3SDXA

Crystal structure of human autoreactive-valpha24 nkt tcr in complex with cd1d-beta-galactosylceramide
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d
publication title Recognition of beta-linked self glycolipids mediated by natural killer T cell antigen receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 68
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3sdxA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3sdxA01
3CMOH 4QYOB 4HT1H 5I8CA 4XCCH 2NCMA 4PJ7A 4YHLH 4FTVA 3VXQB 1FFQA 1JNLL 1TVHA 5D7KD 4K7PL 4DFIA 4OZFG 4YDVB 3T2OA 1PG7X 3EO0A 2V7HA 1LE5B 3IJYA 3ZHKA 1DVFD 3ARXA 1I9IL 2P8LB 3VXMA 2BXZA 2OM5A 4TSBH 4DUVA 3TZVD 1NL0L 3LEYL 3O6FB 1AKJA 3EO1B 1MQ8A 3W39A 4YBLC 1BJMA 4LCIL 4ONFL 1JMZA 2R4RL 1HDMB 4NO0A 5F3BB 3U7WL 1FN4B 1Z0NA 3DRTB 2DQCH 1A3LL 1F5WA 4RSVA 3EOBB 3FJTA 1NCBL 1KTDB 2ITDB 5EN2B 4KI1A 2F74A 4I0CC 2HN7B 1C5BL 1ZT4B 5DMYA 2QSCL 1ZHLB 5DJXB 5ISZD 4MCZB 5DEFA 2XZCH 1K3ZA 3LV3A 1J5OL 4MNQE 3ZE2E 1NBQA 4N90E 1ODAA 1EFXB 1G6RL 3L3KB 4XMKL 1CFTB 3WO4C 3DHJA 3VDBA 4WTZG 5E6YA 4OSUH 4UBDD 2JCCA 4CKVX 1ZS8B 3D25A 4PJ9D 4OCWH 1RVFL 3TCXA 1MJJA 4LU5H 3WIHH 1MELA 4QOKD 2R4SL 4U6XB 3V0AC 4IM8A 1IL1B 4ZFFA 3JXAA 3JWOC 3HB3D 5J11C 3SO5A 2VLMD 4G8GD 5BRZA 4L8DB 5INCA 3ZE1F 5F1NB 3RVXD 5GRJL 4HUUB 3TJHD 4GSDL 3RX7A 5CBEB 3HFMH 4FQ1L 3L3HA 4S1QL 5CKAA 3DHMA 4YH6A 4FABL 3FOLB 1QO3B 4ZSOE 4DQOH 5D1XC 2PCPB 1MFBH 4JVUA 5KS9A 1M1SA 4MAUL 1DQDL 1U8IB 4P2RE 4B7LA 5E8OA 3UJTL 4LSUH 4FQLL 1J9CT 1JI2A 3A6BH 5D1XA 2ZG3A 1L0XA 4ELKB 2EDDA 3OKLB 2QHLA 4XCEA 5F7MC 2YKLH 3T0WA 2AJXH 1A14L 5CEXB 5IB4B 3QP3A 2CLZB 4MS8D 3QDJA 4XPTH 4AYFA 2J2ZA 4KH2A 3BGFC 1C12B 1AO7B 3GMNA 5D2LE 2BCKB 2RAMA 4U1JA 4Q6YA 3DSFH 4XCFL 2ICES 1GOGA 1MHHA 4Z0BL 1OD7A 4OZHA 5F7UA 1XF1A 4PJFA 5HDLA 5ITBH 4UAOB 1CD8A 3ALPA 5KVEL 3NCFB 4JQIL 3INUL 3PQYA 3VRLE 3MX0A 5I2IB 1BBDH 3VWKD 3WXVL 4ZAKD 3RP1A 4KMTL 2BNUA 1TZHB 4LPCA 4Q6IB 3CSBA 3VGAC 5IHLB 3O9WB 5GRXG 1MPAL 4LASH 3B2VL 1LILA 1AE6H 5HI4C 5IJVB 1U8HA 2DBLL 2FX9L 3H7BB 2I5YL 2WP3T 4PGBB 1CD1A 5DXWA 3SGEI 2DQUH 4DN3H 4JRXB 1D5IL 5IKCB 2F54D 4JLRB 1UWXK 3SCMB 1OF2B 3T0BA 1VESA 4IJ3C 5CJXC 5CILL 3VXSD 1GPOH 1JRHL 5D7IE 4M6ML 2GUOB 3MBXH 4KPHL 5EUKB 3RUGE 3EDKA 4ELMA 4FS0A 4P0DA 5CJXA 4P3WA 1GGBH 1EZVX 1U2HA 3K0WA 4JHZA 4KKAC 5TE4H 1TJHH 4OJFH 4N0CA 1KNOB 3O3BB 3S35X 4WTZA 4C83A 2FATL 3BIKA 2Q7YA 5EU3B 2BVQB 3ECBA 5MI0B 1X5JA 2XFXA 4L8SB 2CR3A 4N9GA 1ERNA 5ESAB 5DD0H 5B8CA 4JFXB 4MJ5B 2K7PA 4MVBC 4UIMB 4OQTA 5A2IH 2DI9A 2XN9D 4M43L 3QFDA 4UTBH 2VC2H 4GH7B 4TSAH 4UINH 5DFVC 1X5KA 5DEZA 1PQZA 3BN9C 3SGKC 1INEL 2SEBA 4HJ0D 3QBTB 4V1DE 5FO7B 1CE1L 4EUPG 4CVXB 3FFDA 5MEQA 3GZKA 4NKDA 3QI9D 1X5AA 2ITCA 1U95A 4FZEH 4P23D 4PJEF 3HE6C 3VA2C 5DUBB 4O5LH 2YD4A 3ARFC 1JJUA 3FAXA 3IJHB 2BOBA 1MJUL 1G7JB 3B83A 4C56B 3FFCA 1UM5H 3HE6A 1WC7B 1LHZA 2W92A 2VN4A 4NHCH 4QRPE 3RPIB 1E4WL 3MACL 2FO4B 5J06A 4L3ED 1K8DB 4W81A 2V17L 5CUSL 5IMLA 1EMTL 3FO9B 1CK0H 3BKYH 4JFOB 4S1RH 5I18L 3BN3B 2Y5EA 2A6JB 5F89A 1Q0YL 2OTWA 4LGRB 1LP9B 4Q2ZA 2APVA 3Q5YA 2EH7H 3RVWD 5LAXB 5CD5C 4RNRB 4Z7OF 1O7SA 3VRIA 2GT9B 1SBSH 1JHTB 1IEBB 4FQCL 2R8SH 2OQJB 4NM8H 4F7PB 7FABH 5DQDH 3MLTB 5GS0D 3QULA 1NLDL 4Y4HC 1T1XB 4TVPL 2JK5B 3MLXL 4JJ5A 1NBZA 1BQLL 4LLYA 3SDXF 5DZOA 5HY9B 5T33L 3GMQA 3FQWB 1FIGL 5EPMB 3PWLB 1NCTA 3QFJE 5MEOB 4TNVF 1A4KA 1BD2A 4DCQA 4XB8A 4GBXB 3QXDB 3E8UL 5E6IB 2DQGL 1FORL 3ROOA 1MUJA 1EHLH 2P44B 1AJ7L 4N90D 5IMMA 1OLLA 5FYLL 1YEKH 1MCNA 3VXUB 4MXVF 1YJDC 1CFVL 4URTB 4ZTOL 3R06A 1HKFA 3DUUA 1I1AD 1AP2B 4UDUA 3S36H 5HYEA 4G8FB 1YNTB 4JANB 3UTTD 2X4PB 4UB0H 1B4JH 1GGTA 5KAQF 3KYMA 1DBBH 1JZ4A 2Y06L 1RQ5A 1QFOA 1FO0B 5KS9F 5FGCE 3BPLB 3PABA 4CADA 3O6FC 4M61A 4DW2L 1LE5A 4LRNL 2P8LA 2O5ZL 3OX8B 2J7LA 4OGXL 5DK0A 3BP4A 4JCMA 4KHXL 3DLQR 2F53B 2VABB 4MMXC 4MD4A 3W0WB 1KENL 4U7SA 4GXUN 3OHXA 5IQ7H 1QHPA 4FNLH 1F2XK 3LKSA 3P4MB 1KB5L 3ARYA 3MXVH 4HWUA 4DWHA 1ONQA 2CKBA 2DDQH 2XKSA 3BVNB 3TPUA 3R1GH 4GQ9L 5C2BL 4JN1L 4NIKB 4PJFF 1HI6A 1J1OL 3P3YA 3Q3GB 4XWGH 4BSWA 1JGVL 4M7JL 4XXDA 2XYCA 1IQWH 2FEDC 3X3FL 4WWKB 2I60H 5DD3H 3BIAX 2B1HL 3L3KA 2Z8VC 3WNNA 2B0SH 2A83A 2VRAA 4PGDB 1T3FA 3TF7A 3NCYS 2CDGB 4WVRA 3EHBC 4OCYL 1Q72H 3MV8E 3PDGA 5F70A 2NY4B 2JB6A 3TPKA 1ZS8A 2AXFA 4PJHF 3RQ3A 1RK1A 4ZPTA 1FC2D 4H88L 2YA1A 3O4LD 2C3WA 3RBSA 1RZIA 3ARSA 4DAGH 1TTFA 3AS3A 2IQAB 2R23A 1BEYL 2XY2A 1VFUA 3JWDL 3QCTH 2GK0B 4OQ1A 5GS3A 5HI5D 5F1NA 4FQXD 5HYQB 4ERSL 4U3HA 4Y2OA 5CBEA 3VCLB 3OKDA 4ZS7L 3TV3H 1HCFX 5L9DL 4JFEA 3GIZL 4LSDA 3QPXL 4BFIA 4PJCB 5C0IB 1QO3A 5DJCB 4A2LA 2UVEA 4HIIA 1AGDA 3GSWB 3BZFA 3QG6A 1MNUL 3Q5OA 1U8IA 1OD9A 2VXUH 2FL5B 3VD3A 1FNGB 3KXFD 3OKLA 4R4ND 1CICC 1CLZH 4G5ZL 3UJIL 1KLGB 2DQTH 1EVUA 4K3DH 4BH7B 4XMLH 5CINH 4JQVC 1CICA 4Z78B 3BOVA 4KXZH 4LGPB 4JQVA 5H37G 2YA2A 1DEDA 4PJIA 4FP8L 4CN1A 5E9DE 4RMRA 2DLTA 3EJJX 4ZFGL 3IDYC 3DRQB 1L7TH 2BC4A 4NCDA 3AUVA 1Z0MA 3MOQA 4PTUB 4R7DB 1JGEB 1FYTB 3T0EE 5D96B 3K74B 3H2WA 3O9WC 5CGYD 2G5BA 3QCUH 5CZKA 5ID0B 3IDMB 3QZWG 5EBGA 5TF1L 3RX5A 1S9XA 5EOCJ 1PG7L 