3SE9H

Crystal structure of broadly and potently neutralizing antibody vrc-pg04 in complex with hiv-1 gp120
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
227
structure length
225
Chain Sequence
QVQLVQSGSGVKKPGASVRVSCWTSEDIFERTELIHWVRQAPGQGLEWIGWVKTVTGAVNFGSPDFRQRVSLTRDRDLFTAHMDIRGLTQGDTATYFCARQKFYTGGQGWYFDLWGRGTLIVVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HIV-1 Clade AE strain 93TH057 gp120
publication title Focused evolution of HIV-1 neutralizing antibodies revealed by structures and deep sequencing.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 44
structure length 225
sequence length 227
ec nomenclature
pdb deposition date 2011-06-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3se9H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3se9H01
4Y5VB 1UC6A 3LPGA 3WJLA 3LCYA 4O02L 1QFOA 3D39E 5EN2A 3BHBA 3RTQC 5HJ3B 4I4WB 1XCTA 4OGYH 3TN0D 4JO2H 4MSWB 4HJ0C 1JMZA 12E8H 5GRWA 2HTLD 2XYCA 3WHXB 3UYOD 1MCQA 3IXAA 4LRNH 3VXTA 1QZ1A 2ESVB 4OD2B 3WD5L 3V6ZB 3RI5F 2IBBA 2NY1D 2PTTB 4U1KA 4Y2DD 3EYOB 3VH8G 2R1WA 2Y1VA 5J3HD 1ACYH 3QZWA 4NKOA 4M7KL 4ISVA 3PWUB 5I1GH 4OUUB 4D9RD 2L7JA 3KPMB 4WI6A 3DYMA 4Z0XB 4GW4B 3RY6A 1OAUH 2A9MH 1KLUA 5K9JL 1O5DT 5DJAA 5JHLL 5ESQA 1NCWH 1QSEA 1ZSDA 2B4CH 5GHWL 1WITA 1BLNB 4NDMB 4KV5F 2X4RB 1WZKA 3NMEA 3CXHJ 1NGPH 4WEMB 1CLYH 2X4UA 3OAYH 1FCCA 2L0DA 3ARGD 1NC4D 3OKMA 1EMTH 1JRHH 1L0YA 4CDGC 3VXUD 2FX8H 1OTUD 1NFDB 1OAKL 2XWBA 5IIEB 3DX7B 2VL5B 4KK8D 2G5BA 1LO3L 4HWEL 3HE6C 4JRYA 5I8KL 3O4OC 1ZT1A 3O2VL 3D3VB 2IMMA 3NIDF 3TFKD 4I9WD 1G9MC 4OIIL 2ZG3A 3D25A 5C0BA 1G7HB 3KXFE 3QULA 4ZQKA 2YD1A 4RFOH 3BEWA 3CFEB 5EFIB 4JKPL 4GKZA 4UT6L 5HYSA 4ZTOH 4LVEA 4WWKD 1W8OA 4JVPA 3U0PB 3L3GB 3REWA 2JB5L 1AJ7L 3KPPB 3LHPL 4GG6B 4JGMA 3OJDB 3MA9L 4CMMB 4BKLB 1UQSA 4HXAL 2DMBA 2OTWA 2EXYD 5E5MA 4WW2C 5E4EC 5C1MB 4I77L 4HULB 3VD7A 5JA8B 4LQFL 2BFVH 3G5XA 1G7QA 1G6VK 2AAVA 2H2SD 3TZVD 3JSSA 4UV7H 3WYRA 3CVIH 5ICXA 3PE9A 4WFHE 1I3VA 2GFBB 5JPMA 3WDHA 2PTVA 5IHUH 2I24N 2AXHA 2YN3A 1EVTC 4AEFA 2FX7H 3A67H 1KJ3H 1BZ7B 3RNKA 2YPKA 2O5ZH 4TOYL 4MAUL 5IKCB 3TYFA 3HRZA 3TH4T 5DJ6A 3T8XB 5B38B 4F58L 1Y0LB 1YPZA 4HPOH 3H42H 1BIIA 2HKHL 5C09E 4KJPD 3CK0L 3DOSA 5EU7C 1RUMH 4JLRA 3O45A 1U8LB 1T03L 3HC0A 3HE6B 4D3CL 3I75A 1HNFA 4LHUD 3QDMB 3NCJL 5IMKB 4X9FA 3BKYH 5D2LA 4X6FB 1U42A 1ZHLA 3BUYB 4GKNB 5EA0H 1QFWM 5J12C 2CK0L 3K3QA 4HWUA 4OZGF 3P40A 3QAZB 5LBSH 3BP4A 4JEGB 4WUUE 1MFDL 4WFFD 3KPRD 4PGDA 5E2VL 5F7DB 5KSAD 3OG6B 5BW7A 1SVCP 4E0RA 4FQLL 3NFPB 2VC2H 3DHMA 3SBWA 3T0EE 2EKSA 4WGVB 3BP7B 1GGCL 3T2PA 3TN0A 1ZS8B 4LLVB 1OP5K 1RJCA 2GTWB 5IF0B 3RZCC 3KJ6L 4JFDD 4GS7B 4J6RH 4LK4A 4HV8B 5DZOA 3L5WB 4OKVB 1BQHG 4N0CC 4M5YH 5FGCB 4OFVA 2BVQB 4NNPH 1LD9A 4ZD3L 4Y2DA 4MNQE 1AR1C 3RVVC 1WWAX 4PJBA 3EDEA 2VNCA 1E4XH 3DBXA 4ZS6D 1EGJA 4NNXB 5HYQB 1TPXC 5DRXA 2OYPA 1QNZH 5D7JC 3ZTNL 3MOBL 1IM9D 3ARFC 4XPHL 3HUJB 4H8WH 1F4XL 5CIPA 3S7GA 2W59A 4HLZH 2WW8A 3MV9E 4ZUSA 1P84K 1S78C 2DQGH 3BZ4B 3CZFA 2C9AA 5D7LB 1IAKA 3JTTA 3LIZL 3ARGA 3MNWB 2FX9L 4KWUA 3OKDA 5DWUH 4U05A 3GSNA 2I60H 4MDIB 3OF6D 5F1NA 2Q6WA 1GRWA 1I8MB 3VXUA 5I16B 3MO1B 4MZ2A 3MBXL 3U30B 3C5ZB 1U3HD 4AY0A 4XB7A 1JGDB 3UTQB 1IRAY 4KKBC 1RVFL 4HH9A 4I1NB 5SX5H 5BV7B 4NQCB 3GHBL 4TNVK 1F58L 4Z77A 5EORL 3QCUL 2OK0L 3HCVB 3NFNA 2UWEA 1IQDB 4XH2B 3MRJA 4WWKA 1KXQE 2Q8AL 4YZFF 2P8PB 1Q0YL 3DUSB 4FXKA 3IF1A 1CD8A 5E8PA 3V8OA 2O5XL 4JFQA 3OJVC 1JPGA 5HVHB 1A6TA 3R0MA 4KKAD 4LL9A 4GMTH 1KFAH 2CGRL 3VRJB 2X09A 1F45A 1XGRB 5HDQL 2HT3C 3MLVH 3TZVA 2IH1B 2B1AL 3D39D 2EYSA 4KKNA 3RJQB 3VFNA 2Z8WC 1UFUA 3KPLA 1SJXA 3ARFB 4DGVL 4ZNEA 4EDWH 4OJFL 3AM8C 5CZXC 5DHVB 2EIZA 1F4WL 4ENED 2DKUA 4XP5L 1ORSB 5ICZB 2NXYB 4FG6D 5GISL 1W72B 1AE6L 1P84J 5FUOL 3TLRA 2ITDA 2YWYA 3WMSA 3Q0HA 5GS0D 1FBIL 5IB2B 4WI4A 2Y36L 4PJAA 4ODWA 1ZLWH 1FZOA 5FM5O 1AGDA 1INEH 4LHUA 3ZDXE 4E41B 3Q3GA 3TA3B 5LGJB 2CUMA 1RZJL 4XRCA 5JZ7D 1NPUA 4XHQA 1X6NA 3G5YB 1WBYB 1JHTA 2NY4D 3KPRA 2EIDA 2VO5A 5KSAA 2YBRB 2YWZA 4DKEH 1J10A 1LDPL 2D03L 4D8PB 1PLGH 1F3JB 2XWTA 4X6DF 4IEFB 1A7OH 4JCMA 3B9VA 4JFDA 5F7EL 1KT2A 3VXOB 5DUPL 5HDBE 4JG1H 5C71A 2I9TA 4XPAH 3SDCD 5F1KC 5FYJL 3ULSA 1U95A 1AQDB 5CD5D 3KXFD 4E42A 4GBXC 1QPPA 4I0CC 4JRXE 1YN7B 1HHJA 1FJ1A 5CBAB 2VWEE 4YX2H 5IW1B 2WWMD 3V2AR 5ADPL 2VDQH 1R5VA 5JXEC 4I0KA 4FFYL 2V7NB 1NEUA 4RGNC 3D0VB 4OZFB 4NWUL 3UYPA 4OQTH 3T1FB 2HLAA 4FQ2H 1IJ9A 4FOMA 3N50A 1HI6A 5LKNA 4WFHD 3I6GB 2DWDB 3L5JA 2ARJB 4N8PA 4P2QB 2F53B 3RWIA 2Z92B 1R24A 4FXGB 2ADFL 3OF6A 1NLDH 4HZLA 2E7MA 4F2MB 4XNXL 1C5CL 4MLIA 5IW3A 2CLRA 1U3HA 2YD4A 1JYVA 5DQDH 2C3HA 2J4WH 5IV2B 1YUHA 4KQ3H 1JN6A 3BP4B 3NTCH 2ORBH 3UJIH 1X5HA 5C09D 5MEOB 1A3QA 3TCLA 1AGBA 5IQ7H 1CDBA 4WI3A 4JM2A 4N0FA 3QUXD 1GSMA 3AS2A 3MROA 4ZFZA 1X5AA 4KK9C 4FFWC 3L3HB 3P9LA 1NJ9A 5BQ7B 1IARB 3QXTA 4YHLL 5IWLC 1CGSL 4M62L 5F1OB 1J87A 32C2A 5LG1A 3OGOE 3R4DA 5T1MA 1A4JA 1MCLA 1KULA 3UDWA 1IGMH 4YWGH 4P23D 1D5BA 4YDKH 4WUUD 5BV7H 1P53A 3L3DB 2J6EL 4R9HA 4X6DB 3D39A 2VKXA 5GGRB 3T0ED 4YE4L 1UKQA 5A16B 3P77A 3JV6A 1KB9K 1TNMA 4MD0A 2V7HA 4L1HA 4LKCA 3W82A 