3SDCC

Crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-globotrihexosylceramide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
191
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSACANAFNNIPEDTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 191
sequence length 201
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdcC02
1R5IA 1U8MB 3D6GA 5E5MB 1AI1H 5C08E 4NN5C 3WSQH 1J1PL 4KV5F 4KJQC 1RUKH 3SCMC 4RMQA 3V0AC 1CGTA 2Q8AL 5HGHA 1QLFB 5DMKA 4HKJB 4ZUVB 4DN4L 4RZCA 5F7EH 2AXHA 1MQKH 4NO2B 5DQJA 1TIUA 5EU3A 4I77H 4JZJA 5ESQA 3LHPH 4LKCB 1QUNA 4J4PC 3BP4B 3K4AA 2YSSB 1KJ3H 4OZIB 4YHOH 5ITBH 3OJVC 3WXWL 1INQA 2LV4A 5F8QC 4XCNB 2JJTC 2Y23A 4PD4K 5CGYD 3RVWC 1E27B 3HKFA 1QFWL 4PFEA 2QL1A 5EOQL 3CMOL 4FMFA 5SWZA 2RJMA 1MH5A 3O8XA 4JFFD 2H32A 3TCLB 4OF8A 2ENSA 2UUDH 4G9FB 5DHVH 3T4YB 5B8CC 2NPLX 5H2BA 1OLZA 1JYXA 1CFNB 2BVYA 3EKCA 1X5FA 3MRGA 3ULVE 5HI5D 2FECI 2R69H 1I8LC 4L9LC 3MRCB 4GG6A 3VWJB 3VCLB 4QHUA 4Z7UF 3TM6A 4PGJA 3TT1L 3MLSL 3ZYZA 1BEYL 2ATKB 3NH7H 1ORQA 2L0DA 4CVZB 2IQ9H 3WHE1 1ZKAA 5E24E 3PQYB 2FBOJ 5KOVC 1Z9OA 2XWBB 1IEAA 1NFDA 2BY2A 3VG0H 5D1QD 2MJWA 2O26U 3OXRB 1UWGL 4HT1L 4MSWB 3NABL 5CILL 4DGYH 3FO0H 2CD0A 1AQKL 1B0RB 3GJEA 4CADB 5HHOA 5E2VL 4ZUTB 2GEEA 4WY7L 3MMEB 3IDJA 4MA1B 4B53A 5JXAL 3QIUC 3QFDA 4LPXA 4R4BB 4YHIB 4BSWA 4ZAKD 3K8MA 1NMCC 1OVZA 4L4VA 2NZ9D 4UT9L 2DDQH 2WP3O 3HE7C 4PRNB 3QXDA 5E2JA 1QFWH 1S7XB 2V5MA 4ZXBB 3I3BA 3GI8H 4ODSL 3B9VA 3HR5A 4MMZC 1NBQA 1FC1A 1H0DB 3MJ7B 2P5WE 5EFIB 2JKXA 4PRPD 3S97C 3WUWA 1KNOA 3MRDB 3G9AB 5LAXA 3G6AA 2I5YL 1RY7B 3TPKA 1K8DB 1N5AA 3ZSTA 1M7DB 2VO5A 4CJ0A 1XGPA 3PWLA 1FGNL 1VFAB 2OK0H 3MACL 2HFGL 4KVCL 5DMJB 4M7ZB 4ZPTA 4NKOA 3MLYH 3ULUF 5IG7B 1GVIA 1XIWC 3MBEA 4A6YB 4Y2DA 5BRZB 1UA6H 5CJ5A 1JWUB 5J1TC 2AAVA 4HX1B 5L2JB 1ONQB 2ESVE 2N1KA 4FTVA 1VEPA 2Q76B 3QDHA 2DM4A 2YRLA 4RBPH 3RZWA 4CUCA 3CX2A 3W5MA 3IRZA 4KHTH 5GS1C 3SJVE 4NM4L 4PGZA 3GDBA 2QV2A 3QEQA 4EUPG 1VSCA 3DV6A 1TJHL 3KHQA 5FYLD 3QEHA 2I9TA 1Y18A 3GK8L 4ORGB 5K9OA 3S8WA 3TIEB 4G6MH 1K9TA 3IXTA 3R0MA 4JRYB 4U2YA 2ITCB 4WY7H 2VERN 1FG9C 2A6JB 2GHWB 3RJDA 4G43B 4UT9H 4ZUUA 4PG2A 1Y0LB 4LARL 4RGMB 5IF0B 2Y06L 3FQXB 5D1XD 3O3EA 4HKZA 3MRBB 5LCVL 4KTEL 4ZDHB 5T1LA 3PJSA 4PTUA 1I7UA 2CK0L 2OQJA 4NZUL 4UIMB 1FL6B 2F8XC 5I6XC 1EBPA 3BAEH 2P49B 1OCWL 5DVKA 1JV5A 5I73B 4RFOH 5T3ZD 2J1KA 5F9DC 4O2CA 5JUEH 5ICZB 2NY6D 4P5MB 5BVJB 1A1MA 1C12B 1XGYL 3U0WH 3IAQA 2R2HA 2B7DT 2G2RB 4XNMB 1JZ7A 2QSTA 5LWYL 5EZOL 1JVKA 2P5WA 3NTCH 3LPFA 3QG6A 1NCAL 4PJ5A 2IAND 4Y88A 5D93B 1NBZB 3K74B 3MTRA 3V5DB 1FNEB 2X4PB 1JPTH 2BOBA 3Q5YA 3GNMH 2VWEC 5E2UH 4GKOA 5LBSH 1A6TA 2VQ1B 4YHZH 1MIML 4JPKH 3UAJD 1SYSA 3TBYB 1G9NC 3NCBB 4Z77A 3GK8H 2R4RH 4P3WA 1Q72H 4XWOC 5CD3B 4N0UB 4NQEA 3C5ZA 1AE6L 4OZGA 1HYRC 1Q9KA 4PRDB 4Q6IC 1JWSB 1PYWA 3LKQA 3M8OH 4ZNEE 4P4KA 5IQ7L 1T3FB 3QIBB 4HCRA 5F9WB 2GY7B 2XYCA 43CAA 3UTSE 5HGDA 2COQA 4C56B 4MA7H 2VZUA 1CK0H 4WEUD 3U46B 3MLWH 1CDYA 5JIHA 2F74A 4ODVL 1GAFH 2X4NB 2OJEB 1FNAA 3GBLA 1A8JH 1I1RA 1ETZB 4U33A 2Q86A 4MHHI 1R3KB 1KCSL 5D7LA 2BZDA 2Z9TA 4DW2L 3SKUD 4CVXA 4JFDA 4EUPH 1B2WH 4X80L 4Y2DC 3OBAA 1J1OH 1D5IL 4NQDE 2OMNA 4WI6A 4L1DA 4OCMC 1X6LA 1XGYH 1QRND 4P2OB 4HHAA 1T7XA 4OCNC 4ZD3H 3ULVC 4M3JA 4Y19B 4LSPH 1JZ5A 3WE6B 5A3ID 1SMAA 4X5XB 1DUZA 2KZ1B 5KSAB 1T22B 4G5ZH 4PJFF 1T0PB 2AEQH 4YGVB 4KKLC 5HHPA 3BZ4B 3PV7A 2XG5A 1YEEH 4I0CC 1UB6A 2IADA 3BP7B 2DOCA 4U7MA 2MQ0A 1CDCA 1TITA 3CJJA 4X7TA 2R0LL 1MELA 4W68A 4N1CA 3WHE0 3RWJA 3T0VA 2DJUA 4POZD 5IFHH 3IYLW 4PJEB 2Z31D 2J3SA 1CFQA 4G8FA 1I7TA 3ES6A 3GBNH 2OXHA 3DX8A 3B6SB 5I1CH 1J8KA 5HYJB 3GSUB 3HAEH 4HZAA 4KUZL 5IFAL 2ID5A 1AD0B 3D0VB 4KKCD 3DMMD 1QSED 1JYWA 5EIIB 3IF1B 3O4LB 4PGDA 2DM3A 3HZKB 4P23A 3V4VL 1OAXH 5D7IE 2ADIB 5JHLL 3H9HB 1Z0NA 2NY4B 1Q8MA 3ARFB 3MRJA 1WBYB 1EEQA 4X8XA 4XXDB 4LCWE 4DGVH 2HRPH 1KUMA 1SJXA 3HZVB 5B39A 3OG4B 5ECJE 3OR7A 4CJ1A 5EO0B 1FCGA 4ZOBA 1DDHB 2NY7L 4X4ME 2JE8A 4G9FE 4PJAF 3I75B 1CGVA 1X5HA 1QFUH 1BJMA 2Z93B 1KLUA 2X7LB 2UZIH 3O2WL 3DROA 1ACYL 4BZ2H 3UDWC 3DYMA 1A6VH 5CSZA 4JANB 4UB0H 1DBAL 4PRHB 4HXAH 3KLSA 2C4XA 2EICA 4IIQB 4MJIA 4UTAH 2DQCL 3RI5F 4OTXL 1V7MH 4KZDH 4Y5XB 3CVHH 2XZAL 4JJHA 2IH1A 1S7QA 5GGQL 4UU9B 4JN2B 1K6QL 1I8KB 8FABB 2VLRA 4C58B 3MJ8B 3PQYE 5DA4A 2ED7A 3WS6C 2A38A 2QKIB 4HKXB 5IB5B 5BV7C 2D0FA 5DT1L 5CMAA 4P4KC 1OAYH 3EJZD 9CGTA 4P5TB 4OD3L 5LXGH 4XWGH 3QAZC 4XC1L 2Q6WA 3S37X 1FVEB 1SEQH 3CCHB 2MCPL 4M7LT 2AEPL 2EO9A 1JRHI 1ZHBA 1MJJA 3C8DA 1FSKB 2X89A 3V4UL 1U8MA 1YECH 5BOPA 5JLZA 1TJGH 4KKNA 5E5MA 1CQYA 5CJXA 3C6SB 3I85A 5B4MD 3OKOB 4LRIA 3MLXL 1TETH 4R96A 3UTQB 1P6FA 2DLGA 5F3BB 5ISZD 4DN3L 2D7OA 3PL6D 2PNDA 1QLFA 4HKJA 1J0YA 4OCSL 4JQIH 4NO2A 2Y1VA 1QLRB 2QSVA 2NY3C 3HG1D 4HPOL 5FKPB 4YHLL 5FECB 4GRLB 1U8HB 4NOFA 1NJ9B 4O2FB 4CW1A 3VXRB 3HZYB 4ZFOL 2FJFB 4OZIA 3LPWA 2P45B 5D2NE 1ADQH 5AWNH 1WV7T 2NY2D 1J0IA 5CJBA 5IGXL 1EVTC 1WLHA 5BRZE 2EYSB 4H26B 1JTTA 1EHXA 5A43C 2IG2H 4L8CB 1DBMH 1GHFH 3TWCL 3T4YA 2HLAB 2K7PA 4FP8H 4F7TA 5HYIA 1JI2A 1CZ8L 3V8OA 