3SEBA

Staphylococcal enterotoxin b
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
238
structure length
238
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
total genus 73
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sebA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sebA02
1BCPF 1ESFA 1EEFD 1LTSD 1SE4A 1SE3A 2CHBD 1AN8A 1PTOH 1S5FD 1HA5A 3R8BA 1JWUD 1ET6A 1LT3D 1S5DD 2O2LD 3BVGA 2XRSD 3EA6A 1SBBB 2AQ1B 1LT4D 1LTGD 4BWGB 1PRTC 2QEJC 2AQ2B 1LT6D 3BVZA 1SJHD 4RFBA 4UDUC 4RHRA 2J4XA 2NTTA 4ZYSA 1KTKA 1PTOF 3TSSA 1JWMD 1KLUD 5D3IB 1ET9A 1I4PA 1L0YB 1EU4A 1S5BD 1BCPC 1CK1A 1EEID 2XNAC 1JCKB 3V05A 2IPKD 3DWPA 5FKAC 3OWEB 4C56C 3SEBA 1JQYD 1D5XC 1LTTD 1UNSA 1D5MC 1LT5D 1LLRD 1FNWA 1I4QA 1TS5A 1LTID 3EFXD 1V1PB 3CHBD 2ICIA 2R61A 3URYA 1SEBD 1PTOC 2IJ0A 2Z8LA 3MFGA 1RDPD 1V1PA 4NZLB 1STEA 1LTAD 3BZDB 1JWSD 4TSSA 2TSSA 1HQRD 2XRQD 3MC0B 1YN5A 1I4RA 1HXYD 1PRTB 1SXTA 3DWQA 2QILA 3W2DA 5ELDA 1EU3A 4RHSA 5ELBA 1PZJD 1DJRD 4K6LA 2NTSA 1XXGA 2SEBD 1T5XD 3BVMA 1QILA 5ELCA 1BCPB 1TS2A 1CQVA 1YN3A 4DXGA 1B1ZA 1I4XA 3DWAA 1G8ZD 4RCOA 1TY0A 5ELFA 1M4VA 4O1NA 1XTCD 1YN4A 4Z9CB 1D5ZC 1HTLD 1JR0D 1B44D 1CT1D 3GP7A 1PTOB 1TS4A 1FD7D 5D3DA 1ENFA 1UUPA 4DXFA 1RD9D 5I4DA 1BXTA 1KLGD 1DYQA 4L63B 1D6EC 3R2IA 1S5CD 1LO5D 1FNVA 1LTBD 1RF2D 1L0XB 2G9HD 1EFID 1PYWD 3BYYB 1GOZA 1PRTD 4RGOS 1SE2A 2RDGA 1I4GA 1CHQD 3KLSX 1PTOD 1SJED 1V1OA 5FK9C 1PZKD 1MD2D 1FNUA 1FGBD 4OHJA 1F77A 5TSSA 1LTRD 1AW7A 1PRTF 2XN9C 1TS3A 2AQ3B 4RGNA 4RGMA 1BCPD 1CHPD 5ELEA 1TY2A 3BYTB 4RH6A 1PZID 2RDHA 2WV6D 4RGTA 1S5ED 4L6TB 1RCVD 1I4HA 1EWCA 3R2TA 3O13A
chains in the Genus database with same CATH superfamily
3H09A 4CJ0B 4TQUS 4BY1B 1XNRL 3CRKC 1L2NA 4P1BC 1Q1EA 1YNJC 1RAXA 2I1KA 3FAHA 4LNNA 4PS7A 1HA5A 2IO2B 2W82A 4JBMA 2B3AA 2BCOA 1FFVA 2B2WC 1QG7A 2PEAA 3A8IE 2C7HA 1G6PA 1WWTA 2IZVB 1U4PA 3C8YA 4W9IA 3K5MA 3NHHA 4MDKE 2P5ZX 2D3GA 4X3KA 4MN3A 5JJKA 1KQSA 1MHWC 1UBQA 3MFYA 4CHKA 3K8AA 3S14H 5AZFA 5J3BA 4KGRA 2PPHA 2NZ1D 2JA7B 1VQBA 3OWEB 4NNJB 4LW1A 2OF1A 1LT5D 5E6NA 2M1MA 1I94Q 2F0WA 1UGJA 1XMQQ 1UAPA 4BY7G 3MJWA 2SOBA 3JSVB 4JI5L 2WACA 4ULLA 3KK7A 5HGQA 1G91A 1TT5B 2EMSA 3V96A 3KYDD 2R7FA 3FILB 2KN4A 1VLBA 4IALA 2K04A 2WKDA 1WXSA 4DAYB 5GADC 4KHPQ 3EFCA 2B2YC 3PGEA 1NUCA 2PO4A 1EIHA 1YN5A 3STBC 2L8JA 1RYJA 1O7IA 3DLLA 5CBAE 3GV6A 4B3SL 5C3JB 2IX3A 2UXDQ 4A3PA 1HUNA 2EY1A 1WCMG 4N8X1 2MJ3A 3ABVB 5C3EH 3T4AC 3VDYA 1N8RC 2CWAA 4K6LA 2NTSA 1C4QA 1TWFB 4A3GG 1X1MA 1J5EQ 2EPBA 4XTCS 2UXDL 1NYQA 1TS2A 4DR6L 3I3TB 1NDDA 2BS3B 2LRWA 4BVUC 3S1MH 3S1QH 3HKZE 3I91A 2GRIA 1A3TA 1PXUA 3FKIH 3M7GA 1RLFA 2KCCA 5C0XJ 2KO3A 4F7XA 4MNOA 2DNCA 3LGJA 5A2QE 2YU9H 2KHIA 4O1NA 4K81A 3TMPB 2F0GA 3S2DH 4E71A 1QZHA 3TP6A 1K0SA 1BKBA 4IDIA 1PH2A 4ME3A 4WJ3M 2BKFA 4XWTA 2VB3X 2JPHA 2QDFA 4FHKA 1EQTA 2N7DA 3AB5A 1C9OA 5C0XH 1PFMA 1KM7A 1E0BA 2LS01 1OTCA 2IO1B 4EZKA 5AFWA 2R7ZB 1K3BC 3HUIA 2ZW1A 4OO1H 1DOXA 3NWSA 3VUYA 4RGOS 2UXBQ 5C0XI 1EZ8A 1XPUA 1VQNA 1NR4A 4JVZA 1GKHA 1TYGB 1C8CA 3ND9A 5GROA 4OO1I 1ZKOA 5C4ZA 4A3MB 1QZGA 3QHTA 2UXBL 4DAYA 1YIWA 2IGDA 5T8IA 2R3ZA 3U4EG 1G6JA 4A93G 1UD7A 4W9JA 3TBLD 4A8XC 4AJYB 2JA6H 1WTOA 2AMCB 2LSSA 1GHKA 1X65A 1LQBA 1H9SB 1SDFA 2M2LA 3QIJA 4HJ8A 5G3LD 4L6TB 4O42A 2A19A 3EBEA 1EWCA 4JI7L 4DK1A 2N9KA 1ONLA 1YBYA 3O13A 5C4JH 2K05A 2EJGC 4J8QA 2K1FA 2RPQA 1PH5A 1VQFA 5JEAJ 4B3TQ 4QUCA 1MVKA 4TQ0A 5I9OA 4HWIB 2K03A 1Q8IA 2O2VA 3IAYA 3MHBA 4JW0A 4NXNL 4WORA 3GZNB 3RCZA 4ILWA 2V3NA 2V4LA 2AQ1B 3S17H 3VA7A 2EY6A 3Q8EA 2WXRA 4XXEA 1LTGD 1R4QB 2MO0A 2AL3A 2BF8B 2BYVE 2C7NB 1SROA 4HKZE 2NVUI 2KHWB 2KMCA 3EROA 4ZRZA 2KQ7A 3S2AA 5GXGB 2MBBB 2ZXRA 1IYJB 2FINB 2IL8A 2NTTA 3NK9A 4LK1C 2D2QA 1VF5C 4RF1A 5G5HA 1J9OA 2Z6KC 3K7AB 2WP8J 2CH4A 1E1TA 1S5BD 4DV0L 3GTKH 2AWTA 2MJ8A 2PW9A 2MJDA 5IGDA 3QWZB 3DWPA 3PO3G 2ON8A 2Y5BB 4IC7B 4R1JA 3C46A 3RMKC 2UUAL 3M4PA 1LLRD 4Y7NB 4IFDH 3NQIA 2WXHA 1WOCA 2LVOA 1IXRA 1VZ8A 2F4VL 2N55A 2QDBA 4XQNA 3SVMA 2V9HA 3D32A 4GDKA 1A2UA 2N78A 3HZXA 4HR7B 3AEVA 4GNXA 1IKMA 5MPOA 1CA6A 5CV6A 2K4KA 4V0BA 4NPSA 1EO6A 1U4AA 2Y0SE 3K0YA 4MHEA 1C9FA 3PF5A 3S1NH 3RZFA 1OQRA 5D6JB 3ZJVA 2B2YA 5JPMC 3KVFB 3U8ZA 4WRDA 3CCQA 2GLSA 3LWUA 2MFIA 2F0MA 3HP3A 3MWYW 1XNQL 3ZXVA 4TRDA 4H7BA 3CWIA 1BF4A 1TTNA 4L2YA 4K7SA 1TKYA 2DZKA 4E3CA 2Z6KA 4MSMB 3T13A 2WGSA 2K1BA 3KF8A 5ELBA 2EQSA 2L9HA 3RLOA 5E6PA 4HEDA 4B3RL 3NENA 5EBCA 1N34Q 3CC2A 3F2BA 2Y0SB 4ANWA 2JA5H 3N9YC 1V43A 5A2QL 3DWAA 2DAJA 5AZHA 1Q3LA 3T8MA 3TZUA 2MQJA 1D5ZC 4PMWA 1XPRA 4JI0Q 1JRPA 2JU6X 1VQMA 2K75A 4XYCA 1ROEA 3HM6X 4DK0A 5JHBA 1BUIC 4WH4A 4PQXA 2PE9A 1D6EC 1FVIA 3SDZA 1Y1WG 1NVID 3VR4A 3AECB 2KJHB 2BS2B 3MAQA 1PYWD 1KLVA 2KK8A 2EY5A 1SFOB 4JI6L 5M3MH 2CHWA 4C1NK 1TWHH 1JMLA 2LD9A 2DJFC 4APVA 3RULA 3TIXA 4BY1G 3PV1A 3W9CB 3I55A 4JV5Q 5BN5A 3HOUG 2K3UA 1HZCA 5LL6S 3DEOA 4BOZB 1CJEA 4XWWA 2AQ3B 4GN3B 3KBXA 1YIJA 1IBML 4II2B 1UEAB 2C9WB 4ASWC 1SAPA 1EWYC 4BKSD 5IO9A 3W3AA 3BDOA 4RGTA 2GI9A 4QAYA 4K14A 2R2OA 4DUZQ 3WIMA 1ESFA 1LTSD 3H9DA 4LF6L 4L5QA 2FUG1 2RDBC 1I3QB 