4EOWH 4P57B 3IRZA 5CEZE 4QRUB 1IZKA 4AMKL 4EZMA 1QSFB 4JGUA 4WEUD 3LRSA 3KLHC 2OI9C 2EH8H 2IANE 4K3HA 43CAA 2A77L 3BH9B 3JTTB 2APXA 3H3KA 3JWOC 4MNQD 4XB8A 2YXFA 3S97C 5I18H 5JW4Q 4FQXC 5MHSE 3GSNB 3CVHB 1T0MA 4MDJB 1RU9H 3O3AA 1I9JL 1MI5B 3LEXB 3CFJA 5FHBL 5C0FA 4UUJA 5DHVH 1MFCH 2FRGP 2JIXD 1UVQB 3OXRA 1MQKH 5GS3A 3TBYB 3V6FA 4HH9B 4LSUH 3MV9D 3NH7L 1W72H 5HHPB 1CFTB 3EHBC 3RX8A 1PG7H 1LO2L 4DKFH 3O8XC 3EO1A 3NA9H 5E8NB 3BRGC 4R0LA 4PR5A 4D0CA 2DLGA 5E8PB 1HH9A 3M1BB 5T1KB 3HLAB 2AV1A 3LD8C 4OLWH 4PJCF 2I25N 4KV5E 1F90L 4KUCF 5JDJA 4QHUB 4Z7NF 3UXFA 3CFCH 1WLHA 1FGVH 3PABB 4CU7A 3MRQA 3RX5A 1SMAA 2EDDA 2ZUUA 4IOFC 3KXFA 1CGUA 4MQXC 2GJJA 3LV3A 1I3RA 2PW2A 2AXFA 3BVNA 1KB9J 4QRSA 2EIZB 5EO9A 4GRWE 5HI5C 3NIDE 2DQTL 2DRUA 3DMMD 4BELD 1ZVHA 5BRZE 3RVWC 1JWUA 3WS3A 1SHMA 3O9WD 4PBXA 3WXWL 3CDCA 1I1YB 3PHOB 1RZ8B 3D1MC 4HIXH 2PYFA 3U7WH 1NCUA 4G8GE 3FO2B 1A7NH 4JDZB 3MX0A 4GW5B 4KMLB 2D7QA 2YKLH 5HVGB 25C8H 1C12A 5I15L 43C9B 3TV3H 4X9IA 4WFGE 1EHAA 4OLUL 5EZJA 4LARH 3SJVE 4JY5H 3ES6A 3WIHH 5IESL 4NZTH 5DRZB 3S4SG 2A1WH 1MY7A 4QHMB 5DJXA 4O5LH 3ZYJA 1OVZA 4HCRL 4J8RA 2GJ6E 3EOAB 2W60A 3SGJC 4XRCB 1A7BA 2DMKA 3P0YH 4PJ9D 4HWBA 2WLZA 5A3IC 2OR8A 2FEEI 4OZFH 5EU7E 1AY1L 5C09A 3OXSB 5C0EA 3O8XB 2NTFB 3C8DA 3IJSB 4U1NB 3CH1A 1DQTA 1QVOA 3QUXA 2G60H 4YHZH 1C7SA 3LD8B 3DSNA 4B7LA 3FRUA 1FZMA 1UWXK 2E6PA 4Z76B 2MKWA 3H6JA 1CDCA 1TETH 1XCQA 3HPLB 1UJ3A 3T2QA 4QHNA 4P59L 2VXVH 4DQOL 4NUGL 1B4JL 3ULSB 5HHQA 3QJHB 1DDHB 3PGFL 3PV7A 4GQ9L 4C83A 1HKLH 5DT1L 4P23A 1UM6L 4XX1E 1KJ2B 1GAFL 2Z31C 2IADB 1HHJB 3OMZA 5D1QD 4TUKL 4YFEA 2JCCF 4WWID 4FZEH 3T0EA 3ZTJG 3QNZA 5IBLC 4PJCB 1YEGH 3MA7A 5LGHH 4YNYA 3FRPG 3QR2A 4HS6B 4P3WA 4TRPL 4G5ZH 4H25B 4OZGE 1G6RB 3HAEG 3GMNB 4L3AA 4K9EC 2AEQH 3AB0C 1KCKA 4XC3H 5T1DL 3FB7B 2XN9E 3DIFA 4PB0H 3FAWA 4LMQI 5IFHL 4MNQA 5DMYA 4HQQL 1YJDC 4KJWC 1CG9A 3VD5A 3EFFB 3LB6D 4JRXD 4G7YL 3JXAA 4I0PD 3VGAC 4GAYA 5TDOA 2VDLL 4OFPA 5IJKC 5L9DL 4H1LB 4XXDA 5BVJA 4KJQC 5DFTA 2F8OA 2OL3A 1X6LA 5B39G 4DKDC 4UB0H 1JPSH 2ZCLL 1Z3GL 3QXWA 3PGCA 2C1OB 2JIXA 4QHKJ 4QNPF 5E8OB 3RKDD 4ALAL 4RIRB 2G2RA 1ZANH 5IBTL 3MV9A 5DHYA 4BSJA 1XF3A 1CR9L 4JM2B 5H35B 3EYVA 4RQQB 4N0FB 1IL1B 2P44B 1XEDA 1OB1A 2Z9TA 2ARJQ 1ZLVH 3CVHH 2IAMC 4Q9BA 3WFHA 4H0HB 1S7VA 4X80H 5SWZB 4CADB 3DARA 1GC1L 2VZVA 1MRCH 3N9GH 2ERJC 4OLVL 4PRPB 5BZDB 2ATPB 4NO5B 3SDYH 2DIJA 4G6AD 3ZMRA 4RFEA 2Z31B 1S8DB 4M1CC 5E7FA 3KYOA 5DDHB 4EIZC 3SOBL 1UA6L 2R4SH 4XMPH 1I1RA 1IGJA 2DTML 4PG2A 3NPZB 1MPAL 1OAZL 2XA8H 2DYPB 3P77B 4G6JL 4E5XB 2H41A 5HD8C 4MNGA 3AU1A 1Q0XL 2M8XA 4ZUVB 1NEZG 1REIA 5IG7A 5IB1B 4P99A 2E9IA 5MENB 1DBJH 1VGEH 1Q9WB 3FQUA 1ZVSA 1Y6KR 3DMMA 4LASL 4R3SB 4L3EB 4Y4HD 43CAB 3SKJL 3O9WA 1P7KA 3U1SH 3IFLH 4Z0BH 2JCCB 1TCRA 4JY4A 3RTQD 3VGAB 2WIMA 1WAAE 1J12A 1VFBA 3L3IB 1LO4L 1ZWIB 1NAMB 3F5WA 3CU1A 3O2WH 4HJ0D 5CJOL 4YZFE 1WT5C 1RHHB 2LU3A 4ONFH 3O3AB 5HXMA 1S9XB 5KN5B 3OG4B 1RZ7L 3MRKA 4IDJH 3RL2B 3BP5A 2WINB 3RPKA 4X4YB 5IVXE 4GT7A 1ZK9A 4PJXF 4ZUWB 5CEZD 3GK8L 1RURL 3UPCA 2H32A 1RIVH 1PKQE 4D9QE 1BFVH 2PKDA 4PJ9A 1RHFA 2XTLA 1ZV5A 2IAND 4WGWB 3OZ9L 4KRLB 4JO4H 2RB8A 1MHPL 3MZTA 4I3SH 4XI5D 3T0AA 3X14B 2YSSA 5EC1A 4K3EH 5MHSD 1KCSL 3PWLB 3MRMB 4LKXA 2A6DB 4YHOH 2ZOLB 4D0CB 2F53E 2YR3A 3IGAA 2ERJB 4WY7H 5CSGA 5HDLA 4N5UA 3VDBA 3BGMA 1DBKL 1CK0L 4J3WA 4AYFA 2HN7A 1J1PH 5DYOA 4Y5YA 3RAJH 2MOVA 2PO6B 2P8LA 2MKLC 3C6LC 2GITB 5DQJA 4KRPC 1DANU 3RRQA 1LO5A 2JJWA 2UZIL 1RIHH 5LQBL 3PL6D 1I3RB 5TDNA 2OJZH 1G1YA 5D1QA 4NC1C 4EQ2A 1A47A 2XPGB 5EO9B 4L3CB 1U2HA 3VFPA 5H94A 1CN4A 1P6AB 1OGTA 4UTAH 5KVFL 3S88L 3ARBC 4O4YL 4HK0B 4QTHA 4UBDC 4F7MA 1T83A 5KJRH 1OHQA 1D5ZA 4HX1B 2NTSP 2VL4A 5I73B 1OM3L 4XWOC 1XGYL 1MHHB 4OTXH 4N9GB 1KJ2H 1LNUA 5MI0C 2WBJC 4JRXA 4I0PA 4RZCA 1NBYA 2PETA 2YA0A 3Q2CA 2PR4H 1IE5A 4J8RB 3MRFA 5EOTA 4JHWL 3F6LA 4RGNE 3H3PL 4YHPA 4N5EC 5BRZD 5J7CC 1G6RH 1QRNB 2D7TH 1BFTA 3TT1H 2VDRH 3IFOA 4ORZC 4RSVA 5KTEL 4FQPA 4G8GD 5GSVA 1BMGA 3LKRB 1CF8L 3KDMB 1R3JA 4QXGL 4HDIA 1Q9LA 4G9DA 1A6WL 5LCVL 2OSLB 5ICYB 5GGRY 1MJ7H 5GJSH 5EIIA 3QFJE 4WFGD 2Y4SA 1G7PA 3SJVD 4H1LH 3U48A 5IBUB 5J56B 2H6PB 5BO1L 2ZPKH 1A1OA 1W0WB 2P49B 4QHNB 2GJ6D 1JZ7A 3S35L 1MLCB 4C83B 3LKPB 1I9IH 4ODHL 5I1EH 2ZUXA 4IIQC 2DM3A 4I18A 3DGCR 4C57C 3T65B 2ICWJ 3O2DL 4K3DH 4ZXBC 3GI8L 1IVLA 2CDEB 3GIZL 4YNYB 2R4RH 4HJJL 3OKNB 1AI1H 1RY7B 1PZ5A 1DLFH 1L7TH 4HPYH 1MHCA 1AO7E 3IDMB 3RPIA 4Y4HA 5GS1A 1J9CT 1DN0A 4KTYA 2Q3AA 2VB5A 4JFEB 2ZOKA 1IBGL 1E6OL 2WBJB 5FA3A 3RTQA 5KVEH 4GAYB 1VERA 3CSGA 5CWSA 2FWOB 3RZCD 1MCWM 5HYJB 3VFGH 1B0GA 3CCHA 4PRAB 4K9EH 4X4XA 4Q9RL 1K85A 5DJZA 1AR1D 2YEZB 5GRUL 3QHZL 2IANA 2VDNH 2XN9D 3RVVD 3IJYA 1TVHB 1GZPA 3OKKB 3O41A 1YJDH 3GSOB 3MTRA 3DRQB 3V5DB 1BQSA 1CVRA 4JN1L 1JF6A 5D7SL 1NAMH 1NMBL 1AP2B 3WFHB 3G6DL 1ORQA 5D7JD 1K8IB 2DKMA 3ARFD 2BOCA 2GT9A 1WVZA 1NGYA 3MV01 1BFOA 4KHTH 5DC4B 2X4PA 2Y5EA 3FB6B 4KGJA 1VESA 2ARWA 1S78D 2G9HA 2NY3C 1NC2D 3NIGF 4DN4L 4GMSH 3KYOB 4OF8A 3QUKB 4HFWA 2Y5TB 4ZXBB 1IZJA 3PL6A 4F9PC 5C0CB 2DD8H 1TJGH 4C4KT 3V7AG 1BECA 1HXYB 5IG7B 5E8EB 4EEEA 4NZDA 5FYLD 1NCDH 4DUWA 