3SEBA

Staphylococcal enterotoxin b
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
238
structure length
238
Chain Sequence
b'ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 73
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sebA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sebA02
1FGBD 3OWEB 3R2TA 3EFXD 4K6LA 1D5XC 1ET6A 1CHQD 3O13A 2QEJC 4DXFA 4RH6A 1SJHD 1RCVD 1CQVA 1KLGD 3DWPA 5FK9C 1S5DD 1LTBD 1LTSD 2SEBD 1SJED 4RCOA 2RDHA 1B1ZA 5ELEA 1YN5A 2G9HD 1I4RA 1XTCD 2XN9C 1PTOC 1YN4A 1PTOH 1G8ZD 1LTRD 2AQ2B 5I4DA 1SXTA 3V05A 4RFBA 1QILA 1TS3A 1TS2A 1ET9A 1BCPC 1L0YB 3MFGA 2NTSA 1BCPB 3R8BA 1TS4A 4BWGB 1HXYD 1RD9D 1FNWA 2ICIA 2QILA 3TSSA 1MD2D 4Z9CB 1PZID 4RGTA 1FNUA 1I4PA 1I4HA 3R2IA 4ZYSA 1JWUD 1PZJD 1LT4D 1UUPA 1V1PA 4C56C 1PRTC 1PYWD 1LTID 1PRTB 2TSSA 1JWSD 1M4VA 3BZDB 5ELFA 1FD7D 2O2LD 3GP7A 3EA6A 5ELCA 3URYA 1S5ED 1EU4A 1CK1A 4RGOS 1EFID 1T5XD 1XXGA 1EEID 3BVZA 1RF2D 2J4XA 4RGMA 1RDPD 2IJ0A 5D3IB 1PTOD 1UNSA 3SEBA 2AQ3B 1JWMD 1F77A 1LTAD 3MC0B 2AQ1B 3BVMA 3KLSX 1BCPD 1EWCA 1SE3A 2R61A 1TY2A 2RDGA 4RGNA 4NZLB 4O1NA 1LT3D 2Z8LA 1L0XB 1LTTD 2CHBD 3BVGA 1YN3A 1FNVA 2WV6D 1D5ZC 2IPKD 3W2DA 1LTGD 2NTTA 1CHPD 1EU3A 1I4QA 1PTOF 1I4GA 1SEBD 1KLUD 1B44D 3CHBD 5FKAC 1ESFA 1JQYD 1CT1D 2XRSD 4RHSA 4RHRA 4TSSA 1HA5A 1S5BD 5D3DA 1HQRD 1BCPF 3DWQA 5TSSA 4DXGA 3BYYB 1BXTA 1DJRD 1S5FD 1D6EC 2XNAC 3BYTB 4OHJA 4L6TB 1V1PB 1HTLD 1STEA 5ELDA 1SBBB 1JR0D 1PRTF 1LLRD 1TS5A 1S5CD 1LT6D 1D5MC 1DYQA 1EEFD 1AW7A 1TY0A 1ENFA 1JCKB 1KTKA 1PRTD 5ELBA 4L63B 1PTOB 1AN8A 4UDUC 2XRQD 1I4XA 3DWAA 1SE4A 1LT5D 1SE2A 1PZKD 1GOZA 1LO5D 1V1OA
chains in the Genus database with same CATH superfamily
1XNQQ 4XE0A 2JXXA 4MACA 3Q23A 4FF4A 2GBMA 1ET6A 2K01A 3KBGA 3AB5A 4HEA1 2WKCA 5AZFA 1LUZA 4DAVA 5C4JH 2O5IC 4WJ3M 3C19A 1KLGD 2K05A 3DWPA 2LI5A 3FKIB 3S15B 1V8CA 1K50A 2KJXA 1V2YA 2WHIA 4JV5Q 2C9OA 2LVOA 3TEZA 4B08A 4LF6Q 1YN4A 3UIPB 4JQWC 4EZJA 1FYCA 3TEWA 2PMZB 2A5UA 4C7ZA 4K6DA 4A3EH 5KHQA 2GB1A 1BCPC 3MEHA 1SMYD 5BN3A 3G71A 1Q7YC 3NS1A 4OVVA 2JA7H 1HXYD 2AL6A 5J39A 4CO7A 1XMQQ 3NENA 3PGEA 4DV1L 3QCAA 1TVXA 4K0KL 3DVNU 3KLRA 2A68C 4II3B 3U52E 3CU7A 4GOPB 1GHKA 5BYSA 3PGZA 2ZNVB 1W6KA 4M8MA 1WMHA 1SYFA 1S4ZA 5EPKA 2MHVA 1NENB 3A55A 4A90A 4WORA 3PTFC 3IHPC 2ZW1A 2RBMA 4GN1A 3URYA 3RZDH 4DV4L 2OOBB 3Q3FA 4BBNC 3D8GA 3BDLA 2KKCA 1PH2A 1HE8A 2WIIB 3HOUB 2PZWA 3VA5A 4C80A 1YBYA 2PVGC 3Q24A 4B6WA 3SEBA 3OHXC 3PLUA 2V3PA 4A3DG 2BDOA 1TKGA 2D3BA 2B63B 4ICVA 4WWPA 5JHAA 4FNFA 1A6XA 2DX5B 4TMAB 3J80c 3K5MA 1CKNB 1WE6A 4ARCA 4DK0A 5IP7H 1LTTD 5CC4A 3VR6A 1L0VB 4KV6A 4P7IA 1SYGA 2IX0A 2PVOD 5DPWA 1PH5A 3ULJA 4OO1H 1HQMC 1LTGD 1E8ZA 3CXCA 2JX5A 3OMCA 1NY4A 3TDQA 4QCLA 2B2TA 4AJYB 3IL8A 3ZTCA 1BR9A 4K2LA 4HTHA 4QF4A 2VY3A 1B44D 2XIWA 4QY7A 5M3MB 2WDRB 2LS01 3BG3A 3VDYA 3JC66 2RA4A 4DXGA 1D2BA 1BCPF 1Z5SB 4QL5A 2K39A 2RGFA 4GN3B 1I6HH 2K5HA 4BKSA 2AKWB 5DLQE 2E2JB 2Y0SB 4PMCA 2PJHA 1R9TB 4UPAA 2F3IA 4A3MB 2DY7A 4I6LB 3A9JB 4XGAB 3J81E 2N88A 4HMJA 4E6IA 4CDFC 4LF5L 1K8RB 2W3SA 3RNFC 3CCUA 4ZHOA 2KHWB 3U4EG 2IZVB 4A76A 1SF0A 4NPSA 4HKZE 3HHMA 4EZKA 1PH3A 4X57B 1LT6D 1NBWA 5GAEC 4JI6L 2F4VL 1K8OA 3DHHC 3KYCD 5E6OA 4GLVB 2FUG1 4WURA 3WAOA 4F1SA 5C4XG 2CU1A 4AS1A 1OQYA 1EOTA 3R7RA 4DR4L 1EY0A 2BA1A 4BBNF 5ELBA 2B2UC 3PUXA 2IYDB 2NPTB 5CX3A 3S14B 1D8LA 1KDCA 2KHJA 2N3SA 3NUCA 4PG3A 4B3SQ 1C78A 4OWWB 2WB1E 1PGXA 1FXAA 1K3BC 5KNBA 3QG1A 3J80i 3EFXD 5M3FG 1V1QA 2FAZA 3RI7C 4DAYB 2ZT9C 2B3AA 5T1IA 2JA6B 3ER0A 3QWZB 2DY8A 4HRSA 2B3GA 5I6YA 2JZPA 2MUYA 3S1MH 4NJCA 4K2KA 3X23A 4HCSA 2CFMA 2KT7A 2CWAA 4JOIC 5FJ8H 1UWMA 1MPEA 4KVGB 4DFAA 4DPGA 1J5EQ 1CJEA 2KTRA 1L2FA 3DVGY 1B1ZA 4DWFA 3PV1A 5AEKB 1S40A 2K22A 2EVBA 3SXHA 4MJSB 2DZKA 1QILA 2L4NA 5C3XA 4F7XA 3A1QB 3H8HA 3I3TB 5EPLA 1ZEQX 1ZXIA 4C7YA 1B9NA 5HY6A 2ZPNA 1VF5C 4RA8A 1TWAH 4GKKL 4JBKA 1GC7A 3A4SC 3E6ZX 2JVCA 1N32L 4PMBA 3A9KB 2CW0C 1T0YA 2MPMA 2KTFA 1Y14B 1TIFA 2LVQA 4HPPA 5EAYA 2MBHA 3K7AB 3AU5A 3CPWA 4JE3B 4FJVB 4YSXB 4NDXA 4P73A 4C3JH 1WX8A 3AU4A 1BUIC 3S16B 1AP0A 4LAAA 4GNXA 2M0XA 4Q0FA 3BVZA 2N55A 2HJ1A 2QMTA 1GUWA 2RQXA 4IPHA 2LFNA 1OXSC 3IBEA 4XIGS 2LVPA 3W1GA 1JWMD 1YNJC 1C9OA 2WINB 5FR3A 1QZGA 2VZKD 1LM0A 3FKYA 5DM73 4KHPL 2UXDL 1SE3A 1EY5A 3OAWA 3I91A 3ND9A 3J81c 3TZDA 2BT6A 3UE0A 2INCC 3CMEA 3CC7A 2MH7A 3VH4B 2DUDA 4XYCA 2RVLA 3E0EA 3CAMA 2BS3B 3N52A 5FLMG 1IYJB 1CUKA 2Z6KA 1B3QA 4ILWA 4IUQA 4BA1I 1PH8A 1I4GA 1WJ4A 1XLNA 2Z0SA 3QA8A 1BKBA 4QGUA 1VQKA 5GMVA 3Q3MC 2OTLA 1K83B 4DU9A 3U30A 1HQRD 1Y1WH 1C9FA 4AH6A 1XLOA 4MGYE 1GHJA 1VZ8A 3TBIB 4LF9L 3AECB 2B63H 5JVG3 3RMHA 4K5XA 4A3IH 4EQPA 3TEXA 2WU2B 3UDXA 2LGDA 4JI1Q 1CA6A 3EQLC 5J22A 2W55A 1MSHA 4WJWA 5C0XJ 2DLBA 3C1FA 4CDDC 3BU2A 4GXBA 4RNAA 4IUPA 3SVMA 2CVRA 2C7NB 2N9EB 3MA2B 1F52A 1YD8U 1EZ6A 1TY0A 3GTJH 2I1JA 4GOPA 2R6GA 4PS8A 2MHJA 2KWVB 3QR8A 3AN1A 4L63B 2BOSA 5EKLA 2KJHB 3LXFA 1XD3B 2WXLA 4JWUC 4WJQA 1WZ0A 1LGRA 2EE1A 3Q8AA 1SIJA 3DWAA 2LGXA 2KWCA 4A3JH 1NYQA 2WXKA 3V6EB 1GOZA 4X3UA 3W1SA 2LHEA 4XDDA 1WOCA 3H94A 2C9WB 2QEXA 1IZ6A 