1VMCA 4K6DA 1AN8A 4K5XA 5C3EG 4HIMA 1S5FD 4JBKA 4LF5Q 1J7AA 1JWUD 5M3FB 1E5WA 1WX7A 1HPCA 2CJNA 3D3RA 3K81C 2B2VC 4JI1L 5DPSA 1GB4A 3KJOA 2MCNB 4LF4L 1LT4D 2PMVA 1HJPA 3VXWA 2JA5B 3G6JB 5KHQA 4XC2A 1KDCA 1HNZL 1D1IA 1IBKL 2ZTEA 3CCLA 2SNSA 4XQQA 1YNTE 2G45B 4JC0A 3SK5A 3AE7B 4A3IB 4XDCA 3VTWA 3ZJTA 2ZTCA 1WXAA 1UE7A 3T1YL 1NMFA 1GNUA 2WIIB 5EPJA 4CDFC 4MGZE 2LHDA 1E9MA 4PS3A 2QSDA 5CX3A 2PW7A 1STAA 1W3SA 2L0TA 2V4DA 4GMVA 3CCMA 2FNJB 2CQAA 1JE4A 2JXMB 2YYZA 3NPPA 2X38A 3Q8AA 4IPDA 3ZLZA 2X69A 5IE8A 5FLXL 1VJKA 1YOVB 2MP2B 2VRRB 4HXDA 1N61A 1NCVA 4JX1C 2DNEA 1GHJA 4PG3A 4EX5A 4GOPB 3KH0A 4G11A 2PMZB 3ZJUA 2IJ0A 1KIXA 2GBRA 4KKIA 3D6CA 2J0MA 1I7HA 3HOWG 1A6XA 2ES2A 3Q3FA 1C4CA 4A3DH 3VR9B 5D7GA 5DM73 4IOIE 1AZPA 2K5QA 2C60A 2Z9HA 1WI5A 1WRDB 2KA7A 4WWOA 1XTDA 2H4OA 1E7UA 4TQ1A 4KDIC 2F0TA 1K50A 2NVTH 3BVMA 1FGUA 3RD4A 1NR2A 2CHZA 2RBMA 1CQVA 1Q0WB 3P2BA 4IM3A 2JJQA 4IO9A 4HCNB 4L8JA 1E22A 5LMNL 2INPE 4MZ9A 1XTCD 1I6HB 1QKZA 5IYCG 3S1RB 1ILPA 1YN4A 3MJ5A 3PUYA 4DAVA 4FXGC 1EYGA 3B2GA 2KJ6A 4QB4A 4PYUA 4KD3A 4CQNA 2YTYA 1GUSA 4X64L 2GOWA 2KN5A 1KAWA 3CRLC 4CKBA 3L0OA 5IA7A 2K5WA 3R2IA 1F2YA 4X65L 1RF2D 2JA6G 1EFID 2BPSA 2FUHB 2NS5A 4DAPA 2HT1A 3NQTA 1J7BA 4HVBA 2B2UA 4B9WA 2KENA 3A55A 4DR6Q 1ZGUB 5HFYA 5FLXc 3GD7A 1N63A 1SJED 4A3FG 2PLPA 1VQKA 4I7AA 3VR8B 1VQDA 4MTNA 2R92B 5C23A 2E76C 2FMCA 1WD0A 3I2ZA 2KWVB 1A15A 3KF6A 4W9HA 4J6IA 1MI2A 3OWFA 3AE9B 4RGNA 3GS2A 4CBVA 2MWSB 4K7UA 4P71A 3DM1A 2A69C 1Y8PB 1XD3B 2ACZB 1VQ7A 3I72A 4PS8A 3QARA 3PQIA 2ALYB 4NMZA 2HCCA 3F2CA 2IHFA 4GKKQ 4WWNA 2CH4W 3TEHB 3IHPC 4A55A 2WXLA 1SE4A 5E6OA 2FIFA 1STNA 5IODA 1SGHA 3ZVVA 4F1SA 1XNQQ 4N9TA 4X3TA 3OMGA 4HDOA 4GKKL 3CC4A 3A5UA 5C5LA 4C2MB 4C7ZA 1B9NA 2BA0A 1WFYA 1SE9A 4LUVA 2M0XA 4B95A 5DPTA 2IW3A 1YMHE 1D1KA 4EZJA 2L3ZA 1GJZA 1X3QA 2G9DA 3PZ8A 3NTIA 2L7RA 3H0GB 4MEMA 3GTPH 2UXCL 4KN7C 2NVTB 4ZYSA 2ENBA 4JLCA 4BBSH 3P1MA 4I6NB 2F0QA 3NRZA 3G7LA 3SHLA 1WGDA 3M63B 4MSQB 3ENEA 1WTWA 3Q3OC 5IYDH 1BMLC 3FC4A 2IPKD 1I5FA 2F0FA 1A0IA 4NKLA 5BO4B 4DV6Q 2PCFB 3WAMA 1XEEA 3I4MH 1ICFB 2KQ3A 2JZ3B 4WJOA 1TVXA 4IPHA 1N33Q 2F0JA 4M02A 4KZ0A 3W1SC 3URYA 1N32L 1AE3A 1N36L 1SEBD 1X56A 2LGXA 4OX9Q 2EXDA 2PIAA 5CHVC 1STEA 1F2LA 2XWBB 2WDVB 3KFUA 2KDIA 4TSSA 1YJ9A 2VS1A 1M8AA 4RMFA 5EPKA 3A54A 4A75A 1K9MC 3RFZB 4A3JH 4L1BA 3OJ4B 1E8ZA 3NOBA 3CW2C 3U50C 4ZRKA 4LFCQ 2D3AA 3GE3C 1PVOA 4MELA 4POFA 1YX6B 2NBVB 2V3SA 4BXXG 2MBHA 4IUQA 3PTFC 2G5DA 4XYOA 4LF4Q 1L6VA 4YSZB 2F4VQ 1WF9A 2JA8B 4PK1A 3CIRB 1XYIA 4HIOA 4ARIA 4WJNA 3J80c 2Q2UA 4HIKA 2JZPA 4YIJA 4X66L 2B63H 1JROA 5JEAG 4R3DA 5CHFA 3VQIA 3W5OA 3GP7A 1STHA 1OO9B 1BO0A 4ZRIA 3RUIB 1BBUA 2NVXH 3H1UA 4M00A 1TXYA 2JA5G 3JW0X 3H3VI 4BY1H 3AE6B 1IW7C 3DCGA 3NHEB 4XZ4A 2GBKA 5BYQA 4IURA 1E0ZA 2EKEC 4GLSC 4JK1C 1YHQA 1S5CD 4P73A 2I2YA 3PRPB 4HPLB 3VR2A 1FJGL 2K39A 1V6EA 1SR3A 1HA6A 4IPCA 1XF5L 1EYDA 3RI7C 2DUDA 3NSWA 1L2FA 3CF5A 2KDBA 3GV3A 5EPLA 1KRTA 3S2HB 1CTMA 2N7JA 4AJWA 2XSCA 2WAQG 4FULA 2K01A 3S17B 1VQAA 4KY7A 4DV1Q 4GLVB 3GTLH 2F1MA 3L08A 4K7WA 2W3RA 1IBLL 1JB3A 4AIMA 4IUMB 5GAGC 1Q1OA 2KDMA 2KMMA 4MH8A 1EYCA 1SRUA 2PNHA 1Z6HA 3L10B 3TEWA 4LFAL 2K5NA 3DHGC 4BY7B 4WFN3 3NWTA 2ZNVC 1JWBD 3NZ3A 1WY8A 3B0AA 4XQJA 5KNBA 2QEXA 2BQQA 1RKNA 4BAXA 2NVQH 2KLGA 4RA8A 1JOQA 1ZYRC 4ZK9B 2RR9A 4P74A 5CR3A 2KX3A 4WQMA 1RIPA 1ENAA 2FIDA 3APFA 2GB1A 2N1VA 1VMPA 3BS1A 1QZEA 3BG3A 4DAMA 1QOGA 1TT2A 2QEJC 3APDA 3MC9A 3BK2A 4G3XB 4RFBA 2NBFA 3W1GA 4HJ7A 4W9LA 1HNXQ 4B3TL 5FLXE 2FXQA 2R6GA 1P1AA 2OWOA 3AMUA 3CKIB 4GDLB 2TMPA 2A69D 1R4NB 4HPPA 4NXNQ 3R7RA 3ONAB 3A7AB 1PYSB 1FYCA 3M3YH 2WYQA 3WAOA 3E9SA 3QC8B 1F2RC 3K58A 1J5EL 4NQKE 3GTJB 5KGUA 1QVGA 4GU2A 1V9PA 2PW5A 1ZW7A 3GTOH 1V1PB 2MHJA 3OSOA 3G71A 2JA7G 2HJ8A 4BY7H 1W2BA 3E9HA 2D0OA 1XCQL 3MFGA 3CCSA 5CORA 3OHXC 4LNOA 3K0XA 4B3ML 4DHJD 4L5TA 4F8MA 1AARA 3GTPB 4GOPC 1WD1A 3AE2B 4EKUA 1ESRA 1E10A 1PRTB 3NBIA 2VY3A 3E5SA 3MZ5A 2W3SA 2WHIA 2EYLA 2BKRB 1IHZA 5CMDA 3ZTCA 2EE1A 3K7AH 3VR6A 5HGTA 2JSVX 2LZ6A 1EY7A 1FXTB 2BB5A 4N58A 2RKSA 3OMCA 4EQPA 4ICUA 3GTGB 2NN6H 5D65A 3QG1A 4LF7Q 1XXGA 3DVNU 3PUZA 3V62A 3AEGB 2KFJA 3BINA 1WGRA 4G7ZC 4DDGD 1F9RA 2QCZA 2WXFA 3WANA 1YZ6A 2RSUA 1WXMA 4NQLB 1YJ1A 1CT1D 1QJOA 1FPYA 2L11A 1ZXHA 3KOJA 2ZXPA 4JBWA 1K8MA 3BZCA 3E0EA 2AL6A 4I65A 1V2YA 3M62B 2QW7A 3HOVH 5BN3A 4G50A 1PLFA 5COYA 3HOZG 3QB3A 2R92H 1EF1A 2Q2TA 2PQEA 1PUTA 1XT9B 2D07B 5EE1A 1TKWB 5C0XG 2I5MX 2N9EB 3TRZA 2JY6A 2CKHB 2BH2A 2KWDA 2SAKA 5BYSA 3PIP3 4C3IH 2J52A 3VAWA 4J15A 2L0CA 5IP9G 2F03A 3DMUA 4LF9L 1TWGB 1K83H 4JI8L 3Q23A 2WXPA 2K28A 4YY3L 5IWAQ 5JXVA 2BOSA 1GUTA 3C0RB 3I73A 5C4XB 4QQBX 1LUZA 2J7ZA 4GS3A 1F77A 5ELOA 1LTRD 2ASQA 5LNK1 3IVFA 3C1FA 5C4XG 2D10A 3RR5A 1JRUA 2BDNA 1DOYA 4A93B 5H1SE 3W1SA 4IQZA 2FCNA 3FDTA 3AEAB 5JJZA 4OIKA 3GE8C 1EIFA 5G2NA 2ATWA 3A8JE 5H92C 4DNRB 4LFCL 1E90A 3KQ4A 1TJEA 1LM0A 4B0EA 1N60A 5AEKB 2INNE 4FXDA 1SE3A 2FCQA 5BN4A 5CHWA 3FKYA 4B9KA 2KUMA 3D31A 2CVRA 1IYVA 2LJIA 4II3B 4C3HH 4JWSC 4BXXH 2LWPA 1P7FA 1PHJA 3L54A 3W5VB 2R92G 2XRSD 1QB5D 