3WFHA 3HC3H 5TDNB 1IL1B 4JO3L 2P7TA 1NCNA 3G6JF 1D3CA 2JB6B 2W0FB 4POUB 4M5ZH 2YPKB 4KUCD 3MCKB 3BZDA 2X1PA 4GKNA 3SQBA 3OPZL 4JG1H 1JP5A 3SE3A 5HYFA 4WWKB 4G6AC 4NHUB 1OGTA 5GRUL 3RTQD 3OQ3B 4P23C 3V4UH 5LQBH 1GZPB 3WJLC 3MXVL 5F9JA 4TTGA 3M1BB 1FGVH 4KZEH 1A3LL 5TFSH 5SX5K 5ACZB 4MD5B 3OXRA 3MO1A 5HD8C 5ALCL 4CAGA 5C8JA 1AC6A 3ZSSA 4TOYL 5GGTA 4XRCB 4NN6B 4AIOA 4Z7NE 4WIQA 4FFVD 4BFEA 5IB3B 3DJ9A 3BOVA 3B9KD 4QF1B 4OM1H 3LQAC 3SGEI 4F58L 3STLA 3ZKMC 4ZUTA 2CLVA 3H9ZA 1YPZB 3MMEA 3BKML 3C8KB 3LEYH 1U8OB 2NY0D 4ONHB 3MUY1 4YHIA 4KRMB 2B39A 1U8LA 1XEDA 1KJ2B 1AO7D 1T83A 2FIRT 2CKBH 3BE1L 4XP4L 3CPLA 1CG9A 1WISA 2QTEA 4ELKB 4ZXBA 4XVJH 4Y4FC 4X4XB 5CZVH 5I19H 3NGBB 5I8CA 4NNYA 3ARVA 4HLZG 1DUYA 5HI3D 2ZCKL 1CXLA 3RWHA 3QCUH 4HS8L 3MJ7A 5EFIA 2H6PA 1N26A 3I50L 1CZ8H 4NJ9L 5DRZB 1P1ZB 3LCYA 3RA7H 4Y4HD 1I1AA 3UEZA 5IQ9B 5CBAB 4NRXB 2ZSWB 4HCRL 4M5YL 4YJZL 3QQ9C 5IG7A 1EHLH 4A6YA 5BMFH 2AJYL 2BCKA 2C3HA 4BFGA 4N0UE 4MAUH 5GRUH 5CJXC 3ISWA 3PGFL 1O7VA 2J88H 5CBEA 5L2JA 5DUBB 1FIGH 3T3PF 3OHXB 1UC6A 1N8ZB 4V1DA 4LRIC 3KJ4B 5FYKH 4GG6F 2IAMB 5I16B 2OR9H 1CR9L 3VD7A 4C4KT 1NQBA 3ULSB 3P0GB 4GT7A 4QY8A 3TO2B 1FJ1B 3KNBB 5IJKC 1N64H 4TPRH 3MR9B 4ORGA 5SWQB 3TIEA 2VAAB 2NR6C 1NFDF 4JRYA 1SEBB 5T5NG 3MOBL 15C8L 4XP9H 2AK4B 4U6XB 2A6JA 2CR6A 4WFEE 4PY8I 1TNMA 3KPSD 1N0XH 4O9HH 4XP4H 5IF0A 2P47B 4HJJL 2JB5H 3FQXA 1FLRH 5K9QI 2GJ6D 1BQLL 1FRGH 4X5WB 4PP2B 1UXWA 4ZDHA 4NGHH 1CLYH 4DK3A 5L6YL 2HMIC 4N68A 4JAMB 4Y19E 1YYMH 4UIMA 2PYFB 1BWWA 5C6WH 1YMMD 2FX9L 3VWJC 3RWEB 3KLHC 3FFCD 1DQLL 1U2HA 1FL3B 4M8QB 3SE3C 1J86A 2JTDA 4XCEB 1XF2A 4ESKA 2BVQB 2ZNXA 3S88H 4C59B 5BVJA 5IVXA 1K3IA 1J05B 4DFIA 1J1XH 3BX7C 1EV2E 4FQQB 3L5XH 1T1XA 3D39D 4XNMA 4K55A 4KKAC 3UTOA 4WO4A 4PJEE 4I1NB 3BT2L 4OF5A 3WYRA 2FX8H 4LIQL 1NBZA 2BNRE 3V5DA 1FNEA 3QZWG 4GMTL 4JFFB 5HYJE 5JA9A 4PJCE 1OSZB 1KLFA 1FG2B 3ILQC 1AIFB 5KG9A 1GGBH 5GSRB 4HLZH 2V9TA 3R06B 3O4LE 4XNUL 2XN9A 4ZFFA 4MA1C 3EFDH 4R2GC 3LS4L 4U1SB 3ULVF 3O45A 1WTGT 1T83C 2OL3B 4HQQL 5I1HL 1GZQA 4HK0A 1JWSA 4FQHA 4RISL 3WNKA 4NUJB 4ZXBC 5JMRA 3MLVL 4PGCB 1OAUH 2R0ZL 3GM0A 3K2MC 4Q2ZB 4C56A 1HHJB 1UCTA 4HJJH 2XQBL 1CGSL 1C7TA 3RU8L 4YHPA 4QGYA 4HAFA 3DV4B 2X4NA 2OJEA 3EDDA 2Y25A 1KPVB 2F19H 4KKBD 3T04D 4P9HL 3O0RH 4FN0A 1HWGB 2NXYD 2MPAL 4PRHE 5J57B 4M62L 4M7ZC 1AH1A 1R3KA 1IAIL 2DB8A 3MRPA 5D7KE 3WIIH 5L7XL 1P84K 2X40A 3MLUH 3DBXA 3RY4A 1NSNL 3F58H 3TNNA 5EZIH 3QUMB 5JHDD 3VWKD 4ZAKB 4NNXB 3SE8H 4QGTA 5JW3H 2PO6A 4OFVA 3P77B 4TVPE 3BT2H 3V7AE 1A7NH 3MLTB 3WE6A 5JW4M 4JQVC 2A9NL 3BRDA 2DQJH 5DYOA 3T77B 5IIEA 1A22B 3CLEH 1WC7A 1X4YA 1FCCA 4N0CC 4YGVA 5DA0B 4PRPB 4ODTL 4Q74A 4NFBA 2R2EA 3NCYP 2OBGA 4P3CL 1EZVX 1S9KC 2NXZD 3SKMA 1GCFA 4GH7B 5IJVB 1YQ2A 1IGIH 4U1IB 3DECA 3LB6C 1W72H 4RISH 4LHUG 4RGMC 3ZDZE 2DQFB 5HYJA 4PG9B 3MLVH 3VRLE 2FJHA 3MLPA 1CGSH 3DGGB 4BYHA 3RU8H 1MFCL 1MFBH 2NY5H 4LSRH 3MA9L 4HG4J 3HLAB 4HGMA 4OZGF 4KMTL 1E4XL 3OB0H 3EYUH 5T33L 4F9LA 2ADIA 3ARBA 3H9HA 3LMJL 3AXLA 4XHJD 1WBYA 5I73C 1FV1A 5BQ7B 5E9DA 4HC1A 4Y4KD 1IAIH 4OGAC 1UXSB 3DX9A 1NBYA 3QFJD 5L7XH 1U6AH 4NM8L 1CXFA 1S8DA 1CDGA 3TFKD 3ZKSD 4WO4C 3V9FA 3B43A 5EUOA 5D8JH 3GM8A 5D93C 3QQ3B 4ZUSB 3BN9C 4HFUH 1OAZH 5HDBF 1IMHC 5D1XB 4QNPF 5FYJH 4UV7L 3S35L 4JFYB 3C6LD 3ME0A 4Y5XA 2EYRA 1LHZA 3HZMB 4U6VL 4XMKL 1UZ6F 5I0ZA 2GSGB 4ZFGH 4HXBH 4ODTH 1YEKH 4BSJA 3FO2B 1EUUA 1U58A 2JJSA 1S9XA 1MUJB 1D6VL 5KS9B 3MRLB 4OZFA 1XGUB 1NAMH 3MCG1 3KYNB 3P9LA 2XZQH 5ELIA 1CFVL 3QIBC 5F9WC 2NY6B 3C2SA 2DIBA 4P5TA 1D5ZB 1IKNC 4NBYB 4R4ND 4FQXD 4H1LG 4ODWB 4AQOA 4G6KL 5GGUB 2NTFB 3GUTA 1NEZB 2IANB 4S1DD 1HKLH 4UUJB 2XICA 4M4RA 5FIEA 5CJQL 2DWEB 3GJFK 2XWJA 3D2UA 3CAFA 4JO2L 3VGFA 5EU5B 1MLCA 2BX5A 5T33H 1FH5H 3V0WH 1OQXA 1XFPA 4Z7VA 4MXQD 3S7GA 2H8PA 3LRSA 3OKOA 2LU7A 2YR3A 5EU4A 2V9QA 3TH2T 3UTQA 4BH7B 5F3BA 1Q1JL 3INUH 3H7BA 4P2OC 1QLRA 1HXMB 1RULH 4QRTB 3OKDA 3OL2A 1AGEB 4KJPC 5C0JB 1FNGB 1A6AB 5FECA 4GRLA 1U8HA 4JREB 3VXRA 3HZYA 3QPXH 2FJFA 5KSAC 4PD4J 4X6CB 3NCJL 3DIFB 3MFFA 4KXZH 5MENE 2G75A 2B4CL 3Q6GL 4URTB 25C8H 4MNHB 3O9WD 1F3DH 2EYSA 4H26A 4WUUD 4ZPVB 1VFOA 4N5UA 1ZA6A 1KOAA 1UM5L 2HLAA 3OGCA 1UZ8B 1MJ7H 3A6BL 4ONFH 1EEUA 5TDNA 4LQFH 4DZ8A 1CVRA 3VMPA 4L3EE 3WKML 2VIRB 3O81A 3NIFF 1QRNB 4ETQB 1CYGA 1T7YA 4WWKA 4NHUA 5DK0B 3BD4A 4IMLA 4P2RD 3NN8A 4PJ9D 3WIFB 1GZPA 3VI3F 5BXFB 4XMPL 4Q9RL 2DD8H 4JHZA 3M1BA 1IEBA 4QCIB 2AK4E 2NY4C 3ARFC 4PIRF 5F7HA 1RJZA 3NAAH 1A7OH 2D31B 4MD5A 2GAZA 3C2AH 3HI1B 3VDCA 1CU4L 2ADJA 1MLBB 3EAKA 1L6ZA 2HLFC 1AHWA 4QF1A 4LOUC 2YBRB 3CFBA 5IESL 2Z31B 4X6FB 2P43B 3EJYD 3NCFB 3UJIH 4GRMA 2AV7B 4PJ7B 4YC2B 4OFDA 1YPZA 1VKXB 5FF6A 4Z76A 1RAMA 4NZRH 4ONHA 1Q94B 1DQJA 3L3GA 3IAGC 3JWDC 4IIQC 2X10A 1KJ2A 2QQKH 3TV3L 4Y5XC 3DMMB 1IC1A 1QSEB 1T1YA 4H8WC 1MPAL 2H2SD 5GISH 1VPOL 4X4XA 2K1MA 4H1LH 3KDMA 1JJUA 4MNGA 5A40E 2MCG1 1UM5H 3S5LG 4OZIF 2YC1A 1ZT4B 4UV4H 3T65A 3P40A 4PP1C 3VGEA 3V4PH 5D7JD 1K4CB 4YHNB 5DRZA 2X09A 5DC4B 4U1KB 4P5TC 5IQ9A 4JFFE 1FVCA 4MD0B 2EE9A 4M00A 1NC4D 4F7EB 3X3FH 4JY5L 1NC2D 4ZTPL 