3J81i 1VJKA 2IHEA 3QO2A 2VNUD 5IODA 2UXBL 4RMAA 4YWLA 3I4NG 2VW9A 2RD0A 1PH9A 2D9UA 1TTNA 1A3UA 1CQVA 4L1BA 2ZXPA 4GNXC 4A3BB 4IM2A 5FK9C 1CKNA 4FYDA 1H4RA 3VDZA 3T3NA 1F2LA 1FPYA 2E2HH 3QAQA 1WCMG 3JAML 3KOJA 4BOSC 4C3IH 2LGYA 3WIMA 3UF8A 3QARA 4FXDA 1C8CA 2QKIC 1TS2A 3IVFA 5HURA 3ENEA 1Z9FA 1TS4A 4N9PA 1PH4A 2E75C 1HUNA 4NXNL 1S72A 3TSSA 4C1NI 4P1BC 2JA6H 2IL8A 2CQAA 3PUYA 4HDOA 2A74C 4E71A 3JAME 1KDBA 1RTOA 1QZEA 3M7NA 1NMFA 1N61A 4B9KA 2EYOA 3BZCA 1OXXK 4G7HC 2Z6KC 2K7VA 3HOVH 3A9JA 1VQLA 2K04A 2K6AA 4KJNA 2MO0A 3M9BA 4X64L 5K36H 1Y8RC 4JBJA 2JK8A 2N9LA 2A69C 2SDFA 4RM8A 5JJZA 5IYCG 2QHOA 1OTCA 1LTLA 2HE7A 1QNUA 5ELCA 3ZJTA 5IN7A 5AUIA 4RKBA 1N62A 3S17H 2LMCA 3NELA 2EIFA 4DV1Q 4A3DH 4PQXA 4K0KQ 1T0SC 2KFKB 2WXFA 1KRTA 2NPTA 3HKZG 4RF0A 3UGBB 1CMXB 1VQPA 3M95A 1E0ZA 1S1QB 2CKZB 3IAM1 2FMCA 4OWXB 4KKIA 4H7BA 2I5MX 2F1MA 1TY2A 1XYIA 5DPRA 4KD4A 2IT1A 1H95A 1JT8A 1HJPA 4DAYA 5JJKA 3K57A 1BUVT 1NVID 5LL6X 3B08A 1CZGA 2K1BA 3IFTA 1EY9A 4DV4Q 2OQKA 4TVAB 2QDFA 4ICUA 3Q22A 3R93A 4BBRH 2H89B 4WIPA 1R4NB 3NE5B 5J3BA 3A7LA 2JXMB 3WDNA 1OGWA 3HOYH 2IGDA 5ELNA 4BS9A 5DEHA 1VLBA 5AZGA 1SMXA 1V49A 2BB5A 4BXXH 1XEEA 3PSEB 4NQLB 1S5FD 4DAPA 1HTPA 3ZNZB 4ZRKA 4LF4L 1F1HA 3T16A 4DAMA 2E6XA 3ZXVA 4ANXA 5JEAJ 4MJSA 4C2MH 2F0QA 3A1QA 1L4DB 4KV2A 4P74A 2WXMA 5G5GA 4P71A 4LJPB 3PRZA 4AP4C 2BWFA 2JZ3B 1YIJA 4KKTA 3UDIA 1LM8B 2QJLA 1GUGA 1ESRA 3NTKA 1DGJA 3K0XA 1XNRL 5CMDA 5JEAG 1VMCA 1IL2A 4DV5L 4HIDA 3AQQA 4JI3L 3PO3B 3R7QA 2Y5BB 5M3FH 4LF5Q 3BVMA 3NHEB 1V1OA 4JI5L 1Y1VB 2RF4A 1A2TA 5CV8A 4IC7B 3NXWA 4DF7A 5HFYA 2JRIB 3MC9A 2WU5B 3FRPB 3FDTA 3X3NA 2HIVA 2RR9A 3NSWA 2RMMA 4A4IA 2XBBC 1K8AC 1A63A 2D11A 4JI6Q 2F4VQ 2WGSA 1YX5B 5BN5A 3A8IE 5I2XA 3LGJA 1SJHD 2OEOA 2IO3B 2LEKA 2K5VA 1RCVD 3QQ8B 4DR4Q 1E7ZA 3DUZA 3IFDA 4URKA 4HPLB 4YL8A 4ZHPA 2SEBD 1D4BA 3PRPB 4YCUA 2PI2A 4A3LG 2O5JC 3VYRA 1P7FA 2ENBA 4PZ7A 1VF7A 1GG3A 1NE3A 1P16A 3QB3A 2G5DA 4N9F4 4CYEA 1BCPB 3V3XA 3CCQA 3Q8CA 2QILA 3DDCB 1UGJA 3T8MA 3GTLH 4DHZB 2WP8J 1YQBA 4JIOU 1CKOA 1GNUA 1QQRA 4XQQA 3AEGB 3L16A 1R4NI 1E2WA 4ZDVA 1XMOL 1I5FA 3LYYA 3CP0A 1IBML 1A2UA 3MXNB 2AMCB 3OJ4B 2K5QA 1WYDA 1V86A 2VUMH 3TS0A 2G45B 2DJFC 2WDVB 5IO9A 1V9PA 4US9A 1IYUA 1ZE3D 4X3KA 3CF5A 1YQ4B 1F9QA 5AFWA 3GTPH 2BQQA 4GKKQ 3DOWA 4PZ8A 4AWJA 1FVIA 4IOCA 1KC8C 2JSOA 2HT1A 1JC7A 1VQHA 1N32Q 2ZW0A 3JSVA 4A8XC 2IY0B 2A6ED 2RSNA 1OXVA 2MBQA 2YVCA 1QNKA 1EIFA 2KCCA 4G0NB 1GPXA 2DAFA 3MHSD 2KDFB 2RDGA 4QMGA 1E8YA 1VDZA 2DJGC 1RIPA 4OELB 2R93B 4JLCA 2DN8A 2YV5A 1Z2MA 1E0BA 3I7FA 1HA6A 2NVXH 3HOZG 3I4MB 1E5WA 2FCNA 4ZRIA 1SNDA 2D5DA 2IPKD 2KQ3A 2DZMA 4WWMA 3ONAB 4IOIE 5GAGC 1STYA 1OXTA 3ERQA 4KLKA 3RZOH 1HHVA 4MELA 4BAXA 3LWUA 2INNE 5C23A 1N8RC 3FMCA 3I90A 5DM63 4IUUA 1XPOA 1KD1C 2J7QB 1KIXA 1D6EC 1FL0A 4KHPQ 2UXDQ 1MBYA 1QOBA 2LRUA 4I6PA 2AWOA 4K1RB 2EXDA 2RHQB 2NVYB 1G51A 4A93G 4GU2A 1WFYA 4IJHA 3KUPA 2H4OA 3VUXA 2F0FA 3A33B 1SBBB 3U9SA 3AEAB 2M2LA 1YNND 2HDEA 2QW7A 3NP8A 3VR5A 4H44C 5CBEE 2W9NA 4EUTA 2MSED 1B2TA 2CS4A 1Q1BA 2BE5D 5EJWA 4NB3A 1Q81C 1WX9A 3G7LA 4ME3A 1B8AA 5BN4A 4CHTB 4PS7A 5E6PA 1NI2A 2M4NA 2WAQB 2L00B 3RUZA 2BWES 1SB3C 2LXJA 2VS1A 2WXQA 1F9SA 2E2IH 5IY0A 4YHHL 1YQ3B 4MIUA 4F7ZA 4LF9Q 1NR4A 2BF8B 1LO5D 3VUYA 1SIFA 4ID6A 1L6VA 3OWEB 5J17A 3HKSA 1JWAD 2JY6A 3BJUA 2KCMA 4BOZB 3RLOA 1FO4A 2GBNA 4A3GB 3I4NH 1OQQA 1CHQD 4FXGC 2XK5B 4TV3A 3I8ZA 2UU7A 1VMPA 2LKVA 2KFKA 4CJ1B 5C4JB 3EFUA 1EYAA 1J19A 5IYBH 1BF4A 3E9IA 2Q2TA 1Y56A 2MJDA 2R7DA 1U4MA 2MRPA 5HHDG 1LTBD 4KN7C 2MQJA 5NUCA 4ZUIA 1WCMH 2PKOA 5C3WA 1K51A 4A3KG 3RYTA 2EYPA 2F0WA 4CDEC 3Q6BA 4PK1A 3OMGA 4A3EB 2PYKA 2WQYB 4ZK9B 4LFAL 2MLBA 5E6NA 2PIAA 2UXBQ 4ZQ3A 2JA7B 4G7OC 2WX0A 1PZID 4HIOA 2LWPA 2MQHA 1I4HA 4R4QA 1Q5WB 1JWUD 1YNTE 1ZUD2 4FULA 3WALA 2WB1B 3P63A 5FOBB 4B0EA 2KNBA 1J7BA 4N58A 4DDID 4IWOA 3OSOA 4YSYB 1B9MA 1EY8A 4QQBX 2L05A 2PQEA 2L9HA 1G291 1JQ4A 4HJ9A 4FJYA 2Z9HA 4EOYA 2JJQA 5E3FA 3RZDB 2OJRA 4BKSD 3AEDB 4NXNQ 3GZNB 2RPVA 4K7SA 3CCVA 2XSCA 5IGEA 2GBKA 3M3JA 3CPFA 4C4VB 2DYBA 3UINB 2LHDA 1WJUA 3CIRB 4WWOA 1EWIA 2L5TA 4X64Q 1WYGA 2RDBC 3BDOA 3MEFA 3GTOH 4EFOA 5C5MA 2JA8G 3PRMB 5D7GA 4FHKA 4M1UB 1UWXA 1JICA 1NSNS 2F0OA 1YIWA 1X1MA 4MGZE 5L83A 3HOXG 1WZ3A 1I4QA 3OIQA 1WTQA 1WM2A 1DOMA 2JQRB 4ITKA 4GN4B 4TSSA 4IWQA 4OIJA 1F2RI 3VH3B 2PW7A 2ACZB 2FCSA 2NR2A 3U50C 2ZVNA 2WXNA 4N8X1 1TYGB 1I6HB 4EE2A 5CV4A 4MTNA 1ILPA 1NYRA 4EQ5A 1O7ZA 1VQOA 3NBHA 4WJPA 2G1EA 5JJLA 2MWSB 3WOEA 4GZYC 1I42A 1X3EA 2R93H 2BKRB 2MCNB 1B3AA 1RM6C 3I4MH 2C5CA 3KUZA 4HJ7A 4PYUA 3D4WA 3DEPA 2LGSA 3ZXRA 3T9LA 5JEAH 3ZJUA 1SLJA 1GAQB 1BVSA 4X3TA 3M3YH 1H9RA 1SR3A 3MXNA 1M1KC 2HTHA 4A3CH 3IRBA 3WWVA 4LF4Q 4K3BA 3CMMB 2FXQA 2M17A 1SE4A 5IOIA 5BO4B 1GB1A 1N60A 1Q3LA 3K7UC 1DXMA 2C7HA 3V61A 4K6LA 3PT2B 4UP7A 2KWUB 2NVYH 2BBCA 3ZNID 1V5OA 4G3XB 1X3GA 4WRDA 2V9HA 4RH6A 1DGSA 3TN2A 1QKZA 3HK0A 1Q90A 1J7AA 3S1MB 1TWFH 4PYZA 1KLVA 2L32A 1XNRQ 2B39A 5I9OA 4A3LH 3HKZE 2R2OA 4KHVA 2Q8IB 1JMCA 3RNBC 4DV5Q 2PLPA 1Z6HA 1K73C 4JI3Q 2KJRA 4WFN3 4MM3A 4N9TA 3J7YW 3F8TA 