2WS3B 3GTMH 5EGTA 3GB1A 3P7JA 4EQOA 2XWJB 3SR6A 4DUZL 4A3EG 1U0LA 3TEXA 1NNXA 5L37A 2D11A 2D3BA 5CBEE 2Q2IA 4UDUC 4DHZE 1VQCA 3FILA 4A3KG 2LEKA 4WJPA 3TCAA 2AX5A 1PFSA 3CCEA 2M0AA 1QUQA 5J2RA 5IT9E 1JWAD 4DR1Q 1CZGA 3NE5B 1CUKA 2AYOB 3UDIA 4S17A 3I5JC 1I6VC 1B2TA 3ND8A 5J39A 4S3SA 1FJGQ 2A5UA 2B2TC 3C2PA 3GTOB 1RM6C 2KNBA 5IAAC 2NMQA 1E1OA 5K5PA 1TS5A 2V1CC 3AEFB 1YHBA 4A3JG 4LK0M 5G3LF 4OGQC 1PGBA 5IYDG 3VYSA 3Q8DA 4WURA 1V81A 1VDZA 4K2KA 4FLHA 4FF2A 4YL8A 1IBLQ 4KKSA 4P6VF 1CQFA 2EOTA 1WGYA 2NVYH 4C3HG 3SHQA 3HOWH 4YWGG 4GOPA 1HZ9A 2WFWA 2KDEB 3E0JA 1V49A 3A33B 4A3KB 4NW2A 1I4RA 3FVQA 3VTVA 1HXYD 5BMGA 2EY2A 2K7VA 3DWQA 3P20A 3CD6A 5JJIA 2L1BA 2A6EC 1YX5B 2E3TA 3AMZA 5C4XH 4HJKA 4BKGA 3IAS1 2N3SA 1OXVA 2ZZPB 2JQOA 3K80C 1DGSA 4OL7A 2RCNA 2QF7A 3FPUB 1VQJA 1KFYB 1P0RA 1UE5A 5JHAA 2O6VA 1N32Q 4A20A 2IO0B 2QA4A 4EUTA 4BBRG 1K3RA 1VQ4A 4WJWA 3H8HA 3PS6A 4JWUC 4PYZA 1LYLA 4I6PA 1YQ4B 3RT3B 4IPGA 3ZUNA 4X57B 4NXML 1JR0D 1ASZA 1X6OA 2JYTA 3KBGA 2E8GA 1U4RA 1MKHA 2CS4A 1PDQA 1OGWA 4X64Q 1DXMA 1XPOA 4EQ5A 4LFBQ 1AWDA 4HLEA 4DXFA 1PGAA 4JYAQ 3TP7A 3QJZA 1I50H 4NXMQ 1Y1WH 3NUHB 4BBSG 1JE5A 3PT2B 4H02A 1E7PB 3I57A 2UU7A 1LO5D 3QX1A 4RKLA 5M3MB 2ZNVB 3ZIMA 3F2DA 3ZNZB 4LJPB 4C3JH 1NAPA 4X3SA 4KKJA 1ZDXA 1YEZA 5M3MG 1HEZE 2NZOA 1VDVA 2DX5B 2J42A 1I4GA 2WB1G 1CI3M 4XDXA 4JI1Q 2WDTB 3MVVA 4MGIE 1DM0B 1HH2P 3NUCA 1K0RA 1V1OA 2LY7A 2KCMA 4AS1A 3VVWB 2XIWA 2BE5D 2KEDA 1X3FA 4ZCKA 4A3FH 3BWUD 3TDQA 2A73B 3AM9A 2JRHA 5D94A 1MHXA 4H13C 4L23A 1GAQB 1B70B 3HKZG 4IJHA 2NVXB 4CO7A 4FA6A 3PV0A 3EECA 3C1EA 4WAFA 4XE0A 3SE0A 1J8CA 5DNFA 1X3EA 2BWFA 3IKJA 1S5ED 1CFMA 1C77A 3EHVA 4Q2JA 3HOZB 4XGAB 5KEEA 1OEYJ 4YTNB 4HSPA 5CTRC 5C5MA 4A3GH 2CHBD 4ZKCB 3C19A 4FNFA 2KECA 4GDLA 5LMUQ 3I8ZA 3VYTA 1PTOH 1WMHB 5BR8Q 1HNWL 1V86A 3HIZA 2F0HA 3RZOB 4ZKBB 4B3RQ 4CKEA 2E2IB 4OWTB 2E6XA 1V8QA 1MHHE 3Q3NC 3RLNA 5JEAH 1IPGA 4CJ1B 4MM3A 3OIPA 2VNUD 3QQ8B 3SFEB 2F0DA 3RUZA 4Y52H 1OTRB 3U52E 5E1FA 3V61A 1PTOF 1G2SA 4RM8A 5KNCA 1Q12A 3PO2H 3DVNV 1KLUD 2M4NA 4A4IA 2WDRB 5EE9A 3PO3H 3DBHI 4IOAA 5JVG3 1P8LA 2HD5B 4W9KA 3ML9A 2HIVA 2NN6I 5FO7B 3J81E 1OFFA 1OXUA 1WX9A 2WX0A 3V60A 2MBEA 2F0EA 4KKTA 1UNSA 3I4MB 2JWZA 1YVCA 1I3QH 3UE0A 1FO4A 2JE6I 4AQYQ 3I4NG 4DR4Q 1Z47A 2R61A 1EUJA 4YHHL 1KC8C 3PF4A 4OZCA 5M5XB 2KJRA 2WB1B 1I35A 2YV5A 3DXJC 3M4QA 4A3DG 1HHVA 4LUZA 4GKJL 3RYTA 4JV5L 4DHZB 1LXDA 3ULJA 3CCJA 1ZOYB 1S4ZA 4OX9L 2MO1A 3VR5A 1V97A 2H1EA 4QY7A 3T53B 1AH9A 2QGQA 3AE3B 4IUUA 3ZXRA 3SGIA 4DV7Q 1D4BA 1E7VA 1XMOL 4JI4L 3OG5A 1TWHB 4FADA 1PZJD 5IGFA 3TEZA 1C0AA 1EM7A 5FO8B 4LNFA 4KZCA 1X55A 1EQVA 4LDTD 1SF0A 1CKNB 3UGBB 1KABA 3J80L 4C00A 4X66Q 1XLPA 1PH9A 2JXTA 4J3OD 3QOLA 1Q46A 1JOKA 5IT9L 3OLMD 2M56B 3V6CB 2CCZA 1MIUA 4K3BA 3W5UB 4JI2L 2ZCBA 3I9V1 3VUWA 4A9AA 2A6HC 4KHVA 1C7YA 3H15A 2F4IA 1KJTA 1P7EA 2JYOA 3BDCA 3ML8A 5D3DA 2OJWA 1QQRA 2FAZA 4YXDB 4OW0A 4W9DA 5GAHC 3W1YA 4DR5L 4A3MH 2WU5B 4RAUC 1WTPA 4MTKA 1ASYA 2BT6A 3DHIC 3STBD 3N1ZC 4DNIA 4URKA 3I56A 1BBXC 3HOVG 5IP7H 4A93H 1L5PA 3B1LX 2I5LX 2R7ZH 4HKQA 2JYEA 2PYKA 1H4RA 2OEDA 4LF8L 3ITPA 4P2CB 1NY4A 2C9OA 4A3JB 2X8XX 1AW7A 1SSOA 2AKWB 1CZPA 1K83B 4LMQD 2EKIA 4OO1G 3D6WA 1XQQA 2IX0A 2E5LQ 4KTAA 1S1QB 1E7ZA 2UYZB 2ZJRA 3MA2B 1I6HH 2N88A 1WTXA 2K5HA 4YTPB 1RCVD 1I4HA 2K6DB 3DBRI 1FCLA 3VUXA 2A4ZA 1EEFD 2MX2A 4HN7A 4EVOA 1WXVA 2EYPA 5E4WC 2JA8G 1U4LA 3NEMA 4IFDI 1LACA 2O2LD 4A3MG 3GTLB 1E2VA 1SBBB 2LFNA 1R4MI 4JI3L 3RZDB 5C3XA 2EMTA 4JGHB 3ER0A 5GAEC 1Y56A 3N3KB 3AFQA 5IYBG 2YTVA 1IGDA 3GTGH 3BDLA 1EQQA 4W9FA 2F52A 3V6EB 2UU9L 1ET9A 2V3PA 3HOYB 5IY0A 3T3NA 1CZWA 1EEID 1I50B 1R4PB 3V05A 4IOCA 3U58A 5G55A 1T6BX 2GBNA 3MEFA 2YLMA 5AZGA 3VYRA 5CC4A 1LFDA 2L55A 1DOKA 4LWCA 4R8NA 2B3GA 5J1ZA 2VQFQ 3GTQH 1HNXL 4P1CC 1HTPA 1FMAD 2ICIA 2WXOA 1SMXA 4DA2A 1GG3A 2LRUA 4IWPA 1ZP0B 1ZUD2 4W9EA 3DVGX 1YNXA 3H91A 4R8IA 4EZLA 2O6VD 4MM3B 2PZWA 1VQ6A 3A9JA 4A3OA 4X62L 1V1PA 1TWAH 3OJ3A 2PZTA 5JH5C 2XRQD 3UQBA 3IG3A 4HAEA 4DR1L 2N7EA 4MJSB 4AP4C 1K8AC 2XK5B 3H7PA 1WX8A 3LWEA 3DWMA 4DFAA 3K9PB 2G4DB 2REXA 4N59A 1HNWQ 3OTOQ 3QA8A 4ZRQA 1DJRD 1DOMA 4GZYC 2RGFA 3NG0A 3AULA 2K0PA 5GMVA 3X23A 2PVGC 4K0KL 4DV5Q 3S15H 1JJ2A 1H9KA 1LTLA 4ANXA 2EYHA 1O80A 1SNCA 3J7ZC 1NI2A 2W54A 4GNXC 3ZGZA 2JXXA 4HPMB 1PH3A 2MBQA 4EFOA 3GO5A 4U68A 1TZOA 1PTOB 3OOCA 5IGBA 3S2DB 2GMIC 3CMMB 4LDTB 1ENFA 2ASBA 2M17A 3AXCA 1TIFA 1JJCB 1PV4A 2WNMA 2MHVA 3PLVA 1FFUA 4R4QA 4JI0L 3FKIB 1E8YA 3UINB 3T56B 2PVOD 5IYBH 2XGTA 1SFOH 2QJLA 4REZA 3RD2A 4IUVA 1GOZA 4R4OA 5JPNC 3H0GH 2Z4HA 1M1KC 3KDFB 1N34L 4EOYA 3N52A 3M95A 4TVAB 4BBNF 1FNUA 2F0VA 1J6QA 1FM0D 1QVCA 2NWGA 2N9XA 3DM3A 1HUMA 2JEBI 1UF0A 2DLBA 2IY5B 2LFIA 1GM5A 1A2TA 5KNDA 1A3VA 3R3OA 1DZ1A 3NJTA 2FHTA 4R4TA 4C4VB 1Y8NB 4A3DB 2RDHA 2DYMA 4UP7A 4B6WA 1PDXA 4DV4L 4A3BB 1ACCA 1VCBA 2KDFB 4B0MA 2ZXOA 2C5CA 1D2BA 3NVYA 3FKIG 2OXPA 1UH6A 3VHTC 5ELNA 4KHZA 3J81c 4KLKA 1Z7TA 4H0LC 1LT3D 3KF8B 4O2DA 2A68C 1Y8OB 2Y3AA 4OXPA 2PZUA 1FEHA 2D5DA 1ZKHA 1HTOA 3KUZA 4KV2A 1YJNA 5K36H 5CV5A 4PNYA 3JC66 2LJ5A 4JQWC 3S1NB 