2FEEI 1NUFA 4FFYL 1SYVB 1WF5A 1XFPA 2CLRB 3SCMC 3G5VA 4YQXL 1MCDA 4M1CC 5C09E 1UH2A 1X44A 4LSTL 1BZ7B 3GEWB 1UYWH 4X6FA 3GRWH 2VLLB 3GBML 1QKZL 2XA8H 2YWYA 2V5YA 4XH2A 2BVPA 4X8JA 1IZKA 2GJJA 2LU3A 3TO4D 5A2LH 4PY8J 3L5WA 1PAMA 5IFJB 3GMMA 4MDIB 1BVKB 4JPKH 1UWGL 5KJRH 4PV9B 1S9VB 2OZ4A 3SKNA 3WLBA 2VSDA 2I07B 1MHCB 5DI8A 5MI0C 4L8SC 5K9KA 1DBAH 2E27L 1JGDB 3UJJL 1M7IA 3T2PA 1DQJA 1KB9K 4RGMB 1R3HB 1MI5A 4TNVK 3QDHA 3PHOA 3N85H 2JF1A 1A21A 4KVCL 8CGTA 1NC2D 5LG1A 4ZD3L 1F6FB 1MVUB 3O3AA 5ITFA 4Y4KC 5C71A 1VKXA 4ORZC 5FHAH 1K4DB 1V5JA 5LXGH 3NA4A 3BMWA 1J0KA 4KK6D 5T3ZD 5T5FH 3FO0H 1JTPA 2B4CH 2BSRB 4Y4KA 1HSBB 1DFBL 5AD0A 2FD6H 3QPQD 4GAFB 3WKMH 3ULVC 3T04D 2N56A 4U6VL 3KAAA 3QFJD 5KVGH 4A6YA 1CLOL 1AD9B 3HUJB 1F4WL 1CDYA 5HPMB 4L8CB 4M5ZL 5FYJE 3LOWA 4M5YL 1B6DA 1KPRA 5IB3B 1FG9C 1FP5A 5E1AB 2NZ9C 3H9SD 1IGFL 3IXTA 4YE4L 3OJMB 5C08B 3VMPA 2VR9A 1Q9LB 2FECL 3LKNA 4YHKH 3L3DA 4LMQE 1S7RA 5KZCB 2GCYB 1N26A 4JG0H 4PFEA 4ZPVA 4PY7A 4I0PD 2IBGA 4LLWA 5HHOB 5CP7B 1II4E 2HFGL 2BOCA 2QQKL 5LAXA 1QLEL 1KFAL 1I3RA 5ICXA 4EDWL 4F7PA 4Q9QL 3OKYA 2DOCA 4G9FA 1FFOA 4IRJD 4HZLB 3TBSA 5FYJH 5BV7L 4PJGE 2I25N 1RZ8A 4ODTL 1U3HA 4HFUH 4ONGL 5MEOA 2ATPB 3MLYL 4KJYA 2KPNA 3QZWA 3QB7C 3IF1A 2MCG1 3DVFA 5GGQH 1I7UB 1KTLB 4LVNB 3OKOB 1GYAA 7CGTA 4H8WC 1M6OA 1QFHA 4UU9B 4ZTPH 4OF3A 1X4YA 3VFTB 4L4VA 2Z4QB 2Q1EA 1D5ZA 1QRKA 4YDKH 1H8NA 4D8PB 1N8ZA 2AGJL 4R2GB 3LKOA 1AHWB 4X7SH 1U41A 1FO0A 3SKOB 2X4SA 3O2WH 3B9DA 1UB5A 5J13B 5C0JA 1IM9D 4I77L 3RVUC 3BRGC 1S7SA 3HPJB 3QUXD 4NHUA 5ICZA 2XZQL 4BA8A 1F4XL 5F72S 4G6FB 2J4WL 1OAYH 3OX8A 1JPFB 4YDLC 5TE6H 3O6LH 4V2CB 5GSVA 3RWFB 2B2XH 5BO1L 5F93C 1MHEB 4M6OH 3W0WA 1AD0A 1VCAA 3C8KA 2B39A 2V5TA 4IRSB 4LPXA 3S35L 1NBVH 3QCVL 4YHOL 1W72A 2WBJB 4K8RD 3RZCB 4JO4L 1TPXB 5E00B 3L1OL 5BW7C 5CGMA 1N7ML 3IDJA 3IFLH 4AY0A 3U82B 1UWEH 1QSVA 2Q76A 3NN8B 4WWKC 4R0LB 2YS4A 4QHKJ 4JPIB 4WUUE 4NRYA 1B4RA 5FUOL 1UACH 3F58L 5F1KC 5BW7A 4FXLA 3IJSB 5CJBA 5J9PB 1ORSB 4RAVA 4WWKA 2YXFA 5M95B 4F9PC 3DVNB 3SKUD 3EFDH 1S8DB 3MR9A 5DWUH 4K94C 3EO9L 3ULUE 3DX9A 3BQUD 5HDQH 2H6PA 4TQEL 1WAAA 4LL9A 5TPWH 3W2DL 5FUZH 4M1GH 4F9PA 4HK0B 4KGLA 1VEMA 4Z5RA 5ALBH 3ES6A 4XCCL 1HYSD 2FEEL 1BLNB 5ICYA 3EW3B 3VXNA 3KGRA 4YHLL 3RL1A 4XNQA 2GK0A 3HG1B 3HMWH 5HYQA 3WLWC 4M48H 4Y1AE 1IMHC 1XGYL 4W6XB 3TYFB 1D9KD 4HWBA 4RIRA 2A6DA 5IFHH 1A7NH 2RQ8A 1CTOA 3VH8G 1U8MB 4LDEB 3SOBL 4PJCA 3H9YA 3O45A 5C09D 3CH1B 4KY1H 3ZKSD 3E2HA 4G6AC 5A2KH 2X70A 5GXBB 2WIMA 5BZWA 4N0YL 4ZUUA 3MV9B 3UEZA 1NFIA 4P9HL 2DQCL 1UWXH 2J8UA 1KV3A 1U92A 2BP3A 3ULUH 2EDYA 3I75A 1Y18B 4E0RB 3CFDA 4HKZB 1KIRB 3LKRB 5CEYB 5HD8C 4J8RA 5LWYL 3GO1H 1U93B 2ZUYA 3MLRL 2YUXA 4UUJB 2X9WA 3B5HA 4TRPH 2DM3A 3EDDA 4I4WB 5SWSA 5FM8A 3KLHD 1FZKB 5C0AE 1QEWB 1MLBB 1ZOXA 4OCWL 1NGYB 3B8SA 5FDWB 2GJZB 1TJIH 3WIHL 2M26A 3L3IB 4DFHA 1FYTA 2GJ6E 3OKMB 5J8OA 4WHYG 4HPOH 2RR3A 1AXSB 1FHGA 4F7EB 2Y5TB 5ILTL 2UY7A 4OV6F 1G7QB 5JUEH 1YEEH 1YPZA 1KIPA 3HS0A 1E4XI 4O4YL 2OLDA 5C07B 3CFIC 1I8LA 3SDDD 2P5EB 2RB8A 3O3EB 3WIIH 2D7MA 5FYJD 3I9GL 1QR4A 3N9GL 4R90H 4MA1B 1HHJA 3ZSTA 1X5IA 1BIIB 3I84A 1Y6MR 4PJ5B 2IAMD 2LVCA 1DBJH 4KK9C 4MDIA 4JPWH 3S96A 3T09A 1ZVYA 1T22B 1FL6B 3G6JA 4XVSH 1YYMH 4L29A 3AROA 4RGMC 4Z6AT 4QGTA 3S37L 3A6BL 5GIRB 4JFFB 3ZE1E 2EEBA 2AJXL 2JIXB 1P6AB 2CXKA 3BKMH 2IWGA 4QTIL 4ZDHA 4XPTL 3X12B 4RWYL 2CH8A 1CI5A 1U3JA 1WBXB 1WBZA 4ODVL 1CG9B 1EBPA 1G6RB 4XP1H 4X7TA 5DF0A 3LN4A 5TFSH 4NCC1 1N0XL 4GUPB 4X0KB 3DSFL 3C5SB 3OJVC 4NC1E 3FB7B 2IMNA 4OZ4A 2XZZA 3QUYC 4JO3H 5FM4A 2BDNH 3D39B 2YHGA 4KKBC 4LCYA 2NY1D 3PWNB 1GZQB 1BBDL 4PV8B 3QUYA 4KUZL 4N0UE 2GEEA 4X6DE 3CDYA 4JFPA 3QH3B 5BS0E 4UNVA 4JM2F 3C87A 3VH8A 3C6SB 4R96B 4BM7A 3OJ2C 4LCCB 5IOPA 3AVEA 1N6QL 1RHFA 3TBWA 4AENA 2EO1A 1BOGB 4MQXC 5HJ3B 4DN3L 3BUYB 4X6CA 5CZXD 4OF5A 5DMIH 3T65B 2DKUA 1ZGLA 5DVOA 2Q3ZA 3EYFA 2BMKB 3CSGA 4YFDB 2GCYA 3GMRA 3WNMA 1GPOL 2YMXL 3HNSL 3MBXL 4JHAH 3RY5A 3EYSH 3SJVD 4JPVL 1GGBL 3AB0B 1XGTB 5TE4L 4X98A 4OJFL 2MOVA 1JNHB 3QUZC 4Z7WA 3CX5J 2EDTA 2PW1A 5DO2D 5HGHA 4EKXA 1RJLA 25C8L 4N68A 3NH7H 2EDOA 2QQNL 1K3IA 5FGRA 5T1LA 1ZLSH 1RMFH 2AJZA 2XG5A 2E7MA 1WAAF 3QUZA 2IPTL 1QRNB 3ESUF 4LVNC 1J8HD 4UTBL 1X5FA 4KXZI 4AG4L 1RJCA 4TSAL 1UB6A 4NQXB 4UINL 5L2JB 5IWLC 3F7VA 2XWBB 3WV0A 4HIHB 2H32B 5C6PB 4K23L 2R0WH 4R2GC 5EIQA 2MPAH 3BZEB 5IWLA 5E7BA 4DK6A 3AXLB 4OLEA 4O5LL 3BP6A 2B1AH 5J13C 2IPKB 4U1SB 1OTSD 3MRPA 5INDB 1UM5L 5FCSH 3EZ8A 1D3CA 4QTHA 3QDMA 4WV1C 4I13B 1UA6H 4QXTA 3B43A 1S7WA 35C8H 4P46B 4YX2H 4LEOB 1A6AA 4WV1A 3D69B 2J8UF 4IRSC 2DQHL 5HGBA 1CK0L 3BKYL 4S1RL 3RZCC 4OCXH 1TPXC 4PJEE 4ZOEA 2FH8A 4OI9A 3AM8A 4WI5A 4IRSA 4GLRH 1B0GB 1CGSH 1U8JA 2EH7L 2PYED 3QWRA 1TNMA 3A6OA 3G5YA 2R8SL 3BJLA 4NM8L 4QHLB 1VADB 1FE8H 5DQDL 3NN8A 3WNLA 4YHYB 1RZJC 3BDYH 2M8XA 4XHJD 3ZYZA 4DTGL 1NFDA 5I1AB 4KK8C 5TDNB 3T8XB 3MRLA 2QADB 3R0MA 4WEBH 2D7PA 1IQDB 1OAQH 2L7UA 1BFOB 4AL8L 3M8OH 5IVXB 3O3DB 4XTRC 3VFWA 1BQSA 2GIYA 1ZK9A 1A1MA 5JOFA 4AM0B 3TCLB 2R2HA 4LAJH 3BAEH 4OTXH 1KCLA 4Z95L 4LLMA 3RNQA 1VFBB 1EHLL 