2NLJB 5A2IH 4HV8A 4M4PA 5KANI 3V79C 1FSKC 3AROA 1PW3A 4IBLT 1J12A 2OSLA 3MV7D 1NGPH 1OM3H 4BQ8A 3O3AB 5DUBA 3S6CA 4D0BB 3OHXA 4BUGA 3C5JA 2DIJA 5I16A 1T1WA 4GBXA 1WUNT 3P9WB 3ULSA 1J0KA 4JQXA 4YDIL 3ZTJH 5HDQL 4JPWH 3TO2A 1U93B 3MR9A 4GRLC 2NW3A 4PREB 3V6ZA 5JR1H 3K81A 3TPUB 1UEYA 3QIWA 2AK4A 1R24B 4FQ2L 4U6XA 3UBXB 3VXTB 4NKIL 3FQNA 2X4SA 1BHGA 1LP9E 4TULH 2IFFH 3V6OE 2WZPD 1JNJA 3BESR 4PP2A 4HUWA 4JY6B 1CDBA 1ZHNB 4JAMA 3EFFA 3M07A 5ISZB 2VITA 5I76A 3PL6B 2IH3B 1BOGB 1XR8A 3GMQA 2D4FA 3RWEA 5F7DB 1CFSA 4M8QA 3BKYL 3EYVB 3RWFA 3HG1B 4WWKC 1CGYA 2FATL 1A0QL 4JY5H 1J7VR 4PRPE 2HKFH 2W9DH 2VDOH 2BVQA 4OAWA 3DX7A 3K4ZA 1J05A 2Z4QA 5DJYB 3QDMD 1XF3B 1JUFA 4F7PA 2OZ4L 2W9LA 3GJFA 1OAQH 1SY6A 2NY2B 3HUJA 2YUVA 5DC9B 2GKIA 1UG9A 5IT2L 4KDVA 1RPQA 4NN6C 2V6HA 5EIVA 1JWMB 1M7IA 1PQZB 1OSZA 4HC1L 1AHWC 5F7NC 1EGJA 3VXNA 2UYLB 5CAYB 2LU4A 4YDIH 5JDSA 5I8KL 4U1SA 3LH2L 5FUCC 1NMBH 3FJTA 4JFPA 5FYLE 5SX5H 4JB9L 3CFCL 4U1NB 1NGZB 4DGIL 5DMGC 5GJTL 2N7BA 2VH5H 2I9LB 3NGBC 3RTQB 2GITB 4GSDL 4PGCA 4Q2ZA 5IBUB 1IGCH 3WLWC 5D70H 1YY9D 3EO1A 1KPVA 4Z7OF 35C8H 4LLVA 3NFPA 1CF8L 4KJYB 2X1WL 5J3HD 2Q8BH 3O6KH 1HOCB 4S1SL 2DQIH 1SBBA 3B9KB 3QHFH 2YA2A 5J13C 5JPNB 4TTDD 2ICWI 3BKYH 4NQCD 5C3LD 2W91A 5C2BH 2H45A 3GSWB 3QUMA 4LLDA 2NY0B 5B21A 1FVDB 2WWMD 5MEPB 5C6TL 4NNXA 2AJXL 3VW3L 5I17B 1AO7B 1YUHA 2VNCA 4X99B 3RDTD 3KJ4C 3P77A 2IAMC 3B9AA 5HHMD 3RUGE 3T77A 2YKLL 3IDNA 4JQXC 5IVXF 2EIZA 1AXTH 5CHNB 2ADGA 3K0WA 3QNZB 1MCJA 5FCUH 3K46A 2IANE 3CFIC 3U9PL 4J8RB 1JYVA 3CC5B 4Y4HB 1JZ2A 2A74A 3Q1SH 4WTZA 3NCYS 4RIRB 1MRFL 1RZ7L 4QYOB 3MNVB 5IJVA 2CJUH 4J23A 3SY0A 4LLWB 1PX3A 3GSRB 1DQQB 3WNLA 3P0VL 1WFNA 2AP2A 2JCCB 1PG7H 5GS0C 4GSDH 1X7QB 2H1PL 1U95B 3MRRB 2V2XB 3BRFA 4LLQB 2X41A 1JRHL 4OGXL 2FGWL 3U4EB 5JQ6L 3U9UB 1CF8H 1KIRB 2OTWA 1NMAL 4X6CE 4Z0XA 5EUKB 5GGRY 1TPXB 4S1SH 3QXWA 5MEQB 5BQ7A 4CN4A 5AZ2H 4IRZL 3RGVD 5HPMA 1N6VA 1EFXD 3HA0A 1UJ3B 2VLKD 4KK5D 4R8WL 4XPGH 4HGKC 5CGYC 3RIAK 5EU6A 4EJ1C 1R5VB 5DF0A 2YD6A 2DQEL 3KPSB 6FABH 5GRYA 1TQBB 1OF2B 3BPLB 1EHNA 5FUZH 2FB4L 4OIAA 5D1XA 2GJ6B 2H2PD 2F53D 4FZ8L 4PJBB 3X11A 5MHSD 1QRNE 4WFHD 3WV0A 2BVTA 4JFYA 3L3KB 4NC1C 4FRWA 1T0MA 3HZMA 1K8IB 1I3RB 3QDGA 3D85D 2WBJA 1HQ4A 1YMMB 1MUJA 2X05A 5KS9A 3FFCB 2X4QB 2FEDD 3QWOB 5B3NA 4K9EC 3N1QC 3JV5A 3KYNA 2DJSA 3FB6B 3VXMA 4KRPD 4MCYA 4GW4B 4X7DC 3BZEB 5C0AD 2FH8A 1OD7A 1D5ZA 2A83A 2C1PA 5GGSY 5DI8B 3D39B 4RMRA 3TVMD 4E5XB 1EJOL 5IVNA 4S0TD 4DKAA 2FJGA 3H0TA 1C1EL 2NTFA 4PJ7E 4UUJA 2IALB 1NDMA 4QHNB 3EZJB 4ODUA 5KSVB 2MKWA 2G60H 5E6ID 1MAKA 5JQ6H 5EU5A 1AGDB 3TBTB 1IC4L 1HDMB 5H94B 4WU7B 1S7UB 4JCLA 2OR8A 3P4NB 4POYA 2GIYA 2CDEB 1U8JA 4JFZL 4ZAKC 4ALAH 2NZ9C 1OP5H 3LIZH 4QRTA 5IB4B 5C0JA 4U7KA 1FNGA 3F62A 2Z8WC 2YRZA 5IHZB 5GGRB 5J8OA 2J6EH 5FM4A 4WI9A 2HP4A 5LGHL 5DS8A 4K2UL 4MNQD 1GGTA 3DWTA 1DANU 3ULUD 3PP4H 4D8PB 5H8DA 1H5BA 3TA3D 2WV3A 2EDOA 2HT3D 4MNHA 3K1DA 2BK8A 4HUXB 2NXYB 4RX4D 1RU9L 5EUOF 1EMTH 3G5ZA 1NAKL 1UZ8A 2X1QA 3MRKB 3Q5OA 2WANA 4X7EC 1IM3B 3BEVA 2GYSA 2H3NB 3OF6D 2Y72A 5JHDB 1JNHB 3VWKB 2VIRA 4LFHG 4ETQA 2EXWD 1NGQH 2PTTA 3X3GL 4LEXH 2Z0BA 3E8UL 4K3DL 1MHEB 1C1EH 3MREB 4MA8L 2YMXL 3O6LL 3HC4H 5BXFA 2X4UA 3UMTA 4X6DA 2R0WL 1T03L 1H8OA 2D31A 4ISVB 1I9IL 1A5FL 3LQZA 4I3SH 3TBWB 3HI1A 5GGSB 4YHKL 1N7ML 3RX5A 2X42A 3MRFB 1L9NA 5E8NB 1MLBA 4DWHA 3P4MB 1T0NB 3T0AA 1KN4L 1IC5L 4QXUH 2NXZB 3GMNB 5C09D 2YBRA 3TN0A 2Z31A 4OV5A 5SX4H 1BP3B 4MD4B 1WIUA 4NQXA 5J1SC 4Z7VF 3H42L 3LS5L 5D1XC 1Q94A 1A1NB 4HMCA 1SY6L 3RHWK 3MJ9L 4WW1A 4LLUA 3DPBA 1OTUD 3WDIA 2PUQT 3GO1L 3HG1E 3T4AB 1QSEA 2DLHA 3QUYA 3QDJD 3QXAA 4AH2A 5IFJB 5DRXA 1U8PB 4N8CL 4HZLB 2V7HB 3GEWB 1RU9H 1QRKA 1G6RB 5M95B 1NAKH 1JHTA 4Y4KB 1DFBL 1I1YA 2HWZH 2NY6C 2YPLD 4YHNA 5I66A 3QFJB 2HVKB 4U1KA 2AK1H 3ROOB 3IVKB 4LKXB 1F4XL 3OAYK 4DZBB 4MD0A 1LK3H 4F7EA 1FORH 2NX5D 5EU7E 4P99A 1OTSD 4TNWK 5EC2A 3E8UH 1MI5A 4QRSA 4FNLL 2L7JA 2OJZL 3EDFA 1MAJA 3SGDH 1U8KB 4PLKD 3OZ9H 2NY1D 5E2TH 1PG7X 4EDXA 4LASL 1MNUH 3C6LB 3V0VB 4D0BA 1ZLWK 1FO0B 3UAJC 2KH2B 5GZOD 1T03H 3SGJA 1U36A 1HILA 1QKZL 4YHKH 4U1LA 1RHHB 4XAWL 5IV2B 2K7QA 3JWOL 4XNXH 4B7IA 1OP9A 1MQ8A 3OWEA 2GSIB 2VZVA 1KN4H 4QTHB 3SQOL 1H8SA 1U93A 4JREC 1ZWIB 4OJFL 4GRWB 5J11B 3HMXA 4YBHA 2UY6A 4JY4A 2I07A 3LS5H 4S1QL 4FQXB 3BN3B 1U8IB 3MJ9H 3UP1A 3O2VH 3VXTA 3SDXA 4LLMB 2C3XA 2VDRH 3L1OL 3U0TB 2VDPL 2XY2A 5MERA 1S5IL 4LVNB 2YK1H 2YEZA 3F8UB 1Z3GH 3ESVF 4F57L 4N8CH 5IB2A 3F12B 1A7RL 1YPZF 1AO7E 1ZGLP 4L8DA 2X4RA 5GRVK 3U7AA 4UT6L 5ISZA 3PL6A 4FQIL 4K7FA 1G0DA 2VDMH 5F9OL 1C08B 5F7DA 1KBGH 1E6OL 2DQTH 4BZYA 2RCSL 3EYVA 3WFCL 5I2IA 1IARB 4YQXL 5A3IC 3U79A 1J8HE 4ERSH 4XT1C 2OJZH 1XF3A 2DQGL 2H32H 4LAJH 1CTOA 3PUCA 4H5SB 3MRNB 3DSFL 2GFBB 4WHCA 4PTTA 1HZHH 2DLIA 3O9WB 1MWAA 4WUUB 1RD6A 2XKNB 5CINH 2JCCE 2PR4L 3RVXD 4POZC 3TN0C 2H9GA 2Z31C 1LEKB 1JIBA 1QACA 4YC2C 4FXLA 1W8OA 4OZHB 2I27N 2FR4B 5DJ6B 1WIOA 4N8VG 5E4IA 1OB1B 1A02N 1KCVH 4BH8B 2BNQA 3X12A 5ADPH 1ZLSH 4UT7L 4KKCC 3DMMC 4OD1L 4U1NA 4P2RB 1JE6A 4Z95L 2I9LA 3GBML 5SV4A 2GITA 