3I7FA 4XT3B 4C3IB 5E7NA 3KF6B 1YJWA 3K9OB 4LTUA 4GNXB 3OIQA 4FHJA 4X3UA 3Q2AC 3IAM1 1BBWA 3MXNB 3P4RB 1JCKB 1IKLA 2JN4A 3GTQB 2VZKD 1GC6A 3AE4B 3C3LA 2KD0A 4C56C 4NJCA 1D5XC 1IL2A 3VYUA 2KKCA 3RPFC 4PMCA 2HQEA 1LTID 4K5VA 1VQPA 3K5OA 2MA9B 3MXUA 1YD8U 3GTKB 2MEKA 4TKOB 2CW0D 3GDEA 1MJCA 2KTFA 3ZNGC 4HMIA 3DBLI 4FJVB 2R2QA 5M9OA 3KWVA 3TMEA 2D62A 2GN5A 2PI2E 2PQAA 1WTVA 1HNZQ 2TSSA 4KI0A 1MJDA 1TKGA 3D4WA 3CCUA 1DD2A 1ICWA 2CU3A 3RZDH 2JWUA 1CM9A 1BVSA 2KANA 2HTME 1B8AA 1A5RA 2B8FA 3P1HA 3A7LA 4BA1I 1VQOA 1ZPSA 1E6EB 1HZAA 1LABA 4YWKA 2LUMA 2Y5PA 2NN6G 4KGTA 5EE3A 4LFAQ 1KRSA 4MIUA 2SEBD 4US9A 4RF0A 5IT9c 1BCPB 1T3QA 4YY3Q 5IWAL 2RPVA 2WXKA 3BIID 1UGMA 3NS1A 2I0QA 4GXBA 3PMFA 2KXJA 4F88A 2EJMA 1I4XA 3JAMi 1H8CA 4YWMA 5ELFA 4IJLA 3IFDA 4LUOA 4EGVA 4KHPL 4US8A 3OW7A 4BBRB 4OELB 1QWYA 3KLRA 3DPDA 4GN4B 5EDSA 2F0UA 5E3FA 2R7ZG 2WLBA 5EQ0A 3SDLC 2NUCA 2O5JC 4G7HC 4NAWB 1WI0A 4IFDG 3B2FA 2A68D 1XLQA 2QDLA 4D2KA 2ZJPA 1S72A 1PRTD 2KACA 3HGBA 2UU9Q 1U5KA 4FP5D 3ULLA 4DN4M 4B3SQ 4OVUA 2KVZA 1PTOD 2QIEB 4TV3A 5L83A 3AU4A 4IFDJ 2PQAB 4JYAL 1WCMH 1RJTA 3MTSA 3L4PA 1KNAA 2EJFC 1MJEA 4LF5L 1KH0A 1SB3C 3EJIA 1A70A 3S9WA 1K8OA 1VZ6A 4IM2A 4ZHPA 1KD1C 1SYGA 4X6AH 2KBNA 2BB6A 1KRHA 4POGA 1TS4A 3KJPA 1P3QU 3HOXH 1J8IA 5HHDG 1VCIA 4DUYL 1X9NA 3HOVB 4N6EB 3HVDA 1A62A 1A63A 2ZPYA 3M4YA 3UDFA 1Y1VG 1QE6A 2UUAQ 2DYOA 1CA5A 1F2ZA 3BVGA 3B6YA 3E6ZX 2B63G 3HOYH 1PFBA 4LJOB 4NDXA 5IYCH 3PIOA 2JX5A 4RCNA 2JEAI 3ERQA 4HCPB 3OYYA 1LT6D 4KJNA 3CPWA 3BVZA 3J7A5 1E8XA 3L0WB 4JE3B 4KX6B 4OIJA 1EY9A 2D2CC 3BU2A 4FYDA 1PH8A 3RNCC 3M4OH 3KUCB 2WXJA 5BYRA 4I7ZC 3UIPB 2EYOA 3X3NA 4JI7Q 1VQHA 2OQ0A 1H9RA 3K59A 3VRAB 4N8FA 2N8NA 3UDXA 4KSLC 2HCIA 4WAAA 3KWLA 1Q82C 3ALBA 1C4AA 3ZRFA 4FN2A 3AYHB 1YHAA 2Y5CA 5EAYA 4YHHQ 1GPXA 3Q8FA 3EFXD 1HR0W 5IN7A 3CHBD 3M3JA 3VRBB 1AEXA 4C1NI 4DV6L 1SSNA 2K32A 3PO2B 1SYFA 3EQLC 5FR3A 2H89B 1L1OC 4LNQA 2CHXA 2ZM6L 4UP9A 1FXIA 2VH1A 5FLMG 4NZLB 1I42A 2XVSA 3GTJH 4LFBL 3QCAA 1SN8A 2YTXA 4BKSA 3FEWX 3PZDA 3Q8CA 4ZRPA 3HOYG 3TZDA 4JI6Q 4ZUIA 2L0FA 3FHWA 3W2DA 4QIWB 1WVLA 2DY7A 2K22A 4MACA 3RZOH 1FD6A 1K8RB 1EU3A 2ID0A 4RHSA 1JQ4A 1Z2MA 4M0WA 1IL8A 1VS0A 3BY4B 3WCQA 5TR5A 4OWWB 4JPSA 2A74C 5DEHA 1WJUA 4H44C 1HR0L 2J7QB 3DBHB 3AE8B 2RA4A 3T1HQ 1B50A 3G48A 4YSYB 1QNKA 1B1ZA 3TS2A 3U30A 1OXXK 4RCOA 2EIFA 4GN1A 4X62Q 5JVH3 5E4XA 1Y1VH 1F2RI 1SNPA 2MW5A 2RHSB 2KQ4X 3EIVA 5C1ZA 5IP4D 1U4MA 2KAJA 2I1JA 4OVZA 3UF8A 4E6IA 5LXHA 1IYFA 1KHIA 1BXTA 2BDOA 2KEEA 1R9TB 2MP2A 4YTMB 5EKKA 1HZBA 1HTQA 1AZQA 4IUPA 4BBSB 3NP8A 2G9HD 3TP5A 3BYYB 4KSKC 4M8MA 1FR3A 2RSNA 2INCC 3QK0A 1EY6A 2G3QB 2NBUA 4LF8Q 4DR3L 1NENB 1PH6A 3A4RA 2HDMA 1MSHA 3M7NA 1FGBD 1N9WA 1PRTF 5C3WA 3S2HH 1Q10A 2FJ2A 2E5LL 4DU9A 1UBIA 3H0GG 3L17A 3IT4B 2UUCL 2KTRB 4DPGA 4RH6A 3BJUA 3TS0A 4A3LG 2QHOA 2ZPNA 3KYCD 4ALPA 3H3VH 3I4OA 3P4SB 3SD5A 5M5XH 1DOLA 1SLJA 3D4DA 2RHQB 2EXZA 3M9BA 5DLQE 3V2TA 3X3MA 5ISRA 3FPPA 2UUCQ 1RFKA 4NJ7A 4DF7A 2BVCA 1TR5A 4ZUJA 2HDLA 4IUNA 2Z4IA 3UE1A 1KXLA 3IT6B 3LDZE 2IBIB 2CW0C 2E75C 4ZAIA 5LMNW 2HHHQ 2F0IA 3SFDB 3T51B 2RQXA 2F0PA 1XX8A 3TUOA 1B9RA 2VZKB 2VQEQ 2AQ2B 4OWXB 3EFUA 1KOTA 1OXSC 4DV1L 1H9SA 1DONA 5C4HA 3P42A 2DN8A 5J22A 3KUDB 2MBOA 3HG9A 4FBJB 5C6AA 4JCVE 2L15A 4E74A 1UEBA 4UY8C 2CKZB 2VZAA 2KCNA 4UHVA 1E3PA 2MSED 4RM9A 2PKOA 2YVCA 2XNAC 5GQOA 1D7QA 3B08A 2NR2A 1KDAA 4DQOC 5C44G 2IHEA 1GUAB 2JQRB 2L76A 2JF5A 3CP0A 2YEPB 1AP0A 2LGIA 3N32A 4K1RB 2D3CA 1UWMA 3Q69A 1TGZB 3AQQA 2WKCA 3CXCA 1FXAA 2VQFL 1B9MA 1LGRA 4A3EB 3DQVA 4IG7B 4O0AA 1AFPA 3CC7A 2W9NA 1D8LA 2R93G 4I6LB 1GC7A 2WQYB 3KDFA 5L95C 2HIXA 5LL6X 3ZJYC 3RNEC 5JZEB 1NTGA 4HIDA 4PZ8A 3I4LA 2IYDB 4PT5A 1HQRD 4NP5A 5HURA 4QJFA 1E8WA 1TBEA 3J7AV 2K5PA 2QILA 4FXCA 2MH7A 2K9XA 1G51A 1FRRA 1SYDA 2KCTA 1PH1A 1IBKQ 3VA5A 3APCA 3ECIA 4EE2A 1Q86C 1T0QC 2EVBA 1XJVA 2KQSA 2NCNA 2M9VA 2QMTA 4M8NA 5FJ8G 1O7LA 2ZTDA 1IBXA 2IDYA 2MJEA 2KX0A 2L1AA 1CSQA 2O4XA 3NTHA 3ZO5B 4A3EH 2ICEC 2GA4B 5I9PA 2Z1CA 3K5NA 3HS0C 3RMHA 1NBFC 1WH3A 1S40A 1SYEA 1LV9A 1A3UA 3HKSA 3J9CA 2RSOA 1J19A 3O65B 4IM0A 4CDDC 3NVWA 2NBWB 3OTOL 1YQ3B 5J17A 3UDGA 2ZCCA 2MNAA 4KDLB 3P4PB 2LMCA 1UUPA 5CGKA 2BYFA 5IP9H 1CKNA 1RODA 2XBBC 2W55A 4L63B 1QVFA 5DPRA 3R3MA 1LTBD 2OHFA 4HJ5A 1NBWA 2ZJQA 3ULPA 1CKOA 1Y14B 2NB0A 1QLBB 3QOJA 1JJGA 4ZQ3A 1EY8A 1VQ8A 2Z0DB 3A4SC 2RDGA 5CV8A 5IP7G 3Q6SA 1T5EA 1DGJA 5DCNA 3A9JB 1CHQD 2LUEA 3MXNA 2ONQA 4KKUA 2LMCB 3A5ZB 1L4ZB 3HOXG 2ZEQA 4A90A 5AJ3Q 4LNIA 3JAME 2ZM6Q 2F0NA 1N33L 3AFPA 1WJNA 3RLFA 1R4MB 3IFWB 4ZOHC 3NS8A 3AEDB 2K6QA 4DDID 2M8SA 1W6JA 2MRPA 1Q5WB 1TY2A 1YNND 4NB3A 3L7ZC 5C2TB 1S3SG 2N9PC 3MHSD 3ZKJC 2VXWA 4XT1B 4QGUA 2O2VB 3A8KE 3IXSA 1BUVT 1VQLA 1E24A 4AYBB 2PJHA 3VDZA 4A3BH 1MFWA 2JA9A 3UIOB 1L1OA 1EWHA 1QCBD 2JRIB 4NAWA 4YCUA 2EYMA 3MXGA 4QL5A 5KIXA 2BGFA 2FCSA 2PPBC 4HJGE 3R8BA 5I2XA 1K51A 2IGHA 1AE2A 4RWSC 2DENB 1F9QA 1S5DD 3HHMA 4RKBA 3A1QB 5EBDA 1C1YB 4KD4A 3Q14C 3I3CA 2FE8A 1PRTC 5CV7A 3MHZA 3S1MB 5D14A 3S1QB 4USAA 4LAAA 1WZ0A 1SJHD 4M1UB 4IWQA 1MGSA 4CKCA 3T16A 2VB2X 3N1YC 