3TMPB 4APVA 2NVTH 5ISRA 4DHZE 1VQMA 1EWHA 5ELOA 1G8ZD 4JI5Q 1TT5B 4ACFA 3S1QB 4ZRJA 4X65L 4J15A 1L4ZB 2QDBA 2PMVA 1ET9A 5JJIA 4QJFA 2YTYA 3HOUG 3BIID 1KRSA 1ENCA 3NWSA 1S3SG 4OO1I 2J0KA 2VH1A 1TWAB 3PIOA 1CA5A 4G11A 4A3GH 3ZUNA 3ETRA 2X6GA 1WGYA 2HIXA 5CGKA 2F03A 1LT4D 2DAJA 1IP9A 4IJLA 4ABNA 1KM7A 5D2MB 3S2DB 1OFFA 2K6QA 5C44H 1UD7A 2CHWA 3DVNV 1PQSA 5FO9B 3K6OA 2A4ZA 3HRDD 1SAPA 4C3JB 5C3EB 2K8BA 3B6YA 1K0SA 1GXDC 1XXGA 1OEYA 3KYHC 4IUMB 3I4OA 4JC0A 1IUEA 1UE6A 2P5ZX 5H1SE 1EWYC 2I46A 3KUCB 4R3DA 2EYFA 4DR6L 2Y0SG 2LGIA 4K3CA 4HDQA 1B50A 1XMOQ 2B2UA 1IBMQ 1I3QH 3K5NA 3AXCA 2GVAA 4OX9L 2BDNA 2UXCL 1LT3D 2F0DA 2XWBB 3A5UA 1TWCH 3HOZH 2CKHB 2KD0A 2FIDA 2L0TA 2XK5A 3HM3A 4G50A 3OW2A 2MGSA 5EKIA 1VQJA 1RHPA 3CCSA 1FCCC 1G6ZA 4FHJA 2EYJA 5LL6S 4CKEA 2NMQA 4AYBG 4YTNB 4IFDJ 3QOLA 5JAVA 4ASWC 3D4RA 3I4LA 2KQSA 4JOIA 5GXGB 4RHSA 3N20C 4KZ0A 2NVUI 1HZCA 1OTRB 1UELA 3AYHB 1Y1WB 3NVWA 1WX7A 1PFBA 3VR4A 3EFCA 2PZTA 3CRLC 4A93H 5HG2A 2I2YA 4LUOA 3I57A 1RFKA 3FILB 4A3IB 1YJ9A 2ES2A 3SHLA 1VCIA 4IFDG 1TWHB 2WAQE 4G57A 4IUTA 1ML0D 1O7LA 2B2YC 1WTXA 2W82A 3H7PB 1XTDA 2WDQB 4NAWA 3GTJB 2WNMA 2N4FA 4X62L 3MP9A 1V80A 1PRTD 3J81L 2KQ7A 4JK1C 2WXOA 5HKHA 2Q8RE 4NW2A 3CSFA 2LSSA 5EE9A 1WRDB 4JI8L 1WXSA 3EVQA 4L2YA 4ODGA 4ANVA 1S3OA 1ZYRC 2A5HA 2KDBA 2KC1A 1MJDA 1LV9A 4A3JB 1YI2A 2V0GA 1YEZA 1BDOA 2G3QB 2X8XX 4A3PA 3BZKA 1F9JA 1XQQA 1SRUA 3S1RH 2CWPA 3M4YA 1VZ7A 4HSVA 4BY7G 3RFZB 4KY6A 3KW5B 1FR3A 5IYDG 3Q8DA 1C4AA 3K9OB 1UE1A 2WXJA 4I7AA 1TQOA 3APDA 2FJ2A 4RCOA 4A3KH 2KX3A 2W54A 1IBXA 4W9JA 2RDHA 1GB4A 4YHHQ 1VQIA 2WACA 4JI0L 2ONQA 3E5SA 2VZAA 2E2HB 4C3IB 4P6VF 2KHIA 1YITA 1XCQL 1AFPA 3ZJYC 2BS2B 3C46A 5J1ZA 3L3OC 4BBSG 3CWIA 2IGGA 2X38A 1DD2A 1F2RC 4W9DA 3H0GG 2ZTDA 1X55A 1ROEA 2R7ZH 3HOVB 3DBHB 3Q2AC 4LTUA 5KRUA 4BKTA 1ONLA 1XCTL 4QB4A 2O2VB 4OGQC 2EY6A 2R7FA 5ELFA 5HGTA 1BMLC 1JALA 1MJEA 3RN2A 3K80C 1J7CA 1BBUA 2WWZA 1IW7C 4LFAQ 1YJIA 1W3SA 2K3UA 3BINA 1EY4A 4PT5A 3ZJVA 3S17B 2J4XA 4EGVA 3S1QH 1ZW7A 2Q5WD 3NVYA 1VQ7A 4F8CB 3Q3NC 4A3DB 1PTOD 1E8WA 2O4XA 3NVVA 3NUHB 2N7DA 5T8IA 3RZFA 3B0AA 3NY5A 4HJKA 3IG3A 1R4QB 4TQ1A 1HEZE 3ZRFA 5M9OA 3E9HA 4DKAC 1EYGA 2L0FA 4UP9A 1C7YA 4LWCA 1NEKB 2JA8H 1HUMA 3AE9B 2K8HA 5H8YE 2Z4IA 4BA2I 2KAJA 1D5ZC 3TEHB 4U673 2Q2IA 2PNRC 3S2DH 1UF0A 2KQ4X 3L10B 3VTWA 2G4SA 2HQLA 3VVWB 4ZCKA 2EZVA 3DBRB 3HUIA 3KH0A 4BBRB 1KLUD 5C3EH 2SNSA 3NOBA 4HJGE 4LDTD 1CT1D 3HOYB 4OZBA 3TP6A 3AE3B 3AEVA 3NWTA 3KQ4A 4TKNA 2K75A 5CV6A 3RCZA 1CSPA 3M4QA 1FFVA 5CHWA 1BO0A 1KAWA 3M7GA 3EUB2 5C1ZA 5BMIA 3Q8BA 2DNEA 2OQ0A 5IGCA 2LUMA 4C2MB 2KX0A 4YTMB 3MJWA 2NWGA 5IT9c 1Q1OA 4XTCS 1WVLA 2MBBB 3ONSA 3SE0A 4DBGA 2WXIA 3ZVVA 1LXDA 3HVDA 1LLRD 1JMLA 1G2SA 1PH6A 1CI3M 2K5WA 1SNMA 5C4XB 3S2AA 1D5MC 1TXYA 4A3BG 2ZVOA 3IAS1 1EEFD 4KHZA 4A3FG 1ENFA 3LDZE 3PZDA 4R4TA 4Y7NH 1KTKA 4DK1A 5JVH3 1TGZB 4DV0L 2Z4HA 3P4QB 1X9NA 3HGBA 4RG1A 2JEAI 1WGRA 3HG9A 2ZXOA 3L0WB 2L1AA 2OTJA 1UBQA 2VZKB 3KK7A 5M3FB 3IT6B 5ELEA 3DBHI 1U0LA 4GDLB 4JGHB 1B9RA 3ZYYX 4NQKE 2KYWA 3NPPA 2D2CC 5DPSA 4J8QA 4K81A 1GKHA 4LF8L 3T51B 2Z6BA 2BH2A 3AE2B 1JJ2A 2IO2B 3CCMA 5K5PA 3GQBA 2L83A 4HEDA 2N8NA 3DHIC 1TWHH 3LB8C 4ZKCB 1F9PA 1EFWA 2Q8TA 1X6OA 3MWYW 4JPBW 1YMHE 4S0RA 4BVUC 1HCZA 4LUVA 2Y5CA 2ALYB 4XT3B 4BY1G 2SAKA 2R92G 3VHTC 3UQAA 3QIJA 1T6BX 4LLGM 3ML8A 1LABA 4LJZC 1WD1A 1AYFA 4KY5A 4AJWA 1NR2A 5CYUA 2K32A 5IIFA 1NI3A 3EROA 4WJOA 2F0NA 1GD7A 3R8BA 3HOWG 1RD9D 2KVMA 5G3LF 5C0XG 2A6HD 2EMSA 1OO9B 3GTLB 3KWVA 4USAA 1FRDA 5M5WH 1I4PA 4XYOA 5G2NA 3DBRI 5D6JB 3R2IA 3L2PA 3IXSA 2N9KA 3CQZB 4MGKE 1XPRA 4KGRA 1ZOYB 3R3OA 3FILA 3PIO3 1JWSD 3C2PA 2VUMB 3OIPA 3DM1A 1WTVA 2D10A 4XX5A 1PFNA 4X65Q 2K1FA 3GP7A 3VR2A 3TJPA 1V5TA 4RGOS 1EIGA 2WXRA 2OT2A 3GTPB 4S17A 1GUSA 3G48A 4NXML 2KACA 2WFWA 1H9SB 2DGYA 1TJEA 3ABVB 2VQFL 3JW0X 2C60A 2HCCA 4O0AA 2HUGA 2GRIA 1GC6A 2KUMA 5E4WC 1SFOH 4HLEA 1U5KA 1GUOA 1B53A 4NPNA 3Q14C 2KA7A 1WI0A 3MXUA 2ZJRA 1X3PA 3PUWA 4C3HG 4ZLTF 2F0MA 1FNVA 5EBCA 1O7YA 2NN6G 2NVXB 3AEEB 1JE4A 4KKJA 3BS1A 3EC8A 3QJYA 1VQAA 1V9JA 1Q10A 1PYSB 3FHWA 3RZOB 2LXAA 1JQYD 3U4VA 3A8KE 4DR6Q 5DCNA 3OWFA 4A6QA 1S5BD 3GTGH 3QOJA 5CHFA 1NNXA 2Q2UA 3PO3G 2KLGA 4J3OD 4J6IA 1GVPA 3HRZC 1DOLA 3FEWX 5FO7B 4CDCC 4OX9Q 3OG5A 1RKNA 3SFEB 3BYTB 4ZUJA 3PUVA 1G91A 1HZBA 4OHJA 1EF5A 2UXCQ 1V1PB 2PZUA 2AYOB 4E74A 3KFUA 2GBRA 2K33A 4IFDH 2AWNA 3DHQA 4P75A 2JYOA 2F0VA 4HAEA 1L1OB 1JJGA 3MC8A 3Q6SA 4DV7L 3P4PB 3KLSA 1Q46A 4MZ9A 3B2GA 1QCBD 2LFIA 3NZUA 3PO0A 3X0WA 4JVZA 1M90C 5LMNW 1N9WA 1OXUA 2F0TA 2QSDA 4LF7L 1XX8A 4KSLC 3Q8FA 1VRAB 3SK4A 2AX5A 4IALA 1SMYC 2QF7A 3CKIB 4M8AA 1BBWA 4B3RL 2EJMA 2E2IB 1EIHA 2N0SB 3TQYA 2QIEB 1FGUA 4RFBA 5D3DA 1FGBD 2HD3A 1JORA 1IXRA 1AWDA 1NTGA 1TT2A 4RM9A 3TUOA 2BB6A 3NZSA 2CH4W 1H9KA 1L7YA 4BY7H 2A19A 3GE3C 3I4NB 4OZCA 5IYDH 5FO8B 1BOSA 3ZRCA 1XLPA 3D31A 1T3QA 2R2QA 2HDLA 2MA9B 4XDXA 4ZOHC 1TWGH 1N34L 4X62Q 5GAHC 2BTEA 4KKUA 3CC4A 1IHZA 4KJOA 5C4XH 1NAPA 4J6HA 4CJ0B 3J7AF 2JYEA 4JI8Q 3A9KA 3WCQA 4ANUA 4FBJB 3L17A 1WCMB 2L7RA 3VFKA 5IP9G 2XN9C 1AZPA 3NK9A 