4Z7OE 4PR5B 2YD9A 3UBXB 3GSOB 3FL7A 3OGOE 3AREB 2EYSB 5EIVA 2IFGA 4O2EB 5ERWB 3S36L 1A1OA 1B2WH 1B4JL 2EDWA 3U36A 1DBBL 4LK4A 4O02L 1DN0A 3U30C 5D6DC 4QRQA 2NY5L 3BSZH 2OK0H 3CGTA 3FRUB 3MJ8B 1NLBL 3MJ6A 2HYMA 3QIWB 1FDLH 2MJWA 2EC9T 3L7FA 5D6DA 1IKFH 2EE9A 2KQNA 2VN7A 5T3ZL 1CXEA 1KG0A 4YR6A 3WFDH 2EIZA 4FXGA 5FAAA 5EBWB 2VXTL 5D1ZD 4PB0H 2APWA 2OP4H 3QEQA 5IQ7L 3N1QC 4FNLL 1WTGT 2DLIA 5D7LB 1T66D 4DZBB 1T83C 3T2QA 1KTRL 2AXJA 5KS9E 3RGVA 2DDQL 1I3GH 3FOMA 3P73A 3R1GL 4JQXC 3GMLB 3EJZC 4R4BB 3T77A 2NNAB 1I9EA 5DRNA 4LBEA 1IQWL 4QRUB 4BJLA 1JWUB 4OIAA 4LP5A 1W0VB 2IALB 4UUJA 1Q72L 5FCUH 1A7OL 5JW5B 3OAYK 1FZKA 3CLEH 2PXYD 3FMGL 5DR5L 2PYFB 1MLBA 3SDCB 1A4JB 4KAQH 3OSKA 2AI0L 2A2QT 2ZUWA 1SJXA 4XX1G 1E4KA 3OKMA 3O81A 4OZHE 1I75A 4PJFE 2EKSA 4KVNH 1KBGL 2NY2D 5DVNA 3PQYE 4OLWL 4HC1A 1FGVH 5HSFA 3PWJB 5D7SH 3ARBB 2QL1A 5FO9A 1QSFB 1HH9A 2RFXA 2HRLA 3BP5B 2DB8A 3QQ3A 2P5WD 3O8XD 4XBGB 3V4PH 3QUKB 5GGSB 1BIIA 5I1JL 2PO6B 1RHHB 4PRAB 1E6OH 1R3JA 3VMNA 1OCWL 5GS2H 5F6HI 4YAQA 2GAZA 5I1EH 2VXUL 5HVHB 2EDKA 1KB5B 4CJ1A 4X5XB 1MAKA 4LAQH 1LEIB 2IG2H 5CJOL 4AT6B 2DQTL 1YY9D 4L4JA 5F88A 1KACB 4K3DL 5F7KC 1BIHA 2IFFL 3A0OA 1WBXA 2OL3A 1O5DT 2MQ0A 3HRPA 5CINL 1BREA 2A6IA 5BXFA 2XNAA 3CX2A 4HWEL 4QY8B 5B39G 2E6PA 3OXSA 4HLZG 3PP4L 2VZSA 1GHFL 2D03L 1A1NB 2ED9A 4OZFH 2FSEA 3V4VL 3OXRB 4WU5A 4YDIH 1UH3A 3FQXB 4Y19B 1S9KC 1L7TL 1WTLA 3B9KB 5D72H 5DUPH 3KLAA 3LQMA 3VD7A 3IXAA 1F11B 4K8RL 3BKCL 2MFNA 4OB5H 3QCUL 3QISA 1G7LB 5IG7B 4Z7UF 2MKWA 3VXRB 1XR8A 5GGUA 3VFUA 1UYWL 2GI7A 2I9TB 2XA8L 4BKLB 4NQCB 1C5DA 5C0EA 2AK1L 1BM3H 4YXLH 2QQLL 3AB0C 2FX8L 4JPKL 4KROD 4K3HA 3QQ4B 4FTVD 2VLKB 3I50H 3QJFB 1F97A 1IBGH 5KJRL 1A6VL 5EBMB 1NFDF 3S5LB 4L3CA 5H8DA 1U6AH 2BERA 2YRPA 1WFUA 3WL9A 1DBAL 4CNIB 3SBWA 4CBPA 3MRMB 1X7QA 3OMZA 5TGBA 3N85L 1N59B 5DD5H 3VXMD 1VFAB 4LSSL 1HHIB 4PPTA 1XF2A 4ODWB 1OQXA 3NPZB 1AKJD 3HCVB 3QEGL 4UQ2A 1SEBB 3K1DA 5LXGL 5LBSH 4I3RH 4NQXA 3RIAF 2CRZA 4GAYA 4YPJA 2FWOB 4G42B 3P30H 2RJMA 3PWPA 2B4CL 4U2ZA 3JTTA 1MSPA 5H94B 3TT1L 3WKML 3P4NB 5BVJA 1BD2E 4PJDB 1KJVA 1QUNA 5DRXA 2FJGB 1JNNH 4X7FC 3TBTB 5JW4R 1YC8A 4TYUA 5DJYB 3LRSB 5T3XH 4HUVB 5GGRB 5ELIA 5DJ0A 1JTOA 1MFNA 4OAWA 2X4UB 2A74A 1CE6A 1ZHBB 2ZKHL 4MQ7A 4ZS6C 1S3KH 1DUYB 1C7TA 5E5UB 1IRAY 4NQEB 5CSGA 3FN0H 4OFDA 4M9PA 3DO7B 1T1YB 1JK8A 3NABH 1WEJH 1IKNA 2D3VA 1NEZB 3RAJL 3OPZL 4JG0L 4IIQA 1KT2B 2NYYC 4F15C 1I9RL 1B0GA 5BRZD 4MA8H 3FT2A 5B39A 1IGCH 3JZ7A 1AGCB 1OSPH 3S98A 4ZFOL 5IHZB 2C1PA 2QADC 5EIIB 1OGAB 5EWIH 5LGJA 5IIEB 4HHAB 4PD4K 4X9IA 5KSAC 1LO2H 4Z76B 3K4AA 1J0ZA 1G9NH 4GRLA 3DUHA 1HQ4A 5TDNA 1DVFB 3I2CL 5FYJL 4Y5YB 5DUML 2N1KA 1G0YR 3TZVB 4HFUL 5EUOB 3ZMRA 3TPUE 2D9QB 5KSAA 3DX6A 1PG7W 2NW2A 1KTKE 3MJ7A 5D1XD 2DMKA 4LCWA 4OBRA 3MNWB 1I7TA 3QDJD 4JFDD 3TBVA 4HGMA 1A9BA 5SWZD 1CDCA 3IFOB 4YUEH 3KYNB 1FQ9C 2GY5A 3UMTA 2Z93B 4P99A 1FH5H 3QIWC 4Z7QF 3WDJA 2HVKB 3V95A 3DROB 3CSYB 2I9LA 4P3CL 1L4IA 2IC2A 3NCMA 4QCIB 4XNYH 3C5ZA 2E9BA 4WY7H 2R2EA 3RWCA 1RSFA 3LKPB 3MA9H 1OAYL 2OMBA 2VB5A 3PQYD 4PJ9B 4NPYA 1EEUA 1DE4B 4J3WA 5TE6L 3O6LL 4QOKB 5BJTB 1YUHB 2FZ3A 4BQ8A 4GMSH 4KKNA 1N3NA 3TYGH 4M6OL 4NN6C 4BUGA 1X6LA 4YZFE 5IBTL 5EBWA 1E27A 5L8KB 1B0WA 4ZXBB 4G8GB 1ETZA 4XPHH 2WWKO 1EJOL 3HMXH 4HV8A 4EUPH 3GSNH 1NMCC 1BF8A 4HH9B 2ENYA 4CMHB 5DD1L 1UWEL 3FB8A 2EIEA 3GMLA 4K7FA 5KANG 2DMBA 4HQQL 4NZDA 5EOTB 5BV7B 4XMPH 2R9HC 5HI4D 2NNAA 4NO5A 4QRUA 5AG8A 3SDCC 1I7RA 4HUWA 3G5ZA 3V6ZA 5ESVB 3EFDL 3LS5L 5E94B 1V7MH 5HDQL 4S2SA 3SDCA 3CVHA 4N0CD 1QACA 4RFNB 5FUZL 3PL6A 4M1GL 5C0NC 1Z9SA 4PUBL 4G43B 4S1DC 2OTPA 4PJIE 4NQVB 3S4SB 3H9HA 2FX7L 3ARBC 2OI9C 3MUGA 1IC5H 4W6WB 2HJKA 4QNPF 3DI2B 3MRNB 1AGFB 2JELL 4I9WE 2FIKA 1MCEA 2PO6C 3VFOB 2WUCH 3CFCH 2HVJA 2OI9A 1I8IB 1QSFA 3BP5A 4M48L 1LO3H 1MFAH 2BY1A 4ACPA 1VGKB 4K9EC 4QWWC 4MVBD 4M7ZC 3OV6A 3QR2A 5IFHL 1U0QA 3VRJA 4F33B 5I74C 3QNXB 5HVHC 5DFVD 4M8QB 3BN9D 3VFPA 2NR6C 3PWVB 3VWKB 1UENA 5I8KH 5TQ2H 4EVNB 5FO8B 2DWEB 2R69H 4M4RA 5D7JC 3FFCD 5EBLA 2ZCKH 4YGVB 3BPCB 3HE6D 3ELAT 3FB5B 3DTXB 3BUTA 4PS4H 3QDGD 4KTDH 3ULUL 3V5HB 4YIQB 1JVKA 1MCHA 4LKXA 1W2KT 4LARL 1YEDB 5C0BA 2VQ1A 1BF2A 1RJZA 4KJQC 5D7JA 3RIAK 1LK2A 1XH3B 3NZHH 2BY2A 1HSAA 4AH2B 3B9KC 3V6BR 4LHJB 2NX5E 3HRZA 2FDBP 2H26A 4TRPL 2HKFH 2BXYA 4PRPB 3O3UN 4OCRH 4NBZB 3VI3E 3JWDC 1TJIL 5IMKA 3SHSA 5IVZA 3MGTA 4EI5B 3VA6A 4N8PA 4HPOL 2G60H 3LHPH 5CD5D 1UXWB 1H8OA 1FAIH 3OJDB 2X4TB 1G7LA 5JUEL 1YEEL 1JZ5A 5BQ7A 3UPRB 1RUQH 4H0IA 2OR9L 3RKDD 3KPLB 3IU4H 1BD2D 1HH6B 4Y8DC 2XN9B 3WIIL 1ZANH 5DJ8A 2H2PC 2XTLA 2EYRB 2WWMD 4MSWA 5IW1B 4YBHA 4GW5B 4KKCC 4R90L 3WUWB 4CW1A 2ICWJ 3C5JA 3Q0HA 2OZ4H 2HG5A 5EC1B 3VFVB 1FL3A 3UYOD 3S34L 3QI9B 4JPWL 4O58H 4P23B 1J1XL 4LHQB 4HKBB 1YYML 3VFMA 4GW1A 5MEPB 4KZDL 2P47B 4LVOB 1AGEB 3MRHA 2A1WH 2AEQH 1WQVT 1YNKH 3I3DA 2VDRH 2EKJA 2FBJH 4BQ9A 3BKML 1NKOA 3LN5A 1QBML 1MWAA 1YDPB 4UV4H 3WS3A 4Q58C 2FJFA 5I1LB 1X5YA 2DQFB 5ACMA 4XP1L 3TNMA 3O6FD 5DYOB 5TFSL 3GSQB 3HCVA 1CYGA 2HKHH 4DVBA 1H9VA 4GKZA 3D48R 2DJUA 1ZHNB 5CEZE 1A5FH 5GQBA 1B9ZA 2HLAA 