3QISA 5BO1L 5C07A 3OMZA 5E2WH 3SCMD 4GAJL 1KIPA 2ITDB 3MV7A 4CMMB 5SWQB 4LCUB 1V3LA 4DKEL 4NWUL 5DEGA 1XZ0A 2FEDD 4HZAA 2HT2C 4Y4KA 2G75B 4P59L 3CD4A 3BWUC 3DUHA 5SWZA 4A6YA 4Q9RL 3GJFH 5M95B 3OKDB 4G8GB 3WFHB 1C08B 3IETA 3RA7H 5K9OB 2H2PC 2UY7A 3QUZB 4JFFA 4DTGH 4RMSA 3T0EA 2DIJA 5EU3A 1QR1B 3RPIB 3FQNA 1CYGA 2R2BB 3AUVA 4JREB 2H26B 4JHWH 2GSGA 2VDML 1FV1A 4G9FA 2XY2A 2J8HA 2DQEL 2EYSA 3BP4A 4MS8D 5IESH 1R3HB 1KLUA 3V5HB 5GS0D 2XZZA 1U8IA 2ORBL 3CSBA 2W9LA 4YFLI 1OP5K 3LQZB 4EUPG 4YFLF 2JELH 3TO4C 4HLZG 1OM3H 2YUVA 5DHVH 3QUKB 3QRFM 1FG2A 4XBEL 4DGIH 3OKMA 1BM3H 1RJLB 2BNRB 3ARGC 3WFCH 1JZ4A 3AS1A 4HIIB 4V2CB 1P1ZB 3FKUS 2VSDA 2DF3A 1OTSD 3OGCB 4FNLH 3QDGE 5I8OL 4Z7WE 5GGTA 4O51B 5B4MD 1CCZA 1CGVA 4MDIA 1AP2A 1QYGL 3DVGA 3DXAA 5I66A 4KRMB 4ZUSA 3BH8B 2A77H 5J9PB 1Y18A 1C5CH 1DANU 3QWOA 5TQ2H 2QTEA 1INQB 3QEHA 1NGXB 5D4QA 1UQSB 3GBML 1IEAA 3K7UA 3QG7H 3GMLA 4YX2L 1OAQL 4X6EA 3WIFA 4EDWH 3DV6A 5I30L 5IBLD 3TJHD 4U1GB 5IK3A 5EC1A 2YD9A 3O4LA 4DVBB 1LO5B 1KTLA 3BO8A 3T4YA 3ZL4H 4BUHA 1MFBH 2GKIA 1ZANH 1DBJH 5HVGB 4IOFD 5EU5B 3FT4A 4MNQA 1IARB 1A6TB 4RA0C 4JN1H 5INCB 4ZAKA 2H8PA 1JF6A 1TJHH 5EZIL 2JKXA 5HSFA 1KN2H 4PJ5D 5IMMB 4NQSA 4QOKA 1KB9J 2GCYB 3P9MB 4PRAB 2IFGA 1SHMA 3ULVL 3ARBB 1YY9D 1KJ2B 3QULA 4GOSA 1Z0MA 4WV1B 2CK0L 2XPGB 4PLOB 2EIDA 2CDFA 4NKIH 1U6AH 4N90D 4I8DA 1GZQA 5IR1A 1AGEA 2V6HA 1NFDE 1EX0A 3QIWD 4KKAD 4KRPB 4QGTA 3KR3L 1K2DA 5I15L 1E4KC 4MJ6A 1J0KA 5F88A 4HJ0C 4L29B 1YNTB 4NQVB 3RY5A 1G6RA 4ONHB 3QAZC 4CU8A 2X4PB 1I1YB 1D9KD 1RPQA 2CIIB 1LK2A 5D7JD 4BA8A 2ZSWB 2VC2L 5D6DC 3T09A 3OKEA 4DOHE 2K3TA 4X6CA 3IS1X 3KPPA 4XZUA 2D0HA 1WCBB 3HE6D 2XTJC 4KK6D 3PG2A 3VI4F 4F58H 