1WWTA 5C3JB 2FBWB 3PSIA 3AMZA 3HM6X 3KF8B 1IYVA 1ASYA 2L11A 1UEBA 2KDIA 4BBSH 1QVGA 4ZAIA 4MN3A 3S9WA 2YEPB 5BMGA 4C00A 1PUTA 3H0GH 4RGTA 4M00A 1MG4A 4ZYSA 4AQYL 2EY5A 3L4PA 1PRTC 1VQNA 2L76A 1RAXA 1GJXA 2LZ6A 4JI0Q 1M4VA 1ZKHA 2REXA 1PFMA 4TRDA 1MSGA 3PQIA 5LXIB 3A7AB 1JRUA 3N1ZC 5IKCM 2CCZA 3V60A 4L5TA 1EU4A 1CK1A 1EFID 2IY1B 3L0OA 4FXCA 4GDKB 1Q12A 3GTQH 2PE6B 1OEYJ 2B29A 2ZTCA 2KK8A 1DOYA 2XGTA 3HKZB 5D3IB 3AEBB 1I94L 2UUBL 2MJEA 5TR5A 3U8ZA 1MHXA 3OLMD 4GLSC 3VTUA 1BCPD 1LACA 4M8NA 1CFMA 1C4PA 3I56A 3CQZH 2N7JA 3D32A 3GTOB 4JI2L 4DQOC 1HPCA 2IWHA 3RT3B 3AE5B 5EE3A 3ITPA 2H1EA 4L5QA 4HK2A 4KK7A 2A68D 3MHBA 2JYTA 1ZPSA 1V43A 3GO5A 4IPGA 2C35B 3TZUA 3OW7A 4DV6L 1TZOA 3RNCC 4LNFA 2C5LC 4JI7L 3N1XC 1HA5A 4YSZB 3NZ3A 2E76C 2KLCA 2BYTA 1IGDA 4R1JA 2HD5B 3HP3A 5IWAL 3W1BA 2JA5G 1C76A 2O6VD 2ZM6L 2VB2X 3ML9A 2FINB 3P1HA 4B3ML 4XZ4A 1HTLD 1STEA 3ECIA 4LNNA 1D1KA 1T5EA 3PMFA 3MAQA 4DR1L 4UP8A 2MW5A 2VH2A 1PRTF 2EYMA 2JA9A 3PPAA 1T9HA 3EN2A 4A3FH 1Q8IA 5FLXE 5FLMH 1CM9A 1E9MA 1I50H 2ZJPA 4P2CB 1P8LA 1TKEA 1WJ6A 1WR6E 2M8SA 3O65B 3M3YB 1JOOA 3IKJA 2EMTA 2YTXA 4CGYB 1PYBA 1KDAA 2XRQD 2BA0A 1VQDA 4HWIB 2I38A 3CSTA 3R2TA 4YCWA 1L0WA 3QX1A 4JX1C 4HSPA 1N63A 3TP7A 3M62B 2CU3A 4DN4M 4WJNA 1U4LA 1MFWA 1MG8A 1ZDVA 2K14A 1H9SA 2NZOA 3NBIA 2NYZD 2LUEA 3APFA 5CTRC 3EECA 2YTVA 1BQQT 1TWFB 2LY7A 2WB1G 4RWSC 2CR5A 2WP9B 4DV0Q 1WXQA 1LTSD 1X54A 2BCOA 5M5YH 2RHSB 4I65A 2KEEA 1XTCD 2G9DA 2B2WC 2NVTB 5I4DA 2Z59B 1STBA 5CORA 3F2UA 3AFPA 2WLBA 1TS3A 3HOWH 4TQ0A 4HXDA 4J1MA 1E2VA 4POFA 5C0XH 2MNAA 4LF8Q 2NBWB 3DWGC 3WAMA 4DXAB 1MI2A 2DNCA 4KZCA 5IOCA 2MP1A 2ZXRA 3SR1A 1Z7TA 3A56A 3F1ZA 4LNQA 2IDYA 1FNUA 4LMQD 2PTLA 4K5WA 1EO6A 1KNEA 4WWNA 1PFDA 5BMHA 1U9RA 1UUPA 1V1PA 2ASBA 3PO2G 4N6EB 5IP7G 1V6EA 2FCMA 1A5RA 3RLFA 3EHVA 3PV0A 2UUCL 3B9JA 2C7MB 3ULPA 4P16A 5C44B 3L9AX 4FVMA 1FD7D 2MO1A 4OO1G 4JBMA 1XF5L 2KANA 4L23A 3LNNA 3AULA 2O2LD 1LFDA 1EQTA 4OIKA 5EKKA 2CJOA 1BBXC 3DBLB 3U9OA 1A15A 4DA2A 1IBKL 1E3PA 2MJ3A 5G5HA 2AUKA 3ZDTA 1RWSA 4B95A 4G4KA 4KIKB 4DR2L 1C1YB 3W3AA 3F2DA 1A62A 1UE7A 2EELA 2EKIA 4RF1A 1DM0B 1H9JA 1I3QB 5E4XA 2ASQA 3ZLZA 4R9WA 1XJVA 2L52A 1WXVA 3HOZB 1TWCB 2NN6H 2WXHA 2N1VA 4A9AA 2CW0D 1FXIA 1J8CA 2F0EA 5IYCH 4UHVA 1CHPD 2EPBA 3QHTA 4KDIC 2PEAA 2J42A 1TKWB 4XWTA 3C0RB 4NXMQ 3WA0A 1NMGA 1PDXA 4CKCA 3UE1A 4HJAA 5IAAC 2JXTA 5FLXc 2VQFQ 5TSSA 4FJZA 1AEXA 4NP5A 4RKLA 2NB0A 1GM5A 1KRHA 4W9IA 1C0AA 4L5RC 1N33L 3ALBA 4A93B 4DV2L 5EBDA 1WJNA 2B76B 3KUDB 1SYDA 3PHXB 3KF8A 1K8GA 4W9CA 3U7DA 2KDEB 3U7ZA 3QIAA 2INDC 2CHXA 2KCTA 1JR0D 3P7JA 1B4OA 4MDKE 1HR0W 1I35A 2G4DB 3TS2A 2BYVE 1S5CD 5LXHA 1V8QA 5FJ8G 3J7AV 3A4RA 3LWEA 1A3TA 1XT9B 3PS6A 3RULA 2N49A 3MJ5A 4HVBA 2Y5PA 4QIWE 2E5LL 2NZ1D 3NVZA 3UIOB 3K5OA 5EPJA 5J2RA 1VQ6A 3UQBA 4KGTA 4BZAA 1E7UA 4K7UA 4JL9A 4UDUC 3RNEC 2WKDA 1TR5A 3I70A 1CSQA 1IL8A 2F0KA 1PH1A 1I7HA 1FCLA 4DV7Q 5CHVC 4GDKA 3SR6A 3APCA 3RNAC 4TKOB 1QOFA 4GOCA 1QVFA 3AE7B 4N8FA 5E1FA 1EY7A 3CCLA 3N3KB 3ZNHB 3S1RB 1L1OC 1EUVB 1RL2A 4M02A 3OTOL 4DHJD 3CCEA 1D3ZA 3KDFB 1A8VA 4LF7Q 3DBLI 3M4PA 1TBEA 3BY4B 2JZZA 4YTPB 2DZIA 2ON8A 1SJED 4A3KB 3AFQA 4LW1A 4XYQA 2NBVB 3FKIG 3TBLD 3ULLA 4B3RQ 1U4RA 1E6EB 4ME5A 2V3NA 1AZQA 4U68A 1ZGUB 4GS3A 3BK2A 3EGRA 3N9YC 1HH2P 4A20A 2Y3AA 3AM9A 3VAWA 1C79A 3M4OB 1ASZA 1MD2D 4IN3A 4JI4L 5C4ZA 1N34Q 1Y8NB 2V4LA 1HTOA 1WGGA 4IOAA 2FMMA 1QOAA 3I63C 3MHZA 4IURA 4NJ7A 2R7ZB 2LASA 1V97A 2ZTEA 2XTIA 1FXTB 3D6CA 4GLXA 1LQBA 4LFBL 1ISNA 3VR3A 3HZXA 2NVQH 1JW9D 5AZHA 1ZXTA 4YWMA 1S5ED 2KMAA 3DVGX 4W9LA 2ZCBA 3RLNA 3V96A 1GJZA 5A2QL 2B2YA 2DENB 3L13A 3E56A 4PNYA 1L2NA 4FDBA 3SHQA 1UNSA 2UUAL 2DWQA 1HNZL 4FF2A 2K25A 5I9PA 4AQYQ 4PV1C 1QT9A 2K9XA 1K8MA 1FJGL 2AWTA 3AH7A 2K5NA 1HNWL 2MFIA 4DV3L 1WSPA 2R61A 4H13C 2B63G 1DONA 3T1HL 4A3IG 1QZHA 1QJOA 1FM0D 1JRPA 2LXKA 5A2QE 2JA8B 4GLAC 1X56A 1YJJA 5LMNL 1B70B 5D94A 3IAYA 3BVGA 4DNRB 1SYCA 2WV6D 4OONA 4HJ8A 2N78A 3U4ZA 1R4PB 1SNCA 1NBFC 4ZYNA 2M00A 2D62A 1SEBD 1WY8A 4HMIA 2BYFA 4XXEA 1RFAA 2WXPA 1ZKOA 2A69D 5M3MG 1I94Q 2UUBQ 1ILQA 3DWQA 4NJ6A 2LD9A 1Q8KA 1EZ8A 2KC2A 4A3JG 2KVZA 2ZJDA 4R4CA 4TQUS 4A3MG 4FP5D 4JI2Q 3HS0C 3KLWA 1RYJA 3ERSX 1PFSA 3EBEA 3FP9A 1U4AA 3FAHA 3OJ3A 2DYMA 4EVOA 1KAAA 4IG7B 4LFCL 4DV6Q 3L08A 4OW0A 5CV9A 2L12A 1ICWA 4JI7Q 5MPOA 3DMUA 5KHOA 4QUCA 2JF5A 4Y7NB 3M85A 2QCZA 2IY5B 3GE8C 3RD4A 5IWAQ 3R3MA 3KYDD 4W9KA 3RUIB 1TU2B 4H0LC 2ZM6Q 4C3IG 4FF1A 4B3MQ 4B3TL 4X66L 5L95C 3D0FA 5A35A 1V81A 4IUVA 4DR1Q 2YEPF 5L37A 1E2ZA 2D3GA 3B2FA 4OL7A 3DHGC 1B7YB 2JUOA 2JA6G 1U4PA 2VQEL 4KIKA 2OCEA 3W5OA 2M9VA 2IW3A 1EOVA 3HOVG 2EOTA 5IT9L 2YU9H 2V1YA 3RZWC 3P75A 2JWUA 2FHTA 5K36G 5CV7A 4R4IA 3SDLC 2VB3X 2KMMA 2I5LX 2PO4A 3NTHA 2EY2A 2A6EC 5E7NA 1VR9A 4WH4A 4CJ2C 4KX6B 3H3VI 3SK6A 4DK5A 1Y8PB 1HZ9A 5IT9E 2ICIA 5KNCA 2KVRA 4KTAA 4R4OA 4O2DA 4JBWA 1MGSA 5M5WB 1WTOA 3PO2H 2DYOA 1GUNA 3HVZA 2NS5A 4C4VA 4C56C 1JOKA 2QDLA 3K81C 4IO9A 1X3QA 3H9DA 1PRTB 4MHEA 2K0PA 1J0GA 5COYA 2E3TA 3NQIA 1R7SA 1IBLL 4OVUA 1N6ZA 3AU7A 3RN5A 1UBIA 3H91A 2GBJA 3EA6A 1TIID 3S2HB 