4G9FE 4KZEH 2BDNL 1N6VA 3K2MC 3K4ZA 3MODH 3PGFH 2R39A 4G8IA 3MC0A 4JO2H 4HS8L 3V6FB 2BHYA 2C3HA 3P4OB 2VZ1A 5T1KA 3P4NA 5CIPB 4NNPL 2AV7A 3RRQA 4XHQA 1DDHA 2BNRE 5GS1A 1ZLUK 5GRUH 3RZWA 1PX4A 2HRPH 1PZ5B 5GGSY 3JV5A 4JZJB 5D71H 5DVKA 3LKQB 3KYKH 1EV2E 4L4VE 3HR6A 2FEDD 4NZTH 4LLVA 1IAOB 4XVJL 2H45A 1XIWB 4MNQB 3MLUL 2OJEA 3BZ4A 3EHBD 2CUMA 4OT1L 3HLAB 1I8MA 4JY4B 3M17B 3Q6FB 1GAFH 4I2XB 4NHUE 4DZ8A 2AKRA 5H37H 4PBWD 3EYSL 3MRIB 5CEZH 1DQLH 4IOSD 3GMPA 1DVFC 4Y5YC 3JV4B 1HEZA 2YRZA 3NH7L 3O2DH 1ZLSL 3FQNA 3LPWA 3PXHA 1RMFL 1HINH 4JFED 1SHMA 1UKTA 1MY5A 4LSVL 4OZGF 5DFWH 2X6MA 4CUCA 3MRCB 4ALAL 5EUOA 3IGAA 3RTQA 2VITB 3C9NA 3QEUB 4UMGA 1DN2A 2G5RA 1RZKH 3PNWA 1I85A 4IDJH 3WEXA 1PKQA 4PLJD 1J05A 1XCTA 4GG6A 2H1PL 3FO2A 5CWSA 5DD6A 2HP4A 3BYYA 1AXTH 1CICD 5J7CC 2B1AL 4NQTA 3MRFA 1WAAE 4HUMB 3OAYH 4FXKB 3HC3H 4E42A 2P24B 4KQ4H 5K9OA 5EU7C 3CSYA 5ID1A 3L5XH 1Z3GH 35C8L 2OYPA 4YX2L 3KPSA 5ADPL 2LQRA 3TEUA 4I9WD 3MUJA 1V7NH 2IGFH 5GRVL 3IFPB 3UO1H 2QR0B 5HHME 4ZXBC 2B8OT 5DMKA 1EEYB 4OCXL 1P4LB 3O4LB 1T5WB 4ZOAA 4CMHC 5CSZB 2FHBA 4DGVL 3RVXC 2UVFA 1A7QH 4PJAA 1PD6A 4G6MH 1CGSL 5C92A 4KMQA 2H9GB 5BV7C 3JV6B 1JI1A 1ZWIB 3MRGB 3HI5L 1MRDH 1FE8L 1JFQL 4HKJB 4LDOB 1M7DA 2BSSB 3BDYL 4HCRL 4L1HA 3SCMD 1KCSL 5E95B 4M1CD 2J8UE 2X4NB 4RGOH 1OAQL 4JKPL 1D5XB 3M8OL 4MNGA 4RFNC 4E41A 1B0RA 3G04B 3UTZA 5TDPA 2VTFA 4LFHG 2EZ0D 1T4KA 3BAEL 4H5SB 4OTXL 2VDQH 4UNTA 1QPXA 5DJ6B 2NTFB 1MI5D 5GGRY 3CCHA 5SWSE 3EOTH 1GZPA 3S4SA 4WCYL 3A67L 2DYPB 5JO5B 5J6HB 3BDBA 1B2WL 1VERA 4BZ1L 1AGFA 1CL7H 4M00A 4HWBH 5LJYH 4X83A 2AK4E 1UCTA 4ORGA 2VYRE 4F9LA 2KZWA 3KPRE 1FDLL 3VD5A 3VWKC 4Y4KD 1YPZE 2YN5A 3BEWA 2PTTA 3U4AA 1IKFL 2CDFA 4H25A 2HMID 3QNXA 3GGWB 1S7QA 5HPOA 3T3ME 3WFDL 1T2JA 3N1GC 4PGCB 5E08H 5AWNL 4Q7DA 3ULVD 4EVNA 2C3GA 1DQMH 3MRJA 4F7MB 1G7IA 4PB0L 4F3FB 3UTQB 4V1DB 4I1NB 3HHRB 3D9AH 4HF5L 2AXHA 5HHVH 1LO5B 4JY5H 4CVUA 3LRGA 2NZ9D 3TO4B 5F9JA 1FPTH 3I6LD 4GS7B 2K7QA 1XF5A 1KJ2H 5FCUL 1AIFA 4EI5C 3RWDA 1FJ1A 1MREL 1NFKA 3CLEL 5EO1B 1XR9B 4KAQL 2M2DA 5AYQA 3FQUB 1WT5C 5F3HB 4EI5A 1NAMH 4F7TB 1HE7A 3D3VE 3JBG7 4G9FD 1CZ8H 1F00I 1UM6L 4MNHB 2DF3A 4NN5B 1NPUA 2PR4L 3HE7C 5L6YL 1SJHB 3EGSB 1WT5A 1IC7H 3ZT5A 1SM3L 1U3HD 3OKNA 1FGVL 2XKNA 1NEUA 4RAUA 3HE7A 1UT9A 2R29H 3MRQA 3X13B 1TZIB 4NWTH 3G6DH 4KI5F 1RURH 1R3LA 2XG4A 4LVOC 4I48A 5D6CB 5IMOB 1JMXA 3PIQB 5I1EL 5FUCE 3QFJB 4HKBA 1OLZA 2CIKA 3BT2H 4PLOB 2IG2L 4JKKA 5SV3A 2JLLA 1FG2A 1OP5K 3FAWA 2V5SA 3H9SB 1IT9L 3MROB 1DUZB 5I1LA 1QPPA 3HZYA 2DQFA 3ALWA 4OIBA 1R24A 3BHBA 2DQIH 4Z7WE 3RVUD 5C2UB 1H3XA 3QIUB 4GG6F 3W0WD 1GGCL 3CC5A 1WFOA 5FGCB 4OCSL 4P2QA 1EX0A 4YDIL 1KLUA 4D9QE 2W0KA 5DURD 1TJGH 1KCGC 5DUPL 5T1MA 5LVEA 1X6NA 1DQTA 4U1LB 3VXPB 3WFBH 4MA3B 1FNAA 1FVEB 1H3WM 1IEHA 4S10A 4TUKH 1A6TB 4G7VH 3RDTA 1MRFH 4WWKD 2JJSA 1EZVY 1A6PA 3K8MA 4L4TE 5F9WC 3MCKB 1XIWC 4HZAA 1OT2A 1WSST 3FT4B 2RHEA 4K07A 2F8OA 3C6LB 4YNYA 5I1IH 1IAKB 1NH6A 3GDBA 3QDME 4YXLL 4F8TA 1LP9F 3NZ8B 1K4CA 4QGYA 2Y36H 1BFVH 2NXZB 2YPLE 1E28B 5CS7A 5CHNB 4NSKA 3BJ91 3MV8B 4LPVA 3ZYJA 4BK5A 5AZEH 1XT5A 4KKLC 2DQJH 1OAZH 4ZQKB 3IFNL 2YPKB 3T08A 2Z8RA 1N5AA 2P42B 2NPLX 5IT2H 4OQTL 4WHYH 4P57A 1A64A 1F6LL 1IM9B 2OR7A 5DD5L 1I1FA 4UV7H 3QUXB 3MNVA 43CAA 1OSZB 5C1MB 5AUMA 3WLWD 2V9QA 1U91A 1K2DA 5I8OH 4E5XA 1XZ0A 1BQUA 1CVRA 3MRCA 4YFLI 1JIBA 1A47A 3KPOB 4I3RL 5B4MC 1ZTXL 1NFDE 5CD3B 3HKFA 2Q6WB 1P5UA 3V52L 3FN3A 4OCLC 4G6AD 4NYLB 2VDKH 4U33A 4W6YB 4ZSOA 5C8JA 1HIML 1NC4A 5E2TH 5FYJU 5TF0A 1XEDA 4P2RA 2C4FU 2R1XB 5MERA 3DV4A 5F96L 1JNNL 4FQIH 3SN6N 4P5MB 5IEHA 4MHHI 3F65A 3S88H 2GTZB 1T0NB 2LAGB 1UEMA 5JHDE 4MB3A 1UQSA 2ESVA 3WIFA 1EH9A 2X4QB 2DKSA 4I5BB 1BQHG 3BQUB 3BP7A 1FYTD 5D2LA 3T4YB 5F9DC 1BBJB 1WEJL 1E6JH 5A3IC 3BH8A 1EEYA 2EDJA 4GMTH 3QNZB 5I6XB 3KYOB 5E9DB 4MA8L 4DVRH 1YQ2A 1IGCL 2R1WB 3CDFA 4ZODA 1RD6A 4PBVC 3MRGA 3T0EB 1KCVL 4X4XB 4OKDA 2YC1B 2JKXA 2GKIA 2O5YH 2AQ1A 3GSRB 2FR4A 5DTFA 1LMKA 2R0KH 3QEQE 1G9NL 1D9KB 2W1NA 4RRPG 2CKNA 4HIEA 1PLGH 2EDBA 2W9EL 3W9EA 5C09B 4Y16C 3MGOA 4OF0A 1INQA 4M7KH 4KHTL 4KK9D 1NGZB 3CFBB 1F4AA 1F6AB 5DDHB 1D5MA 3LSOA 3N1MC 3QYCA 4EI6A 1JE6A 5DHYA 4Y16A 4FOMA 4HJGA 1NGWA 5TDOA 5D7IA 3TIDB 1DL7H 3RUGA 2NW3B 4YUEL 1KULA 1N64H 1FNEA 1U8KA 1FH5L 4RGNE 2LABA 2VISA 4DGIH 4XNYL 2F19L 4FQJL 1V05A 3HR5A 3B9AA 1E0OB 1GOFA 2BFVH 2HT3C 5A43C 5IF0B 2ICWA 1VEOA 2LAAA 1KXTB 3ARGB 2IPUG 3QUYD 1I4FB 3F5WB 2YD7A 5AZ2L 4KKBD 1KC5H 3MV11 4PRNB 2W0LA 3U4BH 5JPNA 1OP3K 1IILE 2X05A 3NCJH 5MHSD 2CKBL 4BZYA 1FRGH 4NRXA 4ZFOB 4Z7QE 4XPHL 2C7UA 1S7TB 4V1DA 3QHFL 4WHDA 3TO4C 1CDHA 1CQYA 2HT4C 5HVWA 5C08D 4AEIH 1S5IH 5FA4B 3V7AG 1T0MB 4IEFB 3T2NH 4JFYB 1AGBB 2EDFA 3UAJC 3ULSB 1QZ1A 4NKOB 5FK9B 3STLA 2AEWA 3UTSA 2ZG2A 3QQNA 4UTAH 2IAMB 3DO3A 5DGQA 4P2OC 3VGDA 2APBA 2UV3A 4AK1A 4PREB 4QRPA 1ACZA 1V7ML 2HH0H 1EDQA 4IMKC 4M6NH 4NN5C 5EO1A 4OM1H 4K3JH 5K59F 4P2OA 5C3TA 1XR9A 3E6HB 4MJIA 4LP4A 4WW2F 4HK3J 2B7DT 2Y72A 5F3HA 2C1OA 4F7TA 5T1LD 4HS3B 1ZHKB 3QUZD 1IC5L 2AJ3A 1BQHA 5HYSB 3F8UB 1YEIL 1CN4A 1DLHA 5E5MB 3C2AH 