3RRQA 4OFPA 1I9JH 3GMOB 2X1QA 5JW3H 5KSBB 2ZJSL 4NZUH 5EU7E 3SDCA 4MYWB 3T65A 1WEJL 1LILA 2VLJD 1SYSB 3PQYA 4XX1G 3NN8A 1AC6A 3TPUB 3CDFA 3H0TA 2WUBL 3QXUA 5C0RL 4F7CA 1UWGL 1P4BH 5T3XD 1QSEA 1K6QL 3NH7L 4KJWD 5TDPA 4WW1B 3HI1A 1ZHLB 2AW2A 4CMHC 5IB3B 1RUPH 3L3KA 4WWKB 4JFZL 4QRPB 3ZTNH 3RVWC 3HE7A 4U7SA 4YXLL 4CVUA 1DJSA 2AK4E 2P5WE 2AEPH 1KT2A 3JV0A 5C6TH 5D1XC 4F33A 1BREA 1Y6MR 1FFOB 1L9MA 1OGTA 3BPLB 2Q3AA 1UA6L 4LGSB 2ZUWA 4FTVD 5DJCA 4PV9A 5C6WH 5E8PA 4PJXF 3AAZA 2BVYA 1T5WB 4Z7VF 2XWBB 3B9KC 3OR6A 3T3PF 5IHZA 4M93B 4OZHA 1FSKB 1FVEB 4Z78A 3O3AB 4PG9B 3STZA 3O8XD 5L2JB 2AEQL 1MHCA 3MRRB 3ZO0A 1DLHB 1FQ9C 3VXSB 3QRGL 3O41A 4PGCB 4WU5A 5J1AA 5FO8A 3GGWA 4G8IA 1MIEH 4MHHI 1NFIA 2C3XA 5C0GB 1NGZA 3LKQA 2XZCL 2DLFL 3MUGB 4OV5B 4ONGH 3RI5K 3WHXB 2BFVL 2YEZB 2Z31A 1UACH 4JN2A 2C3VB 2R56L 2PO6C 4YHLL 2R1WA 4YO0A 1XF2A 3O6FA 2MMXA 4PJHF 5E6ID 3TLRA 2P8LB 1RHHB 3B3IB 5HXMA 5IV2B 1BFSA 1S7XB 4QYOB 4MA3A 5C0AB 1RUAH 2OBGA 3O3BB 3QIBD 4MJ2A 4QXUH 3BKCL 4YHIB 3SDXF 4FZ8L 3MRPA 4NQDB 3U7AA 5FA4B 5EUOB 3TP4A 5I1EH 1KB5A 1JGVH 4NYLA 1BZ7B 4OKDA 5D5MB 5BQ7B 5CINL 3C6LC 3HNSL 3MR9B 4MGXA 2AABL 3A67L 3JTSB 1OSZB 1CE1H 2WINA 4XVSH 4U1JB 4Q6IC 5H2BB 5DUPH 4I3RH 4A2LA 3OR7A 2VZVA 2YHGA 1G7PA 5K9KB 2NY5L 4HS3B 4HWNA 4NFDA 2Q8BL 4QF1B 1PW3A 4OB5L 1S9VA 3C2AH 1E27B 1VGKA 4NKMB 3CK0L 3ZYOA 3BP5A 3QDGD 4AH2A 1ZHNB 3C5ZD 2CMRH 2HRPH 4HUMB 1WBXB 1CFNA 2I26N 4K2UH 3MODL 3QCTL 2R4RL 4R9HA 3RP1A 1EDQA 3ZKSD 2VR5A 3CVHA 3NTCH 5I73C 3CIQA 4UDUA 3VFPA 1FYHB 3MXWL 4JFEE 2Y9RT 4P3CL 5I1CH 1I3UA 3C60A 4A6YL 3V7AE 1QFPA 1XGUA 2BVQB 5HI4D 5E08H 3NABL 5DJ6B 5F6HJ 3QI9B 4Y2DD 3VA6A 5D7IA 1SJHA 3OF6D 1A6VH 2QHRH 2J6EH 