4H2AA 2N0SB 4B08A 3KLWA 4IKGA 3L16A 1MG4A 4IW0A 3H7SA 1I4PA 4HCEA 5HG2A 3ERSX 5I6YA 1EFWA 4B3MQ 3DDCB 4C3IG 1R9TH 2YEPF 5IIFA 3ZNHB 1F9PA 1AYFA 4C3HB 1IZ6A 1EY0A 2B2UC 3CAMA 2L00B 4K3CA 4LLGM 2LXKA 2J0JA 3T3OA 2UWQA 1XLNA 2Z0SA 3M3YB 4ZRJA 2MP1A 2NPTA 3T1YQ 3PIO3 2LGDA 1SNQA 3SR1A 1WSPA 1NE3A 5IGGA 4HTHA 3IL8A 3BZDB 3AEBB 4ZYNA 3A0JA 4QCLA 3HM3A 1SIJA 2SNMA 4PMBA 1PFNA 3CCRA 3T9LA 1W6KA 1ZXTA 1YITA 2WXQA 4HSVA 2HQLA 2L52A 1WTRA 5KYIA 2CQOA 4IZ8A 2F0LA 2KLCA 4DK6C 2WP9B 2MGSA 1Z5SB 5IOIA 1YJIA 2AWNA 2LASA 3NVZA 1ZXIA 1T5XD 5KHOA 1JALA 5ELCA 1NYRA 2K25A 3RN2A 3H6NA 1P9DU 1N36Q 4KVGB 3OAWA 2KTRA 3R93A 3JAML 2XK5A 3H7PB 1BNZA 2H88B 5FOBB 1II3A 1IBMQ 1PGXA 3KUPA 4P75A 3PUXA 4JI8Q 1PH7A 1FCCC 2BYTA 1L0WA 5AUIA 2IO3B 2O6VB 1F9JA 1YJJA 2IY0B 3U9SA 2IY1B 1N5WA 2HUGA 2NZHA 1T0YA 4HK2A 1V1QA 3U4ZA 4ARCA 4R4IA 1V9JA 1GXDC 1SNMA 4CJ2C 5IGCA 5LMNQ 1Q7YC 5LLIA 1L0XB 1VQ9A 2MLBA 4A6QA 1XMQL 4ZDVA 3DVGY 1SE2A 1VRAB 4F87A 2ZJDA 2IGGA 1KNEA 2X6LA 1VQIA 1HCZA 4FF4A 2DWQA 3PZ7A 5FK9C 3TP8A 3CF6E 1EIGA 2D0PA 3CCVA 3CQZH 3D4RA 4OHJA 2EYJA 2VL6A 1EIYB 4NAMA 1L4DB 5FR6A 4RGMA 2EDGA 2EYFA 3KW5B 4WJ4A 1NJIC 3AU5A 4C3JG 4KK7A 3AE1B 3U7ZA 4MGKE 1UE6A 5T1IA 4GGQA 3LJ3A 2DZMA 2OTJA 3KYHC 2DGYA 2E2JH 1QT9A 1BCPF 2JA8H 1OQQA 2J0TD 1TKEA 1N6ZA 3NBHB 3J80i 3DBLB 3HKZB 1N5XA 3UI2A 4GLAC 2IX1A 2K5VA 3GOEA 5D2MB 3FMCA 3A56A 3H94A 2AWOA 3OPOA 4DV3L 1QOFA 3TREA 2DZIA 2Z6BA 3GQBA 2HD3A 3PO3B 2OEOA 4C4VA 1WIAA 3KLSA 4BWGB 3N30A 1GUNA 1EWIA 3K7UC 3JAMc 3S15B 4GB9A 1DOIA 4ANUA 2X6GA 4MGYE 2K14A 1KAAA 4K8JA 4EQNA 1NI3A 2NVYB 2J4XA 4G57A 4DGZA 5M3FG 1GVPA 1WJ4A 2J53A 3PGZA 2B2WA 1KTKA 1QOBA 2ZT9C 2KHJA 3LX0A 3J7YW 1HZ6A 1JWMD 3I4NH 4KY6A 3K6OA 3N6RA 5E6JA 2JSOA 1RRBA 2JUOA 5J18A 4P72A 3JVZX 4MJSA 4UAIA 4YCVA 3SK4A 2HTHA 3ZYYX 2L32A 1PFDA 1FNWA 1TWAB 5BR8L 3ONSA 3JYUA 2YU9B 2E2JB 5LXIB 4C80A 2B2VA 2WB1E 3A9KB 1VZ7A 1QUQB 2E2DC 3A74A 1HRJA 2B2TA 1R4NI 3HOUH 1XO3A 2VH2A 3PHWB 4FJZA 4DR4L 4OZBA 2VUMG 4A3CH 1Z9FA 1TWFH 1WXQA 3K57A 4QF4A 1RTNA 1WZ3A 1XLOA 2AHOB 1V5OA 1L7YA 1PA6A 5JOBA 3PRMB 1TU2B 5IGEA 4YSXB 4MT5A 2OOBB 1WGGA 5AJ3L 4R4CA 3PVLA 1EOTA 3U7DA 3LXFA 2CFMA 2C7MB 3M4OB 3DUZA 1SMYC 1N62A 2UUBQ 2WDQB 3AH7A 4MH0E 4LF9Q 1YN3A 2KT7A 2KWCA 4ME5A 2DZJA 3P4QB 5M5WB 2R93B 2M00A 3T1HL 2ZVNA 2LKVA 2WINB 3SK6A 3J81i 3ZW3A 3IRBA 2RF4A 1HFGA 3MP9A 3RNBC 2LXJA 2I5HA 3MXPA 2F3WA 2RDFA 4ZLTF 3J7AF 2ZVOA 4KGSA 2JA7H 4AOFA 4G7OC 4ID6A 5C44B 4JI2Q 4Q5VA 1EZ6A 2E74C 5JAVA 1DYQA 2AUKA 2LXAA 4CDCC 5KRUA 3P63A 3F1ZA 1T0RC 2GBJA 4LF7L 1FNVA 1TWGH 1XMOQ 1WFQA 2JP1A 3PO0A 5IKCM 3EC8A 1C48A 3NY5A 2AEHA 3LB8C 5EJWA 1PZKD 1X3PA 3ETRA 3U2SC 1WCMB 1JMCA 2LGSA 4PZ7A 2I46A 2MQHA 3F2UA 4JPBW 2E2IH 1ML0D 2Q8RE 1H9MA 3NZUA 5EKLA 3Q3MC 5ELEA 2F3VA 3CMEA 1LM8B 3V3XA 2XEWA 2A6ED 3CU7A 2BYEA 2WV6D 4EEWA 2XTIA 2K50A 1BDOA 4RNAA 3I90A 3Q3JA 3M85A 3HFZB 2WXIA 4JG2A 1EUVB 3WAPA 5CV4A 1B3QA 2CR5A 3DHHC 2HHHL 1S3OA 2LGYA 4JBJA 4AH6A 4TMAB 3WA0A 4DHJB 1D3ZA 1WGHA 2JT4B 3L9AX 5FJ8H 1WR1A 4N9PA 4R9WA 1SYCA 4HEA1 2JK8A 2N49A 2PMZE 2UXCQ 4DK5A 1IGCA 2HJ1A 1RHPA 4W9GA 2WAQB 4DR2L 2BH8A 2A6HD 1IYUA 1MI0A 1Q8KA 2RD0A 2K5DA 3PSIA 3AV8A 3IBEA 2VQEL 3BK1A 3J80E 4RHRA 2L05A 2Z59B 4AQYL 3OW2A 4JI3Q 4TKNA 1X3GA 4C3JB 4HROA 4CYEA 1P16A 2MUYA 1M94A 3A9KA 1UWVA 1YNNC 5M5YH 1MSGA 5D3IB 2R7DA 1C78A 2IWHA 4TUUA 1CK1A 4GKJQ 4LNKA 4KN4C 2L5TA 1Q1BA 1X54A 2J0KA 2V1YA 1SE8A 1RTOA 2MPMA 1STYA 3TQYA 4K5WA 4NY0A 1D5MC 3E3XA 4A3IG 4KIKB 1H95A 1OXTA 1GUGA 2WAQE 1J7CA 3Q24A 4K8IA 1X32A 3K5LA 1L0VB 1I94L 3CSFA 3WDNA 1NMGA 5T1GA 5BMIA 1Y8RC 5FLMH 1RDPD 3S16H 3DWGC 5JJLA 1OEYA 1CSPA 1GD7A 2I07B 2EELA 2LI5A 3RN5A 1E2ZA 1B7YB 1SMYD 3P75A 5ELDA 5DAUA 3TBIB 4M8AA 1F1HA 1G291 5DM63 2K6AA 3PCOB 2F0KA 1WJ6A 1EYAA 2DHZA 3LNNA 4UP8A 4XIGS 4A3KH 2F3IA 3U9OA 4BBNC 2JZZA 1F2MA 1STGA 4DR3Q 3NBHA 4C7YA 1STBA 2LHEA 1GO3E 2NVQB 3MTNB 4F8CB 2K33A 4DXGA 2FFKB 3QJYA 2SDFA 1MBYA 1K8GA 2WXNA 5I2YA 2KHSA 4G0NB 3RNGC 2BTEA 2HDEA 1G8ZD 3I70A 3PO2G 1HQMC 4J6HA 5K36G 1C4PA 1EQRA 2G1EA 1QOHA 3AEEB 3HK0A 3LYYA 1B44D 4WQOB 2VW9A 4AUQC 3CSTA 1FD7D 3S1RH 2KC2A 3S24A 1L6UA 4A3GB 4GOCA 4OVVA 3QO2A 1TWCH 3EUB2 3CQZB 4LCDE 3FRPB 4UPAA 1OQYA 2WU2B 2KJXA 1WYGA 3DBSA 2INDC 3AE5B 4BFRA 4PZ6A 2B39A 1PMRA 4KIKA 5IOCA 2BE5C 1P98A 4OONA 2AUJD 1KF6B 1EOVA 3FP9A 2KFKA 4YCWA 2KVRA 3RNFC 1JOOA 4N9F4 4JL9A 1MD2D 3L3OC 2DJGC 1GUOA 5TSSA 4XYQA 4FJYA 1CKMA 3F8TA 1JC7A 2EZVA 2E2HH 3SK8A 1ISNA 1TQOA 2FBWB 2NPTB 3NZSA 1Y1VB 3QR8A 3HOUB 2HE7A 2VUMH 4A3CG 1RFAA 4FXKC 3VR3A 2B63B 1QOAA 2CWPA 4CDEC 1WMHA 3RNUA 2GVAA 1Y1WB 2K8HA 4S0RA 1WTHA 5I6WA 2F0OA 4DR7L 1VR9A 5HKHA 1BR9A 4LJZC 4IUTA 4M01A 4OZAA 3ZNID 2OT2A 2Q8IB 4FO2A 3UQAA 2K8BA 3EA6A 2KOXA 4DR7Q 1B4OA 3DOWA 1Q81C 5CV9A 2DYBA 3EVQA 1EY4A 4DV7L 1C76A 4JI4Q 3VTUA 4JOIC 3ZTDA 2L4NA 4GLXA 4DV2L 3G4SA 1WYWB 3HVZA 1PH4A 4KJOA 3RZWC 3TSSA 5H8YE 1TZ1A 2KFKB 3PLUA 4ICVA 1O7YA 1L0YB 2L12A 2Y0SG 2A8VA 3TJPA 1JT8A 5C44H 2OQKA 5FKAC 2QKIC 2BS4B 4Y7NH 4LF6Q 4GN5A 5M3FH 4HJAA 1QNUA 3SEBA 1JQYD 4WJQA 1LTTD 4DV3Q 4BZAA 1I4QA 4NJ6A 3J81L 