2CRIA 2G5RA 1ZVSB 4QRQA 4OFYD 2LVCA 4IS6A 4KKBD 3L3OB 2XXMB 3CMOL 4EUPG 3GBNL 1TCRB 4KTEH 4ODUB 5EZLA 5KG9B 5J1TC 1P7QD 1VFBB 4RNRA 2FDBP 3WLWC 4NZJA 4FQQA 4ZAKB 3QUMB 2R0LH 4ODVH 3MLRL 1MRDL 1TZIB 3DGGA 4APQB 5E08L 4UI2A 4P4RB 4NM8L 3BAEL 4MCZA 3RWEA 5BRZA 2OTPA 2ZCHL 2R8SL 4WW2A 4DK6A 1TFHA 1U41A 2HT3D 4PRDB 5D8JH 1UXWA 4I3RL 4G8GA 3C9NB 5EWIH 4GW1A 4CW1B 4HBCH 3LKNB 4LGPB 2HG5B 4U2YA 1YEEH 1BHGA 3GMPB 4YR6A 1YN6A 2JKXA 4YUEH 4RBPH 2CMRL 1CFSA 4KTDH 5D6CA 1MJ8L 3PHQB 5D1ZD 5IMMB 4HS8L 1TQCB 3T2NH 3P0VL 4K8RH 2GJ6A 1U92B 1INDH 1U93B 1VPOH 4IRJD 3S5LA 4D9QD 2YUXA 3GSUA 2VE6B 1JUFA 1TQBB 4HIJA 4HGWB 4Y89A 3U4EB 2QL1A 1YC7A 4NHCL 1ZGLM 2F53D 4ZMAT 4X6BA 2IALB 1TJHL 3FQNA 4IHOA 4P3DA 1FORL 1A7PH 2AK1H 1CLOH 4RMWA 4GUPA 4ZUUB 3HZMA 4QTHB 4AENB 3OX8A 2DKSA 4B5EA 5T5NF 4BUHA 1NLBH 5HYEA 4OSUL 5A2JH 3FQWA 5T3ZH 4AEIH 1WC7A 1F42A 1DVFB 5E00B 2PW1B 2AK4E 3A0OA 1IT9H 2RIKA 4BQ8A 5EZIH 1KIPB 5ALBH 1ETZB 5JDSA 1RIUH 1IC7L 4F7TA 3V8CA 2DDQL 1EAJA 3TBSA 4L8SB 4MJIB 4V2BA 2X6MA 2F8XC 3B3IA 1LP9A 2F74B 1LHZA 4M61A 4TQEH 1HEZA 2FGWL 2UYLA 5IGXH 4O58L 4KAQH 4NN6C 2JCCE 4GBXD 3UO1L 4HDIB 3H7BA 4U1GC 1RULH 1G7PB 5DJ0A 3I84A 2B2XH 2CXGA 1EUTA 1XR8A 2YZ1A 5JXED 1IMHC 2Q3ZA 4UV4H 1J18A 4L9LB 1SYSB 1CICC 4P2YA 4RGND 4PRIB 3LN5B 1GHFH 2QR0A 4NPYA 2BMKA 4GG8A 1UGNA 1NC2A 1S5HB 1JMXA 1EV2E 4C59B 4JGJA 3OGCA 4L1DA 5I66A 3B5HA 1EERB 3W9DA 4R26H 3QFJD 3QNYB 1SBSL 4QNPE 3V5HA 2AJZA 2M1KA 4LVOB 2KDGA 1I1CA 2X70A 2PYEB 4U3CA 2BSTB 4HS3B 1YECL 2AJUL 1DBAH 5FB8A 3GSVA 2ZOKB 1U36A 1XGTA 1IGCL 4YHYB 1CGWA 1BPVA 4W68A 5TF0A 4YHKL 3SPVA 1BQHB 1P7QA 2DQCH 1EHXA 5DMJB 2HT2D 3F58H 4PGJA 4JDTH 2VDPL 4FFWD 3WEXB 5ANME 3L95B 2NX5E 3S36L 3B43A 2WK2A 1M71A 5ESVA 1NGWA 5ALCH 1V3JA 4G8FB 1KC5L 5C0DB 2OJEB 1U8QB 3SY0A 1OT1A 5GRJH 1F4AA 1QPXA 3OJ2C 1AO7D 4XP1L 4Z7VA 5E2UH 3LOWA 1FLTX 4I13B 1A1MA 2VN7A 4DOHE 4XNYH 4RAUA 3LQZA 6CGTA 1T04A 1YMME 1SJEB 4D0DA 1HQRB 5JMOC 3SQOL 5TGBA 4XNZB 4KXZI 1WZLA 4YBLB 5L88L 1WAAA 3FO1B 2A6KA 2YS4A 4MCYB 3U2SB 4R4BA 5DD3L 1JHKL 2X7LB 3QUMH 1CICB 4Q9QH 2HRLA 1NGYB 1WK0A 5D1ZA 1IAIM 4I5BB 2KUTA 4F33B 3KLHD 1ED3A 5IVXA 1C5BH 2IG2L 3KGRA 5CUSH 1NANI 4G6FB 5CJ8A 1QQDB 4IRJA 3TIDA 1PKQA 4O51A 3TPUA 2P24A 1FH5H 5MEPA 4FQXD 5HBBA 3WCYA 3C6SA 1LK2A 4KU1A 3BYTA 5KSBF 3TNMB 2E6JA 2XFXB 4PJXE 4NM4H 4QTIH 2CJUH 1VGKA 2MHAA 2ZG1A 3AUVA 1F6AA 4AH2B 3DX8B 4IS6B 1MOEA 1MAML 1NDMA 1FYHB 4ODTH 5I19H 4WW1A 4IOIA 5A2LH 1GPOL 1RPQA 4IMKA 2FR4A 2Y7QB 4KY1H 3EHBD 5T3ZE 5JHDB 3I50H 3U79A 4RRPG 3SDXE 3G5ZA 1A6ZB 2UUDK 4M7JL 5IROC 4NC1E 3K7UA 1NGXA 1LVEA 2XIDA 2VXQL 3QFDB 2AJSL 4XMKL 5JXAL 2P46B 1U3ZA 1FNFA 1IKFL 3SCMB 3B2VH 5EDXA 4ZO6A 1MWAL 4LSPH 3I2CH 5A43C 1MIEH 2P1YA 1OL0A 4IOFD 4MQXD 3HNVH 3TYGL 4GBXA 1NGZB 4NN7C 3VRLE 3RA7H 1QFPA 4M5ZL 3G6AA 3TCXA 1GZQB 1JPTL 3RDTC 1AGEB 4P2RA 3UC0H 3TO4D 2CRYA 4OV6F 4AG4H 5JXEA 1EX0A 3MXWH 4JQIL 5C0GB 1K6QH 3QIBB 1RJYB 2YRPA 3N85H 4Z95H 1H3UA 4OLXL 3H9SB 1N0XL 1RZFH 5E2TL 5FM4A 5BS0E 4NQXB 1C16A 1TTGA 4D9LL 3UTOA 1UEMA 3CSYA 3S96B 1OD9A 4HC1L 4IRZL 4XZUB 3BMVA 3QFJA 4RGOL 2A2QT 4DGIL 1OWRM 5C86A 3P4MA 3NAAL 2XTJC 4GUPB 1HXMA 1FSKC 1HNGA 3IS0X 4ZSOB 4GSDL 3UZQA 5DQ9B 4X7TA 4HKZB 3FQWB 1FLRH 1WC7B 4WU7B 3BKJH 1JZ6A 3H0TB 5JW4N 5DMGC 4PJEF 1IAOA 4JKMA 5AUMA 5HPOA 3NVQA 4Y5XA 3EYUL 4R2GB 1VFAA 4JHBA 1KTDA 2CKBL 4L4VB 1IGFH 3NCEB 8FABA 5I6XB 2D9CA 1EXUB 4WCYL 2BRQA 1AO7A 4OZHF 1CBVH 1HKFA 4OB5L 3U7YH 1AFVH 3MV7B 1BZ9A 1U91A 1LE9A 1UCBL 2AK4D 3LN4A 4ZYKA 2MCG1 5IBLD 3R06B 1D5IH 2VERN 3N1QC 2QHRH 1JZ2A 1HOCB 1QLRB 5EBLB 1H0DA 2DQHH 4YXLL 1SEQL 1QD0A 2QR0B 3MBEA 1UKSA 3IDJA 5TJWK 1FVDB 4XCEB 2DQEH 3EOBA 2VDKL 3WUZA 1S5IH 1N7ML 2IQ9H 4KJWD 3NPSC 1V7ML 1X9QA 3T77A 2PN5A 4X0KA 1P4LA 5E7BA 1RZGB 2VAAB 3LMJL 2X1WL 4PLJC 4KJQD 4Y19B 3MGOB 1DL7L 2XTJB 2COQA 4XAKE 4OFIA 1X5JA 3PWJB 1FSKB 4HFUL 4RAVA 1QOKA 1QKZH 1B2WH 4O2EA 3I6LE 3GUTB 1J1OH 4KROB 5TQ2H 3PDOA 1B0RB 4K94H 5EPMA 3WLBA 1FVEA 3TWCH 5DC9B 4JR9H 3HMWL 2EH7H 3I6KA 2IAMD 4U4BA 2BSSB 1NGWB 3X11A 4Z78B 1JNJA 1FZKA 2WMPA 1Y18B 2C4XA 1OQXA 1UWGL 4DJMA 3MNZB 4U1MB 1FYTA 5JOEA 5L0QB 4M1CD 1F00I 1H3TA 4EI5C 3FMGL 5CKAA 4PJEB 1N6UA 2A6KB 3G6JF 3V0WL 5HD8D 5BOPA 5INDA 2NX5D 1RUQL 1A7RH 3QB7C 3TO4A 5M94B 1ADQA 1SY6L 2X4SA 4WTZG 4XTRC 2YK1H 2DQIL 2A83B 4JPIA 5DZLA 1WICA 3QQ9C 1EEUA 3MRCA 1DFBL 3UPRA 1VKXA 4FQHB 4PGEA 4HKJB 1NKRA 1YMMD 3C6SB 1LK2B 3QO0A 3VWJD 4R96A 4M8QB 2WP3T 1BOGA 1CDIA 1U8JB 3MLWL 3ZL4L 4EN3B 1WCBB 3BE1L 1DBBL 2FIKB 1F6AB 1QA9B 1MCHA 4G9FA 1TZHA 3SGJA 1HHHA 3NABH 4ZFFB 2X4TA 4R4FH 2JJTA 3ULVL 4A6YL 1NUNB 3BP6A 1ZXQA 3MPCA 5JLZA 1D3CA 2QQKH 3G5ZB 3P73B 1CL7H 2OXGA 5BZWA 1AXIB 2M26A 3OPZL 3BRDA 2XZAL 1U8MA 4NRZB 3QG7H 4XNUH 3REVB 4HAFA 2VH5H 3HG1E 1A14L 2X42A 3HPJB 1FFPB 1YY9D 1I9RL 4LGRB 3U0WL 2EO1A 5GGVY 3C6LD 4AEHL 4JO3L 2IPKA 4KRPD 3QNXA 1WWWX 3F7RA 1KCUL 2P7TA 4WVRA 3OR7B 2HRPL 3M8OH 5T3ZD 1EO7A 4FFZH 1ZA3A 5GGTA 5I1HH 1DANT 4Z18A 5JPNB 5E0QA 3OKOB 2AK4A 4P2RB 2CLVB 3QCVH 1UH4A 5FV1L 1G84A 2DQFA 3ARBD 4K07A 2NY0C 3VFVB 2ZSWB 1BM3H 5T33L 4UBDD 3DX6B 2ADGB 2IH3A 1AQKH 5E6IC 1L9NA 3L7FB 3T04D 3IS1X 3ARYA 