2PW2B 4PJ9B 4JGUA 2JIXD 1LVEA 2VDNL 4F57H 2EECA 1YEJH 3G08A 4KJQD 3ZL4L 2B0SH 3ARUA 1G9NH 3ELAT 2EDYA 3P30H 5D9SB 1IC7H 2GJ6E 4PJBE 1MFEL 3EOBA 3B9KA 5F9OH 4M6NH 1T21B 5IKCB 5ETUB 1P84J 1FN4B 1KGCD 3GHBH 3CNKA 3KPQB 5EN2B 2MQ3A 1B90A 1WZMA 1YMME 4TQEH 1U91A 2DS4A 3OGOE 3VFPB 1KT2B 1ZGLA 1AO7A 2R1WA 2FHCA 4JG0L 3JV0A 4E9LA 3OMZA 4XPTH 4HMEA 4UDUA 1Q9WB 1RZJC 4I18B 3KAAA 5A16A 2DBLL 5CHNA 4DAGH 4HS3A 5D7JB 3EJZC 5I1GL 1ZANL 3BVNA 4J8RA 3B4NA 1D5MA 3CC5A 4Y4HA 1ERNA 2X44D 4RIRA 5DJXB 3HUJF 2AKRB 1NC2B 1OSPH 1NCDL 4G8GD 1YJDC 4UT7H 3ULVH 4P49A 2ZUWA 4YBLB 3JUYA 1AXIB 1BIIB 2G5BB 4HIXH 4LLWA 3GSRA 2ZPKL 3MV7B 3GBMH 3SDCD 2ICWA 5TE7L 4Y2OA 5C0CA 1X7QA 1N2RA 4YDLB 4EXKA 4U49A 2NTSP 3MRRA 5B4MC 2AJZB 3BUTA 4MLIA 4LLQA 5FCSH 5IW1A 1B6UA 1F97A 3PL6C 2OS7A 2YD2A 3QRGL 2X9WA 2P46B 1F3JB 1DVFD 5EUKA 4G42B 1S7RB 3D25B 1KXQE 3C9NA 1ZGLM 4JVPA 2UZYB 4XP1L 4HFWB 2VL5A 5C0EB 5C71A 3SKNB 4K71B 1QP1A 1UJ3A 1WWWX 1KJMA 4PJXB 4YR6A 5K9JH 1E4WL 1VGEL 2IWGA 4XVSL 2NY2C 3GMMA 1R5VA 2BOCB 1N59A 4OCYL 3KPSA 3MYZA 4JPVL 5IHLB 3HE7D 1VACA 1OTTD 5JHDE 5DD3H 4UQ2B 4PJBA 4Y7MA 3L3KA 5EU7C 2I25N 3EYFB 1ZLVK 2DBLH 2M2DA 1K8IA 3SKOA 1FDLH 1BGXL 3VD5A 1KFAL 5GRJL 4F37K 3GSNB 4ETYA 2D7PA 3FFCA 4OCRH 3QWOA 1DBJL 4Q9QL 1NCDH 4QOKA 4GW4A 5E7FA 3RTQC 5E6ZA 4OLZH 3QDMB 2ZPKH 5DI8A 5B3JE 3D39A 4RMWA 1BJ1J 2P24A 1FE8L 4GAJH 2HJKB 3V52H 4U6YB 3WNNA 3U6RB 2IALA 2AQ1A 4LF3A 4FFVC 1IAKB 1BQUA 3B9KC 2BNUA 3TBTA 1JPSL 1P4BL 4RGND 5BV7H 5DJ2A 5DJ8B 4MQSB 4PY8J 1CIUA 3GMRB 4FQLL 1A3QA 2NY0C 3BSZL 3FOLB 4YXLL 4RGOL 4KQ4H 1MVFA 1VESA 1D7FA 1JF6A 4YPGB 1FIEA 1VGEH 4BKLB 4KAQH 3QFJE 1JZ6A 4JPVH 4GAYB 1G7JB 1O7SA 5SWZD 2GJJA 3OKNB 3O8XD 1KCUL 4PJDB 4D8PA 4BELD 1PLGL 1KPRB 2QSCH 2QADB 4UMGA 3G6DL 2FIKB 4OT1H 3VFVB 5GRJH 4Y4HC 2QBWA 2DQDH 1YY8A 4TSBH 3BFOA 5CWSA 4NQCB 1OGAD 3QEUB 1MCPH 1FPTL 3MRIA 2DL9A 1BVKB 5FO9A 1XCQB 3QWQB 3AAZA 2BJML 1J11A 4QRUB 5ALBH 1BREA 2VSDA 5DEGA 3RDTB 2OP4L 5KS9F 2W0PA 3PP3H 5HHMB 4E42B 3MREA 4GRWE 4WCYH 5EZJB 3T1WA 1TPXC 1IM9D 1T1ZB 4RA0C 4XPFH 4XMLH 3OKLA 4ENEC 4ISVA 1RUAH 3F7RA 3AMLA 3GRWA 1KSRA 5GGSA 3CXHK 2HN7B 5HHOD 5F72S 1DLFH 1UJ3C 5E8NA 3P4MA 1CFBA 1T0NA 4R3SB 2O93L 2R56H 2FLBT 1PAMA 1YEIH 4ODXB 5I1EL 1TQBC 1UKQA 2CLZB 3BPLC 4OUUA 4RMVA 3IJYA 4XGZB 4XZUB 5IWLA 5DZLA 1Z5LB 4WVRA 3U7WH 2FGZA 5FO8B 1F4AA 1KB5B 2CR3A 3G04B 1QG3A 1BVZA 5GGVL 5LJYH 1XMWA 4FZEH 5JOPE 1JZ4A 5IFJA 2XACC 4K23H 2V7HA 4UNTA 3EDEA 5T1MA 3WUZA 3LQAH 2F5BH 1RIUL 4Y4KA 1YN6B 2RBLA 3RGVB 5FDYA 1NCBL 2HVKA 3IVKA 2WLZA 1EFXB 3DXAA 4LKXA 2VLKB 4WUUE 3MBED 2D7TL 1DTUA 3TNMB 5FGBA 3DVNA 1NGWA 2F5AH 4HIJB 5TPWH 3Q48A 4OZHE 4FTVD 5JMOC 3T0ED 5DUMH 4Z7UB 1IGML 2Z35B 5T1DL 2F53B 3S4SA 4KMQA 1T6VN 3V0VA 3QEQD 3FHQA 5ACLA 1MCFA 5C0FB 4G8EA 4KKLD 4P2RE 4RMSA 3D85B 4JZOB 3DHMA 5IV2A 1JHKH 2K3TA 3D69B 4WHTA 4PGBB 4YWGL 3H3PL 1MIEL 5E70A 4GQ9L 5F21B 4KRPB 1ZWIA 3UC0L 4X6DF 3UZEA 1DN2A 1FNLA 2WNGA 5T3XD 3OX8A 5C0AB 4WEMB 3W9EB 1U8IA 1TDQA 3L7FB 3TVMB 4FFYL 2W9EL 3RL2B 4ODHL 3U0TA 4KKBC 4F7CB 3WNMA 1AD9B 2NXYC 4KDTA 1V3JA 2HH0H 3MBXL 1B4JL 2ZOKB 5E6IB 1A4JA 1LO5A 3DYOA 1G7QA 3F12A 4QHMA 4A2MA 1YNLL 3BDXA 2B1AL 3HNTL 3BO8B 3NACL 4MA3B 5F7MC 3U4AA 1I3GH 4AY0A 1BF8A 2EDFA 5IM7B 4K3EL 1URLA 1MFAH 3VWKC 2VYRE 1Z9LA 1OW0A 1NLDH 2PYED 1HXYA 3TYFB 4D2NA 4MZ3A 2NNAA 5T5FL 2PXYD 1PEZA 4IDJH 4PJ5D 1YNKH 2WUCL 1DP0A 3TH3T 4F80A 1IGMH 4H20L 4UDTB 2X70A 4H5SA 3MRNA 2GFBA 2MTPA 4ZODA 3TA3B 3QBTB 3I02B 1ZHKB 1WAAA 3O9WA 2VJXA 1CLOL 5DEFA 1R3LB 3MV7E 3LN4B 2NXZC 1YEDB 4NQED 1EFQA 1FBIH 2WIIA 3QI9A 4YWGH 4EI6A 1LEKA 3HC0B 2DQUH 3C5ZD 4U1JB 1N6QL 5E1AB 1CCZA 1VHPA 3QNXB 4P4KD 4AZ8A 4YE4L 1OB1A 1Q9LA 1L7TL 1SYVB 1SJHB 2DAVA 1HHIA 4WI3A 4KQ3L 3UO1H 3ARPA 4OSUH 2BC4B 4KPHL 4XPAL 3OJDA 4RRPG 3WIHA 3H3KA 4PJXE 1WWCA 2DLEA 1RFDL 3PNWB 3VGAB 1UH2A 3MBXH 1B4JH 4XHJC 4RNRB 5TE4L 2Y6SD 4M9OA 4M8VA 4Y4KC 4QLRA 4D3CH 5D7LD 3CLFH 3SDXF 4F7MB 4OCXH 4IOIB 5C09B 3CVIH 3TFKC 3IS0X 4MX7B 4GOSA 1T21A 1CL7L 5ETUA 2EEDA 1FN4A 1KTLB 1QFWI 4LCIL 5I1KL 1LK2B 4WU5B 4X5LA 5CUSL 3UYRL 3EYOA 3RP1A 5E94B 5F1IA 4X7CC 3VFPA 1LGVA 1KT2A 2BRRH 3F65A 3MOQA 3C6LC 5DSCA 2W38A 1B6DA 1KPUB 4BQ9A 1BPVA 5GRVL 5AZEH 3QDJB 2ICEA 4IMKA 3NFSL 2BXZA 4YZFE 5ADOL 2APBA 4I18A 3QJFB 3QDME 4TNVF 4JM4H 5IMKA 5E8EB 4P3DA 2DICA 5HHQB 5D7JA 3L6FA 2YPLB 2CO6B 4HDIB 4XAKD 2FO4B 1QHPA 1FL5B 4A6YH 3BHBA 3H6JA 2X6MA 3HPJA 2Y5EA 1HH9A 2NX5B 2HVJA 4O02L 1NCTA 3MRQA 3RNQB 1AJ7H 4S1DC 2G5BA 4LVNC 5INDB 1OARH 4X83A 2AJVL 4KDTC 4KPHH 3OKMB 2NY1B 2AEWA 2R1YA 4NWUL 1RFDH 4MXQC 4HWZA 2AJZA 5C6PB 1IBGH 2H26B 3TZVA 4AMKL 5TE4H 4NQUA 1D5BA 2HRLA 4P5KB 32C2B 1CGUA 3GIZH 5E5RB 1YEGL 1A9EB 1UADC 1S7RA 2XPGA 3D25A 4PJDE 3DRQB 3MNZA 1H3PL 1OW0C 2R4SH 4KTYA 4HFWA 4LU5L 1RUMH 4U05A 3BPCA 1KJVB 3BIBX 4LLYB 4IHOB 2BVOA 5DMYA 2BOCA 3MJGX 3DHJA 4XBEL 2CRZA 1QBMH 2RB8A 4HWEL 1EEYB 3TBVB 3O9WC 5IEKB 4NZTL 3HR6A 4UQ2A 3NFSH 4YDVA 1FFPB 3GRWL 3WS3B 3QI9C 1OLLA 4D0DB 4XCYA 5F96L 4KTDL 3ZYOA 2O5YH 2E6JA 5HHME 3OAUL 4N8PA 2ZOLA 2PCPA 3QNYB 4R0LB 4PJ8D 2AJUH 2Z8VC 1RZFH 