2YWZA 1RIHL 2AP2A 1MFDL 2ARJB 2J6EH 5GZNC 5E0QA 3QPQC 1ES0B 3SEPA 1OW0C 1LO3L 3F12A 1JWSA 4YPGB 1ZLUH 4WO4A 4PP2B 1CFSB 3LEVH 5IM7A 2NY1B 4PJGB 1OW0A 3QT2A 2PW2A 5KVFL 4HW6A 1PYWA 3DX7B 5TQ2L 3SDAA 1ZA6B 5HGDB 1CFQB 4RDQG 4QNPE 1UZ8B 4G7YH 4R2GD 3LN9A 3M07A 2OL3H 2ZOKA 3QDMD 2DLHA 4K71B 4KTDL 5ESQB 5B21A 1XGRB 1MIEH 1S7VB 5JOPD 1NKRA 2XACC 2Q86A 3L3OA 1EGJA 3QIUC 2XA3A 3GB7A 2XXCB 2EDLA 2GSGA 2QJDA 2NMSA 4NRZA 4NQUA 1T6VN 2XWTA 4P4RA 4D0DA 3NZHL 3KWWB 1HNFA 3QIUA 3WS6C 1MLCA 4IRSD 4P5TB 4Y89A 5D8JL 1HXMA 4MD0A 4EOWH 4YHMH 1OHQA 2VSCA 3QWRD 4OCRL 2X41A 3VGHA 2MMXA 1S9YA 4XX1E 3NFPA 3WS6A 1ZKAA 2Z8SA 4JFQB 4PGEB 4ZMAT 1D5BB 3LHPL 3MPCA 5I73C 3DBXB 1FAIL 3PWPE 5KN5A 1G7PA 4IHOB 4NP4L 1OWRM 1UVQA 4CN4A 3C6LC 4YXKH 3GJFB 1RUQL 5EO9B 3SE9H 2MKLC 4DKAA 2FB4H 4P59H 2N4IA 4F57L 3U2SA 1TCRB 3U7YH 1ZANL 5BMFH 1HCVA 3OKEB 1ADQH 3C6LA 4WUUB 3S97C 2NXZC 4XTRD 2OZ4L 4YXHH 3MA7B 1KEGL 1A6ZA 4LSPH 2G2RB 5IB2A 3QEHA 1ULVA 3B3IA 1F3JB 1YMMA 1L0QA 3MV8A 1LE9A 2VAAB 2XQBL 1A0QH 3I02A 2A1WL 2AEQL 4K55A 2ATKB 1LK3H 1R6VA 1S78C 1IGJA 2VDRL 1U8LB 2FBJL 1XGPA 4CMMB 4OUUB 1INDL 2C3VA 2ZP0T 4QF1A 4UV4L 5JDSB 4BSVB 4X4YB 1OAXL 1MEXH 2CK2A 5E2UH 1A7RH 2HKHL 2DN7A 1N5YH 4YHNB 1FFPB 1SYSB 3L6FA 1A5FL 2XKUA 4HDIB 4OGZA 4Y1AB 4KZEL 3CLFH 3MODL 4A6YL 3QEQD 3MV9D 1I8KB 4JO2L 3QIBC 3Q6GH 1IGTA 4FN0A 1ED3A 3RGVD 2DWDA 1YMHB 4IOIB 3ZKMD 4WFED 3ZO0A 3QIBA 3MLPA 2Z8WC 5HYJA 3WFCH 2HRPL 2BRQA 4I3GA 3EJZD 1BFTA 1XF3B 3GRWA 3VXTA 4R7NB 1NANI 2V2XA 3VE0A 4NZTL 4DGYL 1QLFA 5I66A 2HA1A 3MCLH 5I6XC 1HYSC 4R8WH 2YD6A 4HLZH 1RULL 2DM4A 4LNRA 5GPRA 1NQBA 4ZNEE 5F7DA 3T0EC 3MRBA 3VFSA 2UY6A 4CVZB 4NNXB 5FIEA 2HWZH 3K1KC 1Z9OA 1QLRA 4NNYA 1DQLL 5TE7H 3QA3A 3UP1A 1OB1A 4KDWA 1Q9OB 4UT9L 3IVKA 1D9KC 2ARJQ 1RJYB 3OF6A 1UJTA 2QKIB 3BO8A 2GJ6B 4Y5XB 3IDIA 1HINL 2B4CC 2YD3A 3MMEB 3FT3B 1ZSDB 1HXYA 5I76B 4MXWL 1QBAA 3MO1A 1CDIA 5KSUB 1KB9J 3NMEA 3MCG1 2NY0D 1EO5A 4IDJL 5D1ZB 4OD3H 4Q74A 2GK2A 3D2UB 3V0WH 3L3GB 5ACLA 2VKXA 4XCNA 3GMOB 4HXBH 3MUZ1 4WUKH 2FHCA 2P48B 5SX4I 3ZT7A 1AXTL 4PLKD 3EYOA 3HC0B 4CRPA 3HC3L 4KQ4L 4OZGE 1LDPL 5GRWA 5E8PB 3ARGC 1J0IA 3L5XL 1Z3GL 1TQCB 4WDIB 1RUAH 3IETA 3I3BA 2WQ8A 1NCAL 2O93L 4EXKA 1KN4L 1V7NL 2IGFL 2PXYB 2QSVA 3MNZA 3QXWA 4JGMA 1W72L 2FRGP 2WWKT 5T1DH 4PRNA 1R5VA 2VE6A 4YHIB 1P7KA 2EH8H 1LNUA 1FVDB 3L5IA 1LEGB 4D0BA 2NY6D 1MAMH 1MRDL 4N0UB 3P0GB 4X6DB 2EYTB 1PY9A 2IAMC 4FQ2H 1ZLVK 1DBKL 2P5WB 3O8XB 4JG1L 2I26N 1F90H 2AJUH 4OFYA 4ODXA 4PRHA 4RGOL 4P49A 3CVHH 2VXSL 1A8JH 1FL5B 3NIFF 1OP5H 4NM4L 5I71C 5GHWH 2V2WA 4K94L 3U48A 1H15B 2VDQL 1WWBX 3L9RB 3CPLB 4P4KC 4U1KB 2HFEB 3DURA 2DICA 3E6HA 2DQDH 3MOAL 2WAHA 1K5NA 1HILB 5BVPH 4HJJH 4LF3A 2EDQA 5ECJE 4MYWB 4P4KA 5JQHC 5F9OH 1MRCH 2H3NB 3JUZA 1K6QL 4HWBL 1NDMA 1ORQB 1RZ7L 2D0HA 2NY1C 2ARJA 1Y0LA 1BZQK 2Y25A 3PWPD 4QXGH 4D0CB 5DQJB 5LCVH 3CSPA 4LKCB 5C0FA 3OR6B 1BHGA 4PJGA 1KPUB 4NKMB 2WY3A 5HGDA 1CFQA 2GYSA 1KCRH 4LCUA 1IGML 1C16B 2CIIB 4RZCB 1R0AL 3TT3L 4MDJA 3N06B 5HHVL 4FFZH 3GJEB 1XAUA 4PJ8A 5IV2A 5DSCB 1H3PL 1R5WA 3KLSA 3QXAB 4OD2A 4WFHE 3M1BA 5D9SA 5DHVB 4XP5L 5EOQH 4P5TC 1KXVC 4R4FH 3GIVA 1AFVH 15C8H 2Y9RT 4LQFH 4XNZB 1GL4B 5ACZA 4ZS6D 3IT8D 4TUJA 4Z77B 4KFZC 4YJZL 1P1ZA 5I8CB 4L3AA 4PJ7B 5EO0A 1J88A 3RWEA 1TVHB 3KPQA 3VW3H 4YEEA 4YK4B 1PZUB 2NYYD 1TVDA 2VDMH 1NAML 5EA0L 5F7EH 4PJEB 4RDQF 1CZ8L 1XCQA 4ONHB 2V7HB 3E1F1 4GRLD 3IJYB 4U0RC 2OS7A 2O61A 1NSNL 2QADD 3VXMB 4HX1A 1IC7L 2DM2A 5IR1A 5KSAD 1AKJB 3W39B 2ZSVA 4PY8I 4LCWD 2ZWLT 3TBYA 4NO0B 4WUUA 1BX2A 5FB8A 3I6KB 3MXWH 2AJVL 2JJTC 5D1QA 3G6DL 1RURL 5ABDE 3MA7A 4J4PA 3ILPA 3ULUC 2ADGB 5CSBA 5F1IA 4HIJA 2Y07H 2F74B 3MLVL 3BD3A 1OTSC 3PXJA 2G75B 2JJTA 1R5IA 4JGJA 5DJAA 5JHLL 5DEFB 4X6EA 3LV3B 4FQQA 5F7LB 1PFCA 3BT2L 4JRXE 2ATKA 1WCQA 1HKLH 1MJ7L 3D0VA 1U8LA 3UYRL 3SGDI 5DRWA 2VL5A 3QIWD 2ARWA 1SBBA 3G6AA 4GKOA 4J2XA 3D25B 2YEZA 2ID5A 4PJXA 3DX8A 4KI5E 1NEZG 2ED7A 1MJJB 2DQIL 3N0PB 3MLZL 3WO4B 1F42A 4NUJA 1GGIL 4YHNA 3T4AA 4OZIA 4Y1AA 1EERB 5DC9B 5JXEA 5D7LD 5BRZB 3I85A 1WWAX 5INCB 5J11B 4G8EB 4Z7VF 4PTTA 3L3HB 1GJIA 4XC1H 1EHNA 4IRZH 1MFCL 1J1PH 4MJ6A 4PJBA 4GG6E 1A7PL 2R9HD 5KS9B 5FYLD 5E8OB 1IFHH 4GAGH 3DV6A 3MBEB 3SDCD 1UKSA 5D1XB 1YYLH 3PL6D 3TWCH 4V3EB 5B38G 5BZDA 3QO1A 3ZDZE 3D5OF 2X4OA 4Y5VA 1RZGA 1UZ6F 5HHNB 2Y36L 3P0VH 3NFNB 3KPSE 5EU7E 5AZEL 4N8VG 5C0ND 4NNXA 4OLUH 3GMNB 4Y5XC 4HMDA 5C0AA 4XT1C 2LTQB 4U1JB 2BRRH 4NGHH 1QSFD 1MF2H 1CVSC 1MHHB 4AZ8A 5J1TC 2GJ6A 3MUHL 5KSVA 5IT2L 4OZHB 4H0GA 2BHUA 4PJFB 5IVXF 4ESKA 3L5HA 4PJAE 4UV7L 4YO0A 4RFOH 1OP3H 2PO6D 3MMEA 2IPUK 1ZSDA 3MGAA 1SJEA 5JDJA 3OQ3B 3PQYB 3SY0A 3UDWC 5F7NC 1LP9E 5D1ZC 5HYIA 1AQDA 2BNUB 5FHBH 1MJ8H 2NZIA 5E2WL 3UDWA 1Z5LA 1IGYA 2OJZL 3D2UA 3L3GA 4MNGE 2VDKL 1WVZA 4W4OA 4XB7A 1KGCE 1U8HB 2MHAA 5C0BD 1OM3H 2V2TA 4Y2DA 5D7JD 1WBYA 1CD1B 3GBLA 1IEAA 5HBBA 3G08A 2Z91A 2VXVL 4GT7A 2UZYB 1CT8A 1GIGH 4KJQD 1CBVH 2IANA 4O00A 3BW9A 3MRRA 3CU7A 4ELMB 4NC1C 4IJ3B 2YXMA 3BXNA 2PF6A 4HKXA 4HWZB 4C83B 1AR1C 3RHWK 3BIKB 3ECBB 4IS6A 4GMTL 2XFXB 4N9GB 2WUBH 4L5FL 4DKEH 5B8CB 3P9LA 