4NGHL 1QVOB 5MEPA 2P5EB 4GRLB 4DCQB 1UT9A 1ZLWH 4NN6B 5JHDD 1FAKT 1LP9A 4N1HB 1G6VK 2G60L 3BIAX 4P4KC 25C8L 1T22A 3IDNB 3AS0A 3PGCA 3EYUL 3RBGA 3E8UH 4YIQB 4OZIA 1BQHA 3BD5A 1EXUA 2P46B 3D85A 2Y72A 4LLWB 5IB5A 3NFNB 5EU6B 1T6VN 2F15A 3P0GB 3QIUB 2WBJC 3OHXB 1J1OL 3MRCB 4KZDL 3AM8C 1Y6NR 3T1FB 1ONQA 5SWSE 1E6OH 6FABH 5GGTL 5GS1A 4MQ7A 1P2CA 1CDGA 3OJDA 3SGEH 1J9CT 3PHSA 3SOBH 4E0RA 2FHFA 5MEQB 4ALAH 1AXSA 1OT2A 2PTVA 3HNVL 3OWEA 4P5KA 3CFEA 1U92A 3CX5J 5DK0A 2NY1B 1BJMA 5HHOA 5SX4H 5J1SC 3BQUC 1I85C 4NNPL 1KJMA 3H9SE 4PTUA 1JGDA 1HH9A 3FO9A 5A43C 1YEHH 2IBZX 4PP2A 2DWDA 4C4KO 5BMFL 4GKOA 1HDMA 2OX5A 3CLEL 4XC3L 4BYHA 3CGTA 4HWUA 5B39G 3RWDB 3D2UB 3NA4A 3QEUA 3V5DB 4R6UA 1JYWA 1GIGH 4FFYL 1IM9A 3BOVA 4X6DA 3EYOB 3MA9H 3MOAH 2F53A 4NT6A 5AUMB 1NC4D 5F96H 3SCMA 4QRSB 4JPKL 1FFPA 4LKXA 4GS7B 2ZUYA 4TTDD 1MOEA 4UZGA 2EDOA 4LCYB 1HXMB 2IAMA 3O9WD 3RWJA 5F1KC 3UC0H 5KW9H 1FLRH 4IRSC 2AK4D 5A3IC 3VXMA 4KZEL 2P5WD 1WZ1H 1X5YA 1WISA 1B9ZA 1LEGA 3MV9A 1YQVH 2J4WH 4PTTB 1CFQB 4R97B 3INUH 3HAEA 3NAAH 5IB2B 3HC4L 3V0VB 4PJEB 5BZDB 4M1DH 5JOPE 2NTFA 3V4UH 1DBBH 1HHHB 3VRIA 1G6RL 3P73B 1KN4H 4MNHB 2HTLC 3LKNA 4GAFB 3FB5A 3OJ2C 4XC1H 3WCYA 3P0YL 3LCYA 3QWQB 2OL3A 4MNGE 2AGJL 5I1LA 1YDPA 2BRRL 2JJSA 3B6SA 3IKCB 5BO1H 1QG3A 1YQ2A 4RNRB 4GAJH 3ORJA 3DIFA 4NWUH 4O2EB 4DKEH 3VRLF 4YZFE 3T2PA 3X3FL 1KG0B 1K4CA 3L7FA 4P59H 4TSCL 4O5LH 4NUJA 2FIRT 1B0GA 4GRMB 4Q9RH 3T0AA 3KJ6L 1LMKA 4ZYKB 3VG9C 3ZKXC 4UU9A 4PLKC 2W92A 4IRZL 4P5TB 4PB9H 4DKDC 5I75C 1JIBA 1KIRB 1WBYA 5CJQL 4X4ZA 2W0LA 3EHBC 1JHKL 2E7MA 3HZYA 3MX0A 3DOSA 2VDMH 2B0SL 2DIAA 5JHLL 5HI3C 3UJIH 4WJ5B 1IGML 2ORBH 1RZKC 4JKLA 2APXA 1CT8B 3RVTD 4UDTA