1VFOA 3SKNB 3G6JB 3S4SB 5CBEB 4P46B 1C16B 2Z35A 3B9DA 1HSAA 3BH8A 4JB9L 3TVMD 5E24E 2NY7H 4Z8FL 4HT1L 3CFDA 1OY3B 4HF5H 5F96L 4PG9B 2VJXA 3WO4C 1GXEA 1PGRB 1KNOB 4LSVH 1KB5B 4LRIC 5BOZG 3OAYK 2H8PA 5EO1B 4YXKH 4RWYL 2AXGA 1DSFH 2C4FT 1M05A 2F5BH 5EUOB 4X8JA 2CDGB 2DI8A 5HY9A 2BNQB 5BS0D 3V4UL 1OAYL 3BDYL 3GIVB 2JB6A 5DURB 1D6EA 4NO2B 4Y5XB 4M48L 1VFAB 4J4PC 4R7NB 3SO3C 5JORA 3QWRD 2YA2A 4LQ1A 3AS3A 1M7DA 5E9DB 5I30L 5HGBA 4OF0A 5A40E 1N5YH 5TF1L 2BNRB 3EO9L 4GAJL 2VABB 3VWKB 3VFOB 2GQHA 2P5EB 1KCVL 4H5SA 5KS9E 4ZYKB 4TSAL 1FHGA 3KS0J 3O6LH 3DV4B 5ANMA 1IEAB 2NX5A 2NY0B 4BSVB 2YA1A 4PGBA 2NPLX 1FIEA 2FNBA 2V2XB 1Q9OA 3EYQC 3RBGA 4U7MA 2QQLL 1P4IH 2OQJB 3MBEB 3RNQA 2AJXH 3TIEA 2X44D 5DFVC 4HIIB 4ZUTA 4EBQH 5B39B 1AXTH 2PXYD 3T77B 1QACA 3CU7A 2WWKO 1YMMA 2HJFA 4Y1AE 1OGAE 1WT5A 2LABA 4W4NA 3VWJA 2WIIA 2VLLB 2WUBH 5TPWL 3WO4B 4U0RC 4NQVA 2DQUL 3KPSA 3WFEL 2ZUQC 4PJ7B 4UQ2B 5F97E 1ZA6B 4JANA 3E3QC 1UYWH 3FN3A 5GS2D 1WFOA 4AQOA 1UCTA 3TT3L 1FVEB 1QHPA 2YUVA 4M1GH 4MX7B 1QSZA 4O02H 5GJTL 3X11B 4EQ3A 4S1DC 5D5MF 5HGGS 3UX9B 3BZFB 2IMNA 4XAKD 3KNBB 4PJXA 2RCSL 3O3UN 5C0IA 2I26N 2J5LC 5DR5H 3FT3A 4JY6B 5CHNA 1FYTB 5FECB 1YQVL 4K3JL 2NY3D 3C6LA 2JE8A 4ZSOE 4Q74A 5JQ6L 3WD5H 1NEZB 3I6LD 1FG2B 2BERA 4LOUC 4KQ4L 5CJXC 3SDXA 5CZKA 5KSBE 1AIFB 4M7KH 3RHWK 4PJGF 3ZE2F 3N0PB 4JKKA 1BVKA 1U8OB 3TO2A 5DUBB 3ORJA 5CP3A 4LF3B 5DRNA 5DVNA 1XF1A 4YGAB 1A2YB 5JW3L 1J8HB 2HJLB 3VXMB 1QLFB 3KPNB 1EGJL 1U8IB 5AG8A 5F3HB 3AREC 3HR6A 3WLWD 1ROWA 2VXUL 4U0RB 3TVMA 1A4KA 3STZA 1JV5A 3WE6A 3FAXA 5J11C 2DLTA 2DWEB 1KPVA 1WGOA 3O3EB 3BPOB 4G9FB 5TDPA 1HCVA 1R3KA 1T89C 2BJML 4PRBB 5DVKA 3BGFB 1LO3H 4HWEH 5I8KH 1G7MB 3BOVA 3QUZC 3ARXA 3ZDZE 3BP6B 4U1HB 3O2VH 1F02I 4NCC2 4PS4H 4NN5C 1QLEL 2VLJE 4Q6IB 2D4FA 4KJYA 5BZWB 4FXLA 2E9JA 1RZIA 1HIML 5BS0A 1F4HA 1U8MB 1N59B 3VRIB 3DLQR 2Z4QA 3L3KA 4JKPH 4UT6H 1FQ9C 4ZOBA 5ITFA 1DQLH 2J5LB 3G9AB 1XH3A 1AJ7H 1WV7T 3QWRA 3CZJA 3U6RA 1EVUA 2YPLA 4XPGL 3MA9H 1KEMH 5IVZB 3FOLA 5L2JA 1KB5H 4IIQA 2BNUB 3PWNA 5ENWA 4HMCA 1CD1B 5SWSB 3IU4L 5LWYL 1CDJA 4I77H 1OW0C 2K1MA 5D5MB 1MLBB 3G04B 2QBWA 4LQFH 5AAWA 5EOQL 2I07A 3E8UL 2W65B 2X9YA 3FTGA 2NW3A 1CDGA 1T66C 4KGLA 3HG1D 1EHLH 3BSZL 1I7TA 4K3GA 2ADIA 2IH3B 3EO0B 4MAUH 5FYKE 2JK5B 5HTSA 3FQTA 4F58H 1TZGL 3ZTJH 3H9HA 2R2HA 2HKHH 2PXYA 1SEBB 4X99A 3ZDYE 4NYLB 3QDGE 3CK0H 3HAEH 2B0SL 5C70A 4P4KA 4NP4L 3HN3A 1YY8B 4D3CH 5J6GA 1JFQH 1HWHB 3U9PH 4OZHE 3ARRA 4NN5B 2GY5A 3NCJH 5F7UA 1G7LA 3QEQB 1FL6A 1K2DA 3MRGB 3MV8A 2APBA 5J9PB 3IJHA 5HHOB 3MC0A 4JM4L 1ONQB 3T3MF 1J0HA 1T4KB 1MFDH 3F7PC 4NT6B 2FYYA 3P9WB 5E2VH 2NCMA 3RI5K 4TPRH 4LDEB 4WV1C 1EHNA 3ZE1F 5HHMB 1K5NA 3E2HC 3L9RB 2AS5M 2R29L 3NGBB 1CLCA 5C08E 3WNNA 1QHOA 4H20H 4AIOA 2GSIB 2E6QA 3ZT5A 3QUYB 1MCKA 4DZ8A 4JAMB 1RJZB 4QY8A 2J12B 1KIQA 3QWQB 5JNYB 5I8CB 2DM2A 5EU6E 2DBJA 2YPVL 1XF4B 4HGKC 1UH3A 1X44A 5HPMB 3RNQB 2RFXB 4P5KA 4AL8H 1F4XH 2D31A 5B38G 2GCYA 5E6YA 4U7SA 4U6XB 5F88B 4IM8A 5C0AB 1N5AA 3Q6GL 4CVXB 3OKLA 3MQIA 3IFNL 5FO8A 2EC9T 2E8ZA 4X4ME 2WIIB 4AIZA 4K7FA 1D5MA 1A6UL 2FX9H 4S2SA 3UBXA 2ZUWA 3KPSB 4OCMC 1HINL 4G80A 1G7JA 4N1HB 4Y16C 3NFSL 1ND0A 3VE0B 3NN8B 4LSSH 4F7CB 3QJFA 3GJEA 3QCTH 3BMWA 5FGBC 4KZDL 1I1AB 3QXDA 1ZMYA 2BY1A 1EEQA 3GHBH 4PGCB 1F58H 4M3JA 5JIIA 5EORH 3QCUH 4MJ5B 4Y1AD 1OGAD 1Q38A 2ZCKL 3IAQA 4U1SB 8CGTA 1U9KA 1FNLA 4LAQL 2WNGA 2Q8AH 1Q0YH 1TVBB 2UY7A 1R0AL 1FO0H 3FFCE 2O5XH 1AGFA 5AWNH 1DQQB 1YNTA 4Y4FB 3MLUH 5KOMC 4DZBA 2CGRH 5HDQH 5HVWA 5CLWA 3GSQB 5CLTA 5FK9B 4LIQL 4EUPB 2B1AH 4YDVA 2F5AL 2H45A 3X13B 3THMH 1BZQK 5D9SB 4PB9L 3HG1A 3GEWB 5JIPA 1ZLUH 5EO0B 4OJFH 4JQXC 5IEKA 4TVPH 2D2OA 3O11A 3TH2T 1A1NB 4OCXL 4NUJB 5GISH 1VACB 1AE6H 3INUL 5FUOH 4XCFH 1C1EL 3EUUA 4YEEA 3CSBA 4BFIB 5FOBB 3WE6B 1FBIH 5DSCB 3X17A 3GMOA 4Y16B 3U82B 3ETBF 2Y36H 2HVKB 5GS0L 3AS0A 4L29B 4W4OA 1CTNA 4WU5B 5D1XB 4EI6B 4HUVB 4QRTA 4OKDA 5HHXL 4QHKI 1T6VN 1RZJH 5IEHA 3GSXB 4LBEA 4DAGL 4Z7WF 5EIVA 3L3KB 4M93C 3HI5L 5K9QG 2O93L 4HJGB 3RDTD 2HVJA 1H3PL 3B2UC 4GKSA 1V7NL 4OF5A 3MJ7A 3VW3L 2H3NA 1LDPH 5IQ9B 3V5KB 2OX5A 4ONGL 1FVCA 4QCIB 3G08B 5GSRB 2YPLB 2V2WA 2AI0L 1KJVB 4LSRL 5F7EH 1OSZB 1JWMA 3DXAE 5DUPH 4D94A 4CVZB 5AD0B 3FT4B 4JO1H 2VLJD 3GGWA 3MOAL 4GXUM 3WUWA 4MWFB 5FYJH 4XP4L 3EOTH 1NFIB 1T5XA 1FL5B 4HBQA 3JWNC 1T7VA 3CDGA 3LKOB 4FQJL 1EIBA 3QZWG 1S9WB 1QO3B 2PCPA 2YD6A 2NW3B 3PXHA 5CAYB 4OF7A 3WXVH 3KLDA 3ELAT 1HILB 5B4MC 1I7TB 3OBAA 4U6HB 1DQDH 4TULH 3MRLB 1FNGB 5ADPH 4ZFGH 4OZIE 3JV5A 4OAWB 5J4MA 1F2XK 3BEVB 1BFSA 4L8CB 2BC4B 4FFYH 5KAQG 4I2XE 3HNSL 2QADB 2HFEA 4ZDHB 4NWUH 5IW6A 4TTGA 5JO5B 1JNHB 5L6YL 4NKIL 5KS9A 4P4KB 1F11A 2CDFB 3PWVB 3VFMB 3TNNB 4NJAL 2ADFH 3QEUA 4RMQA 4XPBL 1MCSA 3FO0L 5DEGB 4XNXH 1C5CH 1MNUL 2DJ4A 3MV8B 3B9EA 5FYKD 1ZT4A 3U46B 1QR4A 3DO7A 4PBVC 4LVHC 2CIKA 3VJ6B 2KZWA 4MB5A 1ES0A 3GJFA 3OJMB 1M6OA 1KJMB 4P5TC 1FNEB 3QDGD 5HYSG 4Y1AA 1OGAA 4HWBL 3L5XL 4NQEE 1T21A 5IVNA 4G3YL 1HHGB 3ILQC 5E1AA 1I1FA 3E3QE 3K0WA 1CGSH 5LJYH 2VISA 4YIQA 5IT2L 4CJ0A 3MLSL 2VSDA 3LKQB 4PP2B 2EDBA 3ECBA 2VLRB 2FBJL 5INCA 4U6YA 2DLEA 3CPLB 4JJ5A 1K4DB 2Z91B 3BWUC 