3L2PA 3S16B 3I4MG 4KV6A 1EY5A 2N1WA 2GVBA 3ICEA 3E56A 4DWFA 3PHXB 3AB9A 3X0WA 1VF7A 1RWSA 1V80A 2PI2A 1PTOC 4YWLA 5M5WH 2R93H 2C5LC 2RVLA 2O5IC 1UE1A 4KY5A 1LTAD 3NTKA 3NVVA 1JWSD 3N20C 3D8GA 4GDKB 5F2DA 3EN2A 2WWZA 4DV5L 1SXTA 3PREA 2WXGA 5LMUL 1GB1A 3QWNA 1R7SA 3CMAA 1WTQA 3TL5A 3SXHA 1BT0A 2BWES 2PTLA 4ABNA 1VQGA 1H9JA 1TIID 4BS9A 5M5YB 2FCMA 3A1QA 1ZYRD 4C2MH 4DBGA 1HZ5A 2NYZD 1DCZA 3TN2A 3VH3B 2KVMA 3J81j 1XNRQ 2OJRA 1QILA 4KMUC 1ZDVA 4A76A 1L1OB 1A8VA 4Q0FA 1VD2A 3HOXB 2LXCA 3ZDTA 1M4VA 4CHTB 1WR6E 1HTLD 2B8GA 1M90C 3G6EA 1B3AA 1BQQT 2KOLA 1RD9D 1K53A 1T0SC 2G4SA 1KLGD 2K8CA 2K52A 1K52A 4AYBG 2B29A 1F0ZA 1WYDA 3I63C 3EGRA 1PYBA 1F9SA 1UELA 4JI5Q 3BZKA 4P16A 2L83A 2KYWA 1SIFA 3VH4B 1ZEQX 4RMAA 2M19A 5AUKA 3KLSX 1Y69U 1FRDA 3VFKA 4DXAB 2Z0EB 4BA2I 2DY8A 1ENCA 2IT1A 1JORA 2XN9C 3DEPA 4JOIA 3WWVA 2DBYA 1TS3A 3HEJA 2PE6B 4V190 4ACFA 4F7ZA 1CHPD 3MEHA 1V8CA 3GZNI 3BYTB 3H3VC 1F52A 1PQSA 1U9RA 5KYLA 1J0GA 1JICA 1SYBA 3N1XC 3Q22A 4AWJA 2KWUB 4RG1A 5NUCA 1JB7A 2V4IB 3H6MA 2N9LA 2WX1A 2BW2A 3NXWA 4IWOA 4DKAC 4A3BG 3HRDD 3PPAA 5HI1A 1IBXB 3TEYA 4HDQA 1ET6A 1E2WA 4B9XA 3DHQA 4A3FB 4L5RC 2A5HA 1UWXA 3ZRCA 1C3TA 1VQEA 1YNJD 4PV1C 1YQBA 3U4VA 1WJJA 4CGYB 1VQ5A 1JW9D 3WALA 3Q0AA 1GJXA 4HCSA 1HE8A 1WRIA 2Q2HA 3QAQA 3RN9C 4GSWA 2Q5WD 1EU4A 2N4FA 2RMMA 1BCPC 1TWCB 2CJOA 1ZE3D 2KC1A 3MC8A 4DUYQ 4FF3A 2GBMA 3CPFA 4JIOU 1MG8A 5A35A 4XDDA 3ZQ4A 4AQ7A 3E9IA 1G2TA 3S14B 3Q8BA 5C4JB 3RNAC 2OTLA 3D0FA 4K0KQ 4DR2Q 2WXMA 1O78A 4ANVA 1IP9A 2Z8LA 1CMXB 4WWPA 1RL2A 4BOSC 4A3IH 3UI3A 3W1BA 2JA6B 2Q8TA 3WOFA 4IN3A 2DNFA 3JSVA 3R66C 3MC0B 4AYBE 1IUEA 2V0GA 4ODGA 3IFTA 4QIWE 4U673 3L13A 4W9CA 5DPWA 1V5TA 5G5GA 3I4NB 2ZW0A 2A1AA 1XCTL 4ITKA 4HMJA 1XWEA 4QMGA 5EE0A 4DV4Q 2F0SA 1ILQA 2D5GA 4FVMA 1Q90A 3HOWB 2D9UA 3AN1A 3SU8X 1EL0A 1WE6A 1SNOA 1EF5A 2CU1A 2LVPA 2H5XA 4HJ9A 4NPNA 1UZXB 4WWMA 1TY0A 2BA1A 4DNTB 5LHY1 1HR0Q 2DAFA 4ZHOA 4Z9CB 3PSEB 2RCFA 3PRZA 1WM3A 2PNRC 5EKIA 1YI2A 4BBRH 2FMMA 5I4DA 1HFNA 4DK3C 2UUBL 2OCEA 1MPEA 2BBCA 4FF1A 2I38A 2KZRA 1WM2A 3AU7A 1WGKA 3HOZH 4M0WB 1NEKB 1QF6A 2QCPX 5HY6A 4DV2Q 2LVQA 4K2LA 2VUMB 1C79A 3AI5A 4DV0Q 4L5SA 4P7IA 5BMHA 4J1MA 4OEMB 3ZDMC 4X65Q 1IW7D 3PUWA 2KMAA 4YT0B 2E2HB 1GUWA 4FDBA 5C3EB 1B53A 5CYUA 1K28A 4WIPA 4A3LH 5FO9B 2QC8A 4HRSA 3B9JA 1FIQA 4DR5Q 4G4KA 3HRZC 1O7ZA 1NSNS 3GTMB 4BKTA 3WOEA 1SNDA 4QUFA 1K73C 3R7QA 3PUVA 1BCPD 3DBRB 3Q6BA 1BOSA 2JVCA 2B76B 1FL0A 1KL9A 1KDBA 1PZID 2C35B 1WE7A 3PIPA 4GIVA 1T9HA 4XX5A 3QIAA 3R2TA 1G6ZA 3NELA
chains in the Genus database with same CATH topology
3H09A 4CJ0B 4TQUS 4BY1B 3CRKC 1Q1EA 1YNJC 3FAHA 1HA5A 2W82A 2BCOA 1FFVA 2B2WC 1QG7A 3A8IE 1WWTA 1U4PA 3C8YA 3K5MA 3NHHA 4X3KA 4MN3A 3MFYA 4KGRA 2NZ1D 2JA7B 3OWEB 2OF1A 1LT5D 2F0WA 1UGJA 1UAPA 2SOBA 2WACA 4ULLA 3KK7A 1G91A 3V96A 3FILB 2KN4A 1VLBA 4IALA 2K04A 2WKDA 2B2YC 1NUCA 2PO4A 1EIHA 1YN5A 1RYJA 5CBAE 3GV6A 5C3JB 2IX3A 1HUNA 2EY1A 3ABVB 3T4AC 4K6LA 2NTSA 1C4QA 1TWFB 2EPBA 4XTCS 1NYQA 1TS2A 2BS3B 2GRIA 3I91A 1A3TA 1PXUA 3M7GA 2KCCA 5C0XJ 4F7XA 2DNCA 5A2QE 4O1NA 2F0GA 3TP6A 4IDIA 4XWTA 2VB3X 1EQTA 3AB5A 5C0XH 1PFMA 1E0BA 2LS01 5AFWA 2R7ZB 3HUIA 2ZW1A 4OO1H 1DOXA 3NWSA 4RGOS 5C0XI 1EZ8A 1NR4A 1TYGB 1C8CA 3ND9A 4OO1I 1ZKOA 4A3MB 5C4ZA 4DAYA 2IGDA 5T8IA 2R3ZA 3U4EG 4A8XC 1WTOA 1GHKA 1H9SB 1SDFA 2M2LA 5G3LD 4L6TB 4O42A 1EWCA 2N9KA 4DK1A 1ONLA 3O13A 2K05A 2EJGC 4J8QA 5JEAJ 4QUCA 1MVKA 4TQ0A 5I9OA 2K03A 1Q8IA 3IAYA 3MHBA 4WORA 4ILWA 2V3NA 2AQ1B 3Q8EA 3VA7A 2EY6A 2WXRA 4XXEA 1LTGD 1R4QB 4HKZE 3EROA 4ZRZA 5GXGB 2ZXRA 4LK1C 2FINB 2IL8A 2NTTA 3NK9A 1VF5C 4RF1A 5G5HA 1J9OA 3K7AB 2WP8J 1S5BD 2PW9A 4P16A 2MJ8A 2MJDA 5IGDA 3DWPA 3C46A 1LLRD 4Y7NB 4IFDH 3NQIA 2WXHA 1VZ8A 2N55A 2QDBA 4XQNA 3SVMA 1A2UA 3HZXA 4HR7B 1IKMA 5MPOA 1CA6A 5CV6A 4V0BA 1C9FA 3K0YA 4MHEA 1OQRA 3ZJVA 2B2YA 5JPMC 4WRDA 3LWUA 2F0MA 3HP3A 3MWYW 4TRDA 4H7BA 3CWIA 1BF4A 4L2YA 1TKYA 3T13A 2K1BA 3KF8A 5ELBA 2L9HA 4HEDA 5EBCA 2Y0SB 3N9YC 1V43A 5A2QL 3DWAA 1Q3LA 3TZUA 1D5ZC 4PMWA 1JRPA 2JU6X 1ROEA 4DK0A 1BUIC 4WH4A 4PQXA 1D6EC 1NVID 3SDZA 3VR4A 3AECB 2BS2B 3MAQA 1PYWD 2EY5A 1SFOB 4C1NK 1JMLA 3W9CB 5BN5A 2K3UA 5LL6S 3DEOA 4XWWA 1CJEA 2AQ3B 3KBXA 1UEAB 1SAPA 1EWYC 3W3AA 3BDOA 4RGTA 2GI9A 4K14A 1ESFA 1LTSD 2FUG1 1I3QB 1VMCA 4K6DA 1AN8A 4K5XA 1J7AA 1S5FD 1JWUD 5M3FB 1HPCA 2CJNA 3D3RA 2B2VC 1GB4A 1LT4D 2PMVA 2JA5B 3G6JB 1KDCA 1D1IA 2SNSA 4XQQA 1YNTE 3AE7B 3SK5A 4XDCA 3ZJTA 4A3IB 2WIIB 5EPJA 2LHDA 1E9MA 2QSDA 2PW7A 1STAA 2V4DA 2CQAA 1JE4A 2JXMB 2YYZA 3NPPA 2X38A 3Q8AA 2X69A 5FLXL 1VJKA 1N61A 1NCVA 4JX1C 2DNEA 1GHJA 3ZJUA 2PMZB 2IJ0A 4KKIA 3D6CA 1I7HA 1A6XA 1C4CA 3VR9B 5D7GA 5DM73 4IOIE 1AZPA 2K5QA 2KA7A 2H4OA 4TQ1A 2F0TA 1K50A 3BVMA 3RD4A 1NR2A 2RBMA 1CQVA 4L8JA 2INPE 1XTCD 1I6HB 1QKZA 1YN4A 3S1RB 1ILPA 3MJ5A 3PUYA 4DAVA 4FXGC 3B2GA 4QB4A 4KD3A 4CQNA 1GUSA 4CKBA 3CRLC 2K5WA 3R2IA 1F2YA 1RF2D 1EFID 4DAPA 1J7BA 3NQTA 2B2UA 4B9WA 5HFYA 3A55A 3GD7A 1N63A 1SJED 2PLPA 3VR8B 2R92B 2E76C 2FMCA 1WD0A 1A15A 1MI2A 3OWFA 3AE9B 4RGNA 3GS2A 4CBVA 3DM1A 2A69C 1Y8PB 2ACZB 3I72A 