1PVOA 4BBRG 3KBXA 1O80A 5I6WA 3HOYG 3HEJA 3T13A 1RDPD 3Q8EA 4BXXG 3QK0A 1YNNC 1DOXA 2KMCA 2AQ1B 3M4OH 2NUCA 5CBAE 2BE5C 2EJFC 1VQCA 1YHQA 1SFOB 2UUCQ 1PV4A 3S1NH 3TREA 1EQVA 1KF6B 3J81j 3CCRA 2ATWA 5LLIA 2Z8LA 1E7PB 5JXVA 1C4QA 4ARIA 5C5LA 3I2ZA 4A55A 2K8CA 2AUJD 2LMCB 4WQMA 3W2DA 4AYBB 3PF5A 3SFDB 1ZP0B 2NTTA 1YJNA 2I1KA 4KMUC 1EY6A 3H09A 1EU3A 3KDFA 1IBKQ 1K52A 1G6PA 2RCFA 2KBNA 2V4DA 2HTME 3P42A 1WM3A 1ZDXA 2XRSD 4DR2Q 1PMRA 3CMAA 3GTGB 3GTMH 3PIPA 1L5PA 3P2BA 3BYYB 4HPMB 1QE6A 2KCNA 1NUCA 2E8GA 4CBVA 4DNTB 4DUZL 4L6TB 3W5VB 3ZKJC 2F0LA 3VQIA 2MBEA 3DPDA 4F87A 3DEOA 4K7WA 3H3VH 5HI1A 1C48A 3QWNA 3Q69A 4FN2A 3GB1A 4MH0E 4F88A 3E0JA 3HOXH 5D65A 1P98A 2OF1A 4HIKA 1WGDA 4MTKA 1VQFA 1JB3A 3K0YA 2INPE 4BKGA 3FPUB 1PTOB 1FD6A 1N33Q 1STGA 4DV2Q 4V0BA 4DR5L 2BH8A 2KXJA 2FCQA 4ANWA 1KXLA 2IHFA 1KNAA 1PA6A 3SD5A 2M56B 1YNXA 1D5XC 4I7ZC 2BS4B 1SROA 4BY7B 1EQQA 1QG7A 1RLFA 2LXCA 2F0HA 2Z0EB 4HIMA 3OYYA 2B2TC 1G2TA 4HR7B 3E3XA 4OZAA 4DUYL 1TWGB 5JH5C 3G6JB 2E5LQ 4YY3L 2JSVX 4QAYA 3NJTA 3FKIH 3S15H 2JWZA 4LDTB 1JE5A 3DCGA 3MTNB 4HCNB 1VS0A 2VUMG 1YN5A 2HHHL 2SNMA 1LTRD 2F52A 2CQOA 1LYLA 1SXTA 3V05A 1SSOA 3PF4A 1ENAA 2L8JA 4LNOA 1HNXL 2UWQA 1KABA 5JHBA 3KWLA 3MXPA 1A70A 4BBSB 1Y69U 4X3SA 2GVBA 3D6WA 3OTOQ 2J52A 4Z9CB 4EKUA 3H0GB 4DR3L 2I0QA 4MSMB 1VQ9A 2EY1A 1PDQA 1PZJD 5IP4D 2N7EA 4IQZA 4G7ZC 3TL5A 4B9WA 2KOLA 4GKJL 1PYWD 2B8FA 4KI0A 4X6AH 3TCAA 3VYSA 1VCBA 4MT5A 4HN7A 4HROA 2IO0B 5FR6A 3U58A 1KOTA 3H15A 2HJ8A 4IFDI 1K0RA 4IDIA 4WJ4A 4CQNA 1UZXB 4ZRZA 2IX3A 1WTRA 2DBYA 1G6JA 3GTQB 4UY8C 3HOUH 1HZ5A 2MP2B 4JI4Q 2JPHA 1CKMA 3STBD 1HZ6A 4D2KA 5BR8L 4B9XA 3EIVA 1N36L 2OWOA 1XO3A 2AQ3B 1WD0A 3RN9C 2KWDA 1F77A 4LNIA 2PPHA 3V2TA 1NCVA 4Q5VA 1HR0L 2BKFA 3LX0A 3MVVA 5IGBA 4RGNA 2IX1A 2LJIA 5C2TB 3L54A 3TP5A 3ICEA 3VR9B 3SK5A 4A75A 1O78A 4LFBQ 3CC2A 5KIXA 4KDLB 3K9PB 3D4DA 4LK0M 1YJ1A 3RPFC 3TP8A 4ZKBB 4JYAL 2WYQA 3I9V1 3CHBD 5M3MH 3JSVB 3S2HH 1EYCA 4II2B 3I55A 1F9RA 1PXUA 4RHRA 4DK3C 1HNZQ 2UUAQ 2L3ZA 2OHFA 2RPQA 1VQGA 2PW9A 3H7PA 1W6JA 1VZ6A 4PS3A 1WIAA 2E2JH 2ZEQA 1YHAA 1FJGQ 4GN5A 1JWBD 1R9TH 1HNWQ 4DV3Q 1WF9A 1HTQA 4A3MH 5IGFA 3T1HQ 2PE9A 4F8MA 3FPPA 2ZJQA 1JOQA 5LMNQ 4P1CC 1P9DU 3F2BA 3EJIA 1RRBA 2EJGC 2J0TD 1P0RA 2M0AA 5I2YA 4XDCA 3H3VC 2KEDA 4EQNA 2KOXA 4IW0A 4MGIE 3ZO5B 4DK6C 3T3OA 2PMZE 2PQAB 3WOFA 1HRJA 2JEBI 5IYBG 3PLVA 1QVCA 4A3FB 2F0JA 3GOEA 3OPOA 1H8CA 2HDMA 1WXAA 2F0SA 4DNIA 2GLSA 2V1CC 1E10A 1I50B 2VRRB 4H02A 3WAPA 4E3CA 1JCKB 1ACCA 2M1MA 1E22A 4RMFA 2FNJB 1CZWA 3S14H 2ID0A 2K28A 4M0WB 2GOWA 4I6NB 4BFRA 1LT5D 4AUQC 1PZKD 1TS5A 3ND8A 3VRBB 5LNK1 4NMZA 1IGCA 1Y1VG 1X3FA 2H88B 1EYDA 5G55A 2AL3A 3O13A 3BDCA 4LFCQ 4FLHA 2D0PA 3VYUA 1WFQA 2RSUA 4GIVA 3J9CA 2PW5A 4YIJA 1R4MB 4MH8A 4FF3A 2BYEA 4BY1B 2R92B 1QB5D 5C4HA 2K03A 1T0RC 1PLFA 5M5YB 4DDGD 4B3TQ 4X66Q 2F0PA 1I4RA 2G9HD 3CCJA 3LJ3A 2K52A 1PGAA 1WGHA 2VL6A 1PTOH 2K5PA 2O2VA 3T53B 3GDEA 3HOWB 3IT4B 4AIMA 1AARA 2PCFB 3F2CA 1K9MC 3RD2A 2R3ZA 1F2YA 2VQEQ 4QIWB 4XT1B 2GI9A 4DR7L 4KN4C 4XQNA 1GUAB 1UEAB 2EQSA 1FIQA 2RDFA 4K8JA 4H2AA 4FADA 4NKLA 1X32A 3HFZB 3NHHA 4YCVA 4GOPC 2D5GA 2ZNVC 4JCVE 3KJPA 2JE6I 2RCNA 2TSSA 5JZEB 1E8XA 3K7AH 2Y0SE 1TKYA 4EZLA 3I3CA 1VQEA 3W1SC 4AOFA 3TRZA 3S16H 5EQ0A 1N5WA 3S24A 1TZ1A 5CR3A 4YWKA 1FRRA 1SE9A 1JROA 2GA4B 2UU9L 3P1MA 1ICFB 4EQOA 2Z1CA 5KYIA 2EXZA 4K8IA 3RNGC 4FO2A 1YHBA 3C1EA 4AYBE 2J0JA 3K5LA 1K53A 3QJZA 4KD3A 2PPBC 1IBLQ 4C3HB 1QF6A 3T1YL 1SDFA 2K6DB 1D1IA 1DOIA 5BYQA 5C6AA 4A3OA 3JYUA 2CHBD 2R93G 3ZDMC 5AJ3L 3PCOB 1HZAA 3G4SA 1VQ4A 3I4MG 4PMWA 4JPSA 4B0MA 5IGGA 5GQOA 1QUQB 2RSOA 1JB7A 1C77A 3B1LX 1ESFA 1RODA 4MEMA 5LMUL 1ZXHA 1K83H 4OXPA 3UDGA 4A3CG 1KHIA 2QCPX 3FVQA 1BXTA 1QWYA 2L15A 1R4MI 4MSQB 2JP1A 1IKMA 3IFWB 2B2WA 1IPGA 1VQBA 4UAIA 3PIP3 3RNUA 4IZ8A 1XNQL 1VDVA 3JVZX 4GDLA 1PHJA 3X3MA 1O7IA 4RAUC 1P3QU 1WE7A 2DNFA 5JOBA 3W1YA 4IM3A 3GD7A 3JAMc 4HCEA 3TIXA 4ALPA 5C0XI 4DGZA 3NTIA 3CW2C 1Q82C 2V4IB 3T56B 1EM7A 3P4RB 2ICEC 2EYLA 1KH0A 2QC8A 5T1GA 4DUZQ 4EEWA 2E2DC 2WAQG 3NBHB 4N59A 4ZRPA 3AI5A 4JV5L 1DOKA 1EUJA 3RR5A 2GN5A 2TMPA 4LF6L 1Q86C 3Q0AA 1CTMA 1STHA 3TMEA 4R8IA 2RKSA 1WXMA 2N9XA 3N30A 1CZPA 1MHWC 3K59A 5FLXL 4KSKC 4NY0A 1SNOA 2F3WA 2XWJB 3NRZA 3PZ8A 2MP2A 2B2VA 3D3RA 2QEJC 4OWTB 4DXFA 2AEHA 4A3GG 2WDTB 1K28A 4JW0A 1XMQL 3C8YA 5IA7A 4GGQA 5DAUA 2YYZA 3GTKB 3KF6B 5EE1A 2X6LA 2JQOA 4A3BH 1JJCB 1S5DD 1STAA 5C44G 2F3VA 3G6EA 4DR5Q 3U2SC 1EQRA 1KL9A 5JPNC 1KJTA 1PTOC 1BT0A 2O6VB 3BK1A 2AQ2B 5H92C 3OOCA 2AHOB 1L6UA 2J53A 2KO3A 1FEHA 1SNPA 2KHSA 2SOBA 3BWUD 5AUKA 1F2ZA 3AV8A 3KVFB 2PI2E 1L0YB 2BGFA 1XWEA 2NN6I 3K58A 2NTSA 1VQ5A 2A8VA 4A3EG 2DHZA 2JT4B 3WANA 5EDSA 2F0UA 1YOVB 3A74A 4PZ6A 2EDGA 4P72A 1ZYRD 3PUZA 5LHY1 3A54A 2VXWA 4MNOA 3J7ZC 2J7ZA 4DUYQ 2JA7G 3SU8X 4YY3Q 3JAMi 4OVZA 3W5UB 3ZW3A 1SNQA 3AB9A 4MM3B 3NS8A 1J8IA 4QUFA 1I6VC 1LTID 2HHHQ 2EYHA 2H5XA 3BZDB 5IE8A 4BY1H 2R92H 3VRAB 2WX1A 3M63B 3V62A 1HNXQ 1MJCA 1J6QA 1YZ6A 4O42A 2NVQB 2PQAA 4GMVA 4XC2A 1EL0A 3H7SA 2BVCA 1T5XD 1OQRA 2K5DA 4R8NA 4CKBA 3GS2A 1RF2D 4JG2A 