2Q87A 1IQWH 3LKSB 4PLJD 2J6EH 1I8LC 3EAKA 4JFXB 2R0WL 4PY7A 3VFTA 3PP3H 2VDML 1TJIL 1YEKL 4YE4H 3KG5A 1CGXA 1Q94A 4CVUA 2W0PA 4OD1L 2XT1B 1QR1B 4TVPE 1BEYL 3IDYC 5C08D 4OGYL 2C3VA 4HUWA 5I1JL 2Z93A 12E8L 5I76B 4N0UB 5SWSE 1JNLH 2A77H 4LLWB 3BPNC 3AXLA 4KKLD 1MHEA 5D5ME 1U8PB 4LRNL 5L8KB 1D9KD 4FTVE 2LAGB 3KLAA 3PJSA 4CAGA 4EUPH 5EU6D 1S7TB 4L8BB 3S36X 3B9KC 4HKBA 1G7JB 5C7XL 1I9JH 3QWOA 4P5MA 5K59F 1ND0B 5FHBH 4CNIB 1ACYL 5F7KC 1MVUB 1U0QA 4L4TB 1Z6JT 3MYJB 4LLYA 5I1GL 3C2AL 4YPGA 3JUYA 4PBWD 3WIFA 4FNLH 1G9NL 4EI5D 4NFDA 1OAUL 3L3JA 3HZKB 5E99L 3C5SA 3KYKH 4ZPTA 4U1LB 5DS8A 1NCWL 4PJGE 3ZE2E 4U6VL 5EULV 1B4RA 2CQVA 4JFYB 2MPAH 2VZOA 3MUZ1 1J0KA 2BVOB 3PV6A 5FM5M 4MLSA 1J5OH 4PLOB 4XTRD 1NGPL 1EK3A 5I2IB 1WZMA 4ZTPH 3QQ9D 4XVUC 4PV9A 1F90H 5M95B 3OKEA 4HIEA 4WTXA 2VLJA 4PV8A 4MD5A 1ZLVK 3AC0A 4XVJL 3A6BL 1T2QH 3DSFL 2R69H 4OV5B 1J1XH 3K4DA 1PZUB 2ICWI 1RJLA 3D85D 2A6JA 4QYOA 3QI9C 2XZQL 2IQAB 1MJUL 3VXPB 1UZ8B 1XR9B 3FFCD 4GRLC 5F7FA 2DQTH 4ZTOL 4MXWL 2OR9L 4PREB 4MD4A 1Z2KA 1IFHL 3WXWH 3KWWB 4TNVF 2ED7A 4MQ7A 4XBGB 4MMZC 1FL3B 3FFDA 3MJ8A 3C60C 5I15H 2ED8A 3Q6FA 3C09C 4MJ6A 4OLUH 4S11A 5GIRB 4M4RA 2R39A 2V9TA 2Q76B 1H8OA 5IESH 5C6PB 4OCYL 4UV7L 1XF5A 4X83A 1LO0L 1K4CB 4UDUA 4HCRH 4PRHA 4PUBH 4PRNB 5F93C 1CE6A 1L6XA 4QT5B 2HJKA 2BXYA 1CXFA 3CFBA 2O61A 3QO1B 3JV4B 1AY1H 1CT8A 5ETUB 4NQUA 4GXVH 3QDGA 4HPOL 1B88A 2R2BA 1JPST 2FO4A 1FVCB 2NY0D 2NZ9D 1R3IH 1QBML 5I9QB 1T3FB 3SDDB 3VCLA 5E6ID 4WHTA 3MR9B 2AW2A 4OZHA 3DPBA 4QXWA 5ISZB 2P42B 3GGWB 3IKCB 4P59H 1ITBB 4NUGH 1B4JH 4GQ9H 1DQJA 5DT1H 1F6LL 4ZOEA 1UM6H 1AD0A 1XGPB 1VEPA 3QPXL 4FZ8L 5EU3A 1GAFH 1BJ8A 2XY2A 1A9BB 1EDQA 3CFKB 3PIQB 2GHWB 1ZAGA 2DI9A 2X10A 4C56A 5AYUH 1U8HA 4L5FL 1DEEA 4NOFA 5H37G 1U8NA 3DURA 4JFPA 2X4OB 3X12B 1FN4A 1I3GH 2DI7A 3EYFB 1N2RB 5C08A 3V7AE 2NXZB 3DXAD 5IB4A 5K9QI 2CO7B 3A6OA 2FATH 5DC0A 2VSCA 2J8UF 5T1DH 3C60B 3SE3C 5ACZB 1FV1B 4X6CF 2FJFA 1BJ1H 1XIWB 3C09B 3LRHA 1D9KA 1I85C 3RWGA 5CJQL 1AD9A 5DO2C 1EEYA 3MRPB 5EU6A 1LDSA 4LHUG 4EDXB 2ZCLH 1Z3GH 3BESR 1RK1B 1HHKB 3WL9A 1E4XL 2IC2A 4XCYB 3WFCL 4V2CB 5CCKH 3KPOA 2W9EL 4EI5A 2EXWC 4ELMF 4LLMB 4H8WL 5J13C 1CR9H 4H26A 1ZHNA 2BVPA 4X4MA 3NZ8B 1FCGA 1L0QA 5T1LB 4TUJB 3F7VB 4PTUB 3OTTA 4OM1L 3EYQD 4OZ4A 1UB5B 1N0LA 5EBMA 1WUNT 5DFVD 4OD3L 5GGUB 1CXIA 3PNWB 2NW2B 4IRSC 1RFDH 4UDTA 1EBPA 2EDRA 3C5JB 5DK0A 3IU3A 2EYTB 1UA6H 3SOBH 5CJ5A 3VFTB 4ZPVB 1PQZB 5DVMA 1LEIA 4L8DA 1MPAH 1OAZH 4G6JH 4XC1H 3D85A 3ULUF 2CLZB 4FQ1L 1Q0XH 4NQED 4JN2B 1C08A 1XGUA 4UNTA 3MLTB 2W9DH 4LASH 1MIML 3BWAA 4F80A 1CFVH 2AQ3A 1ZHBB 3LS4H 1KXVC 1PYWB 2NNAB 2AV7B 2NR6C 4S1DD 5DI8B 5IUSA 3BYYA 1DJSA 3KLAB 4WNQA 1LO4H 4GMTL 5CJOH 3ULUC 4QOKB 5IMLA 5F9WB 5C0JB 3QWOB 2R56L 1RZ7H 1INQA 3MLVL 2LU4A 1X5IA 4TVPD 3GK8H 1RURH 2J8UB 4PJFF 2WQRA 1ZT7B 3E6HB 3DECA 4LOUD 4HHAB 1VA9A 3F12B 4EDWL 5B3NA 3LY6A 3I02A 5CSZA 5KZCD 5E5UB 4JZJC 3OZ9H 3O4LB 1MHPH 5E56A 4CVWA 3VD9A 5CEZL 3HHRB 3ZO0A 1EEZB 3WN5A 4CN6A 1KCSH 5C07E 4FTVD 3PV6B 4LCWE 4U1IA 4J3UA 2W0FA 4PFEA 4OCNC 1VSCA 1DBKH 1CK0H 4M9OA 5E6IA 2DIAA 1E4WH 5FF6A 1W8NA 1JYXA 4ZFOA 4ELMB 3ARED 1INEL 1RSFA 2GY7B 4NQDE 3W0WB 2VQTA 4PJ8C 3ZHDA 4RGMB 3FCTA 1OAXL 2IPUG 1NUDA 4G43B 1OP5H 3TBTA 1BX2B 3QEHA 3G5VA 3JTSB 3IDXL 5EZOL 3QUZD 4JDVB 3TH3T 4C55A 1I4FA 2VLME 3RUGE 5L2KB 5KVFH 3S88H 4YO0A 4OT1H 4Z7WE 4ZO7A 2GSGA 3DXAA 5KSUA 1A7OL 3VFRB 5IFJB 3AROA 4KZEL 1OQOA 1OM3H 1XGYH 5MEQA 4PJ5B 4JG1L 5D2NC 2B4CC 1G9ML 4XPAL 3RWHA 4MJ6B 5FYKU 3CMGA 4YHNA 2BOBB 3ROOA 4YAQB 4UQ3B 4PRHB 4JHWH 3WHE1 4KDTC 5J8OA 2OBGA 3H3PH 4YX2L 4OZIA 5CEXA 4LEOA 3RWCA 4I2XA 5DZNA 1CT8B 5KTEH 4N8CL 1S7XA 2UVEA 1H5BC 2XNAB 3M17B 1KIRA 1X5GA 3VDAA 3EJYC 4DCQB 1K3IA 3E6FB 3UTSE 4QXGH 5DJCB 1A9EA 5DTFA 1II4E 1A6WH 1T66D 3HZVA 5LCVH 1TNNA 4HC1A 1T22B 4MXQC 1KCRL 3QIUC 3RVXC 3TJHC 1EBAA 4M6OL 1OARL 5BO1H 3Q48A 5IMOA 3D0LA 2IWGA 4BZ2H 4ODHH 1L4IA 2GK0B 3JZ7A 4BQBA 5D96C 4PJ8B 2V2TA 5IB3A 4HUKB 3KPQA 3WSQH 5I75C 3RWDB 3DVNA 2J4WL 3O2DH 1AGCA 1S3KL 2MWCA 4C56B 3NTCL 5FKPA 3UJIL 1UG9A 3GIZH 1R5WB 2B5IB 4HJJH 5IQ7L 4R4NC 1X7QA 1BF2A 1OT2A 4HG4K 1LEKA 1JL8A 4X5XB 4KRNA 4Z7UF 5IB5A 4LPTA 1E4KA 4NKDA 4G42B 4HWNA 5DK2A 3GMRA 1RK0A 5DD6A 4F15C 5ESAA 3ILPB 1E6OH 4F7EA 5DLML 2P5WE 15C8L 2R9HD 1DE4B 4ERSH 4FMKA 5KVDL 1KLGB 3VXRB 3FO9A 4LLDA 3UTTE 1MY5A 3PWPE 3MV11 1OSPH 2GUOB 2A38A 3UAJD 4RFNC 3ARDC 4PD4K 3V0VA 4CN4A 4WO4C 1AXSA 1FFOB 4UOW1 1JVKA 4Q9RH 2XZZA 5AYQA 3QHZH 1ODAA 3L1OH 3QHFL 2V5TA 3VD4A 1OAQL 1YDPB 4JN1H 5E03A 4FTVA 5D7SH 4M7ZC 1NMBH 1T7YA 5BXFB 2GTZB 4KVCL 3G6DH 4PJDA 1WISA 4M03A 4MAYD 3X3GL 5K9KB 4FN0A 3SDAB 3SQBA 1NDGA 3EW3B 2ADJA 4G8EA 5D93B 3O3DA 2ED9A 3JBG7 4DN4H 3AREA 3O3BB 3HI1A 3ZKNC 1MFCL 3DV6B 2AQ2A 3U36A 4X6EA 4HLJA 4LSUL 3S9DB 3IDGB 2NY2B 1BQLL 4PYHA 3VDCA 1T89A 3BX7C 1RUKL 4HG4J 3DYOA 1JK8A 3DROA 3QUZA 2GI7A 4XNMA 5TH2A 3QPQC 1C5DA 4DKFL 4Y5VC 1C8PA 3MFFB 4KK6C 5B8CA 4F15B 5I17B 2BX5A 4N8VA 2Y06H 1U58B 3ZSTA 1Z9MA 3GBNH 1WFUA 3QDJB 3F65A 2I9LB 3SGEI 2KZ1B 4QXTA 1OLZA 1PW3A 3CLFL 4J1UB 2OMBA 4JFOA 1UB6B 5IMLB 1BVLA 4OCRH 5E95B 5FGSA 1WSST 1WTGT 4DGYL 5F9JB 