4NMZA 2HCCA 4A55A 2WXLA 1SE4A 1STNA 5IODA 4N9TA 4X3TA 3OMGA 4C7ZA 5C5LA 4C2MB 1B9NA 2BA0A 2IW3A 1YMHE 1D1KA 1X3QA 2G9DA 3PZ8A 3NTIA 3H0GB 2NVTB 4KN7C 4ZYSA 2ENBA 3P1MA 2F0QA 3NRZA 3G7LA 3SHLA 1WTWA 1BMLC 3FC4A 2IPKD 2F0FA 4NKLA 2PCFB 1XEEA 2KQ3A 1TVXA 2F0JA 3URYA 1SEBD 2PIAA 1STEA 1F2LA 2XWBB 2WDVB 4TSSA 1M8AA 5EPKA 3A54A 3RFZB 4L1BA 4IUQA 4XYOA 1L6VA 4YSZB 2JA8B 3CIRB 1XYIA 4ARIA 2JZPA 4YIJA 1JROA 5JEAG 4R3DA 3VQIA 3GP7A 1STHA 1OO9B 1BO0A 3AE6B 1IW7C 5BYQA 4IURA 1E0ZA 4GLSC 4JK1C 1S5CD 2I2YA 3VR2A 1HA6A 1XF5L 1EYDA 3NSWA 3GV3A 5EPLA 3S2HB 1CTMA 2N7JA 2XSCA 2K01A 3S17B 4KY7A 2F1MA 2W3RA 1JB3A 2KDMA 2KMMA 4MH8A 1EYCA 1Z6HA 3TEWA 4BY7B 4WFN3 3NWTA 1JWBD 3NZ3A 4XQJA 5KNBA 1RKNA 4RA8A 1JOQA 1ZYRC 4ZK9B 4WQMA 5CR3A 1ENAA 2GB1A 1VMPA 3BS1A 3BG3A 1QOGA 1TT2A 2QEJC 3BK2A 4RFBA 2NBFA 5FLXE 2R6GA 3AMUA 3CKIB 4GDLB 2TMPA 2A69D 3ONAB 3A7AB 1FYCA 3E9SA 1F2RC 3K58A 3GTJB 5KGUA 2PW5A 1V1PB 3OSOA 1XCQL 3MFGA 5CORA 3OHXC 4F8MA 3GTPB 1WD1A 3AE2B 1ESRA 1E10A 1PRTB 3NBIA 3E5SA 3MZ5A 2W3SA 2EYLA 1IHZA 5CMDA 2EE1A 3VR6A 5HGTA 2JSVX 4N58A 1EY7A 2BB5A 2RKSA 3OMCA 4EQPA 3GTGB 2NN6H 5D65A 3QG1A 1XXGA 3PUZA 3AEGB 4G7ZC 1F9RA 2WXFA 1CT1D 1QJOA 2L11A 1ZXHA 4JBWA 2ZXPA 1K8MA 4I65A 5BN3A 1PLFA 5COYA 1PUTA 3QB3A 2ON8A 2PQEA 5EE1A 1TKWB 5C0XG 2KWDA 2SAKA 5BYSA 3PIP3 2J52A 2L0CA 2F03A 3DMUA 2WXPA 1TWGB 5JXVA 3Q23A 2K28A 2BOSA 1GUTA 3I73A 5C4XB 2J7ZA 1F77A 5LNK1 1LTRD 3C1FA 1DOYA 2BDNA 4A93B 3W1SA 4IQZA 3AEAB 3FDTA 5JJZA 4OIKA 3A8JE 5H92C 4DNRB 3KQ4A 1TJEA 4B0EA 1N60A 2INNE 4FXDA 1SE3A 5BN4A 2KUMA 3D31A 2CVRA 1IYVA 2LJIA 4JWSC 1P7FA 3W5VB 2XRSD 1QB5D 2WS3B 5EGTA 3GB1A 3P7JA 4EQOA 2XWJB 3SR6A 3TEXA 5CBEE 4UDUC 3FILA 2LEKA 2AX5A 2M0AA 5IT9E 1JWAD 1CZGA 3NE5B 1I6VC 1B2TA 3ND8A 5J39A 4S3SA 2B2TC 3C2PA 3GTOB 1RM6C 2NMQA 5K5PA 1TS5A 3AEFB 4LK0M 5G3LF 4OGQC 1PGBA 3VYSA 4WURA 1VDZA 4K2KA 4FF2A 4KKSA 4P6VF 1CQFA 2EOTA 4C3HG 4YWGG 3E0JA 4A3KB 4NW2A 1I4RA 3FVQA 1HXYD 5BMGA 2EY2A 2K7VA 3DWQA 3P20A 3AMZA 2L1BA 2A6EC 2E3TA 3IAS1 1OXVA 4OL7A 2QF7A 3FPUB 1KFYB 4WJWA 3H8HA 4JWUC 1YQ4B 1JR0D 2JYTA 3KBGA 1U4RA 1PDQA 1DXMA 1AWDA 4DXFA 1PGAA 3TP7A 3NUHB 1E7PB 3I57A 1LO5D 4RKLA 5M3MB 1NAPA 4X3SA 4KKJA 1ZDXA 1VDVA 1HEZE 2J42A 1I4GA 4XDXA 1CI3M 3MVVA 1DM0B 3NUCA 1V1OA 2LY7A 4AS1A 2XIWA 2BE5D 2KEDA 3BWUD 3AM9A 3TDQA 2A73B 1MHXA 4H13C 4L23A 1GAQB 2NVXB 3PV0A 3C1EA 4WAFA 4XE0A 3SE0A 5DNFA 3IKJA 1S5ED 1CFMA 1C77A 4Q2JA 3HOZB 5KEEA 4YTNB 4HSPA 5C5MA 2CHBD 4ZKCB 4FNFA 2KECA 3I8ZA 3VYTA 1PTOH 2F0HA 3RZOB 4ZKBB 4CKEA 2E2IB 2E6XA 1V8QA 1MHHE 5JEAH 4CJ1B 3OIPA 2VNUD 3SFEB 2F0DA 3RUZA 3U52E 5E1FA 1PTOF 1G2SA 5KNCA 1Q12A 5EE9A 1KLUD 2WDRB 5JVG3 2NN6I 5FO7B 3J81E 1OFFA 1OXUA 2F0EA 1UNSA 4KKTA 3I4MB 1FO4A 2JE6I 1Z47A 2R61A 4OZCA 5M5XB 2WB1B 3DXJC 1HHVA 1ZOYB 1S4ZA 3VR5A 1V97A 2H1EA 3T53B 3AE3B 4IUUA 1D4BA 1TWHB 1PZJD 5IGFA 3TEZA 1EM7A 5FO8B 1EQVA 1SF0A 1KABA 3J80L 1XLPA 2JXTA 4J3OD 3QOLA 5IT9L 1JOKA 2M56B 3W5UB 4A9AA 3I9V1 4EE2A 2A6HC 4KHVA 1P7EA 2F4IA 2JYOA 3BDCA 5D3DA 1QQRA 4YXDB 4OW0A 2WU5B 4RAUC 1WTPA 2BT6A 1BBXC 1L5PA 4HKQA 2JYEA 2PYKA 2OEDA 3ITPA 4P2CB 2C9OA 4A3JB 1AW7A 1SSOA 1CZPA 1K83B 4LMQD 2EKIA 4OO1G 3D6WA 2IX0A 4KTAA 3MA2B 2N88A 1WTXA 4YTPB 1RCVD 1I4HA 1FCLA 1EEFD 4HN7A 4EVOA 2EYPA 5E4WC 1U4LA 4IFDI 1LACA 2O2LD 3GTLB 1E2VA 1SBBB 2LFNA 3RZDB 5C3XA 1Y56A 1IGDA 3BDLA 1ET9A 2V3PA 3HOYB 3T3NA 1CZWA 1EEID 1I50B 1R4PB 3V05A 1T6BX 3VYRA 5CC4A 2L55A 1DOKA 4R8NA 5J1ZA 1HTPA 1FMAD 2ICIA 2WXOA 4DA2A 1ZP0B 1ZUD2 3H91A 4R8IA 4MM3B 2PZWA 1V1PA 2PZTA 2XRQD 4HAEA 3LWEA 3DWMA 4DFAA 4N59A 4ZRQA 1DJRD 1DOMA 4GZYC 2K0PA 2PVGC 1H9KA 2EYHA 1O80A 1SNCA 2W54A 3ZGZA 3GO5A 4U68A 1TZOA 1PTOB 3OOCA 5IGBA 3S2DB 1ENFA 2WNMA 2MHVA 1FFUA 3FKIB 3T56B 2PVOD 2QJLA 4REZA 4IUVA 1GOZA 5JPNC 2Z4HA 3N52A 1FNUA 2F0VA 1FM0D 2NWGA 1HUMA 2JEBI 2DLBA 2LFIA 1A2TA 5KNDA 1A3VA 3R3OA 1DZ1A 2FHTA 1Y8NB 4A3DB 2RDHA 2DYMA 1PDXA 4A3BB 1ACCA 4B0MA 2ZXOA 2C5CA 1D2BA 3NVYA 2OXPA 4KHZA 1Z7TA 4H0LC 1LT3D 2A68C 1Y8OB 2Y3AA 2PZUA 1FEHA 2D5DA 5K36H 5CV5A 4PNYA 3S1NB 4XT3B 4C3IB 4LTUA 3OIQA 4X3UA 3IAM1 3P4RB 1JCKB 1IKLA 3GTQB 2VZKD 3AE4B 3C3LA 4C56C 4NJCA 1D5XC 3VYUA 3RPFC 4PMCA 2HQEA 1LTID 4K5VA 3K5OA 3MXUA 3GTKB 2MEKA 4TKOB 2CW0D 4HMIA 5M9OA 3KWVA 3TMEA 2D62A 1WTVA 2TSSA 4KI0A 1TKGA 3D4WA 1DD2A 1ICWA 2CU3A 2JWUA 1CM9A 2HTME 2B8FA 3P1HA 3A7LA 4BA1I 1ZPSA 1E6EB 1LABA 2Y5PA 4KGTA 2LUMA 5EE3A 2NN6G 4MIUA 2SEBD 4US9A 4RF0A 2RPVA 1BCPB 1T3QA 3BIID 3NS1A 2WXKA 3PMFA 4F88A 2EJMA 1I4XA 5ELFA 3IFDA 4EGVA 4US8A 3OW7A 4BBRB 1QWYA 3KLRA 2F0UA 5E3FA 2WLBA 5EQ0A 2NUCA 2O5JC 4G7HC 4NAWB 4IFDG 3B2FA 2A68D 1XLQA 4D2KA 1PRTD 2KACA 3HGBA 4FP5D 4DN4M 1PTOD 2QIEB 4IFDJ 1RJTA 3MTSA 3L4PA 1KNAA 2EJFC 1KH0A 1SB3C 3EJIA 1A70A 3S9WA 1K8OA 1VZ6A 4ZHPA 1SYGA 2BB6A 1KRHA 1TS4A 5HHDG 1J8IA 1VCIA 3HOVB 4N6EB 3HVDA 3M4YA 1QE6A 2DYOA 1CA5A 1F2ZA 3BVGA 3E6ZX 1PFBA 4NDXA 2JX5A 4RCNA 2JEAI 3ERQA 1LT6D 4KJNA 4KX6B 3BVZA 4JE3B 4OIJA 1EY9A 2D2CC 4FYDA 2WXJA 5BYRA 4I7ZC 2EYOA 3X3NA 1H9RA 3K59A 3VRAB 2HCIA 3KWLA 1C4AA 2Y5CA 1GPXA 3Q8FA 3EFXD 3CHBD 3VRBB 1AEXA 4C1NI 