3G5VA 1UB5B 5GJSL 4OIIH 4BFIB 4M1DL 3X14A 2XTJD 2HA1A 1NFIB 2X89D 4KV5E 1W0VB 3CFJB 2E3VA 5EO9B 3P0YH 4XPHL 1LEGB 4PS4L 3IB4A 3U6RA 1JK8A 3S96A 3G5YA 2CMRH 3RHWF 5GXBB 4LHQB 4EBQL 2L4OA 2BHZA 3SHSA 2EDBA 3EJYC 2MSPA 3VD4A 3GMRA 2XWTA 1A14L 5HVGB 3BMWA 2E27L 2IPKB 1EXUA 2C4FU 5HXMA 4PRAA 1WITA 5IHUL 4FG6D 1MCLA 4RSVA 5J9PB 4Y89A 1AY1L 1MCWM 5F9AC 4BKLA 3DSNA 4GAYA 4PJAB 2VLKE 4I18C 2JIXB 4NRZB 1U42A 1M4KA 3LZFH 4OI7A 2XZCH 3V7AG 1K5NA 4PJDA 1PKQB 1KPRA 5D7JC 3OXSB 5FGRA 5E56A 5HBBA 4PJIB 3REVB 5BJTB 3VFVA 3SKJH 5C1MB 4Z7UE 1CBVH 4U1HB 4TSAH 2FZ3B 2F53E 1K4DA 4LCUB 5MHSE 4WFHE 5FGCB 2UUDK 4NQCA 4PJBF 4YBLC 1U92B 1EO8H 1F00I 1BVKA 2R1XB 1QSFA 4L8BB 4OCWL 5M7QA 2GY5A 4YDLC 1QHOA 2Q1EA 4QRUA 2Z91B 1BVLB 1ZSDB 4H8WL 3MUHL 3VGGA 4E42A 1BQHA 2W60B 5C0AE 5EZJA 3V5HB 5EDXA 3EYSH 4R7DB 1T1ZA 4U0QB 1BZ7A 5D71H 1CE1L 1FZJB 3MLRH 2A6IB 3QUZD 4TVPL 1YQVH 5FV1L 5TH2A 2ZJSH 3CDFA 4K71C 4RDQF 1A14H 1BBJA 4GXVH 4L8SA 1CD1B 1F02I 4FFZL 5GRXG 2FLRT 4R2GD 1HH6A 4G8GB 1MCSA 1HHHB 4ODXA 3ZTNL 1PFCA 3P4LA 4XGZA 2R9HD 3QEGL 2VXVH 3O2DA 4PY7B 2X4TA 1IGJB 1P2CA 3SDCB 4G8IB 3JUZA 5ID0B 4H0HB 1KB5A 3U2SB 1WCBB 1DLHB 1KEMH 5E8OB 4PUBL 4Y1AE 1NEUA 1MHPL 3WN5B 2BMKB 3BKJL 4R7NA 4YO0A 5L2KD 4HUVA 4W4OA 5CKGA 4MNQE 1DVFB 5KVEL 1I1AD 4D9RD 3ULUE 5B38A 4MQ7A 5DD0L 3MV8E 3BGFB 5L9DH 1TVHB 1XF5A 2C5DC 3LN5B 4OLVL 4QXTB 2UVFA 1MJUL 2HFTA 1YN6A 2Z92A 5I1IH 1RUQH 1J5OL 4BQCA 3RGVA 1QBLL 4RAUB 5DLML 2WUBL 4FS0A 4C83A 5BZDB 6CGTA 4BSVB 3KR3H 3JWDH 4JR9L 5D6DA 3MUZ1 3WIHL 1ZLVH 2VR4A 4HIJA 4V1DD 4H8WH 4TRPL 4JDTH 3HE7B 2ZKHL 1UCBH 2G5RA 4OZFH 4ZUWA 2AXGA 4FMKA 5C0FA 3U1SH 4N0CD 1DQTA 4RBPK 4L9DA 3HI6L 3D85A 4V2CB 3QH3B 1R3JA 1ZVSB 4YBQD 4OM0L 4UTBL 3FOMB 3THML 4HWBA 4XCFH 5ICXA 1R3HA 1CWVA 2A2QT 4RWHA 3NCMA 2ARWA 3T2NL 3ZTNH 1QR1A 5JIIA 3P9MA 3OR6A 1R5IB 5C09E 3L7FA 2BFVH 3UTZB 1JNNL 1YY9C 1G7HA 3N1PC 1MVUB 4NP4L 4M3KB 4JN1H 2QADC 5B3JF 5BW7A 4EDWH 1ITCA 1MRDL 5HI4D 1AD9A 5GQBA 5J3HC 3CDCA 2DBJA 4EI5D 2ZOKA 5E1HB 4WEBL 4RZCB 3R1GH 4TTDC 3WCYA 1OAKH 4RGNB 5DQJB 5MI0B 3SE9L 3BO8A 4XCCH 1BWMA 4K7PH 4JZJB 3QDJE 5L88L 4NC0B 3VXPB 3TF7C 5HGBA 2Y07L 5DLMH 1KV3A 1GPOH 3HS0B 4WO4D 4WHYG 2YPLE 3VXSA 3O3BB 4I2XB 4OQTA 2B2XL 2FX7H 1ED3A 4TRPH 2V7NA 5SWZB 4TSCL 3QHZH 1A21A 4UDTA 3O8XB 3KPRD 3SBWC 2NX5E 3MXWL 2D2OA 3N85L 8CGTA 5C0BD 3I02A 5H2BB 2P48B 4HPYL 1NPUA 1ZHKA 1WFOA 2I60L 4KC3B 5F7LB 2XN9D 4UOW1 2LVCA 3GHEL 2IPTL 4QHUB 2IGFH 3HNVL 4U1JA 1V7NL 5E1AA 1OGAB 3LSOB 4P46A 4H0IA 3QNXA 3OF6A 1ORQB 5D72H 1ITBB 1K85A 1FFRA 3E1F1 1SJHA 3AM8C 2YD7A 1BBDL 4S11A 4GS7B 1JNNH 1NFDB 4JO1L 3U7YL 1FZMB 2BC4A 4YHYB 3EGSB 3UCRA 3AS2A 1EEZB 3RAJH 3P4OA 1AKJA 12E8H 1IM9B 4W81A 4RMTA 5C0GB 4RNRA 1IQWL 4MJ4A 5EWIH 2VDKH 1GGCH 1VEMA 3GJEB 2FD6H 5DHVA 3RGVC 1C8PA 1A4KB 4HUKB 5HHOB 4TUJA 2A1WL 1K2DB 5CCKH 4YGAB 4KK5C 2B5IB 4F7MA 2V9RA 3IDJB 3CFKA 1LMKA 4MX7A 4BSWB 3QFDB 1KJ2H 3V5KA 5D6DC 1HCVA 2XRAL 2P4AB 1VFBB 1KTLA 1UWEH 2PO6D 4JFED 3NCEB 2A6KB 1QO3A 1KXVC 2EYTA 3QXDB 4PJGA 3UZQA 1ZVHA 4XNQA 5E94A 5FHBL 2DN7A 4K94L 1KPUA 3MXWH 4JZNB 4NKMA 3QDJA 3N85H 4NOBA 5EORL 1KNOB 3DYPA 5LAXB 3G6AB 5B22A 5E8EA 4FQCL 3PWLB 1XGQB 4M7KH 5C07D 5HHQA 4KRPC 4JE4B 4J3XA 4YK4B 1U8NB 4NKOB 2M26A 1RK0B 3MBEB 4U3XA 3C09B 1DE4A 2ZG2A 2XNAB 1UM4H 1GC1C 3A6CH 4OLUH 4UINL 3TVMC 1QYGH 4Q7DA 4ZFOB 1WAAF 3RNQA 2PTVA 5CGTA 3NIGF 1BBDH 1U3YA 1RQ5A 4FTVB 3T0EB 4OFYA 1JGUL 3LEVL 2CDFA 4PBXA 5TF1H 4G3YL 1JGVH 3ARBD 3QEQB 3DV6B 2B1HL 1Y6KR 2SEBB 4P5KA 5E9DD 3IFNH 1Y18B 2I9TB 3QCTL 3BJLA 3SO5A 1XAUA 5K9OB 4FQPA 4PJAE 4NWTL 1A9EA 1MCHA 1NCWL 3CZFB 5DD1H 3IXTB 4XVUC 3SE4C 5A1AA 2OL3L 3N9GL 3PHOA 1PKQE 3MGOB 1A3RH 5CEZL 4LOUD 3CDYA 3HE6A 3LN9A 7FABL 4X9GA 3VRIA 3IXAA 3HNSH 4LQ1A 3ULUC 5FGCE 5GS0H 4M1CD 4HKZB 3TA3C 1YYLL 1EUTA 3IJHB 4WTZG 4NNPH 2HT3C 5FK9B 1I7UB 1KGCE 1EEYA 5J4MA 1U9KA 3ZKND 4J12A 2OQJB 3M17B 4M6MH 5EORH 3WS3A 1FQ9C 4D0DA 4EOWH 2WIMA 3QRFM 5TQ0L 5IEHA 4H25B 2R8SH 5HSFA 4O2CB 4DQOH 1EAJA 4K3JL 4PB0H 1KIUA 2EXWC 1FAIL 1T04A 1QFWM 4AEIH 3PDOB 4UINH 2PYEB 4M43H 3O2DL 3VFTB 5CIPB 1RZKC 5D7SH 2R2BB 4HJGA 2PXYB 3FQTA 3QG6B 4PJ5B 4NFCA 4Q9BA 5C7XH 1OL0A 1Q0YL 5EO9A 3VGAC 1LEGA 3D2UD 4NUGL 2BOBB 1A6ZB 4PGEB 4G8GE 2N4IA 3X13A 1EGJH 1A6TB 1TXKA 3BMVA 4JJ5A 4B0MM 1F8TH 2MKLC 3MRHA 5KAQF 3QCTH 4YUEH 4NQEB 4NWTH 5HHXH 3TT3H 1MHCA 1WBZA 2OL3H 3C5ZB 4K9EH 1CDIA 5BV7B 2P8PB 4OZGB 1GGIH 1NDGA 4K7PX 1KEGL 1PYWB 3LKQB 4P4KB 4HUUA 2YD4A 2XIDA 1OTUC 4J2XA 5IROC 3QAZB 5D2LA 1T7ZA 3HMWH 3L95A 1YYLH 2F74B 2N56A 1N4XL 2HFEA 3QG7H 4LSTH 3GKWH 2MHAB 3GMLB 3OXSA 5F7KC 3G6JE 4PJIA 5D7LB 1KCRH 4IOSD 4DVBA 4XNYH 3WLBB 3MOAH 4U1HA 3QUMH 5EBLB 1A6WL 1KF9B 3FONA 1NEZG 1TCMA 1OTSC 4CBPA 4GAGH 4WWKD 1G9ML 5JNYA 4J6RH 2R1XA 3O3DB 4PLKC 3I9GH 3IU4L 3KXFD 3VXQB 2NY1C 1DUZB 1ES0B 3VDAA 1TJIH 3DURA 4QTIL 2Z91A 3PWPA 4NUGH 1AGBA 4UOW0 2BY0A 5GZOC 1RHFA 1DL7L 1KELH 1LO3H 2W60A 2FNBA 5HHPB 1MREL 3FFDA 3V5HA 5I1DA 3VFUB 1WGOA 3QUXA 4UILL 5CEYA 3WFEH 3BDYH 1LO4H 1KACB 1FZJA 3CXHJ 2A6IA 1YEHL 4LVOB 1CN4A 3HE6C 4LVEA 2ADFL 5I75B 1CFQB 1DEDA 4IS6A 