4F8QA 4JFFE 4MHHI 4V1DB 1MRDH 1CD0A 4EXPX 4Z7UB 3AMLA 3ARDB 3QDHA 5E08H 1R3HB 2XKUA 4WO4B 1IEBA 1FFRA 1OCWH 1W0VA 2QQNH 4PD4J 4P2OA 3BAEH 1A02N 3EYSL 2VDOL 2ZCHH 3S3PA 2R8SH 2NY5C 5DRWB 2EDTA 5HGAA 5DEFB 4I3RH 4LLQA 1NMCC 1YYLL 3P2TA 5T5FH 4WUKL 2VZ1A 4ODSH 4DW2L 3ULUH 5F3BA 4N68A 3DI3B 4HIXL 2W0FB 3QG6B 2ZP0T 3NCYS 2A6IB 1WBXB 5JOPE 5F6IB 3RGVB 2CMRH 3HMXA 4B7IA 3D2UD 3TV3L 4HS8H 5SWQB 2ATKB 3P0VH 3RGHA 5IVOA 5IJVB 4A6YA 1G1CA 4LARL 4JY5L 4HUXA 4W6YB 1LE5A 3ARWA 3IFPB 4HKXA 2XKNA 1GCFA 1VADA 3FOMA 1AHWC 1CE1L 4OLZH 5C07D 5F7MC 1EFXB 3GMLA 1PSKL 4LCWD 4ELKA 2EKJA 3FONB 3O6FB 1TJHH 4F7PA 3PF2A 4EVNA 5C8JA 1MWAB 5T3XE 3SKOA 5D7IF 2G60L 1E6JH 5HGHA 4XPTL 5CMAB 4Y4KD 4NQDD 3B2UD 2JJVA 3MUHL 1J05A 4LCCB 4WV1A 4S1SH 2JJSC 4IDLA 4NO0D 4ORGB 3IDIA 3ROOB 1NBVL 4RA0C 1IC7H 1UEYA 5F44A 3EDKA 4NIKB 2VLMD 1J0IA 1TTUA 3K80A 4ONOA 3MJGX 5E2WL 1NMCB 4XVSH 4M4PA 4O58H 1E4JA 4NSKA 4KC3B 4Z9KB 4P3CH 5DTFB 2NY6B 1JHLL 4XXCC 5B4MD 2N1KA 4HIHA 3DX9A 4PB0L 2R0ZL 2F54E 2OZ4A 1PX3A 4MAYA 1YEDA 3B5TA 1BAFL 1S7QA 4TSCL 4K55A 1KEGH 5F7YC 4X6CE 1SMOA 3IXTA 1BOYA 3HE7C 3ZE0E 4YDIL 4YHIB 4KI5F 2YC1A 1I7UA 2VQ1B 3L5IA 1AHWB 4UB0L 3HS0B 5EOCH 3KLSA 4PJIE 3ROLA 5I1DA 5C6TH 3UTSD 3CFIC 1AGCB 4U1JB 3ZYIA 3MUGA 1UM5L 1ZANL 3E0GA 3UJJL 3B83A 2X4NB 4N0RA 4RAHA 1IGTB 2CKBB 2FZ3A 1SBSH 3QAZC 4ODXB 5IB5B 1NCCL 4JZNA 3BQUD 1AKJB 3RWFA 3OKYA 1RUAH 2VZ3A 3GMRB 1YECH 4X80L 1UXSB 4YDLB 4P5TD 1JF5A 1IGCH 3N9GL 4HD9A 1ZGLA 4NKMB 3ZKXB 2M2DA 3T4AB 4DVRL 1JYWA 4GS7C 2VDPH 1ZHKA 1CU4L 3MRRA 3S36H 3HUJF 3ILQD 3IETA 4Z7QF 3D18A 2X4QA 1U8KA 3VXNB 2F19H 1JPFB 5CGMA 5JOFA 1KC5H 5D7IB 5GGQL 4O2FA 1I8KA 1AXSB 3BXNA 2WBWB 5FEBA 1L7IH 1D5XA 4XP1H 2A0LD 3LEYL 3ULVF 1DBJL 4JZOA 2EE3A 3QRFM 1R5IA 3SQOH 1MVFA 1KG0A 2P5WD 5L88H 3WO3B 3U1SL 1PEZA 3I85A 1DUZA 4PJDB 4UU9A 4WI5A 4Z0BL 2DS4A 2FSEA 3W9EB 4GRMB 1JHKH 5DJYB 3UTTD 3CC5B 3VG0H 1CIUA 3PWPD 5E5RB 3QQ4B 3QXAB 1MREH 2EYRA 3D2UA 4S10A 2IG2H 1I7ZA 4LGSB 3HE7B 5F8QC 3MRNA 4IDJL 3HI1B 2ICWB 4MJ2A 3PQYB 5HHVL 1JF1B 2K7QA 1I9EA 3LPWA 4PY8J 4X6EB 5HYIA 2R1YA 3P4NA 4UZGA 1H9VA 3GMQB 3U30C 3C5ZC 4M00A 3W11C 2VR9A 3B9KD 4K2UL 5C07A 3JWOL 3QSKB 2CR3A 1D7FA 2XG4A 1S7WB 4LCWA 4TYUA 4I3SL 1T5WA 2Y07H 1G0DA 1LEGA 4FQIL 4PJFE 5I8EA 2WQ8A 3IDNA 5BV7C 1OPGL 1MCNA 1P9MC 1GPOH 4WY7L 5FA4A 3EDFA 3C08L 4Y8AA 5SX4I 4NNYA 4Y4KA 2E7LC 3D69B 3BW9B 3UYRL 2BSRA 4NQDA 3VGEA 4M7JH 4R7DB 1T1XB 5DJ2B 3VGBA 1HWGB 4HXBH 4NO0A 5HVHC 3VXSE 5H2BA 2BSED 3OQ3B 2FJGA 1T1YB 2DLIA 2VXQH 4Y88A 5KAQF 4X9GA 1X5LA 3T4YB 4XVUD 3NBNA 1T1ZB 4XMKH 5JXAH 4P2OB 1VDGA 3RUGA 5DJDB 1T2XA 1S9YB 1HH6B 1MWAH 2VLKB 4UNVA 4BH8B 3VFUA 1MUJA 2VXTL 1MJJB 4LLQB 3MREB 3RY6C 2DQJL 4M6MH 3F7YB 4UTAL 2DAVA 3T3PF 1CFNB 3TYGH 5D2NE 3V4PH 2P8MA 4M5ZH 3CUPA 3OB0K 5GRZA 1JPTH 3QI9D 3D9AH 4JHAH 1GIGH 4JFFD 2NXYC 4GRLD 2R1XB 1CVSC 1JWSB 3QXUA 1CFQB 3DVIA 1Z9OA 2OLDA 1NC4A 2NY5H 1ADQL 3GSWA 3WFDL 5E2TH 3QIWB 4D9LH 3UTSA 2D7TL 4AT6B 4LPCA 3TT1L 2VDRL 3TA3C 4ELKB 5EU5A 4RGOH 5JOPD 2V5RA 3PDDA 5HSFA 5EN2B 3BHBB 5ECJE 1Q9KA 3GJFK 1XCTB 3BQUA 1HDMA 2H2PC 3SKOB 4ZG1A 5D4QA 4GSDH 3V0AC 4Q2ZA 3HR5A 3X3FH 2F8VA 4P5TA 3IXAB 3VXTB 4L9DA 1MFEH 1TDQA 4JPKH 4PJHE 5IM7A 1JE6A 4U1KB 1YPZF 3EYUH 2R1WB 2FL5A 4NKOB 3QZWB 5DMKA 2CKBH 4ISVB 3B6SA 3KYNA 2XA3A 4K3DL 1IKNC 3FB5A 5T3XD 4WHCA 1WEJL 5CJBA 4YC2B 4XWGH 1AI1L 1X5FA 4QRPE 3MODL 1KLUB 5DJAB 4QHLA 4OB5H 3OHXA 1ITCA 5ESQB 1L7TL 1HSBA 1WCQA 5DJ8A 1I8LA 1QSEB 1ZSDB 4HH8A 4XNQA 2P5WA 1BD2E 4KUZH 2HKFH 2Q86A 5D2LF 1DLHA 3FQRA 2X4UB 5ID1A 1S7QB 5GGTL 3TC9A 3UTTA 1M7IA 5KVEL 3OKMB 1SEQH 4RWHA 3UTZA 3GRWA 3S5LG 1A3RH 2VOTA 5TQ0H 2XWBB 3K8KA 3OR6A 2G5BB 1UH2A 4JRYB 3VFGL 1N7MH 5I1DB 4G8IA 2R2EA 2P45B 1ZT1B 1V7MH 3U0TA 4K9EL 5DO2D 4ODBD 3RY5A 3LMJH 5CINL 3ZKQD 1F3DH 3B9KA 5C0BB 2VDNL 3D25B 5F89A 2V17L 3QULB 4ZQKB 2F54D 1YJDL 3BEWB 4GKZB 5HYSB 1FE8L 4QRRE 4HFUH 1YMHA 1BBDH 3VI4F 4WI8A 3REWB 2I27N 4PJBF 1CLZH 4X5WA 2VR4A 4XX1G 1UQSB 1GGBL 1HYSD 4N90E 1EJOH 1KPRA 1TVDA 2OTWB 4KHTL 2MQCA 3HMWH 5E5MB 3QA3A 1U8KB 3LSOA 3G5XB 1G7QB 2J88L 4LDOB 2NY1C 2BXZA 3BPCA 4Y2DC 5ICXB 5D72L 2DD8L 5IK3A 3EKCA 4IRSD 4F3FA 5BMFL 5JPMB 1UWGH 3U4BH 1S7SA 2A9NL 3DVGA 1M7XA 3RNKB 2YPKB 5I74B 3TYFB 4HWZA 4ZS7H 3HRZB 4N1CA 4UT7L 4OBSA 5DJ6B 3MYZA 1WFNA 1IM9A 4LU5L 4UIMA 2HLFD 1YPZB 4LVNB 2ESVE 1HK6A 4XVTL 5ABDE 3EFDL 4M1DH 1Q8MA 1BIIB 4C58B 1NAKH 1RUQH 3GMMA 4JFFA 5IR1A 1JGUL 2D3VA 4GRLA 5FO9A 1SY6H 3MSPA 2DQIH 3QEGH 4JLRB 3QRGL 3O45B 2UWEF 2YRLA 4ODVL 3DUUA 3HC0B 1DFBH 5C9JA 3BIKA 3I75B 4NGHL 2W07A 2NR6D 1E4XI 3MRIA 3P4NB 5D2LB 1ZHLB 4M9PA 2HT4C 1OF2A 1YEFL 1SJHA 5F6HJ 3HI6L 3MLWH 1W0YT 3UEZA 3ZL4H 4PGDB 4UILH 4GFTB 4E0RB 2RR3A 2SEBA 2EKSB 4B0MM 3TN0B 5BVPL 3ULVH 1T1WA 4WWKC 1WWBX 5ID0A 2ZNXA 1NFDE 2BSRB 3K81A 3T2NL 2C7UA 5K93A 1INDL 1VPOL 2E8YA 2ITCA 3LQAC 3OPZH 3GHEH 5BCAA 3D3VE 5DFWH 1LD9B 5E94A 2D0GA 1OD7A 2NY1B 4Y2DB 4JG0L 1S7UA 3U4AA 4H0IA 1I9RH 5L7XL 4PJBB 4PTTA 1XFPA 3P4LA 1KPUA 2GKIA 4JO3H 3DBXB 1MAKA 5DVOA 1MCPL 1KCUH 5DRXB 5FHAL 1A7PL 3TBWA 4GG6E 4PJAF 1JGVL 5CIPB 1GYAA 3MJ9A 4O2CA 2XY1A 4ZUSB 5E2JA 1NLBL 3VXSD 3CZFB 1FZJA 2YD7A 1IAKB 