3SEBA

Staphylococcal enterotoxin b
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
238
structure length
238
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 73
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sebA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sebA02
1DYQA 1PRTC 1AW7A 4RGOS 1S5FD 1RF2D 3CHBD 1CK1A 1EEFD 1T5XD 1BXTA 1EU3A 4RCOA 2AQ2B 5ELCA 1GOZA 3DWAA 1CHQD 1L0XB 1HQRD 1PTOF 2CHBD 3R8BA 1FNWA 3R2IA 4UDUC 1ET6A 1LTGD 1HTLD 1TS5A 1FGBD 2R61A 1LTSD 1YN4A 4DXGA 1B1ZA 1L0YB 3BVMA 1KLGD 3W2DA 2QEJC 2SEBD 2TSSA 3MFGA 4DXFA 1S5ED 1RD9D 1MD2D 2Z8LA 2RDHA 1JR0D 4K6LA 1PTOC 1ESFA 2J4XA 1SJHD 1BCPB 4L6TB 1STEA 1PRTB 1JCKB 1SBBB 3R2TA 4L63B 1PTOH 5FK9C 1QILA 4RGNA 4RFBA 2IPKD 1D5XC 3OWEB 5FKAC 3URYA 1CHPD 1EWCA 1HA5A 1LT4D 1SEBD 1I4RA 1XTCD 4RGMA 3EFXD 3DWQA 4Z9CB 3BYYB 1G8ZD 1AN8A 1HXYD 1LTAD 1LTBD 1TS3A 1JWMD 2XN9C 1KTKA 3BVGA 3V05A 4OHJA 1V1PB 1SE4A 2QILA 1DJRD 5ELDA 2O2LD 1ET9A 1XXGA 1F77A 1PTOB 1RCVD 4BWGB 1UUPA 5I4DA 2G9HD 1BCPD 1TY2A 1SE3A 3BZDB 1PZID 3GP7A 1RDPD 1D5ZC 1I4PA 1D5MC 4RH6A 1LT6D 2AQ3B 2NTTA 3TSSA 2NTSA 5ELEA 1EFID 3O13A 2AQ1B 5TSSA 1D6EC 1BCPF 1PYWD 2IJ0A 3BVZA 4C56C 1EU4A 1I4GA 1LTRD 1M4VA 4NZLB 1JWSD 3BYTB 4O1NA 1B44D 1TS4A 5D3IB 1PZKD 1I4XA 5ELFA 4ZYSA 3EA6A 3DWPA 1FD7D 1BCPC 1I4QA 1S5CD 1S5BD 1JQYD 1EEID 3KLSX 1S5DD 4RGTA 1PRTD 1FNVA 1TY0A 1CT1D 2RDGA 1SXTA 1V1PA 1FNUA 2WV6D 4RHSA 4RHRA 1LLRD 4TSSA 1SJED 1PRTF 1I4HA 1LTTD 1LO5D 1YN5A 2XRSD 1CQVA 2XRQD 2XNAC 5D3DA 3MC0B 2ICIA 1TS2A 1LT3D 1JWUD 1LTID 1YN3A 1KLUD 1LT5D 5ELBA 1V1OA 1ENFA 1SE2A 1UNSA 1PTOD 3SEBA 1PZJD
chains in the Genus database with same CATH superfamily
1SFOB 2WXGA 3CSFA 1SAPA 1VCIA 2XK5A 3PLVA 5FO8B 1WYGA 4TQ0A 1EQVA 4L5QA 3SFEB 1WXQA 1Z2MA 3GTJB 5LMNQ 4RF1A 5G5HA 5ELCA 1OXSC 3SK5A 5C4XB 3QG1A 5BR8L 5F2DA 1AE3A 5DPRA 3OMCA 2FCNA 4NJCA 4CKEA 5IIFA 2D3CA 1P7EA 4EKUA 4DUYQ 3G6EA 5I6WA 3LGJA 3AB5A 4ZCKA 4EGVA 3S1MH 2BYEA 4BY1G 1SSOA 3BVMA 4ZK9B 5M5YB 4JI3Q 4BOZB 3VH3B 1HFNA 1MG8A 2RSOA 5JXVA 1RM6C 2HD5B 1HQMC 4H44C 4ILWA 5IKCM 1GNUA 4DV7L 1V5OA 2BPSA 2N9KA 2PTLA 2N8NA 3STBC 4UP9A 1EQRA 3SXHA 3NWTA 1IW7D 1WZ0A 4K3BA 3S9WA 1BBUA 2KZRA 2CHWA 2UXBL 1ZYRC 1TWFH 5IGFA 1RRBA 4IQZA 1SIJA 4GN4B 2LZ6A 1HPCA 4U673 2KDEB 5ISRA 3VR6A 1LT4D 2IT1A 1TT5B 5C3WA 1A8VA 1U4LA 3VYSA 4ME5A 2W82A 3B9JA 3N1YC 1QVCA 3E9HA 4LWCA 2LFNA 4B0MA 4OHJA 3OSOA 1SE4A 3GTPH 4M1UB 2KVZA 1QE6A 4C7YA 2BA1A 