4RGMA 1N5XA 5HGQA 1SYEA 2IJ0A 4DR3Q 2KN4A 3MXGA 2IBIB 2D07B 1P7EA 4GSWA 2JN4A 2NBFA 1PH7A 4WAAA 3MC0B 4OEMB 1DZ1A 4M0WA 3TEYA 3KLSX 3ZTDA 4GKJQ 1EWCA 3H6MA 1XPUA 2JU6X 3P4SB 1M94A 1HFGA 1SSNA 4HKQA 3NQTA 1FFUA 3I72A 1YX6B 1UE5A 3SDZA 4REZA 1A3VA 2F0GA 1MHHE 2HCIA 3K8AA 3PHWB 3L7ZC 1L1OA 1YVCA 2ZZPB 4W9FA 3DBSA 1F2MA 1PTOF 2LJ5A 2L1BA 3J7A5 2N1WA 5IGDA 1WTWA 1YJWA 3AMUA 5BR8Q 4NNJB 1N36Q 3UI2A 2EKEC 5E6JA 3I73A 4Q2JA 2JA5B 5M5XB 2B2VC 1P1AA 3PVLA 5JPMC 4LK1C 1IW7D 1HR0Q 3VXWA 4CHKA 1WJJA 2XNAC 4K5VA 2W3RA 5DNFA 4B3SL 3RMKC 2I5HA 2HQEA 1WMHB 2CJNA 5ELDA 4Y52H 1AE3A 4FXKC 1A0IA 4L8JA 2XVSA 1E24A 4C3HH 2D3CA 4JWSC 4W9GA 3VTVA 3DXJC 3CD6A 4JYAQ 2FIFA 3T4AC 2OXPA 3P20A 3ZQ4A 3I5JC 2Z0DB 4LCDE 2J0MA 1STNA 1WTHA 1KFYB 3NG0A 2DZJA 3STBC 5KGUA 3C3LA 1J5EL 2KJ6A 1EF1A 3PO3H 1AN8A 3A5ZB 2D3AA 2A6HC 4HCPB 5DPTA 5BYRA 4WQOB 3VUWA 4FA6A 4YXDB 1WTPA 4XQJA 1Y1VH 1X65A 2QGQA 5KEEA 3E9SA 3HIZA 4IPDA 1SGHA 1QLBB 2IO1B 1FMAD 1DCZA 1CQFA 1UH6A 2FE8A 4NAWB 1MIUA 1E7VA 5G3LD 2JRHA 2MX2A 3Q3JA 3VA7A 1MI0A 1YNJD 2B8GA 4LNKA 1QOHA 1WI5A 2R7ZG 3Q3OC 1IKLA 1GO3E 4M01A 2YU9B 1J9OA 3GV3A 2LRWA 5CV5A 2NBUA 4POGA 1MKHA 1WRIA 3N1YC 3DLLA 4KKSA 2K4KA 2KECA 3R66C 1M8AA 3QC8B 1WR1A 2E74C 3GV6A 4HJ5A 1QUQA 3MFGA 1VD2A 2BW2A 2NZHA 2OJWA 3H1UA 2PNHA 1AH9A 4BWGB 1FNWA 2GMIC 1Z47A 5F2DA 5EE0A 1EIYB 1H9MA 1UAPA 2L55A 2MBOA 2IGHA 1AE2A 2L0CA 3PO2B 3NEMA 1IBXB 1XLQA 1WGKA 3KJOA 4L5SA 2M19A 2N9PC 4WAFA 3VYTA 1Y8OB 3GTKH 3DM3A 2MJ8A 1IYFA 1C4CA 2ZCCA 2NCNA 2XEWA 5IP9H 2KENA 2ZPYA 2WXGA 3FC4A 3AE1B 1GUTA 1SYBA 2UYZB 5EGTA 4IWPA 4C3JG 1NJIC 5C3EG 2K50A 3AE4B 4IM0A 1EEID 3V6CB 1UGMA 4K14A 2KN5A 4DR7Q 1RJTA 1Q0WB 3A0JA 5GROA 2QA4A 2I07B 5KNDA 4KY7A 4LUZA 4IPCA 4DHJB 1LTAD 3H6NA 4TUUA 4US8A 1VQ8A 4S3SA 1T0QC 4ZRQA 3VR8B 2MEKA 3S1NB 2KTRB 4NZLB 1SE8A 4O1NA 3CF6E 1L0XB 1SN8A 5GADC 1RTNA 2KDMA 3ZNGC 4W9EA 3ZGZA 2A1AA 1YN3A 4AQ7A 5D14A 3A8JE 3J80L 1QOGA 4JI1L 1PGBA 5J18A 2YLMA 3SK8A 3W9CB 4IKGA 2UU9Q 4EX5A 3KF6A 3MZ5A 3AE6B 4YWGG 3UI3A 5FKAC 2D2QA 2D0OA 3CRKC 3MTSA 4ULLA 1WH3A 2CHZA 3AEFB 3DQVA 4V190 3GTMB 1DJRD 3MFYA 2KZRA 3J80E 1Y1WG 3ZIMA 2O6VA 3PZ7A 1UWVA 4XWWA 1F0ZA 1Q1EA 4C1NK 1WYWB 3UDFA 1E90A 3T1YQ 2CH4A 1HFNA 2OEDA 2F0IA 1E1OA 1D7QA 1BNZA 5AJ3Q 1C3TA 1W2BA 5KYLA 3GZNI 3AE8B 2V3SA 1II3A 4GNXB 3N6RA 2Q2HA 1DYQA 2A73B 5LMUQ 2WS3B 3HOXB 3N32A 4NAMA 1AW7A 4RCNA 4KGSA 2F4IA 4LJOB 2FFKB 2BPSA 1K3RA 3DWMA 1NDDA 4W9HA 1E1TA 3PREA 4YT0B 1I4XA 4IUNA 2FUHB 2KFJA 2X69A 1SE2A 2JA5H 5M5XH 3SGIA 1MVKA 4GB9A 1KQSA
chains in the Genus database with same CATH topology
4XE0A 4MACA 3Q23A 4FF4A 1ET6A 2K01A 3KBGA 3AB5A 4HEA1 2WKCA 4DAVA 2O5IC 1KLGD 2K05A 3DWPA 3FKIB 3S15B 1V8CA 1K50A 2KJXA 2C9OA 3TEZA 4B08A 1YN4A 1FYCA 3TEWA 2PMZB 4C7ZA 4K6DA 2GB1A 1BCPC 3MEHA 1SMYD 5BN3A 3NS1A 1HXYD 5J39A 1TVXA 3KLRA 2A68C 3U52E 3CU7A 5BYSA 1GHKA 1W6KA 1SYFA 1S4ZA 5EPKA 2MHVA 1NENB 3A55A 4A90A 4WORA 2ZW1A 2RBMA 3URYA 3D8GA 3BDLA 2WIIB 3HOUB 2PZWA 3VA5A 4C80A 2PVGC 3Q24A 3SEBA 3OHXC 2V3PA 2BDOA 1TKGA 2B63B 4FNFA 1A6XA 4TMAB 3K5MA 4ARCA 4DK0A 1LTTD 5CC4A 3VR6A 1L0VB 4KV6A 1SYGA 2IX0A 2PVOD 4OO1H 1HQMC 1LTGD 2JX5A 3OMCA 3TDQA 4QCLA 2B2TA 3IL8A 1BR9A 4K2LA 4HTHA 4QF4A 2WDRB 1B44D 2XIWA 5M3MB 2LS01 3BG3A 1D2BA 2RA4A 4DXGA 1BCPF 2E2JB 2Y0SB 4PMCA 1R9TB 4A3MB 2DY7A 3J81E 2N88A 4HMJA 4E6IA 2W3SA 4ZHOA 3U4EG 1SF0A 4HKZE 1LT6D 1K8OA 2FUG1 4WURA 4AS1A 1EOTA 1EY0A 2BA1A 5ELBA 2B2UC 3PUXA 3S14B 1KDCA 3NUCA 1C78A 1PGXA 1FXAA 5KNBA 3QG1A 3EFXD 2ZT9C 5T1IA 2JA6B 2DY8A 4HRSA 5I6YA 2JZPA 2MUYA 4NJCA 4K2KA 4HCSA 1UWMA 1MPEA 4DFAA 1CJEA 1B1ZA 2K22A 2EVBA 3SXHA 1QILA 2L4NA 5C3XA 4F7XA 3H8HA 5EPLA 1ZEQX 1ZXIA 4C7YA 1B9NA 1VF5C 4RA8A 3E6ZX 4PMBA 2CW0C 2MPMA 3K7AB 4JE3B 4YSXB 4NDXA 1BUIC 3S16B 1AP0A 4LAAA 4Q0FA 3BVZA 2N55A 2QMTA 1GUWA 2RQXA 2LFNA 1OXSC 4XIGS 1JWMD 1YNJC 5FR3A 2WINB 2VZKD 5DM73 1SE3A 1EY5A 3I91A 3ND9A 3TZDA 2BT6A 2MH7A 2RVLA 2BS3B 3N52A 4IUQA 4BA1I 4ILWA 1XLNA 2DLBA 1I4GA 1K83B 4DU9A 1HQRD 1C9FA 1XLOA 1GHJA 1VZ8A 3TBIB 3AECB 5JVG3 3RMHA 4K5XA 4EQPA 3TEXA 2WU2B 1CA6A 3EQLC 5J22A 2W55A 1MSHA 4WJWA 5C0XJ 3C1FA 4RNAA 4IUPA 3SVMA 2CVRA 3MA2B 1EZ6A 1TY0A 2R6GA 3AN1A 4L63B 2BOSA 5EKLA 3LXFA 2WXLA 4JWUC 2EE1A 3Q8AA 1SIJA 3DWAA 1NYQA 2WXKA 1GOZA 4X3UA 3W1SA 2LHEA 4XDDA 3H94A 1VJKA 3QO2A 2VNUD 5IODA 2D9UA 1A3UA 1CQVA 4L1BA 2ZXPA 4A3BB 5FK9C 4FYDA 3T3NA 1F2LA 3JAML 4FXDA 1C8CA 2QKIC 1TS2A 5HURA 1TS4A 4N9PA 2E75C 1HUNA 3TSSA 4C1NI 2IL8A 2CQAA 3PUYA 2A74C 3JAME 1KDBA 1RTOA 3M7NA 1N61A 2EYOA 1OXXK 4G7HC 2K7VA 2K04A 2K6AA 4KJNA 5K36H 2N9LA 2A69C 2SDFA 5JJZA 1QNUA 5ELCA 3ZJTA 5AUIA 4RKBA 1N62A 2LMCA 4PQXA 2WXFA 4RF0A 1E0ZA 3IAM1 2FMCA 4KKIA 4H7BA 2F1MA 1TY2A 1XYIA 4KD4A 2IT1A 4DAYA 3K57A 1BUVT 1NVID 5LL6X 1CZGA 2K1BA 3IFTA 1EY9A 3Q22A 3R93A 2H89B 4WIPA 3NE5B 3A7LA 2JXMB 3WDNA 2IGDA 4BS9A 5DEHA 1VLBA 2BB5A 1XEEA 1S5FD 4DAPA 1HTPA 3T16A 2E6XA 5JEAJ 2F0QA 1L4DB 2WXMA 5G5GA 4KKTA 2QJLA 1GUGA 1ESRA 3NTKA 1DGJA 5CMDA 5JEAG 1VMCA 3PO3B 3BVMA 1V1OA 1Y1VB 1A2TA 5CV8A 3NXWA 4DF7A 5HFYA 2WU5B 3FRPB 3FDTA 3X3NA 3NSWA 2RMMA 