4AJ0A 4QHKI 5C6TL 3A6CH 1LEGA 3QFDB 4N0UA 4WI3A 4NZUH 4HK3N 2O5YL 1PQZB 1EEZA 1KLFA 1WITA 2SEBB 4NQCD 5BS0A 1DANT 5IB1A 3FFDB 2H2PD 5MEQB 1YC7A 4NKDB 2Y1VA 1PLGL 1U95B 3N1FC 3S7GA 4GW4A 4I18C 5L0QB 4M7KL 5L8JB 2BOBB 4MWFA 3ARTA 4N1CA 3CPLA 1KIUA 3FFCB 4QRRE 2DLEA 3HE6B 4DKFH 2Q20A 3WHXA 5C0CA 4LDLB 1AI1H 4I18A 3THMH 4WNQB 1DL7L 2C4FT 1N64L 4M62H 5B38A 4TNWF 2CK0L 5IMLB 2RCSL 3F7QA 3FB6A 5ISZA 3MLWL 2ZSWA 2W07A 1L6XA 2OTWB 4NT6A 1ND0A 4N8VA 4KUCF 2W9DH 4Q2ZB 1UADC 1WIPA 5JA8B 1UH4A 3VRIB 3OR6A 4G59A 3QUMA 1KIQA 1WCBA 4NKMA 3DNKA 2C9AA 5CBAB 3QULB 4J3TA 3I6GA 3MFFA 1NBZB 1FRGL 4V2BA 4LLUA 4LLYB 1I3VA 3GMQB 4XP6H 5EORH 2X4RB 3LIZH 2VDPL 3FZUC 3WFZA 1A4KB 4XNZC 2QHRH 1BD2B 3WUWG 2YK1H 1C7SA 2QLVB 4AEIL 4DCQB 1S5IL 2Z31C 3T2NL 3ROOB 4MJ2A 1MUJB 5IMMB 1HOCA 4PRDB 3TJHA 2W0FA 2ENSA 4UTAL 2Z31A 4YK4C 1GCFA 1KJ3H 3R06B 3DUUB 3X3GH 4UDUB 4JRWA 2HH0L 2E9WA 4M6NL 2YUVA 3UBXI 2ILLA 2FHFA 4K3JL 3KYMB 2NXYC 3PGDA 2VO5A 4PJBF 1OGAD 4M3KB 4PRBA 4XRCA 1LO4H 3PABB 4HC1L 4CADB 4P2QE 4PJEA 4M61B 4ONHA 1UCBL 2APFA 3L3JA 1H3UA 1CDJA 2FCBA 5DK0B 3BP4B 3DGGA 4LSRL 4RBPK 3RTQD 2J6EL 4MD4B 2WBKA 5KBNC 3UTOA 4HBCH 5IGXH 1V3LA 3LAFA 5KVDH 4OGAC 3F62A 3I6KA 3OHXB 4G6KL 1KOAA 1WV7T 3P4LA 3LKSB 2ADGA 3JWNC 1ONQB 2CKBB 2F58L 3TPUB 3RU8H 3JTCA 2G75A 1HI6B 4BSWB 5FECA 4EUPB 4G7YL 3LH2L 4XXDB 2XV6B 2OL3L 4POZC 5SV4A 2ZJSH 2Z92A 5A40E 4RMSA 3AU1A 2A83B 3GSVA 1T3FB 1MIEL 1ZVSB 4HPYH 2NQCA 2PUQT 2JB6B 2AXFB 5GGTA 1L6ZA 4CU6A 2VLJA 3SDXA 2EDXA 1RK1B 4ZPTB 4JFHE 3VD4A 1I9JH 2EXYC 1NGXA 2AQ3A 4HUKB 2UWEF 5MP6H 4N9OB 1RZIB 3PV6A 3ZE0E 4EOWL 4M4PA 4ZXBD 1JZ7A 4PJDF 3VXSA 2R23B 4JDZA 1BZ9A 1CU4H 2P45B 4GQPH 4G8EA 5J3HC 5KG9A 4FFEX 5AAWA 3OKDB 4HEPG 4JFEB 3B6SB 8FABA 3MBEC 3DPBA 1NCNA 1EUTA 3SE9L 4BFIB 4NQSA 2FB4L 1OOAA 3PG2A 4HIIB 5C0RH 1AGDB 2W65A 3BZFB 3QG6B 4AEEA 4E41D 3U7YL 1MCPH 1UEYA 1ADQL 3MBEA 3WD5H 4YXHL 4WFGE 5A2JH 1FZOB 2DBJA 5HXMA 2GQHA 2LTQC 3D6GA 1LDSA 5IBLC 5HHNA 3U46A 3NFNA 4YC2B 4UOJA 2ESVE 3O4OC 1IE5A 4N8CL 3SPVA 1CICB 1A0QL 4ZNCD 1FFNA 4PJIB 3BGMA 2R0ZL 1NAKH 2BC4B 4U1IA 3GSXA 4OZFA 5HHOE 5E2UL 5EU6A 1A7RL 2YD5A 2G5BB 3IDYB 1NMAH 2IADA 1CR9L 3CLFL 1S9XB 2HJFA 1ZLVH 3Q6GL 4PJHA 2AV1B 5J1AA 4TNWK 1RAMA 3G5VB 3ILQC 5CMAA 2X40A 2D7NA 1Y6KR 2GFBA 4QRSA 4X6FB 4BZ2H 3H6JA 3GHEH 2BVPB 1Q0XH 4KV5F 4X8JB 4XH2B 3WFCL 1C5CL 3X14A 1YEHH 3BRDA 3L5WB 3GMMB 2JTDA 2VAJA 4OBSA 5IHUL 4N0CC 5GGVH 12E8L 3IDGA 4PRPD 1EXUA 3SKNB 3WLBB 2E8YA 4WW1A 5DI8B 3MCLL 1T7XA 1JPTH 1F4HA 5B8CC 5K9KB 4R8WL 1GXEA 1QNZH 3U0TA 1M7IB 3IRZA 4EI5D 5FOJA 1DQJB 4HWZA 1EO8L 1KEMH 1MI5B 4Z8FH 4ODSH 4LNVA 3PHOB 2AABH 2ICEA 3O3AB 5ITFB 5B3JE 1VKXB 3HE7D 1I1AA 1CXLA 3DETC 3CFKA 2A73A 5E24E 4NOFA 4PRIA 1YY8A 2IH1A 3S3SA 1FBIL 4NUGH 5I8EA 4ZO7A 1ZA3A 4EEEA 4Y4KB 5AD0B 3OB8A 5L0QC 4R9HA 5DGRA 5F44A 2IBZX 4XNUH 4A6YB 4UQ3A 1WZKA 1U9KA 3KPMA 5F7HA 3QJHA 3SQBA 1KPRB 5L7XH 3UTSE 4OD3L 1NCCL 2HT2C 1FNSL 3E3QE 4ODHH 3V0WL 4NO2A 4HXBL 1P4IL 3IXTB 4WNQA 1SVZA 4TTDD 5FOBA 2EC9U 1ZLWK 2AJSH 2W9LA 2GTWA 3IB4A 1KJMA 4MJIE 4OF6A 3M45A 3LKNB 2VZOA 3L3DB 1S7RB 4X4MA 2COQA 4ZPVB 4P2QD 1FVCA 3DXAA 4NC2B 1LEKB 4PY7B 5HDBF 4BELD 2ZCHL 1ITBB 1RUAL 1T2XA 2BX5A 3BD4A 3AS0A 4LLWB 3O41A 3CXDH 2BOCB 1CDUA 3CUPB 2EDEA 3Q1SL 2DLFL 1I3RB 5ICXB 3U4EA 5E8NA 1KCUL 5T1DL 2DAVA 5CBAA 3RKDC 2WMPA 4X9GA 4G9FB 3ZKNC 1FFOB 3HG1E 5DK3A 3AFLA 4RFEA 1G9NC 5LGKA 5I15H 5F1SA 3TBSB 2EH8L 2WWMC 1T20A 3TO2B 1RZ8B 3CZFA 1U3HB 3K8LA 3T3PE 2X4RA 4KJYB 3QZWB 4F58L 4JY6A 3IF1B 1ZT7B 1YEFL 1IM3A 2BNRB 2DTML 4FQ2L 4ZUTA 1XIWD 4MNQD 2AJUL 1N4XL 4FQXA 1LWRA 5D70H 1YNLH 3GFUA 1M6OB 4PRDA 1EAJA 3IDXL 3GUTA 3LQAH 4HGWA 3CVHL 3P9MA 1LD9A 5I1CL 3DOSA 4PD4J 4L4VB 1D5ZB 3REVA 4RQQA 3STBA 1NDGA 1N8ZB 2VQUA 2JB5H 3LKOB 4ISVA 1A2YA 2E3VA 2X4SB 4KKLD 5MENA 1ZAGA 5BVPL 1UB5B 5DLMH 5C0JB 1YEGH 4ZUWA 1S7SB 4GKNA 3KXFA 4NHUB 5ICZB 5F9OL 5KTEH 3DVGA 1SMOA 3WFHA 3ORJA 1K9TA 1YZZA 5JMRA 2X7LB 2FECI 2A0LC 5GSVB 3H3PH 2XIDA 3KNBA 1AD0B 3C8KB 1IAIH 3NIFE 1CD9B 5GRYA 4K9EL 4QXGL 5DURB 4YDLB 1OAUH 1W72B 4QRTA 3W9DA 1MCCA 4YDJB 5B4MD 3MLSH 3IDJB 1NC4D 4OI8A 2Q76B 2IMMA 4P2RD 4MLSA 3DARA 4NRYB 4JZNA 4CDHA 3TF7C 3HMXA 1KCRL 4OFVA 1EGJH 2P5EE 3GSNA 4EUPA 1QG3A 2L7JA 4B5EA 1DQQA 1ZXQA 4RAVB 1Q9KA 4F7CA 1F8TH 1S5HA 4FFZL 4PGZA 3SE4A 1KXQE 3V7AE 4PJ5E 4LIQH 1ZVSA 3MR9B 1YMME 2ESVD 3C60B 4I3SH 3DX9B 3WXWH 2P8PA 3BE1H 2H6PB 3EDFA 1RUML 4LQFL 15C8L 3V8CA 1QFUH 3HI6H 2FYYA 3N50A 4Z5RB 2WLYA 3ES6B 3HA0A 4JB9H 5JTWA 5J1SC 5ICYB 3VXNB 1NGPH 4OCMC 1IGIH 1QR1A 2XRAH 4U7KA 5A3ID 1XGQA 3RL1B 4XNQB 1JCKA 1RZFL 2VDML 3K8KA 3BPNB 1JNLH 4K7PH 4NFDA 4RISH 3SGJC 1I1YA 2VDNL 4KJPD 4NBXB 1TNNA 4RIRB 2MTPA 2A6DB 5FF6A 1PEZA 2DL2A 3B6SA 1BWWA 5J6GA 3D39E 3BMVA 3O45B 3MOBL 3SGJA 5F6IB 3E2HB 3ZE2F 4PLJC 5KVMC 1NC2A 2X70B 4XI5C 3LEYH 5HYJE 2Z35A 3MXWL 4XAWH 5BZWB 1YQVH 4ZUUB 1NFIB 4YC2C 1SJVA 4LCIH 2J8UB 4Y16D 3DYOA 3R4DA 1NCWL 1U92B 2R4RH 1FZOA 1WFTA 4HAGA 3TNNA 3X11A 3HTLX 1WLHA 2Y07L 3I75B 3GKWL 2DYPD 3AY4A 5D2NA 4TUOB 3CFDB 4PB9H 3VWJC 1NCBH 1MWAL 2P49B 4J8RB 2QSCH 4ETQA 1KCKA 1OAKH 