4G8FB 1IFHL 1I7TB 3ES6B 4XBGA 1KEGH 5EA0L 4KMLB 3DX8B 2X2YA 3GSOB 4XB7A 5ILTL 4EUPA 1EIBA 3V2AR 4XP5L 3RPIA 4RGNE 1BFVH 4OQTL 5L8LB 1X6NA 3PG2A 4O58H 1ND0A 4NCC1 3ZHKA 1LNUB 4XX1E 4LSQH 2R0KH 4MXWH 1AI1L 3U30B 4O51A 3WSQL 3ZT6A 5E8DL 1WCBA 3F7YB 3F7VA 1DLHA 1IAII 1I85A 2EC9T 1RUKL 5FYLH 4P0DA 3NMEA 3ETBF 4I2XE 5F7WC 3L5JA 4R0LC 5F7EL 5SWZE 4JRXA 1MQKL 4JDVA 4MAYA 3LN5A 4I77L 4IJ3C 3R0NA 2XXMB 4RAUA 1KLUB 4PJDF 2CLRA 5IW3A 1KJ3L 5ITBL 3DROB 5L8JB 4WI2A 4L3CB 1LD9A 5CSZB 3T3PE 1QSVA 3VI4F 5IMMB 3MYJA 5I1LA 1OGAE 1V8HA 2YZ1A 1AFVH 4NT6A 2D03H 1S7QB 2IH1B 4RCAA 3H7LA 3IDXH 4W6XB 3QULA 3RVXC 1J9CT 2YA0A 4GBXD 1YC8A 5J7CC 3TC9A 2VXQL 4IRSD 5T3ZH 1NFDE 4TN9A 1JPGA 2R69L 1JMXA 4CVWA 3JV6B 2ADFH 4D0CB 2LE9A 1JMZA 2QHRL 2OI9C 3QH3A 4PJ8B 1ZVSA 5DD5L 3W2DH 1MY5A 1NUDA 5DMIH 3I2CH 3QIWD 5I1JH 3GMOB 4QHKI 2VWEE 4WFFD 3NH7L 2P42B 1Z9SA 4M03A 5HHOE 1BD2D 2IQ9L 1MJJB 2XTJB 1QVOB 1E4XI 1MOEA 5DJDA 5JW4R 5JLZB 3SGKA 1JHLH 1ZT7B 2NQCA 3CFDA 4O4YH 3UTZA 3ZKXB 5GS0D 1MAMH 5E8DH 1MVUA 3VG0L 4L4VE 1AP2A 4NQSA 4DGYL 4R96B 3FO0L 3CVHA 3W81A 5KBNC 4WFGD 3E2HB 2XZZA 4O2EB 4NRYB 4WV1A 1QFOA 3BD3A 3VXPA 4CW1B 1B9ZA 3ARSA 4NO3B 3HS0A 4KXZI 1WT5A 1RI8A 3D9AH 2LU3A 2DDQL 1ZK9A 1WICA 4LAQH 3O3BA 3NA9H 4I2XA 1FYHB 3C60D 3GI8L 1J87A 1D6EA 1MF2H 1TVBB 4LFHD 4GG8A 2AJSH 1J0JA 2VXQH 1SVZA 1AR1D 1OD9A 4F7TB 1G0XA 4FTVE 4JKLA 3UBXG 3WFHB 2Q20A 1RK1B 1UGNA 5TF0A 2P7TB 2OK0L 4N5ED 2QHRH 5JIPA 5DD5H 2IQAA 3CDGA 3QEQE 1WQVT 4GKNB 3MLYL 1HK6A 4TVSa 1OGAA 3LSOA 2X9YA 1OGTB 3TJEL 1JI1A 1UA6L 3KS0H 5IUSA 3SDCC 2DRUA 2E9BA 4J3OC 1KYOJ 2VLMD 2NCMA 4KVNH 5HHNB 5DZOA 5F9JB 5BO1L 1S78D 2WMPA 3NBNA 1FZMA 2JK5A 1A7QH 3WN5C 3EGSA 3MO1B 5T3XE 5C8JB 4M48L 4KHTL 1EEZA 1UM6H 1DVFC 1IM9A 3D48R 4MAYC 2X4OB 2AGJH 3BGFC 5C0GA 4C4KO 4KRLB 4P59H 4NBZB 2YA1A 3LD8B 3QUZB 3T09A 1F42A 1A4KA 4XC3H 1BZ9A 3STLB 3BW9B 5JQHC 1K2DA 2DIAA 4G6ML 4L1HA 4HJ0D 2CLVB 1JGLH 3DRTB 2V2WB 3OJMB 3S37L 5E00A 3ZDXF 4R2GB 1U8LB 1VFBA 1EPFA 1SJEB 4V2BA 3H9SA 3N50A 2A6KA 2EKSB 2EE6A 2KZWA 2BSRA 3CPLB 1CG9B 1OTTC 2E7HA 1NANH 5I8CB 1ZEAH 4NNYB 2NYYD 4AEHH 1DUYB 4M7JL 2PYEE 3RY6C 5TE6H 3RWHB 4JZNA 5IBTH 5F6HJ 2H6PB 4PJ5E 5L2KB 4YDKH 3CK0H 2DM7A 3RWIA 1LDPH 1I1AB 3BAEL 2WINA 1XGQA 4RFOL 4WI5A 5JUEL 3HHRB 1U8NA 1X5GA 4I48A 4F33A 2O61B 2Q7NA 1RK0A 3U0WL 4GMSH 4LPUA 3TJEH 2BCKB 3SGKC 2XNAA 4NQEE 4ZFOA 1U3ZA 2ED8A 5CBEB 4YNYB 4OZGE 3NTCL 3EO9H 3BQUA 5BO1H 4V1DB 3T0EA 2CKBA 1I9JH 1JPTL 1RZJH 3GNML 4M48H 3LAFA 4NBXB 5E2UL 5F7YC 5LBSL 3E6FB 4RGNC 4W6YB 5MI0C 2HT2D 4YHZL 5KVMC 2SEBA 4JPKL 2D0HA 4MDJA 5K59E 4JZJC 4HEPG 4GKZA 4QY8B 2EO1A 2R4RL 1Q72L 2AVGA 3K80A 3OB0K 3CZFA 5IBLD 3MGOA 1S7SA 1BECA 3S37H 3LEXA 1DCLA 3R8BB 3RKPA 3M8OL 5EU6D 5EOCH 1YJDH 3HN3A 5D7LE 5HDBE 4QNPE 4JFDE 5DJZB 3A67H 4BA8A 1DBBH 3O8XC 2FCBA 4MA7L 1CK0L 3S9DB 1IAOA 1UZ6E 3MLWL 3W9DA 1UXWB 3IJHA 1GAFL 1V3KA 1XT5A 1H3UA 4M7JH 5FK9A 4WJ5B 2JJWA 3ORJA 2YS4A 3QDGD 4U2ZA 5KVGH 3M17A 5DHXB 3T2PA 4EI5B 3BP6B 2WBJD 2N7AA 3PWNA 4JKWA 4PJGF 3IFPA 3PWUB 4H25A 3QYCA 5SWSA 4DKFH 1H8NA 1J18A 3VXMD 1B2WL 3HAEG 2F54A 1XF2B 3FAWA 1J1OL 5IVXB 1HN1A 4Z0BH 3MLZH 4YXKH 2APFA 3PDOA 2YUXA 1NKOA 1T1XB 2PYEA 4OKDA 4ZD3L 2VXSH 1GOFA 5CJOL 5GZND 3VFTA 1WZ1H 4GS7C 5CIPA 4WO4B 1RJCA 2R2BA 4LSPL 3IFLH 4HEME 1KG0B 2PXYA 4YHYC 5HVHB 4XAKE 4ZSOA 4CNIB 4F3FA 4YPJA 4G5ZL 3LQMA 3ZYJA 5ID1A 4NHCH 3KPRB 2AEQL 1A6ZA 4PGEA 1DEEA 3SDYH 5C0BB 3D3VA 4WENB 4OLXH 4XH2B 1YEEL 2UZXB 3PHSA 5KG9B 5C0RH 4LSVH 5DVLA 1NKRA 2B5IC 1WBXA 2XN9B 4ZFFB 1PJ9A 3NIDF 3FQRB 4HGWB 5IFHL 3O45B 4IM8A 3FO1B 3J7HA 1JGDA 1IGTB 2P8PA 4PYHA 1GZQB 3ZYIA 4HK0B 4OGYH 5CS7A 3GBNL 5DJCB 4FQHB 4XB8A 5TDPB 5I1CL 3ARXA 4DCQA 2ZSVA 3KYKL 5AUMA 2A6DA 3S3JA 5HY9A 4LSSH 3FB5B 4YHPB 1I7ZB 4HUNB 4RAVA 1OAXL 1YDPA 3BKCH 1OQOA 3EHBD 2MHAA 3GMLA 4MJIE 4DGVL 2AXFA 4YK4C 2HRPL 3MRPB 3NIFE 2P5EA 3WLBA 1I1FB 3MBEC 3MCLH 3DBXB 5EBLA 3C09C 2VLRE 3TNNB 4JKKA 2NW2B 3RX7A 4GFTB 2HKHH 2CDGA 1U3HA 1QFUL 4LGRB 3BQUC 2PO6B 2UZIL 4JFEB 5CJOH 3VI3E 3O3DA 1A6UH 3QO1A 3T0EC 2AQ3A 4BZ2L 2EZ0D 1A6VL 2WWKO 4UIKL 3VXQA 4YDJB 2GUOB 4UB0L 1ES0A 4OFKA 1ZLUH 4HXAL 5DYOB 5IIEB 4UTAL 1V7ML 1WC7B 4KZDL 3CVHL 4LK4A 3KYMA 2VC2L 3VMOA 1I4FB 2R2CA 2XTJE 2VABB 3VFUA 2R2EB 1N3NA 3FQWA 3KVQA 5FDWA 5CKAA 5C07B 3WHXA 3SKMB 3TN0D 1CLCA 1OAYL 3PGCB 5EBWA 4ACPA 4FOMA 1RMFH 4PG2C 2OTPA 3BP5A 5LXGL 3GSOA 4XWGL 1NGXA 1SEQL 5IW6B 1WWAX 3KYKH 4C57C 1TENA 2FJHB 1LNUA 3QUYD 5FB8B 1YECL 1A9BA 1TJGL 2FSEA 2DTSA 5DR5H 4OZIE 1TZHB 5IK3B 4K7PY 3F7YA 3ARBB 4S1RH 3AXLB 3HPLA 1TETL 1FV1B 4F15C 3ABZA 5E9DB 1I1CA 3DX9B 1NBYB 2KUTA 2AJ3A 5D2LF 3T8XB 4JQIL 5FA4A 5LVEA 1I3UA 4XXCA 1S8DB 2XI9A 3PGDB 4RQQA 4FABH 4Q6YA 2PXYC 1TVDA 3CUPA 2O5ZH 4JDZA 5EUOB 1MI5D 1ZXQA 4L3CA 4DKEH 4UIKH 1H3XA 4GUPA 4PJIF 3TYGH 3S34H 3OV6A 1ADQL 3JV4B 4PB9H 5AWNL 3AS3A 5IMMA 4O00A 4JM2A 2EYRB 3NFNA 4AL8H 1I9EA 2VC2H 2IG2L 1DBML 2VZ1A 4B41A 5JOEA 1GHFL 3WMSA 1LQSR 1U58B 1S9XB 1P9MA 3C5ZC 1GH7A 4FP8L 3D5OF 4OZFB 4M1GL 3P9LB 3HC3L 3FN3A 1QA9B 3FRPG 4H88H 3JV6A 5H37G 1MFDH 4D0CA 1MCCA 4M5ZL 4PJ8A 2VLLA 