5BN5A 3A8IE 5I2XA 1SJHD 2OEOA 2LEKA 1RCVD 3DUZA 3IFDA 4ZHPA 2SEBD 1D4BA 2O5JC 3VYRA 1P7FA 2ENBA 1VF7A 3QB3A 1BCPB 3V3XA 3Q8CA 2QILA 1UGJA 2WP8J 1QQRA 4XQQA 3AEGB 1E2WA 3LYYA 1A2UA 2K5QA 2WDVB 4US9A 1IYUA 1ZE3D 4X3KA 1YQ4B 1F9QA 5AFWA 2JSOA 1JC7A 2ZW0A 4A8XC 2A6ED 2RSNA 1OXVA 1QNKA 2KCCA 1GPXA 2RDGA 4QMGA 1VDZA 2R93B 2DN8A 1E0BA 1HA6A 3I4MB 1SNDA 2D5DA 2IPKD 2KQ3A 4WWMA 3ONAB 4IOIE 1STYA 1OXTA 3ERQA 1HHVA 3LWUA 2INNE 3FMCA 3I90A 5DM63 4IUUA 1D6EC 1QOBA 1MBYA 2AWOA 2NVYB 3KUPA 2H4OA 2F0FA 1SBBB 3U9SA 3AEAB 2M2LA 1YNND 2HDEA 3NP8A 3VR5A 4H44C 5CBEE 1B2TA 1Q1BA 2BE5D 5EJWA 3G7LA 5BN4A 4CHTB 2WAQB 3RUZA 1SB3C 2WXQA 1F9SA 1YQ3B 4MIUA 1NR4A 1LO5D 4ID6A 1L6VA 3OWEB 1JWAD 1FO4A 4A3GB 1OQQA 1CHQD 4FXGC 3I8ZA 1VMPA 2LKVA 4CJ1B 5C4JB 1EYAA 1BF4A 1Y56A 2MJDA 1U4MA 5HHDG 1LTBD 4KN7C 5NUCA 4ZUIA 2PKOA 5C3WA 1K51A 2EYPA 2F0WA 3OMGA 4A3EB 2PYKA 2WQYB 4ZK9B 2PIAA 2JA7B 4ZQ3A 4G7OC 1PZID 1I4HA 1JWUD 1YNTE 1ZUD2 2WB1B 3P63A 5FOBB 4B0EA 1J7BA 4N58A 3OSOA 4YSYB 1B9MA 1EY8A 2PQEA 2L9HA 1G291 1JQ4A 5E3FA 3RZDB 3AEDB 2RPVA 2XSCA 5IGEA 2LHDA 3CIRB 2L5TA 1WYGA 3BDOA 5C5MA 5D7GA 4M1UB 1UWXA 1JICA 1NSNS 2F0OA 1I4QA 3OIQA 1WTQA 1DOMA 2JQRB 4ITKA 4TSSA 4OIJA 1F2RI 2PW7A 2ACZB 2WXNA 1TYGB 1I6HB 4EE2A 5CV4A 1ILPA 1NYRA 1O7ZA 3NBHA 2G1EA 3WOEA 4GZYC 1B3AA 1RM6C 2C5CA 3D4WA 3DEPA 5JEAH 3ZJUA 1GAQB 4X3TA 1H9RA 3MXNA 1SE4A 1GB1A 1N60A 1Q3LA 1DXMA 4K6LA 2BBCA 4WRDA 4RH6A 3TN2A 1QKZA 1Q90A 1J7AA 3S1MB 2L32A 2B39A 5I9OA 4KHVA 2Q8IB 2PLPA 1Z6HA 4WFN3 4N9TA 3J7YW 5ISRA 1EWHA 1G8ZD 3S1QB 2PMVA 1L4ZB 2QDBA 1ET9A 3BIID 1ENCA 3NWSA 4OO1I 1TWAB 1CA5A 3ETRA 2X6GA 5CGKA 2F03A 1LT4D 4ABNA 3S2DB 1OFFA 5FO9B 3K6OA 3HRDD 1SAPA 4C3JB 5C3EB 1GXDC 1XXGA 1IUEA 1EWYC 4R3DA 2I46A 2EYFA 2LGIA 1B50A 2B2UA 3K5NA 2BDNA 1LT3D 2F0DA 2XWBB 2MGSA 5EKIA 1RHPA 1FCCC 1G6ZA 2EYJA 5LL6S 4CKEA 2NMQA 4YTNB 4IFDJ 3QOLA 5JAVA 3D4RA 3I4LA 5GXGB 4RHSA 1Y1WB 3NVWA 1PFBA 3VR4A 2PZTA 3CRLC 5HG2A 2I2YA 3I57A 1RFKA 3FILB 4A3IB 3SHLA 1VCIA 4IFDG 1TWHB 4G57A 4IUTA 1ML0D 1O7LA 2B2YC 1WTXA 2W82A 2WDQB 3GTJB 2WNMA 3MP9A 1PRTD 3J81L 2WXOA 4JK1C 2Q8RE 4NW2A 5EE9A 4L2YA 3EVQA 4ODGA 1ZYRC 2A5HA 1LV9A 4A3JB 2V0GA 1BDOA 3M4YA 1VZ7A 4HSVA 3RFZB 4KY6A 1FR3A 1C4AA 2WXJA 1TQOA 2FJ2A 4RCOA 2W54A 1IBXA 2RDHA 1GB4A 2WACA 2ONQA 3E5SA 2E2HB 4C3IB 4P6VF 1XCQL 1AFPA 2BS2B 3C46A 5J1ZA 3L3OC 3CWIA 2IGGA 2X38A 1DD2A 1F2RC 1ROEA 3HOVB 4LTUA 5KRUA 1ONLA 1XCTL 4QB4A 4OGQC 2EY6A 5ELFA 5HGTA 1BMLC 1JALA 1J7CA 1IW7C 1YJIA 2K3UA 1EY4A 4PT5A 3ZJVA 3S17B 2J4XA 4EGVA 2Q5WD 3NVYA 4A3DB 1PTOD 2O4XA 3NVVA 3NUHB 5T8IA 4TQ1A 1R4QB 1HEZE 5M9OA 1NEKB 1HUMA 3AE9B 5H8YE 2Z4IA 4BA2I 2KAJA 1D5ZC 4U673 2KQ4X 2PNRC 2EZVA 3HUIA 4HJGE 4BBRB 1KLUD 2SNSA 1CT1D 3HOYB 4OZBA 3TP6A 3AE3B 3NWTA 3KQ4A 5CV6A 1FFVA 1BO0A 3M7GA 3EUB2 5BMIA 3Q8BA 2DNEA 5IGCA 2LUMA 4C2MB 4YTMB 2NWGA 4XTCS 1WVLA 3SE0A 2WXIA 3HVDA 1LLRD 1JMLA 1G2SA 1CI3M 2K5WA 1SNMA 5C4XB 1D5MC 3IAS1 1EEFD 4KHZA 1ENFA 5JVH3 1KTKA 4DK1A 2Z4HA 3P4QB 3HGBA 2JEAI 3HG9A 2ZXOA 2L1AA 2VZKB 3KK7A 5M3FB 3IT6B 5ELEA 4GDLB 1B9RA 3ZYYX 3NPPA 2D2CC 4J8QA 3T51B 3AE2B 5K5PA 3GQBA 2L83A 4HEDA 3LB8C 4ZKCB 1F9PA 2Q8TA 3MWYW 1YMHE 1HCZA 2Y5CA 4XT3B 2SAKA 1T6BX 4LLGM 1LABA 4LJZC 1WD1A 1AYFA 4KY5A 1NR2A 5CYUA 2K32A 5IIFA 1NI3A 3EROA 2F0NA 3R8BA 1RD9D 2KVMA 5G3LF 5C0XG 2A6HD 1OO9B 3GTLB 3KWVA 4USAA 1FRDA 1I4PA 4XYOA 3R2IA 3IXSA 2N9KA 3CQZB 4KGRA 1ZOYB 3R3OA 3FILA 3PIO3 1JWSD 3C2PA 2VUMB 3OIPA 3DM1A 1WTVA 1PFNA 3GP7A 3VR2A 4RGOS 1EIGA 2WXRA 2OT2A 3GTPB 1GUSA 2KACA 1H9SB 1TJEA 3ABVB 2HCCA 2HUGA 2GRIA 2KUMA 5E4WC 1GUOA 1B53A 2KA7A 3MXUA 1X3PA 3PUWA 4C3HG 4ZLTF 2F0MA 1FNVA 5EBCA 1O7YA 2NN6G 2NVXB 3AEEB 1JE4A 4KKJA 3BS1A 3QJYA 1Q10A 3RZOB 1JQYD 3A8KE 3OWFA 4A6QA 1S5BD 3QOJA 4J3OD 3HRZC 1DOLA 3FEWX 5FO7B 3SFEB 1RKNA 4ZUJA 3BYTB 3PUVA 1G91A 4OHJA 1V1PB 2PZUA 2K33A 4IFDH 2AWNA 3DHQA 2JYOA 2F0VA 4HAEA 3Q6SA 3P4PB 3KLSA 3B2GA 1QCBD 2LFIA 3PO0A 2QSDA 1OXUA 2F0TA 1XX8A 3Q8FA 1VRAB 3SK4A 2AX5A 4IALA 1SMYC 2QF7A 3CKIB 4M8AA 2E2IB 2EJMA 1EIHA 2N0SB 2QIEB 4RFBA 5D3DA 1FGBD 1AWDA 1JORA 1TT2A 3TUOA 2BB6A 1H9KA 3I4NB 4OZCA 5FO8B 1BOSA 1XLPA 3D31A 1T3QA 2HDLA 4XDXA 4ZOHC 2BTEA 4KKUA 1IHZA 4KJOA 3J7AF 1NAPA 4J6HA 4CJ0B 2JYEA 3WCQA 1WCMB 2XN9C 1AZPA 3NK9A 1WWTA 5C3JB 2FBWB 3AMZA 1IYVA 2L11A 4ZAIA 4MN3A 3S9WA 2YEPB 5BMGA 1PUTA 4RGTA 4ZYSA 2EY5A 3L4PA 1PRTC 1GJXA 1M4VA 1PFMA 4TRDA 1MSGA 3A7AB 1EU4A 1CK1A 1EFID 4FXCA 4GDKB 1Q12A 1DOYA 3HKZB 5D3IB 3AEBB 2MJEA 1MHXA 4GLSC 1BCPD 1LACA 1CFMA 1C4PA 2N7JA 3GTOB 4DQOC 1HPCA 2IWHA 3AE5B 5EE3A 3ITPA 2H1EA 4KK7A 2A68D 3MHBA 2JYTA 1ZPSA 1V43A 3GO5A 3TZUA 3OW7A 1TZOA 1HA5A 4YSZB 3NZ3A 2E76C 2BYTA 1IGDA 3HP3A 1C76A 2VB2X 2FINB 3P1HA 1HTLD 1STEA 1D1KA 1T5EA 3PMFA 3MAQA 1PRTF 2EYMA 1Q8IA 5FLXE 1CM9A 1E9MA 4P2CB 1TKEA 3M3YB 1JOOA 3IKJA 4CGYB 1KDAA 2XRQD 2BA0A 2I38A 3R2TA 4JX1C 4HSPA 1N63A 3TP7A 2CU3A 4DN4M 1U4LA 1ZDVA 1H9SA 3NBIA 2NYZD 1BQQT 1TWFB 2LY7A 4RWSC 2WP9B 1WXQA 1LTSD 2BCOA 4I65A 2KEEA 1XTCD 2G9DA 2B2WC 2NVTB 5I4DA 1STBA 5CORA 3F2UA 2WLBA 1TS3A 4TQ0A 4J1MA 1E2VA 5C0XH 3DWGC 1MI2A 2DNCA 