1HKLL 4ODUA 1J5OH 1U8QA 4JREC 3HZMA 3VWJA 3S8WA 5SWSB 5IW6B 5L88H 3VGFA 3ZYOA 3WNOA 2WINA 5F9AC 5JIHA 4OM0H 3RNKA 4L9DA 2HT3D 4LLDA 3UYPA 5ADOH 2AK4B 1ROWA 5JPMA 2Q8BL 3KPRB 1YPZB 2R0LL 4V1DD 1KIPB 2ZUVA 4O2FA 3HS0B 2AV1A 4MA7L 2VWEE 4Y4FC 1A9EA 3T0DA 1JHKL 3RY4A 2X10A 4J3SA 1QRNE 5HHPA 3KHOA 4MCYA 2D0GA 1RFDH 3WE6A 1HHJB 4XC1L 5GRJH 4Y4FA 1H3TA 2HT4D 4GSDH 3UTSD 2EZ0C 4S1QH 3S96B 2Z9TA 3G6JB 4QRPD 3UAJD 3P2TA 4WTXA 4BSJA 4MXQA 1IFHL 3IYLW 4IRJA 4XPGL 4L29B 3G9AB 4U1NA 5GZOC 1WICA 1G1CA 1S7UB 3DMMA 4H26A 4P2OD 2HTKD 4MJID 4MAUH 1DQDH 3OTTA 3TWCL 2PNDA 2O26U 1BAFH 3MTRA 3UJTH 1QA9A 3FCTA 3B5GA 4ZDHB 3ZHDA 4Z7VE 5JQ6H 2NX5A 2CDEA 3PP3K 1WBZB 4MB5A 5EU4A 1A14H 4OLUL 4X7TB 1T03L 1DEEA 3LN4B 5A16A 4NGHL 3ARPA 1J86A 1X9QA 5I1GL 3HZKA 1MCOL 4OZ4B 4P5KA 2HMIC 4XCFH 4WO4D 2KKQA 4LCYB 4RFOL 4P3DA 2MCPL 5GZND 3MYJB 4S1SH 4D3CL 1M4KA 3QUYB 3VFNB 2YOCA 1UZ6E 1W0WA 1KSRA 3SDAD 4JFPB 5A2FA 1VHPA 5EZIH 3JUYA 2WLZA 1Z2KA 1U42A 5FHBL 1MJ8L 1NGQH 3VH8B 3WXVH 4PRHE 2H8PA 3QWOA 2H32H 3KR3L 2PKDA 3MUY1 4WHTA 1JHLH 1FNFA 5IOPB 4KDVA 2ZUXA 3TBWB 4AENB 4KQ3L 1DSFH 2E7CA 2VXQL 2IEPA 1MPAH 4X6CB 5IVXE 5IHBA 3WNKA 5JZ7C 1ZGLB 1TVBA 2DBLH 2BNQA 3EYFB 2B5IB 1GIGL 3QIUD 3WJLA 3GMRB 1A6WH 1LEKA 1T6WA 3DIFA 2AW2A 1JRHH 4HWNA 2VUYA 4KPHH 4X98B 3CUPA 3OKKA 4Z7WB 1K8IA 2PW1B 1T80A 5E2VL 1UM4L 5HGHB 4OV5A 4OGYH 1AY1L 1RJLB 1ITCA 3BGAA 4RBPH 4ZUVA 1U3HC 5HYSG 2WUBL 5T1LB 5FKAA 2AJZB 5HVFB 4H1LG 3QUZB 3REWA 2AEPH 2FATH 2CGRL 5EZOH 1KYOK 4RMTA 4XNXL 3TO2A 3A6CL 3O2DA 2A6KA 4OKVA 1UB6B 3C6LD 4NZUL 1ZT7A 2BNRA 1F45A 1RZKC 1ZGLP 4GRWB 3F7VB 3V0VA 2W60A 3WKNA 1O0VA 1INEH 2YPVH 4QXWA 1UKQA 4X6BA 3UZVB 4ZYKA 2NXZD 3PHQA 5L8LB 1RU9L 1YMMD 4M8VA 1GC1H 3MV8D 4Q0XH 5IBUG 5CAYB 3BP6B 5L2KE 4TVPE 3UC0H 1TETH 3WN5B 3GSUB 3CU1A 3H0TA 3MRPB 4JM2C 4QTHB 3QDMB 1MJUH 3THML 3J8F7 4QXTB 1S7WB 2YPLB 1S78D 1A6AB 4JM2A 4WV1B 2DL9A 2KBGA 4Q9RH 4U0QB 5HGBB 4K7PX 1E4WH 1FZJA 3MACH 2X7LA 4M93B 2V17H 5CUSH 1H3VA 5T5NG 2N7AA 3NVQA 1EMTH 4N1HB 4JRYA 4KTYA 3V5DA 2XOTA 5JR1L 1YA5A 1U8JB 5I18H 4FZ8H 3IAGC 2CRYA 4YDJA 4ZO8A 1Q0YH 3G5YB 4RA0C 3O0RL 4BQ6A 5FYKE 3QIBD 5HYJD 3CD4A 1NFDB 1RK0A 1MH5A 3MRLB 3C60C 1U8OA 4NKIL 4XP6L 1NLDH 2CMRL 4TVPH 3MLXH 3LIZL 1J7VR 2JJVA 5IJKC 1BQLH 3KJ4B 3VFWB 2QHRL 3ZSSA 3NCCB 4WFFE 3STZA 1A1MB 5T33H 5JOFB 2R2HB 3C60A 3SQOH 3RNQB 3NIGE 4LLMB 3WO3B 4O51A 5J57B 5IJKA 3HAEG 3FQTA 1QSEA 1DLFL 2DQGH 1M71B 3RWJA 4FG6C 3CMOL 1UG9A 2WV3A 4HT1L 1KJ3L 2CUHA 3QRGH 2RIKA 3X3GL 5E9DD 3BPNC 4PJXE 1A1OB 4ZTOH 1OQOA 4P2YA 3U36B 4EBQH 1HYRC 1DN0B 4QRQB 3T0ED 2F5AH 5HHMA 4KDTC 4DN4H 4OZIE 4JDTH 5F6IC 1WIUA 3U30B 3E2HC 3L7FB 5FYKH 4JDVA 4TSBL 4KDTA 1JZ2A 1URLA 1KG0B 1WISA 4CU7A 4DW2H 4YR6B 4LHUG 2O5ZH 2EIZB 2ICWI 2UYLA 4AEFA 2XQYG 4OGXH 4FXGB 5IGXL 4H1LA 4LGSB 5KVDL 4HS6A 3QEQB 3LY6A 1KENH 4JE4B 4U6HA 4PJBE 3RGVB 3FOMB 3P73B 3RU8L 5IK3A 3F6LA 4TUOA 3T77B 2X9YA 2XZCL 4M7LH 5C0GB 5DRNB 5DMJB 4LBEB 4GQ9H 5C2BH 2ZJSL 1J1OH 1QVOA 1Q38A 4M7JH 4R6UA 3X3FH 5IW6A 4HPYL 4OSUL 3UZEA 3W82A 3OG6B 3ARGD 4XCYA 1H0DA 2VLKE 1TTUA 4LU5L 4RGNB 1KJ2A 1I9JL 2AK4A 3DVIA 2EDRA 2EKSB 4ZUSA 1I8LC 3KPRA 1MQKH 2HFTA 2OSLA 1F3DH 2BSED 1CU4L 5E4IA 1NAMA 1DP0A 3PE9A 2AVGA 5FO9B 1HH9B 2RFXB 4QHMA 2CXGA 3QQ3B 3ZDXF 1H8SA 3HFML 3WNPA 3HZVA 1L0YA 4OFYD 3SGEH 4ERSH 2XWJA 3GBNH 1R3JB 2J5LB 4DQOL 5C0RL 4YAQB 5L9DH 2GAZB 1MFBL 1MCPL 3IKCA 3QPXH 2UWEE 2VLRA 4LSUL 1LGVA 1S7UA 1T0PB 1J8HA 2NY0B 3CDGA 5JXAH 1ZLWH 4RX4A 2IANE 5I16A 4MMZC 2YKLL 1W8OA 3QG7H 1JP5A 3AMLA 3QNYA 5F88B 1JPSH 4P4KD 2CD0A 4MD5A 2OL3B 3ARRA 1NMBH 3S9DB 3UJIH 2A6IB 3G5XA 5BXFB 5EH1A 3X17A 2XNAB 2XICA 3OXSB 4BUHA 4N0FA 1BJ1H 4UDTA 3AAZA 1CFBA 1QD0A 2J8HA 5K93A 3VGGA 1IZJA 4NQEE 1D6EB 2FSEB 4QKXB 4WU5B 3D3VA 3ZTJG 1QSZA 5ITBL 3U9UA 1NAKL 3KLAB 1B6UA 3MYJA 4FP8H 3VFNA 1EVTC 3P9WB 4HMEA 3IXAB 3T1FA 1NMAL 5D7KE 3HNTH 3SKJH 5FUCC 3CVIH 1T21A 1JWMB 5FA3B 2YSSA 4LASL 1XR8B 2CLVA 4NDMA 4LHUA 4PJ8D 5TF1H 3BX7C 1AE6L 2YD8A 5GGUB 2B5IC 2R2BA 2NY6B 3VFUB 1HHKA 2PYEA 2DQUL 3O2VH 3GHEL 4YGAB 1YN7A 1C5DB 3TVMC 3OB0K 5C0EB 2ERJB 1QKZH 5C0CE 3WSQH 3E6FA 1S9WA 2QQQA 3NGBC 4P5TD 3CZJA 3TVMA 4L3CB 2VUOA 4U1MB 2BVOA 3WL9B 3WMSA 1OT1A 3ISWA 1TJHL 1QNZL 4KK5D 5ISZE 4Y88A 1FNLA 1X7QB 2VZ3A 5TGBB 4Z8FL 4ODSL 5I30H 2C5DC 1XF2B 3RWGA 4RAHA 4KV5E 5DD0L 4U1HA 5E6ZA 2AABL 4NCC2 1IAIM 3UPCA 2IH3A 1G84A 4QHNB 3B4NA 1C1EH 4GRMA 4HG4K 4UQ2B 3F7PC 2AQ2A 2VC2L 5KOVC 1J11A 4WUUD 4GAYB 4NUGL 4QOKE 3RIFF 1M05A 1JUFA 3PWPB 1C08A 3JTTB 4J4PD 2P4AB 3EZJB 2YZ1A 2VLME 3GI8H 3WN5C 4FZEL 4L4TA 3SE3A 5BVJB 1KJVB 1MCLA 4WFFD 1XF4A 1CD0A 3V8OA 5DRXB 3ULUD 2RBLA 5L7XL 1CLOH 2IF7A 3WN5A 3GSUA 4HFWA 5ETUA 2VJXA 1F4WH 4ODHL 4XP4H 5DJ0B 4M5YH 1U36A 4H0HB 2ZUUA 2X44D 4NHCL 4OAWB 1J10A 2QTEA 4L8BB 4M93C 2A74B 1CE6B 4MQ7B 2YPLA 2AJSL 1JZ3A 1IGFH 3AM8C 3C8HA 3BH9B 3MRDA 4Z7UA 1JK8B 2OCFD 3L7EA 1G7MA 1PJ9A 3MREA 1HHHB 4Y1AD 4IIQB 3QUMH 1MCKA 3WYRA 1QBLH 2QBWA 3G9VA 3FT2B 3MRKA 5B39B 4ENEC 3WBDA 1QTYT 3IRPX 1SBSL 2C1PB 1H3GA 2F8VA 1RIUH 5DMGC 5HHXH 4F15B 7FABL 5LGJB 2HFGH 3IU3A 5CGTA 5DJ2A 3KJ4C 