1NBZA 4XAWL 1IC1A 5T3ZL 4AEIL 3DRTA 4XT1C 2YOCA 3U9UA 3ARGB 4UTBL 1NC4B 5T33H 4KJPC 3OKDB 1EAPA 1R3LA 1BQUA 5F1NB 2Q6WB 1WBZA 3VXUB 1F13A 3HNTH 5F9OL 2AJ3A 5DD0H 3SE3A 2X1OA 3ARSA 2GJZA 5MERA 2EDQA 5CD3A 4YQXL 5GZOC 1MF2L 1I85A 5BJTA 5CZVH 3MJ6A 5FM8A 3R1GL 1CCZA 3WFBL 4NO3A 5IGXL 5CEYA 3BPLB 2D7OA 2G75A 4Z77B 5F96H 1IC5H 1UWEH 2UWEB 3NFNB 3P4OA 4LLUA 2VRAA 2L4OA 4GO6B 1KACB 3MRJB 4WWKB 2CIIA 4RWYH 2B2XL 3ZKSD 4FXKB 3IF1B 2E27L 2GAZA 4UV4L 4JFQB 4OGXH 1JPGB 4M7LH 3QDME 1J11A 3GKZA 3V4UH 3BDYH 4PJIA 1A6TB 1N3NA 4YHML 5CILL 4LCUA 4MXQD 3KYMA 1GH7A 3QIUD 3RVXD 3TJHD 3SDCA 4FRWA 1Z5LA 4X9BA 1FRGH 3MFGB 3KYNB 3TZVB 2EYSB 3VFNB 5I30H 4UAOC 3KPLB 3GBLA 1KBGL 7FABH 4X98A 5TF1H 3RL1A 4ZS6C 4J12A 2AABL 1IM3A 1KCVH 4DVBA 4LCYA 5FGCE 4TSAH 3FQRB 3ME0A 5LAXA 4R4ND 1E27A 2XZCH 2ITDB 4MA7H 3MRHA 2P4AB 3Q1SL 2PTUA 2QQLH 2Z8SA 1FFNA 4JM2F 1YZZA 4PJAB 1V05A 4ODWB 1DN2A 5ALCL 4BZYA 1FZOB 1AGDB 1QTYT 4QRPD 5F7WC 4LHUB 2NYYC 4N0YL 3Q3GB 1RV6X 5DD5L 3BD4A 3HUJE 4Z7QE 4J3XA 5F72S 1U3HC 4IJ3C 1BD2D 1JHTB 3KPRB 5C2BH 1MEXL 2DQUH 5D7LE 3WFEH 2QKIA 5KSAB 2AVGA 4HUUA 1I75A 4JM2C 1H15A 2XWTB 5SV3A 1DUYA 1P4BL 4Q9QL 1EO5A 4JZJA 4QF1A 4JFDB 1Z0NA 1KT2B 2Q8BL 2LQRA 3LS5L 1URLA 4E9LA 4BJLA 2H9GA 1I8IA 2I9TB 4ZO9A 5GJTH 5DMIL 1GL4B 5JW5A 1BGXL 3W39A 1U95B 2DB8A 3UDWC 4NQCE 2RCSH 4WUUA 4E42B 1GGTA 1P69B 2XG5A 4UAOB 4PJFA 3BZEA 1FJ1B 4QRRD 3V4VL 3ARPA 1YQVH 4K3JH 4QTIL 3ZKND 4Z6AT 1R5VB 1S7RA 5KSVA 2EEDA 4KQ4H 3IVKA 1IM9B 3CGTA 5MP6L 4ODTL 4X7CC 5I19L 4N90D 3N06B 2AKRA 2MTPA 2NLJA 2VZSA 3S37L 5IHBA 3VXSA 4FG6C 5I1KL 2DBLH 3QPQD 2HLAB 4KK6D 1HI6B 4K7PL 1WF5A 5D7KE 3RWIB 5JW3H 1R24B 3BIKB 5HDOA 2WP3O 3P9MA 5AG9A 4HZLB 1EGJH 2HWZL 3MRIB 5CP7A 4F9LA 2CLRB 1U3HB 4IJ3B 5F8RC 4BSWA 5D2NA 5CIPH 3GSRA 1YUHB 2ESVD 3QDAA 1JN6B 1PKOA 2C3WA 3TCLB 1AGBB 2XRAL 2SEBB 2ZJSL 5C92A 4NQSA 3UZVB 1KV3A 3MROB 4ZFZB 1E28A 3UC0L 3GSNH 3P9LB 1ZLSH 1NJ9B 3T3PE 4POZD 4O9HH 2C7UB 1H5BA 2OCFD 4M6NH 4G6ML 2VR5A 4Z95L 1HIMH 32C2B 4E41E 5CKGA 1I7RA 5T1MB 3LPFA 3HZYA 1A4JB 5JQHC 1RZFL 3ISWA 1D5BB 2PO6C 3QIUA 4BH7A 1JYNA 1U2CA 3HFMH 4XHJC 3D39B 1RD6A 4XPGH 5CD5C 4ETQA 3JV6B 5I8OL 1EH9A 1QBAA 2BCKA 4MD0B 2V7HB 4LKCB 2H26A 3IU4H 3MXVL 4MB3A 4XCCL 3BO8A 1QFWL 4OLEA 2BK8A 3LQAH 5TE4H 4O2CB 3LRSB 1QBLL 3E8UH 3DETC 3D3VD 4PJHA 1OP9A 4BQCA 5JR1L 1FLRL 4QWWC 3BSZH 3T1WA 5C0RL 3GNMH 1R3LB 1T0NA 1U6AL 1T0MB 2XQBL 1TZGH 4AQ1B 3SKMA 3CFJB 5IOPA 5MERB 4QRPA 5EUKA 4UUJB 2AGJL 5C0FB 5CD3B 5H37H 3D5OF 4WEBL 3OXRB 3V6FB 1YPZE 2EEAA 3MCG1 4K8RC 1B0WA 3HC4L 2Q7YA 1BD2A 1CBVL 4ZO8A 4KMQA 2OTUA 3P4OB 1YNLL 2FJHA 2NY4B 1AFVL 1YEJL 3S6CA 1T7ZA 1PEWA 1MH5A 2HFFA 3EO1B 2KH2B 4JVUA 1D5IL 4FQCH 3VFWA 4R0LB 4PR5B 5AZEL 4TNWK 2QHRL 4P2QE 1JNNL 5DUML 5C3LD 1HH9B 2AV1B 2DQHL 4JM4H 3H8NA 4Z5RA 3KR3H 2DQEL 4F37F 1V3LA 1NCAL 5DA4A 3SDCB 5KOVC 2W38A 1S5IL 3MRQB 1MRFL 1GJIA 3KXFB 1F4YL 3TJEL 3LV3B 1A7QH 4XGZA 2PW2B 2AXFB 2JELL 2R29H 4QRRA 5FKAA 3BVNB 4BM7A 3DTXA 3JVGA 4QRSB 3T0EC 3SGEH 3L7EA 3HE6D 2UUDH 4NRXA 3EGSA 2DICA 4DN3L 1JGEA 2FO1A 3QDMD 4NKQB 1JWUB 3WS3B 3VFSA 5AAMA 5F1IA 2V5SA 2PYFB 5J1AA 5TQ2L 2YPVH 3P11H 3TWCL 4OIBA 4JR9L 1C12B 3Q5YA 4Y5VA 5D71H 2VN4A 1A6AA 4X6DE 5EZJB 3O6MH 5HJ3A 4S1RL 4FABL 4I4WA 1YEIH 3KHQA 3ES6B 4LSDA 4MQTB 4MSWA 5DJXB 4ESKA 1G9NC 3Q6GH 1T80A 1QBBA 4LPVA 2W60B 3IFNH 3WHXA 5I1IH 1AR2A 2C4FU 2OXHA 1QSFE 4LCIH 1NSNL 4OD2A 3BUTA 1A6UH 5C09B 4KVNH 2C26A 5C0EB 2PTTA 4BK4A 1GOFA 3EYOA 1HINH 1A3LH 2EDFA 3CH1B 3QUXB 1QVOB 1NH6A 1A7RL 3PWUA 3FRUB 1EZVX 4OUUA 1FZMB 4KZDH 4Q0XL 3KPMA 1MI5E 4Z0XA 3VU2A 3DHJA 1XCQB 1UJ3B 4CBPA 2Z8RA 5HHQB 2I5YH 2ZCKH 4P23B 3RU8H 4LAQH 1BLNA 4WUUB 2X4RA 5D7LD 3IT8D 4OGZA 3T0EB 3QNZB 4YFLI 3MA7B 1CFBA 2W0KA 3A6CH 4R8WL 3B4NA 3QHTC 1NFDA 5IIEA 4YDJA 3DX7A 2VL5A 3C5ZD 5F9AC 5CGYC 3W11D 4R4FL 5C9KA 1J0YA 3DMMC 6FABL 3D3VA 3DIFB 3ZHLA 4KK5C 1CL7L 4NQCD 4MNQB 5L8LB 2C3XA 1G7HA 1CG9B 1SVZA 4KMTL 2V9QA 3QG7L 3CFEA 4XNUL 5TDOB 1JZ5A 4XXDB 5BVJB 3PP3K 3T0VA 4ZAKC 2OL3B 3V95A 3U0PA 3K1KC 3L3GA 5JUEL 1C1EH 3KPPA 3PGCB 4N0CD 4APQC 4GG6A 2JIXB 1PAMA 3WIIL 4CMMA 3I9GL 2G2RB 4CU6A 2QSCH 3ZDXF 3MV9B 2HH0H 5DHYB 2XKSA 4FFZL 1XF3B 3BJ91 3BT2L 3EYVB 3RP1A 3CX5K 5GS0H 2W1NA 1OB1B 2RQ8A 2YMXL 3Q5TA 5D7KD 3QCVL 2DLFL 1S7VB 2GFBA 1AH1A 3B8YA 4X4ZA 4DAGH 1BM3L 3H9YA 4MQSB 1BZ7A 1GOGA 5IKCA 4CN1A 4TTDC 4KPHH 3HI5H 3RWJA 4Y5YC 1TQCC 1H3PH 1V7NH 3RHWF 3VW3H 2NXYD 4RFEB 2UY6A 3QISA 4I3GA 3S34L 2DQDL 4ONGH 1TQBC 1IGJB 2AI0H 3O81A 2VTFA 4LSRH 4MNGB 1H3XA 3AU1B 5D1QC 2AEPL 1FNSL 4P0DA 1U8LA 2X9XA 3WNPA 4LSVL 3HE6A 4XP4H 3FQUB 3DMMB 1VENA 4E41D 2IPTH 4FQJH 3TA3D 3EDJA 4X6FA 3O9WB 3BUYA 1P7KB 4URTB 4GKNA 2BRRH 3BIBX 2EDXA 3SKUD 4JY4B 4N9OB 3FT2A 3F5WB 4HMEA 5F7DA 2ZSVA 1KN4L 9CGTA 2N4IA 3I3BA 1DVFC 3LB6C 3MRKB 3BP7A 3LDBB 1J86A 3HNSH 4PJCE 1ZS8A 3BP5B 2VWEC 3ARTA 3FN0H 5IF0A 1A5FL 4Z7NE 2AQ1A 2H32B 5KANG 3CLEL 1EFQA 4HV8A 4PJ9B 3L5WA 5L6YH 4OKVA 4NKIH 4L8SC 2BVQA 5GXBB 2BVTA 1N6QL 4R97B 2YSSB 3F7QA 5EC1B 3CX5J 3R8BB 3FO0H 3TP4A 4OQTA 4OI8A 4LKXB 2BHZA 3IGAB 4M43L 5CZXD 3AFLA 4DUVA 3BGMB 3SJVA 4XP6H 2HN7B 4B53A 5DYOB 5HYQA 4Y5YB 2P8LB 2FGZA 