2XA3A 2Q3ZA 5C0NC 4CL7A 4KROD 2FBJH 4JG1L 3K2UH 2PTUA 3GMOA 5JO5B 3PE9A 5I74B 4X98B 1C16A 1QVOA 3GUTB 2V17H 5LQBL 5JXEA 2XWJB 3D2UB 1FGVL 1ZT7A 5TFSL 4KZEL 1E6JH 2Y6SC 4HIHB 1J0ZA 3DO3A 1MLCB 3BEWA 3X17A 4D9LH 4Z7VB 3ARGA 2CRYA 2V2TA 4U1GB 2H8PB 3LRSB 5EU4B 3G5XB 1OPGH 1P69B 3DARA 1P5VA 2P8LB 3H7BB 4ZG1A 4OM1L 1X5IA 1IGFH 4O2EA 4NRYA 4OIBA 1UH4A 3OKDB 1REIA 3LEYL 4M93B 2AABH 4HS6B 4OLEA 1C5BH 4NO3A 4D9RE 4LNVA 1JN6A 4CU7A 2CKBL 3MFFB 3M45A 3B5HA 5GHWH 2G75B 5E08H 4XVJL 5CZVL 2EDEA 5I19L 1PSKL 1E28A 1IAIM 1TVBA 1ZA6B 3QCUL 5HTSA 1JNLH 3OGCB 1S3KL 4LVOC 5I75C 1ZOXA 3VU2A 4V1DE 4M1GH 3IDIB 4GXUM 1RK1A 3RA7L 4DZ8B 1E0OB 4AEFA 4MQXD 4AIZB 4X7FC 2BNQD 1OWWA 5HYEA 5BMFL 2YXMA 1EHLL 1Y6MR 4IMLB 3NN8B 4LCWD 3KXFB 4MAUL 3U30C 2YOCA 3T0WA 2J88L 4JRYE 5HHNA 4IOFD 4QRQA 5E2WH 4Z7OE 1FIGL 1IEBB 4HF5H 3QO0A 1L4IA 2HFFA 5F7UA 1RJZB 5DUPH 1YC7A 5DO2D 3NPSB 1HWHB 5FYKL 1W0WA 2GAZB 2OR9L 2DI9A 4LHUA 1MY7A 3RL1A 5FOJA 5C9JA 2ADJB 2X4OA 4NJAL 5SX4I 3QDAA 1UVQA 1AHWB 3QUZA 5H35B 3CFBB 1N64L 4TPRL 2Z8SA 2CUIA 4GRMB 3BW9A 5TDOA 3ZDYF 5HVFB 4Y5YA 1DR9A 1ZHLB 4QT5A 3AB0B 3S3PA 3RWDA 3DRTA 1JZ8A 2V2WA 4ZYKA 5FF6B 4J1UB 4Z76B 1NUNB 4XP9L 4C55A 1DQJB 3L3GB 2QQLH 5H37H 4JO4H 1SJEA 4G80A 5BOZG 2EKSA 1N0XL 4O5LH 4O9HL 1T1YB 1W0YT 1FZKB 1P4IH 2JB5L 1FLRL 1KTDA 2W59A 5IVXE 1T2QH 4OF3A 3CH1A 3WXVH 4OLYH 1FRGL 3KDMB 1PSKH 1CGWA 4G7VH 4MNGB 3OSKA 1P9MC 1CLYL 4NGHL 2JELH 1G6RH 4P9HC 1MCRA 2YC1B 3T65B 1YYML 5HYSG 1MCNA 3Q3GB 1S3KH 2CXKA 4W4NA 5L2KA 5F88B 3MPCA 5BS0D 4PJ8C 4OFIA 4Y16D 4YHML 4EN3D 4HBCH 1FVCB 3QJHB 1CT8A 5CD5D 4LRNH 5J13B 1GOHA 5DQDL 2EDKA 3QSKB 4HV8B 3SGDI 3S88L 2O61A 2XTJC 1L7IH 3P11H 1J1XL 5DWUH 3C5SA 2XN9E 3L5XL 2OSLB 3WFBL 5EO1A 3ZKXC 4LSUH 3FT3B 5C0CD 4YLQT 1RUPH 1IJ9A 1FO0H 4YNYA 1H3WM 2FX8L 1BQSA 1V3LA 3C5JB 1MCQA 2GK0A 5KVFL 5AG8A 2ARJB 4Y8AA 1T1WB 4GBXB 3E2HC 1XGTB 4L4TA 3E6FA 4H1LA 3VFGH 4C56E 2CO7B 4GLRI 4NJAH 4IRSB 3LKPA 5CSGA 4ENED 1GGBL 2FYYA 5LGJB 2J8UA 2NW3B 2GJZB 1R3IH 3EFDL 4GRWH 1INEL 2GW5A 3V6ZB 3BPOB 4Z5RA 4FG6C 5CFHA 1SMOA 3QIWB 2DLFL 1TTGA 1BD2B 3FQNB 5FYKU 2VLJA 2X4SB 4LMQI 5DJZA 3H9YA 1OAUL 1S7WA 4HUWB 1SHMA 1GIGH 3EOYG 5GS2D 1FZOA 2F19L 4LBEB 4WJ5A 3EFFB 5CP7B 3O0RL 1YNTB 1R5WB 2VITB 4EI5A 5I76B 3BP6A 3QXTA 1XR8B 3GMQB 1XR9A 1CFSB 4YHMH 2YHGA 2ZUXA 3PWUA 4Y5VB 3WIIL 3RWFB 3WFZA 3MLUL 4QOKD 5DQDH 3F58L 5EZIL 1Q0XH 4OAWB 1MCEA 2I24N 3DX7B 4FQ1H 3MRMA 3O6FD 5E99H 1UJTA 1AQDB 2VE6A 2Z4QB 3VMNA 5DDHA 1JUFB 3SE8L 1T80A 5JW3L 4YH6A 5C07E 3WFBH 4F7PB 2GTZB 3GJFB 1KG0A 1A7NL 2W0KA 5HJ3B 3HUJB 4CNIA 3LPGA 2DQJL 2VQTA 3C60B 4KHXH 3W0WA 3HFML 5KVFH 3CLEL 1M7IB 3KPRA 4CKVX 3LD8C 3QUZC 5J6HB 5C0BA 3V95A 5EC1B 3VXNB 4XH2A 2C26A 4W6WB 3B8YA 5JDSB 2KKQA 1MCOH 1INEH 3FQRA 3EUUA 4HGWA 4JHAH 4E41A 3T0DA 3FO1A 4JFPB 1IGTA 1IGIL 1I75A 5EBGA 3KLAB 2O5XH 2R9HC 4RWYH 5DJCA 5ANMA 5E9DE 1W72L 2DLFH 5TDPA 2QLVB 3MA7A 3U36A 3BUYB 4UQ3A 1OP5K 1MRCL 2Q3AA 3S36H 4OUOA 1L9MA 3FB5A 5DTFB 1MFBL 2NY5L 4LSRL 5JW5A 3EO1B 4TYUA 5EUOE 1I7ZA 4LLVB 3NFPB 4WUKH 5DVMA 3EYUL 1I1AC 3I6KA 3B83A 4CMMB 2D7NA 4X7SH 3DI3B 2HG5B 1Y6NR 1CDHA 3MV01 3FMGH 3JVGA 2HTKD 4UBDD 3RIFF 1I1FA 4JLRA 5L0QB 1I3VA 1U6AL 1C7SA 3RI5K 4XP6H 2NW2A 2BSTB 4MCZA 1BMGA 3VFMB 4LLDB 4LGSB 3S5LA 2Y36H 1OT2A 3RKDD 4F8QA 1YUHB 5KTEH 5AYUH 4JFEA 1OY3B 1RVFH 5D8JL 4AG4H 1EHAA 3FN0H 4HFUL 3T3MF 5J89A 3AGVA 1OAZL 4YDJA 2GUOA 4R26H 2B4CC 3HFMH 5FYJL 5I8OL 3GI9H 3IDNB 2MMXA 1PZ5A 2EIZB 2ADGB 1AR2A 4ZFGL 1I4FA 4HXBL 4PYGA 1YEKL 2VABA 4WFED 4WRLA 2ZCLH 3EW3B 2C1OB 4YAQB 4YBQC 2A74B 5F71A 1NAML 5C07A 3BH9B 4ORZC 3W82A 2XZQL 1MEXH 3CGTA 4Z7VE 1FYTA 3PGCA 5CEXB 1VDGA 1TZIB 2VXUH 3SY0B 2E9JA 4LVHB 1SJVA 5KW9H 4HH8A 2I26N 5IW6A 4NDMA 4YEFA 4Z7WA 4N0RA 5EPMB 1F11B 1MRCH 3KG5A 1HKLL 1RURH 2OZ4A 5HI4C 5FB8A 1F4YL 4EI5C 3VXRE 1TZHA 5IK3A 2HTLD 3FHAA 3UXFA 1FH5L 2OTWB 4Z0XB 3V0WL 4Z8FH 2R29H 2BDNH 3I3DA 4DEPB 5HPMB 5CZXD 2B8OT 3T8XA 3INUL 3DXAD 3S3SA 5K59F 1RULL 5IOPA 2BNRD 1G6VK 3PGDA 5EU6B 5HVHC 3QPXL 4EVNA 3O6MH 4KGJA 4OQ1A 3BXNA 2CH8A 3KPMB 3JV4A 3X11B 4HMDA 4RA3A 1WCQA 5I8OH 25C8L 1T0MB 2VDLH 5MP6H 1A7PH 3QDGB 3GSNH 3KXFE 4U0RB 2WBJB 1HQ4B 4MS8D 1TFHA 1JPFB 1MJ7L 1PKOA 4ONFL 1QA9A 3PV6B 3VXMB 4LQFL 5KJRH 5I1AA 2UWEA 1KXTB 4JFXB 4MCYB 4E0RB 3IDGB 3QHTC 5I9QB 2A83B 2C1PB 4S10A 5JO5A 5FYJU 2E6QA 5CLWA 4X98A 2FJGB 3H0TB 1FNHA 1NDMB 1YPZE 1F4YH 5D7KD 3UTPD 2DD8L 4ODUB 4YIQA 5FUCE 1UENA 4HIHA 3NAAL 1A7OL 4JFHE 3L3IB 3C2AL 4HWUA 4U6TA 3G5XA 1DQMH 1G7MA 1NL0H 4YX2H 1AGFB 3GSVA 4QRRA 4CN1A 1FNSL 1SM3H 3FO9A 2P8LA 3ARQA 4MNGE 1U8JB 3WJJA 1B0GB 3UJIL 2YPVL 3L3HA 2PO6C 5T5NF 5F1SA 3H8NA 2FL5B 4DTGH 1FHGA 4HK3J 4HS6A 4NZRL 2C3VA 1I9RH 3DUUA 5BVPH 2QQKL 5DS8B 3PABA 1H5BB 5GISL 3GB7A 3ZTJG 3KJ6H 5FOBB 3JWNC 3HI5H 2CIKA 1MCWW 1IT9H 1XZ0B 4UV4L 3QI9D 5E8PB 3FB7A 3G5ZB 3V4PL 3PWVB 1ODAA 3IDIA 4OD2A 2ESVB 3BDBA 3BEVB 5DGRA 2BVUA 3X3FL 4JM2F 1GOGA 4AIZA 2VOTA 2PTTB 3FRUA 1S9WA 3MUGB 4U31A 4R9HA 3KXFA 5SV3A 1NGPL 1QBBA 1OM3L 3MQIA 4F9LC 3ARBC 2X4UB 5J6GA 4U4BA 3GFUA 4X6DB 3S36X 4WFFE 3VE0B 3Q2CA 2IMNA 1RZIA 