4G3YH 3D18A 4YHPB 3IDNB 3Q5TA 4GRLB 1WIOA 1HQ4B 4X4ZA 5ENWA 5ALCH 1JN6A 2UZXB 5KSAB 3DX6B 3ROLA 5BV7H 2NW2B 3MJ7B 3TH2T 4LCWB 1G7HB 4ONGH 3MLYH 3U0PA 5C9JA 3OWEA 1YEKL 1I7TB 2BVUA 5T5NF 4U6YA 1M71A 3TBVB 1A9BB 4LOUD 1P84K 3LEXA 4GOSA 5JHDA 5C0AD 3VU2A 2X89A 4APQA 4UB0L 2VLJE 3SDXE 4U1GC 4EDXA 3D85B 2I9LB 2F54E 2GJ6D 3F7YB 3C5ZB 4BH8B 5DLML 2R2EB 5JA9A 4OLVH 3RWCB 1U8PA 2OTUB 3L95A 3VXSE 4UZGA 4NPYB 4MXVE 1F4XH 2FZ3B 2P43B 4GAJH 2J4WH 1N3NB 4L9LB 3PDOA 1E27B 3RGVC 4B0MM 5EZLA 5SWQA 1OAUL 3ZKMC 1ETZB 3D2UD 4HV8B 5ANMA 4NN6B 1PY4A 3MXVL 4Y2DD 3FB8B 2D0FA 4AIZA 3QCVH 2ADIA 4R26H 4K7FB 1X4ZA 4XWGL 3ME0A 5C0GA 1EGJL 4NO5B 3VJ6A 1OTUD 1NMCB 3JTSA 3H8NA 2I60L 4RWHA 1F8TL 1I7RB 3F58H 5DD3L 5FUOH 5GGTH 4C54A 2B0SL 4XPAH 4HUWB 4RGNC 3G5ZB 3V6ZB 5KSBF 1E4KC 5I17A 2C26A 1A22B 2D31A 4I3SL 3IS0X 3PP3H 4S2SB 3CVHB 2WIIA 3PL6B 4POUB 2W0PA 3FQRA 3LVEA 5GSRA 4TQEH 1M7XA 3H9HB 3TA3A 2AXGA 1Q9WB 3MUGB 2HJKB 4DAGL 4LMQI 4KGJA 1Q1JH 4G80B 1AR1D 3EIFA 2FIKB 2AERT 5EU6E 3QCTL 5F1OB 2WBWB 4L3EE 2J5LC 2HVJB 2OI9B 1Y6NR 3OR7A 1VFOA 1HQRB 1I7ZA 4RISL 5BS0D 4IBLT 5D5MA 3P77A 3TV3L 3MV7A 2L4OA 4PJHE 3VFGH 3BZDA 3VRJB 3TH4T 1VA9A 2J6EA 1U3ZA 1XGYH 4KMLB 3VFPB 2P7TA 1S7XA 2NY0C 3EOAA 4M7ZB 3SOBH 1P7QB 2BY3A 5I74B 5IQ9B 3VFRA 4XAWL 1YQVL 2YBRA 5EBLB 4U4BA 5C0CD 4S0SD 5DJZA 4PLKC 4HEME 4DEPB 1CLZL 2KUTA 4N0YH 1RV6X 5JIIA 2ZUSA 4LKXB 4P9HH 5C0BB 2VQ1B 1RJZB 5D7JB 4XMLL 4FFWD 4PB9L 3CFJA 1LK2B 3RIFK 3UCRA 3CK0H 1HSAB 1OAKL 1VACA 3HRZB 2H26B 1D6EA 3C09B 1QYGH 4Z7NF 2ZOLA 5LWYH 1JYWA 5L88L 4MAYC 2R1YA 3GI9H 3MLRH 4I2XE 1TTGA 3CXHK 3K46A 4OM0L 5IMKB 5IVZB 5FEBA 5EZJA 3MGTB 5DZLA 2KQMA 3UTTE 5ADOL 3N1PC 3T1WA 4PRIE 4MAYA 5K33A 1OPGH 2X5PA 1JNJA 2EE2A 2NY6C 3EUUA 4EN3C 2DI8A 3HNVH 5HTSA 5BQ7B 1JWMA 5FA3A 3WHE0 5CIPH 5ILTH 4J3UA 1NJ9A 1TMCB 1EAPB 2ERJC 5DJ8B 4MSWB 3GRWL 4O4YH 4EN3A 1WZ1H 3BEVB 5GS0H 1RFDL 2Y7QA 4CW1B 3FZUD 3C5JB 4NQDA 4EQ2A 2HG5B 1FL3B 3I9GH 3N9GH 2Z31D 1U8NA 1ADQA 3SBWC 3KPNA 2X2YA 3VFMB 3GHBH 4GW1B 1T1WA 4Z0XA 5T3XE 1A02N 2HJLA 4U1MA 3MRHB 1JPGB 4XGZA 4X4ME 5H35A 1BAFL 1PGRB 5E4EC 3PGCA 3S37H 5JQ6L 3BIBX 3DXAE 3LN5B 3CDCA 1MWAB 4EZMA 2NXYD 1Q94A 3WS3B 2FJFB 3TNMB 4QTIH 4X6DF 2E7LE 4JFDA 4RWYH 3EFFA 3KPPA 4QHNA 5SWZA 5I1KH 4ODVH 4JN2A 2NLJA 5F8RC 4WJ5B 4DVBB 1CXKA 4GKZB 5FHAL 1OGTB 1JYVA 3C08H 4JVWA 2HLAB 1N0XH 1NBYA 4NO0D 4X99A 2XXMB 3ARDB 3OGCA 4G8IB 5T5FL 3FO0L 3O4LE 3CFEA 1MAJA 2FD6L 5CP3H 4S1SL 5T1KB 2AV7B 4OGAD 5KVGL 1DDHB 2G9HA 2NY7H 5GS1B 5EZIL 3UX9B 3D0LA 3GJFK 1TENA 1NGQL 4KUZH 1JHLL 3VXOA 1JFMA 1DSFL 4JM4H 5EFIA 1IKNC 4POZD 5JW4M 4L8BA 4LLVB 1N6QH 1REIA 2VLJD 4IIQC 3TESA 5JMOC 3PJSA 2OJEB 3BZ4B 3BH9A 4YHKL 1I8MB 2VOTA 5MENE 4PG9A 1IC4H 3K80A 1A6WL 4XNMA 1HHHA 4NO3A 4Q9BA 3KXFE 4ZFZA 4OLZH 4DZ8B 2Y6SC 2AKRB 3WDIA 2EXYD 2YUZA 3JSSA 4QHUB 2YMXH 3HNSH 1TQBC 2R2CA 5J4MA 3GMPB 2FBOJ 4FRWA 1HHGA 4GRLC 4JPVH 3MYZA 4WWID 4JHWH 3RL2A 4OGYL 1HEZB 3FQNB 4QT5A 3WCYA 4YHPA 2YZ8A 3IDNA 5FKPA 5FM5M 5J3HD 4XBPA 4JZOA 3TN0C 2AEPL 3LCYA 5LQBH 1T5XA 4C59B 1P7HL 5EZOL 25C8H 5JNYA 2LU4A 2QQNH 3ZT6A 3IGAB 1P4BH 1WZMA 2XQYK 3RTQB 2IPTH 3MBED 3C9NB 3TN0A 1JYNA 5HHQA 3SKMA 5GS2D 5GGQL 3PNWB 1HWGB 1G7HA 4AG4H 3WEXB 4DUXA 1PKQB 3FRPG 1J05B 4PJ7F 1XCTB 2YPVL 4MVBA 4ZTPL 4GG6B 4NKQB 3FO2B 5CWSB 4Q0XL 1GC1L 4U6TA 5D5MF 5DD6B 4K23H 3C5ZC 5DS8A 3UC0L 4YDKL 5IW3A 5DJDA 3MRFB 3SGKA 1TETL 5I1DA 3EYVA 4E42B 5IBLD 2J3SA 3D85A 5K9OB 3S3JA 2F5BH 4X7SL 5ID1B 3F7YA 3O2WL 4JAMA 4BH8A 3EDJA 2I24N 4ZNEA 3DYPA 3KPSB 4L9LC 2OTUA 3QDGA 3LZFH 3ARFA 4XVUC 3DECA 4Q9RL 5EU6D 5GJTH 1T04B 5DMKB 2B2XL 3KYAA 4L9LA 2DQHH 2GSIA 3DUSA 3O11A 3V5KA 2P8MB 2WSKA 1R3KA 3U79A 1NBVL 4PJAB 1ZVHA 4FMFA 4FZ8L 2APXA 5H2BA 3UROR 3IFLL 4ZO6A 1AR2A 1CLCA 3EYQC 1M7DB 1KPVA 1VSCA 4O2CA 1UACL 2XTJE 3ILQD 4M1DH 1F4YH 3MJ9A 2DIBA 5GJSH 4OFPA 3FO1B 4GKSA 2JCCF 5T3ZE 1CS6A 4DTGH 4MNGB 2ED8A 3PL6C 5D2NE 4E41B 1B0RB 3UTZB 5TDPB 4AL8H 5DWUL 1ZV5A 4F2MA 1T4KB 3Q2CA 3SQOL 4Y4HA 3SDYH 2VKWA 2HLFC 5TPWL 1T7WA 3KVQA 4OZGA 2XPGA 4Z95H 3CCHB 3QRGL 4WI7A 1GZPB 5ALBL 1Q9WA 2EDNA 2IQ9H 3AC0A 4FA8A 1CQKA 3H9SE 1CGYA 5DA4A 4EBQL 1ZT1B 4G80A 4QYOA 2F5AL 3VXQA 1E4XH 4DN4L 3HMWL 2NY3D 4PRID 4ORGB 4JDTL 4O02H 1HQRA 3EAKA 2NY5H 3BEWB 2PTTB 4YDVA 5FYKL 3DETD 1NLBH 2CDFB 1A7NL 2DM7A 4H25B 3RVVD 1S7QB 4YBQC 4KY1L 5E03A 4DEPC 5T3ZH 1P7QA 2ZUQB 3O6FA 4DOHE 3MRJB 5IQ9A 3EO1A 1G7IB 4BQBA 4GLRI 1NCDH 4W68A 4CJ0A 2VXTH 4MHHG 3OB0H 1HDMA 2DI7A 3WFEH 5F3BA 1FN4A 3DRTA 1EJ6A 3BPOB 2HT2D 3EOBA 5T3XD 4M7LL 3C09C 3TIEB 1KTDA 2ITDA 3FRPA 5EN2A 3S37X 4OZHF 2HN7A 1ZT4A 4U3XA 4U3CA 5F9JB 1ZHLA 5DJXA 3GO1L 4MCZA 4QRRB 3RKPA 3MFGB 3ARWA 2ZNXA 3DXAD 1XF5B 3ABZA 1EFXA 1AIFB 3RWDB 1FJ1B 2J1KA 1CXHA 2VQTA 1CFTA 2ORBH 1A7OH 4A2MA 3FMGH 5DR5H 4ODBD 2AI0H 4U6XA 3RFZC 1MQKL 1IL1A 1QQDB 2X9XA 3OKNB 2XKNB 1KBGH 2PTUA 5GRVK 3BYTA 4RAUB 3ZKND 2A9MH 3HE7B 1TMCA 1EAPA 5DQ9B 4L8DA 4OLWH 3MRQB 3BEVA 3GBNL 4HUUA 4ELMF 1R3LB 4I48B 1DBJL 4QO1A 4WI6A 4MZ2A 5I1JH 4XVSL 5SX5K 3FOLA 1OCWH 2PCPA 1BWMA 5EG6C 2BNQE 3MQIA 4HH8A 2CIKB 4WEUD 5JXAL 1JPGA 3PWUB 5MEND 1FG2B