1SSNA 2K32A 3PO2B 1SYFA 3EQLC 5FR3A 2H89B 1FXIA 4NZLB 2XVSA 3FEWX 3Q8CA 4ZRPA 3TZDA 4ZUIA 1WVLA 3W2DA 4QIWB 2DY7A 2K22A 4MACA 1FD6A 1EU3A 2ID0A 4RHSA 1JQ4A 3WCQA 4M0WA 1IL8A 4JPSA 2A74C 5DEHA 4H44C 3AE8B 2RA4A 1B50A 4YSYB 1QNKA 1B1ZA 1OXXK 4RCOA 5JVH3 5E4XA 1F2RI 1SNPA 2KQ4X 1U4MA 2KAJA 4OVZA 4E6IA 1BXTA 2BDOA 2KEEA 1R9TB 4YTMB 5EKKA 1AZQA 4IUPA 4BBSB 3NP8A 2G9HD 3TP5A 3BYYB 1FR3A 2RSNA 1EY6A 1NENB 2HDMA 1MSHA 3M7NA 1FGBD 1PRTF 5C3WA 1Q10A 2FJ2A 4DU9A 3IT4B 4RH6A 3P4SB 1DOLA 3D4DA 3V2TA 5ISRA 2EXZA 1RFKA 3X3MA 3FPPA 4DF7A 4ZUJA 1TR5A 2HDLA 4IUNA 2Z4IA 3IT6B 2CW0C 2E75C 4ZAIA 2F0IA 3SFDB 3T51B 2RQXA 2F0PA 1XX8A 3TUOA 1B9RA 2VZKB 2AQ2B 1OXSC 1H9SA 1DONA 5C4HA 3P42A 2DN8A 5J22A 3HG9A 5C6AA 2KCNA 2PKOA 2XNAC 1KDAA 4DQOC 2JQRB 2YEPB 1AP0A 2LGIA 1UWMA 3Q69A 2WKCA 1FXAA 1B9MA 4A3EB 1AFPA 2WQYB 5LL6X 4PT5A 3I4LA 1HQRD 4NP5A 5HURA 3J7AV 2K5PA 2QILA 4FXCA 2MH7A 2K9XA 1FRRA 1SYDA 3VA5A 2EVBA 2QMTA 2M9VA 1O7LA 1IBXA 2IDYA 2MJEA 2L1AA 2O4XA 3NTHA 5I9PA 2ICEC 2GA4B 3K5NA 2Z1CA 3HS0C 3RMHA 2MJ3A 1SYEA 1LV9A 1A3UA 3J9CA 2RSOA 3NVWA 1YQ3B 3P4PB 2LMCA 1UUPA 5CGKA 1RODA 2W55A 4L63B 1LTBD 2OHFA 2NB0A 1QLBB 3QOJA 4ZQ3A 1EY8A 2RDGA 5CV8A 3Q6SA 1T5EA 1DGJA 1CHQD 2ONQA 3MXNA 4KKUA 2LMCB 1L4ZB 4A90A 3JAME 2F0NA 3RLFA 4ZOHC 3AEDB 1W6JA 1TY2A 1YNND 3L7ZC 5C2TB 2VXWA 4XT1B 3IXSA 3A8KE 1BUVT 4AYBB 1EWHA 1QCBD 2EYMA 3MXGA 5KIXA 2PPBC 4HJGE 3R8BA 5I2XA 1K51A 2IGHA 4RWSC 1F9QA 1S5DD 4RKBA 5EBDA 4KD4A 3I3CA 2FE8A 1PRTC 5CV7A 3MHZA 3S1MB 5D14A 3S1QB 4USAA 4LAAA 1SJHD 4M1UB 1MGSA 4CKCA 3T16A 2VB2X 4H2AA 2N0SB 4B08A 4IKGA 1I4PA 4HCEA 5HG2A 5I6YA 4C3IG 2YEPF 5IIFA 1F9PA 1AYFA 4C3HB 1EY0A 2B2UC 4LLGM 3T3OA 1XLNA 3M3YB 2MP1A 3PIO3 1SNQA 3SR1A 1WSPA 5IGGA 4HTHA 3IL8A 3BZDB 3AEBB 4QCLA 1SIJA 2SNMA 4PMBA 1PFNA 1W6KA 1ZXTA 2WXQA 4HSVA 2L52A 1WTRA 5KYIA 4IZ8A 2F0LA 2WP9B 2MGSA 1YJIA 2AWNA 3NVZA 1ZXIA 1T5XD 1JALA 5ELCA 1NYRA 3R93A 3JAML 1BNZA 2H88B 5FOBB 1II3A 1PGXA 3KUPA 3PUXA 1FCCC 2BYTA 5AUIA 1YJJA 3U9SA 1N5WA 2HUGA 4ARCA 1GXDC 1SNMA 4CJ2C 5IGCA 1L0XB 4A6QA 1SE2A 1VRAB 4F87A 2IGGA 1KNEA 2X6LA 1HCZA 4FF4A 2DWQA 3PZ7A 5FK9C 3TP8A 1EIGA 2EYJA 4OHJA 3D4RA 4NAMA 1L4DB 4RGMA 2EDGA 2EYFA 4C3JG 4KK7A 3AE1B 3U7ZA 5T1IA 1QT9A 1BCPF 1OQQA 2J0TD 1TKEA 3HKZB 1N5XA 3UI2A 2IX1A 3FMCA 3A56A 3H94A 2AWOA 3OPOA 1QOFA 3GQBA 3PO3B 2OEOA 3KLSA 4BWGB 1GUNA 3S15B 1DOIA 2X6GA 1KAAA 4K8JA 4EQNA 1NI3A 2NVYB 2J4XA 4G57A 4DGZA 2J53A 1QOBA 2B2WA 1KTKA 2ZT9C 3LX0A 3J7YW 1HZ6A 1JWMD 4KY6A 3K6OA 3N6RA 5E6JA 2JSOA 4UAIA 3SK4A 2L32A 3ZYYX 1PFDA 1FNWA 1TWAB 2YU9B 2E2JB 4C80A 2B2VA 1VZ7A 2E2DC 1XO3A 1HRJA 2B2TA 4OZBA 1WXQA 3K57A 4QF4A 1RTNA 1XLOA 5JOBA 1TU2B 5IGEA 4YSXB 4MT5A 1EOTA 3LXFA 3M4OB 3DUZA 1SMYC 1N62A 3AH7A 2WDQB 1YN3A 4ME5A 3P4QB 5M5WB 2R93B 2M00A 2LKVA 2WINB 3SK6A 1HFGA 3MP9A 3MXPA 2F3WA 2RDFA 4ZLTF 3J7AF 4KGSA 4G7OC 4ID6A 4Q5VA 5C44B 1EZ6A 2E74C 5JAVA 1DYQA 2AUKA 5KRUA 3P63A 1FNVA 2JP1A 3PO0A 1C48A 3LB8C 5EJWA 1PZKD 1X3PA 3ETRA 3U2SC 1WCMB 2I46A 3F2UA 1ML0D 2Q8RE 1H9MA 5EKLA 5ELEA 2F3VA 3V3XA 2A6ED 3CU7A 2WV6D 1BDOA 4RNAA 3I90A 3M85A 2WXIA 5CV4A 4TMAB 3L9AX 4N9PA 4R9WA 1SYCA 4HEA1 1IGCA 1RHPA 2WAQB 2A6HD 1MI0A 1IYUA 2K5DA 3AV8A 3BK1A 3J80E 4RHRA 4C3JB 4HROA 2MUYA 1YNNC 1MSGA 5D3IB 1C78A 2IWHA 1CK1A 4KN4C 2L5TA 1Q1BA 1RTOA 2MPMA 1STYA 4K5WA 1D5MC 1OXTA 1GUGA 1J7CA 3Q24A 4K8IA 1X32A 3K5LA 1L0VB 3WDNA 5BMIA 5T1GA 1RDPD 3DWGC 2I07B 2EELA 1E2ZA 1SMYD 3P75A 5ELDA 5DAUA 3TBIB 4M8AA 1G291 5DM63 2K6AA 2F0KA 1EYAA 3LNNA 4XIGS 3U9OA 4C7YA 1F2MA 1STGA 3NBHA 1STBA 2LHEA 2NVQB 2K33A 4DXGA 2FFKB 3QJYA 2SDFA 1MBYA 2WXNA 2BTEA 5I2YA 2KHSA 2HDEA 1G8ZD 3I70A 1HQMC 4J6HA 5K36G 1C4PA 2G1EA 3AEEB 1QOHA 3LYYA 1B44D 1FD7D 1L6UA 4A3GB 3QO2A 3EUB2 3CQZB 3FRPB 2WU2B 2KJXA 1WYGA 3AE5B 2B39A 1PMRA 5IOCA 2BE5C 2AUJD 1KF6B 1JOOA 1MD2D 3L3OC 1GUOA 5TSSA 4XYQA 1JC7A 2EZVA 3SK8A 1TQOA 2FBWB 1Y1VB 3HOUB 4FXKC 3VR3A 2B63B 1QOAA 1Y1WB 5I6WA 2F0OA 1VR9A 1BR9A 4LJZC 4IUTA 4OZAA 2OT2A 2Q8IB 4FO2A 3EA6A 1B4OA 5CV9A 3EVQA 1EY4A 1C76A 2L4NA 3HVZA 4KJOA 3TSSA 5H8YE 1O7YA 1L0YB 2L12A 5FKAC 2QKIC 2BS4B 1QNUA 3SEBA 1JQYD 1LTTD 1I4QA 3J81L 3S16B 4KV6A 1EY5A 3E56A 3AB9A 1VF7A 1RWSA 1PTOC 2RVLA 2O5IC 4KY5A 1LTAD 3NTKA 3NVVA 1JWSD 4GDKB 3D8GA 5F2DA 1SXTA 2WXGA 1GB1A 3QWNA 1R7SA 1WTQA 3SXHA 2PTLA 4ABNA 5M5YB 1H9JA 1TIID 4BS9A 1ZYRD 1HZ5A 2NYZD 1DCZA 3TN2A 2KVMA 1QILA 4KMUC 1ZDVA 4Q0FA 3HOXB 1M4VA 4CHTB 1HTLD 2B8GA 1B3AA 1BQQT 2KOLA 1RD9D 1K53A 1KLGD 1K52A 1F0ZA 3EGRA 1F9SA 2L83A 1ZEQX 2M19A 5AUKA 3KLSX 1Y69U 1FRDA 4BA2I 2DY8A 1ENCA 2IT1A 1JORA 2XN9C 3DEPA 2DBYA 1TS3A 3HEJA 4V190 1CHPD 3MEHA 1V8CA 3BYTB 3H3VC 1U9RA 5KYLA 1JICA 1SYBA 3Q22A 5NUCA 2V4IB 3H6MA 2N9LA 2BW2A 3NXWA 1IBXB 3HRDD 5HI1A 3TEYA 1ET6A 1E2WA 4B9XA 3DHQA 4A3FB 2A5HA 1UWXA 1YNJD 4PV1C 4CGYB 1JW9D 3Q0AA 1GJXA 4HCSA 1WRIA 2Q5WD 1EU4A 2RMMA 1BCPC 1TWCB 2CJOA 1ZE3D 4FF3A 5A35A 4XDDA 3ZQ4A 4AQ7A 1G2TA 3S14B 3Q8BA 5C4JB 2WXMA 1O78A 2Z8LA 3UI3A 2JA6B 2Q8TA 3WOFA 4IN3A 3MC0B 1IUEA 2V0GA 4ODGA 3IFTA 4U673 5G5GA 3I4NB 2ZW0A 1XCTL 4ITKA 4HMJA 1XWEA 4QMGA 5EE0A 2F0SA