3HUJA 5FYKL 4L9LC 4BFGA 1FIGL 4GJTB 4HWBH 2VITA 5DQJB 3L5XH 3NCFB 1AXTL 1LO5B 4G3YH 3NZHH 5D7LA 5TDNB 5D1QB 2OR7A 4NWTL 2WUBL 5IT2H 5SX4H 3MLZL 3MLSH 3MNWA 4P2QD 5A2KH 2FBJH 1Z9SA 3VFPB 1I8MA 1M4KA 5SWZE 5H94B 1SM3H 1OGTB 4WI9A 3MO1A 3V6BR 3C5ZA 3DJ9A 4PRPE 1KENH 1XMWA 4LVOC 4F7MB 2EECA 1FPTL 1NL0H 1JGDA 1D5ZB 3UTQA 2VDMH 4Y4HC 1TJIH 4OM0L 3MACL 3OAZK 4NQCA 1CIDA 1F6FB 4YHYC 1LNUB 1A6AB 5IFAH 4JRXB 3HCVA 4I0PB 4OD1H 1P9MA 4RZCB 2AJYH 1IQDA 1NBYB 1BEYH 4XH2A 2BY0A 5I1JH 2E7LA 3RZCA 1PBYA 3MRFB 5EOTB 1U3YA 2P8PA 5DR5L 1MFAL 4FP8L 5MENE 3DUSA 2VXSL 3L5HA 4YHPB 3GM0A 3KS0H 1PVHA 4OZGA 4L3EE 1BWWA 3EZ8A 3IFOB 1KOAA 2J8HA 5GSVB 3VRJA 2XN9A 4CJ1A 1R3JB 1XGRA 5C7XH 1Q9LB 4G9DB 4P9ML 4XI5C 1A0QL 1RMFL 5D6DC 4HUVA 5EIIB 2IH1A 2XWJA 4XNZC 3C2AH 4YBLC 4LFHG 1CXEA 4IBLT 1G9NH 3GM8A 2D7MA 2N56A 2OL3H 3ARFA 5D7JA 1A1OB 5E99H 4EKXA 4M6AA 5DHVA 3DI2B 4QEGA 4U6VH 1QSFD 1OTTC 1ORSA 4I18B 5ICZA 1J0ZA 5KVMC 1W72A 2XACC 1UACH 4K94C 2VZTA 3V52L 3PL6C 4LSTH 5IB2A 2CKNA 1MI5D 4YDJB 1PZ5B 2HT4D 3OAUH 4NFCA 4XVJH 3A6BH 1MHCB 1MFBL 1T2JA 3DSFH 3OL2A 3RPIB 4OFYA 4Y4HB 1WTLA 4WTWA 4E41A 4GRWF 4WHDA 5GS1B 1DN0B 4PS4L 2FD6H 3TA3A 4BYHA 4DEPC 3EDDA 4GKOA 5LGJA 3BD3A 4WW2F 2EC9U 5FA3B 3G5YA 3RTQB 4OIAA 2XZQH 1WBYA 1MJUH 4WFEE 4RISL 5CWSB 2YBRA 4KK9D 3C8HA 1DQLL 3CAFA 4MXWH 2OR9H 4D8PA 4P9HC 5ELIA 1IFHH 1F3JA 1B0GB 3CCHB 5T1KD 2R0KH 1DBML 1KEML 1KB5L 2UZXB 4K71C 3VXOA 1TENA 4X4XB 5DJZB 4OI9A 3SCMC 2IANB 4H88L 3UBXG 1N8ZA 3IJYB 4JCLA 1GZPB 3O41B 3ALXA 1IKNA 1AQDA 3K2UL 1QFUH 1CGVA 4OCYH 3WKMH 1LO0H 1TIUA 1BJ1J 3RIAF 1YN7A 3ESUF 1ORQB 5CBAA 1EHLL 2AJVH 3AM8A 3H7LA 2BOCB 3WIHA 2GT9B 5IW1A 35C8L 2APTA 4NQTA 1BFOB 3RWJB 2X4PB 2X40A 1BIHA 2H32H 3QIBC 2G9HB 2LTQC 5DHXB 1QRNE 5FO7A 2V7NA 3D0VA 3GI9L 4OZFA 4HFWB 5LXGH 1FGNH 1QBMH 2EDOA 4JFZL 3PL6B 2QHLA 4GQPH 1FP5A 3T1FA 4X7DC 2PUQT 3KJ4C 3MNVA 2UZYB 3I6GA 3K2MC 2DWDA 2ARJA 4P2QA 2F53A 2Z92A 4FXGA 3SE8H 1JFQL 3O4OB 4QRQB 4AJ0A 5GZOD 3U9PL 1Z9LA 4DEPB 4F2MA 4RA3A 3QPXH 4FZ8H 4MA3A 4DTGL 4ZFOL 4KKCC 5FCUH 5EZLB 1KN2H 3FT2B 5IV2A 1LP9F 4NJ9L 4L5FH 4RNRB 3VXQA 5MEOA 2ZSVB 3S98A 3O8XD 3MLYL 4FQQB 4CL7A 4TPRL 1UM4H 3VD3A 5CGTA 3DGGB 1X5ZA 3L3HA 4GRWB 4K71B 4MCZB 4R2GC 5BQ7A 3RWEB 5BRZB 2HAZA 4YPJA 4WW2B 5E4EB 4H20L 5I6XC 5CJQH 1UXWB 4W70A 4TVSa 4G8GB 4JFEE 4PP1C 5I1CL 1JGLL 2E7BA 4GW1B 3L3DA 5T5NG 3JWDC 4OCSL 4ONHA 4OLYL 2PNDA 4X6DA 4YR6B 1YN6B 5GGRA 1K3ZA 3SJVB 5HI5D 5A16A 3STLA 3WFCH 1CFSB 5D6CB 2W9EH 2AEIT 4KUCD 3MLPA 5HYJE 3RVWD 2LTQB 2GJ6B 4AL8L 4P57A 3S5LB 4QRUA 1QSFA 2VITB 3GSUB 1JUFB 3H2WA 4HIJB 4QO1A 1NCBH 3RX7A 4OM1H 5GRYA 3BH9A 3VMNA 3LZFL 2ENSA 4Y2OA 3KJ4B 4OD3H 4JPVL 4X6BB 5KANI 3FQNB 4IHOB 3CVHA 2NYYD 3WUWG 4P3DB 4MDJA 1JJUA 1MI5A 3LEXA 3HZMB 4LSSL 1IEHA 1QG3A 5J12B 1PFCA 3OX8B 3CXDH 3QCTL 1UVQA 5GGVH 5A3ID 3TBYA 2RHEA 4Z7VF 1A6VH 4FQ1H 5HHPA 2QSVA 3WDJA 2J8OA 1CFTA 4JM2D 4KROC 3GKWL 2OP4H 5C0CE 2D7PA 4MNGE 1MIMH 1BVZA 1WAAF 3WHE0 3RZCB 4BZ1L 5JDSB 3W81A 1B3JA 5E8NA 5IWLA 4F7TB 2QTEA 1JIBA 2XXCB 1X4XA 3FL7A 4NZUH 5SWZD 1FO0L 3TBSB 2UVFA 3M1BA 4OZGB 5T1KA 5A2IH 5AWNL 3HLAA 3B3IB 4PRPD 4JKWA 1LP9B 1EO8L 1IAMA 4M61B 5IVXF 1HEZB 3MLUL 1HZHL 3BKCH 4QHUA 2UYLB 2XN9B 3PABA 2F15A 2Z31D 5L0QC 1RZKC 2BHUA 2FH8A 2R56H 3H7BB 4RDQG 2XWJB 5DJ0B 1TPXB 2DYPD 1XR8B 3THML 5FFLA 2KQMA 5D7JB 5MEND 1WZ1L 5CEZH 2EEBA 4NPYB 4TVPL 2BMKB 5D1ZC 4GG8B 4L3ED 2XI9A 4XP9L 1NC2B 2IFFH 4IRJC 4XCFL 1I1YA 3PHOA 1RZ8A 3C2SA 3OGCB 4BUGA 3FO2A 4JDZA 1YA5A 4FQXA 4GW5A 4GXUN 5I66B 2J2ZA 3W9DB 2D9QB 2ICEA 43C9A 2D0FA 2YD8A 3V5HB 2AJZB 1HCFX 4EN3C 2X70B 2CUHA 5DRZA 4QHMA 3T0DA 1JTOA 3GO1L 3EOAA 1OP3K 5FB8B 1OAXH 3GSVB 1XGTB 4IMKC 3SPVB 1V8HA 1P7QB 4LSQH 3IDXH 5EZOH 3OXSA 4AZ8A 4POYA 3O8XA 2NTFA 3IJSA 1M71B 4N1EA 1LILA 4U1NA 3H3BC 5ESVB 2WAHA 4RX4D 1WIOA 4UOW0 4S1QL 1JI1A 4PGZA 3SY0B 5A1AA 4Z76A 3NIGE 4KZEH 4Z7VB 3HPLA 1A1MB 2PO6D 4JO1L 1N8ZB 4RAUB 1G9MH 3LQZB 5GPRA 1T04B 4D0DB 3EOTL 3QJHA 1DDHA 4U6TA 3GZKA 5TGBB 4XHJD 4NBXB 4WFED 1KJ2A 4NBYB 2IADA 4R4BB 3WXVL 4YFLF 4G7VH 2IBZX 4P9HH 1DQDL 4TULL 4PJCA 4ZFGL 4XBEH 5D1ZB 4N8CH 1ED3B 5IVXB 4GRWH 4HS6A 3DETD 5FO7B 3AMKA 4IRJB 4H25A 4UINL 3TIDB 1G6RA 1PKQB 4MJIE 3LEVL 4O51B 3TPUB 2P24B 3GMNA 5MEPB 3DUHA 4QWWD 4YFDB 3HKFA 7CGTA 3FB7A 1KCRH 1MCOH 1CQKA 4M6OH 4P46C 1OARH 5EUOF 2ID5A 1GGIH 3SN6N 3MNVB 1OWWA 3EFFA 1VGKB 2MHAB 4H1LA 1FC1A 2RBLA 3UBXI 3HMXL 1NDMB 4K8RD 3PXJA 4MA3B 3MCLL 4WW1B 4GAGH 4IOIB 3FB8A 4PY8I 4PRIE 2W0LA 2FR4B 1KELL 2C1OA 1QRND 1VEOA 1S3KH 5E8OA 2IFGA 4RIRA 5I1AA 4Y0GA 3VXQB 2IEPA 5E8DH 1NGXB 5H35A 2Q1EA 4RQQA 3AVEA 1IL1A 2HT2C 2V5YA 4Y5XC 1F5WA 5DD1H 5SWZA 4CADA 3PP4H 1FDLH 2PYEE 5DLMH 15C8H 4PRPA 1QFWI 5BZDA 2ATPA 2MMXA 4NO5A 5KVDH 1NGQH 4GBXB 1IQWL 5TE6H 2Z31A 1S8DA 3MLXL 3MGTA 3G6AB 5DDHA 4ONHB 2MCPH 3VWKC 3STLB 2DYPA 4E5XA 4ZUVA 3EIFA 5IB1A 2B1HH 5MENA 4UMGA 5FDWA 4RGNB 3QHFH 1Q9WA 4PJ7F 4R3SA 1OAQH 3MBEC 3UJTL 4L3EA 5ILTL 5IHLB 4S0TD 1JNLL 4ZNCD 4XWOD 4JFED 1FG9C 4KVCH 3EJJX 3X3GH 2JCCA 2WBJD 3JWDH 3CSYB 3SE9H 3WFZA 4YBQC 5IJKA 3L3IA 1ZWIA 1V3MA 1NAMA 3QFJB 1YNKH 3P4MB 1RHHA 1PDKA 2YZ8A 5KVGH 2OZ4L 2X41A 1S9XA 5KN5A