5IOCA 2MP1A 2ZXRA 3SR1A 1Z7TA 3A56A 2IDYA 1FNUA 4LMQD 2PTLA 4K5WA 1KNEA 1PFDA 5BMHA 1U9RA 1UUPA 1V1PA 4N6EB 3RLFA 3PV0A 3B9JA 4P16A 5C44B 3L9AX 4FVMA 1FD7D 4OO1G 1XF5L 4L23A 3LNNA 2O2LD 1EQTA 4OIKA 5EKKA 2CJOA 1BBXC 3U9OA 1A15A 4DA2A 5G5HA 2MJ3A 2AUKA 1RWSA 4G4KA 3W3AA 2EELA 2EKIA 4RF1A 1DM0B 1H9JA 1I3QB 5E4XA 4R9WA 2L52A 3HOZB 1TWCB 2NN6H 2WXHA 4A9AA 2CW0D 1FXIA 2F0EA 1CHPD 2EPBA 4XWTA 2J42A 1TKWB 1PDXA 4CKCA 2JXTA 5TSSA 1AEXA 4NP5A 4RKLA 2NB0A 1KRHA 4A93B 5EBDA 2B76B 1SYDA 3KF8A 3U7ZA 3QIAA 1JR0D 3P7JA 1B4OA 1S5CD 1V8QA 3J7AV 3LWEA 1A3TA 3MJ5A 2Y5PA 2NZ1D 3NVZA 3K5OA 5EPJA 4KGTA 4UDUC 2WKDA 1TR5A 3I70A 1IL8A 2F0KA 1I7HA 1FCLA 3SR6A 4TKOB 1QOFA 3AE7B 5E1FA 1EY7A 3S1RB 4YTPB 2ON8A 1SJED 4A3KB 4XYQA 1U4RA 1E6EB 4ME5A 2V3NA 1AZQA 4U68A 3BK2A 3EGRA 3N9YC 2Y3AA 3AM9A 1C79A 3M4OB 1MD2D 4IN3A 5C4ZA 1Y8NB 2FMMA 1QOAA 3MHZA 4IURA 2R7ZB 1V97A 3D6CA 3VR3A 3HZXA 1JW9D 1ZXTA 1S5ED 3V96A 5A2QL 2B2YA 3E56A 4PNYA 1UNSA 2DWQA 4FF2A 5I9PA 1QT9A 4PV1C 2K9XA 1K8MA 3AH7A 1WSPA 2R61A 4H13C 1DONA 1QJOA 1FM0D 1JRPA 5A2QE 2JA8B 1YJJA 3IAYA 3BVGA 4DNRB 1SYCA 2WV6D 1R4PB 1SNCA 2M00A 2D62A 1SEBD 4HMIA 4XXEA 2WXPA 1ZKOA 2A69D 1ILQA 3DWQA 1EZ8A 4TQUS 4FP5D 3HS0C 1RYJA 3FAHA 2DYMA 4EVOA 1KAAA 4OW0A 5CV9A 2L12A 1ICWA 5MPOA 3DMUA 4QUCA 4Y7NB 3M85A 3RD4A 1TU2B 4H0LC 4C3IG 4FF1A 5A35A 4IUVA 2YEPF 1E2ZA 3B2FA 4OL7A 1U4PA 2M9VA 2IW3A 2EOTA 5IT9L 3P75A 2JWUA 2FHTA 5K36G 5CV7A 2VB3X 2KMMA 2PO4A 3NTHA 2EY2A 2A6EC 1VR9A 4WH4A 4CJ2C 4KX6B 3SK6A 1Y8PB 5IT9E 2ICIA 5KNCA 4KTAA 1WTOA 4JBWA 1MGSA 5M5WB 2DYOA 1GUNA 3HVZA 4C56C 1JOKA 1X3QA 1PRTB 4MHEA 2K0PA 5COYA 2E3TA 3NQIA 1R7SA 3AU7A 3H91A 3EA6A 1TIID 3S2HB 3KBXA 1O80A 5I6WA 3HEJA 3T13A 1RDPD 3Q8EA 1YNNC 1DOXA 2AQ1B 2NUCA 5CBAE 2BE5C 2EJFC 1SFOB 1KF6B 5JXVA 1EQVA 2Z8LA 1E7PB 1C4QA 4ARIA 5C5LA 4A55A 2AUJD 2LMCB 4WQMA 3W2DA 4AYBB 3SFDB 1ZP0B 2NTTA 4KMUC 1EY6A 3H09A 1EU3A 1K52A 2HTME 3P42A 2V4DA 1ZDXA 2XRSD 1PMRA 3GTGB 1L5PA 3BYYB 1QE6A 2KCNA 1NUCA 4CBVA 4DNTB 4L6TB 3W5VB 2F0LA 3VQIA 4F87A 3DEOA 5HI1A 1C48A 3QWNA 3Q69A 3GB1A 4F88A 3E0JA 5D65A 2OF1A 2INPE 1JB3A 3K0YA 3FPUB 1PTOB 1FD6A 1STGA 4V0BA 1KNAA 2M56B 1D5XC 4I7ZC 2BS4B 4BY7B 1QG7A 2F0HA 2B2TC 1G2TA 4HR7B 4OZAA 1TWGB 3G6JB 2JSVX 1YN5A 2SNMA 1LTRD 1SXTA 3V05A 1SSOA 1ENAA 1KABA 3KWLA 3MXPA 1A70A 4BBSB 1Y69U 4X3SA 3D6WA 2J52A 4Z9CB 3H0GB 2EY1A 1PDQA 1PZJD 4IQZA 4G7ZC 4B9WA 2KOLA 1PYWD 2B8FA 4KI0A 3VYSA 4MT5A 4HN7A 4HROA 4IDIA 4CQNA 4IFDI 4ZRZA 2IX3A 1WTRA 2DBYA 3GTQB 1HZ5A 1HZ6A 4D2KA 4B9XA 1XO3A 2AQ3B 1WD0A 2KWDA 1F77A 3V2TA 1NCVA 4Q5VA 3LX0A 3MVVA 5IGBA 4RGNA 2IX1A 2LJIA 5C2TB 3TP5A 3VR9B 3SK5A 1O78A 5KIXA 3D4DA 4LK0M 3RPFC 3TP8A 4ZKBB 3I9V1 3CHBD 1EYCA 1F9RA 1PXUA 4RHRA 2OHFA 1E10A 2PW9A 1W6JA 1VZ6A 1JWBD 5IGFA 4F8MA 3FPPA 1JOQA 3EJIA 2EJGC 2J0TD 2M0AA 5I2YA 4XDCA 3H3VC 2KEDA 4EQNA 3T3OA 3WOFA 1HRJA 2JEBI 4A3FB 2F0JA 3OPOA 2HDMA 2F0SA 1I50B 1JCKB 1ACCA 1CZWA 2ID0A 2K28A 1LT5D 1PZKD 1TS5A 3ND8A 3VRBB 5LNK1 4NMZA 1IGCA 2H88B 1EYDA 3O13A 3BDCA 3VYUA 3J9CA 2PW5A 4YIJA 4MH8A 4FF3A 4BY1B 2R92B 1QB5D 5C4HA 2K03A 1PLFA 5M5YB 2F0PA 1I4RA 2G9HD 1PGAA 2K5PA 1PTOH 3T53B 3HOWB 3IT4B 2PCFB 2R3ZA 1F2YA 4QIWB 4XT1B 2GI9A 4KN4C 4XQNA 1UEAB 1FIQA 2RDFA 4K8JA 4H2AA 4NKLA 1X32A 3NHHA 2D5GA 2JE6I 2TSSA 1TKYA 3I3CA 5EQ0A 1N5WA 5CR3A 1FRRA 1JROA 2GA4B 3P1MA 4EQOA 5KYIA 2Z1CA 2EXZA 4K8IA 4FO2A 3C1EA 3K5LA 1K53A 4KD3A 2PPBC 4C3HB 1SDFA 5BYQA 1D1IA 1DOIA 5C6AA 2CHBD 4JPSA 4PMWA 4B0MA 5IGGA 2RSOA 1C77A 1ESFA 1RODA 1ZXHA 2QCPX 3FVQA 1BXTA 1QWYA 2JP1A 1IKMA 2B2WA 4UAIA 3PIP3 4IZ8A 1VDVA 3X3MA 4RAUC 5JOBA 3GD7A 4HCEA 5C0XI 4DGZA 3NTIA 2V4IB 3T56B 1EM7A 3P4RB 2ICEC 2EYLA 1KH0A 5T1GA 2E2DC 4N59A 4ZRPA 1DOKA 2TMPA 3Q0AA 1CTMA 1STHA 3TMEA 4R8IA 2RKSA 1CZPA 3K59A 5FLXL 1SNOA 2F3WA 2XWJB 3NRZA 3PZ8A 2B2VA 3D3RA 2QEJC 4DXFA 3C8YA 5DAUA 2YYZA 3GTKB 5EE1A 2X6LA 1S5DD 1STAA 2F3VA 3U2SC 5JPNC 3BK1A 1PTOC 2AQ2B 5H92C 3OOCA 1L6UA 2J53A 1FEHA 1SNPA 2KHSA 2SOBA 3BWUD 5AUKA 1F2ZA 3AV8A 1L0YB 1XWEA 2NN6I 3K58A 2NTSA 2F0UA 2EDGA 1ZYRD 3PUZA 5LHY1 3A54A 2VXWA 2J7ZA 4OVZA 3W5UB 1SNQA 3AB9A 4MM3B 1J8IA 4QUFA 1I6VC 1LTID 2EYHA 3BZDB 3VRAB 2NVQB 4O42A 1EL0A 1T5XD 1OQRA 2K5DA 4R8NA 4CKBA 3GS2A 1RF2D 4RGMA 1N5XA 1SYEA 2IJ0A 2KN4A 3MXGA 1P7EA 2NBFA 3TEYA 1QF6A 3MC0B 4M0WA 1DZ1A 3KLSX 1EWCA 3H6MA 2JU6X 3P4SB 1HFGA 1SSNA 4HKQA 3NQTA 1FFUA 3I72A 3SDZA 4REZA 1A3VA 2F0GA 1MHHE 2HCIA 3L7ZC 1F2MA 1PTOF 2L1BA 5IGDA 1WTWA 3AMUA 3UI2A 5E6JA 3I73A 4Q2JA 2JA5B 5M5XB 2B2VC 5JPMC 4LK1C 1IW7D 2XNAC 4K5VA 2W3RA 5DNFA 2HQEA 2CJNA 5ELDA 4FXKC 4L8JA 2XVSA 4JWSC 3ZQ4A 3DXJC 3T4AC 2OXPA 3P20A 1STNA 1KFYB 5KGUA 3C3LA 1AN8A 2A6HC 5BYRA 4YXDB 1WTPA 4XQJA 5KEEA 3E9SA 1QLBB 1FMAD 1DCZA 1CQFA 4NAWB 2FE8A 5G3LD 3VA7A 1MI0A 1YNJD 2B8GA 1QOHA 1IKLA 2YU9B 1J9OA 3GV3A 5CV5A 1WRIA 4KKSA 2KECA 1M8AA 2E74C 3GV6A 2BW2A 3MFGA 4BWGB 1FNWA 1Z47A 5F2DA 5EE0A 1H9MA 1UAPA 2L55A 2IGHA 1IBXB 2L0CA 3PO2B 1XLQA 1WGKA 2M19A 4WAFA 3VYTA 1Y8OB 2MJ8A 1C4CA 2WXGA 3FC4A 3AE1B 1GUTA 1SYBA 5EGTA 4C3JG 3AE4B 1EEID 4K14A 1RJTA 2I07B 5KNDA 4KY7A 1LTAD 4US8A