3VFSB 3LQZB 2EH7H 4OLWH 4LLAA 1U8QB 1LO2H 5HHVH 2YD9A 5INCB 1FNSH 3RNKA 1XGRA 5H35A 3GSQA 1A64A 4JPWL 3TN0B 3ZHDA 1P7KA 4OV5B 2X9XA 1CFTB 2YPVH 2J5LB 1ZHLA 2KQMA 5JR1L 3VFRA 1MJ8H 2APWA 4J1UA 4NQXB 4M1CC 1KB5H 1ZV5A 1VGKB 4WW1B 3U4BH 4LLUB 4K8RD 1WWBX 4TULL 3QUYB 3ZKNC 2XFXB 2RQ8A 3QXAB 1FZKA 2QQNH 2IFFL 1X9QA 2DI7A 4AH2B 4AK1A 5DRXB 1F90H 2JJSC 3QQ4A 1M7XA 1PZUB 2WBWB 3L3DA 5ABDE 2DTMH 3Q3GA 4Q0XH 4WI4A 3SO3B 5B8CA 1JHTB 3HUJE 3LV3A 1I1YB 5I66B 5F88A 1AXSA 3V6FB 3QP3A 4Z7QF 5HYQA 3QJHA 5F93C 3GGWB 4L9LA 1F4HA 5I74C 1E4KA 2HKFL 4NC1E 3HRZB 2W9DL 5GGVY 2VDOL 5EC2B 2BVEA 1MI5B 1PDKA 3MFGB 4QRSB 2BRQA 3EDKA 3DO7A 2VXTH 3WFDL 3FT3A 3LKRB 1OAQL 2MNUA 3DX6B 2EH8H 1WEJH 4EDXB 4U1GC 1OOAA 3TZVD 2EXYD 4Z78A 5KSUA 4OB5L 4I0PD 2ARJA 1HILB 3CX5K 4U1LB 2DYPA 1XGTA 2VLME 1R0AL 4KY1H 1ZT1B 2CRIA 4IRSA 3TH4T 1LE5B 4HWBH 4PJHA 3FT4A 5BZWA 1BZQK 2VISA 5LGJA 2GJZA 4M93C 5MEND 1A47A 2P8MA 2CUHA 1NMBL 4ZFZA 1GC1H 4JY4B 4KROB 2I07B 1BFOA 1H3VA 1RJYB 3SDXB 3L3OB 2VH5L 4L4JA 1RSFA 1U3JA 1BD2A 5TQ2H 2ZCHH 4MJ6A 5MERB 2ZUUA 4M7LH 2YEZB 1ZVYA 1IGCL 1ORSA 4P2QA 5D70L 2OTUA 4L3ED 5IB2B 4I5BA 2W0LA 35C8L 1EVUA 4LBEA 4ZS6D 1HINH 4L8DB 2X4RB 1S7TB 5CP7A 1YNTA 1R5WA 2Q8BL 4K7FB 3O6KL 2DQIL 3QHFL 5I30H 5KVDH 2E7LA 4LP5A 4BJLA 3IU3B 4Y5VA 5C2BL 2ATPB 5I2IB 3UTTA 3B3IB 2W65B 4P57A 1AQDA 5IR1B 3SEPA 1XIWA 4HLJA 3ULUH 3WFDH 2GTZA 3NPSC 3MJ9A 4PTTB 3JXAA 5HJ3A 3K8LA 3C60A 5JW4N 2P44B 3ZT7A 4OB5H 2WBKA 1MWAB 3C87A 3ALXA 1AXTL 5J6HA 4QHKJ 1R0AH 5ENWB 2H9GB 1QD0A 5GS1A 2GTWB 5FCUL 5EC1A 5DVOA 4QRPA 1KN2H 5EZLB 3AB0C 2D7QA 3Q1SL 3FCTA 5HGAA 3PHQA 1Z6JT 4P9MH 4NSKB 1NGYA 3F7QA 4DVRH 1VERA 2BNQB 3X12B 1T4KA 2VZOA 5D7IB 3KLAA 1PGRB 2CJUL 5GIRA 1RZKH 1IKFH 1CLZH 1MCKA 3BUYA 4LCWB 2PKDA 1PG7L 4ZTOH 2J8UF 1KTRL 5CSBA 5DTFA 3TBSA 5EU6E 1V05A 3EOAA 1H15A 3G08B 4OGZA 4NCDA 2QADD 4J3SA 2ITDA 3CIQA 4CMMA 1RJLA 3EOBB 2HG5A 2CUMA 5C3TA 1E4KC 3TGXA 5ITFA 5AZ2L 3SOBH 1F3DJ 1UWXH 4N0YH 3QDGE 5CEZD 3VFNA 2BSTA 3VFMA 4XPGL 1QSFD 5KS9E 1U91B 1VADA 1ZGLB 2R1WB 2VZTA 6FABL 5T3ZE 3VXME 5FUZL 1TTUA 3STZB 1J1PH 3BWAB 4UDUB 4GBXC 2EDHA 3SDDA 2V5YA 4ONOA 5A16B 4IRSC 4NO0A 2Q8AH 1ZMYA 4X6EA 3PP3K 4DN4H 4HS3B 3WKNA 4RFEB 1HIML 3BVNB 1KLGA 5BS0B 4K3HA 1D5MB 2C1OA 3BPOC 4Y16B 4YAQA 4EN3B 4S2SA 4DUWA 4F2MB 3BH9A 3QIWC 3IGAB 1X5JA 1HI6A 2JJUA 5C08A 1UKTA 3WXWH 5C86A 5CEXA 1TZIA 3CU7A 5D1ZD 4Q6IA 3F6IA 2ICWB 5C0CB 5EOQH 3CMOH 1N2RB 5EPMA 1F11A 5D6CB 4F9PA 5IW1B 2B20A 3B2UD 2XOTA 4JRWA 2G60L 1R6VA 3ZE0F 2E7LC 3FTGA 1CL7I 1CS6A 3BIKA 3VDBA 4Y5VC 3C9NB 5DD6A 3PF2A 2VL5B 3KGRA 5D2NB 2BY1A 4UZGA 3BJ91 3TT1H 3MLSH 4ALAL 1BEYH 1KJMB 4YR6B 3LIZL 2YD1A 2OM5A 3EO0B 3REWA 3GMMB 2AS5M 1N59B 2YD5A 2J6EL 3C60C 3VH8G 4M6OL 4HH9B 1VACB 3PP4L 3KPMA 5FV2A 1UWGH 4HT1H 3NABH 5IMLB 1UKSA 5CILH 1AR1C 1EAPB 4HULB 4W70A 3SKOB 1AQKH 2YRPA 3GMPA 2VKXA 1HIMH 4N5EC 1EMTL 5E2VH 3N1FC 1JPFA 3R8QA 1ZA3B 4X6DE 3OKYA 4JKMA 4MXVF 3BGAA 5JXAH 3PV6A 4QOKB 1TQCB 5J1AA 4JFXA 3L7EB 4E0RA 3F5WA 3IDGA 4GW1B 3O6FB 4RMUA 1NGQL 4LEXL 1S78C 4WNQB 4ODSH 2P24B 3HC4L 4N8VA 2F58L 4LF3B 5F44A 1H3TA 1T89A 2ZP0T 2BNUB 3L3IA 2I5YH 3RVTD 4I3SL 3JWOC 5DJ2B 1QSEE 3MV9D 1FGNH 4HJ0C 5L0QC 3MACH 1AGFA 1HEZA 2HFGH 4PRBA 4KVCH 2EE3A 4Z7WF 1WZLA 4U6HA 3TIDA 4QXUL 1M71A 3AS1A 5D5MB 1JTOA 1B0GA 4XVUD 1A2YB 3BISA 5KN5B 4U1MA 2ZG3A 2EE2A 3MNWB 2FL5A 4PPTA 3VXSD 2R23A 3SDDC 2NYYC 4M6OH 1KIPB 1F2QA 3UDWA 3BPNB 4XPBL 4Z6AT 1IILE 4LHJB 3DNKA 4NM4H 1MI5E 5FOBA 1TJHH 4AT6B 4NO5A 1XZ0A 3STBA 5E8PA 2BXYA 3PWVA 1YY8B 2E6PA 1CXKA 2HWZL 5CWSB 3WS6A 2AK1L 2FRGP 2ESVA 4P46D 3MRIB 2GCYA 1W2KT 1LK3L 4LVHC 5FO9B 1FORL 3MGTA 3AAZB 3SJVA 3KPTA 2Q7YA 4F9PC 4LARH 2Y06H 1EA9C 3MUGA 5DEGB 5LCVH 3O41A 4KTEH 3OZ9L 1LEIA 5E2TL 1XCTA 2CK0H 2Y5TA 2F58H 1AKJD 4XX1G 1MNUL 2HT2C 2UWEF 4NZUH 1UACL 3VE0A 3OKLB 3VFSA 1EK3A 3SDXE 4DEPC 1U8QA 1OCWH 4XNXL 5IBLC 5EG6C 3DUSA 4MDIA 2VZ3A 5INCA 3Q0HA 1CICD 4ZQKA 1CFTA 4JHBA 4APQD 2KPNA 5ISZE 4OUUB 5LWYH 1BF2A 3IJYB 5EZOH 5C0DB 4CU8A 1W8NA 1VGKA 3O2VL 1NCAH 1NUGA 1MFNA 1HQRA 1F6AB 2VDRL 4XPBH 3RWGA 4X4YA 2A0LD 2XFXA 2YK1L 1BOYA 4NYLA 4B5EA 1Z3GL 5FA3A 3QXVA 4U0RC 2WQRA 2WBJC 1MIMH 1XF1A 4R97B 1Q38A 5LG1A 2LQRA 5T1MB 1BX2B 5I9QC 3V6FA 2VDML 4JKPL 4LSDA 1AE6H 3DXAB 1KBGL 2BSSB 2DQTL 5IQ7H 3GGWA 5GZNC 2BNRB 4PJCB 3HRZA 4LNRA 3DVNB 1NGWB 1HNFA 4XNZB 4ERSL 4OFYD 1T89C 4ODVH 3S4SB 3LKRA 3KPOA 3DX6A 5FO7B 2BNQE 1HZHL 3WJLA 1UACH 3O3UN 3KWWB 4G8EB 3RWCB 5CINL 4ZNEA 1KCSH 2D4DA 4WHTB 2FWOA 1ZT1A 4DW2H 3UTSA 4NKDA 4X80H 1LE5A 1D5IH 3HE6D 1P7QD 3L9RA 3OX8B 1KCVL 4OBRA 5ADPL 1ZLSL 3WUWG 2XQYK 5IVOA 2MFNA 1H5BC 1RJYA 3L3OA 1F45A 1WFTA 3JTSB 5DHYB 3TO4D 2YN3A 3HCVB 4LEOB 1YEJL 3EHBC 4Y4FA 4NQDA 1A4JB 1LO5B 3C8HA 1G7QB 4LPYA 4QHMB 1QZ1A 5J12B 3N0PB 1ROWA 1S7TA 2B0SL 2R0LH 1G9NL 5JOFA 1CE6A 2PW1A 3P30L 1IC7L 1P53A 4B50A 4JKPH 4M6NL 1KTKE 3IU3A 4KDWA 5DFVD 3AC0A 2ATPA 1HXYB 2DL2A 3GHBL 3B3IA 2GI7A 2EZ0C 2NNAB 3VRJB 2Z8RA 4KUZH 2W65A 5BS0E 5IFAH 3T2QA 4TQEL 5IR1A 5I8EB 2LVEA 2X70B 1TZGL 2V5RA 4XPTL 3V4VH 4EIGB 1LE9B 5JHLH 2QJDA 5F8RC 4BQBA 5DEFB