3CW2C 3CCMA 1TKEA 3UGBB 2DN8A 4A3GH 3D0FA 1G291 2I5MX 1L4ZB 3Q3MC 3NG0A 1RDPD 3ZYYX 4M01A 2WXNA 4AWJA 1DOIA 3EQLC 1VQLA 2QSDA 2Z0EB 2KMAA 3TSSA 3HOYG 1GG3A 4LF4L 2KWUB 5E7NA 1ASYA 4GOPB 4R4QA 3FKIH 3PT2B 3Q8CA 2W3SA 4J6IA 4LDTB 2PCFB 4IOIE 3ZJVA 1PFBA 1TVXA 1RFKA 3UQAA 2AL6A 4A3IB 1EY4A 1O7ZA 4JBJA 3CCRA 3A8KE 1D7QA 3RNCC 1SMYC 1DOXA 1EZ8A 3DHGC 1JWSD 2UUBL 3T1YL 4OO1G 1VLBA 3U4VA 2ES2A 3A9JA 3HOZG 4K14A 3ZGZA 4PMBA 2B2VC 4NNJB 2UXDL 1AFPA 1B9NA 4C7ZA 2FXQA 1N61A 1QQRA 4NQLB 3CMEA 4DUZL 3EBEA 4OONA 2RPQA 3LNNA 2VH2A 2PE6B 2JA6H 2Y0SE 4QCLA 3ZRFA 3TEWA 2KMCA 4G7HC 3ZO5B 3SU8X 5HURA 3FMCA 4YHHQ 3S2HB 1UBIA 2EZVA 1VZ6A 2JYEA 2LY7A 3CCEA 2WV6D 2OJWA 3WALA 2JA8B 4MJSA 4MH0E 4C00A 1YQ4B 3KYHC 3ZLZA 3MC9A 1Q1EA 1E7UA 5C3EB 2INCC 4K7UA 4DV2Q 4FNFA 3I3CA 4NW2A 3WWVA 1JC7A 1Y1VH 2L9HA 4DK0A 2XRSD 5IOIA 1T5EA 3LB8C 3AEAB 2PI2A 1E2ZA 2DX5B 2DZJA 1HCZA 1FRRA 3D31A 2JK8A 2OWOA 1K73C 5TR5A 3CC2A 4X3UA 2SAKA 1UWMA 2Z9HA 4KKUA 4IKGA 1Q82C 3CSTA 2N7EA 1UWXA 1DYQA 3GTLB 2M9VA 4PMCA 4RGOS 1CI3M 1WY8A 2BA0A 4M8AA 4NXNL 3RUZA 2AKWB 4A3EB 5JJKA 3KW5B 4GOPC 1GOZA 1CKNB 2F0OA 2PNHA 4YTMB 3CCLA 2MP1A 3S2AA 1FNWA 1PH8A 3R2IA 4DR6L 2RCFA 2EYHA 2K5VA 3F8TA 2PW9A 4KDIC 1I6HH 1WR1A 4MTKA 3OIQA 3QAQA 3S24A 2YTYA 3J7AV 4H0LC 1WM3A 3BJUA 3C0RB 4P7IA 2DJFC 1OFFA 3AEEB 1MD2D 3TP7A 2BS2B 1P3QU 2FCMA 1KD1C 4EQNA 4PG3A 3K57A 4F7ZA 1E8YA 1OEYA 1GB1A 3QJYA 1QOBA 1E8XA 4LNFA 3EFUA 1M8AA 2MQHA 3ND8A 1HTQA 4AQYL 1IPGA 2V3PA 4GDKB 1XMQQ 3Q14C 3VHTC 3EIVA 2WXMA 1J8CA 4LNOA 1K3RA 1Y8RC 2MNAA 3ZW3A 2WXHA 3BK1A 2KANA 2BDNA 2KCCA 3Q24A 1JW9D 1BBXC 4LF8L 1S3SG 4W9CA 4PZ8A 3EFXD 3DWQA 4JK1C 1N32L 3SR1A 3I2ZA 2AUJD 2JY6A 2ZPYA 4JL9A 1E0ZA 1LTAD 5I6YA 2DYOA 2QCPX 2NVTH 1UZXB 2KJRA 2KNBA 1EWYC 2L8JA 3IXSA 4C80A 1FYCA 3V05A 3FILA 2NN6G 1WM2A 4KHPL 1SYEA 1WMHA 4ZRPA 4KTAA 3WANA 2CHZA 4PZ6A 3EFCA 2MSED 1KNAA 2KBNA 3KFUA 1E5WA 2NS5A 1E24A 4FP5D 2PQEA 4BWGB 1PTOB 3R3OA 1RCVD 1R4MB 4A3CH 3N1ZC 3PO3G 4GKKQ 4A90A 4ARCA 2CCZA 4K0KQ 1HZBA 5CX3A 2A69D 4S0RA 2KD0A 4RH6A 2AQ3B 1EY6A 4IOCA 1J8IA 1SGHA 1SFOH 2MQJA 1FCCC 4CBVA 3O13A 4L23A 3NS8A 3VR8B 1MVKA 2MHJA 2RF4A 4KKIA 2I5HA 5IP7G 4BAXA 4F87A 4OW0A 4HJ8A 4C56C 1D3ZA 2JXXA 1IYJB 4OIJA 5C4XH 2IY5B 5IA7A 1M94A 1A3VA 1I4GA 3AFQA 4NY0A 3RNAC 5BN3A 1XQQA 4M0WB 4F1SA 1BOSA 1O7IA 3IT6B 1DXMA 1ZXTA 2PMZB 3S1RB 4DGZA 4ZYSA 1K83H 4OWWB 4A3LG 2E75C 4HJ9A 3HM3A 4HRSA 2M17A 2L7RA 1VF7A 5DPTA 5M5YH 4B6WA 1PXUA 2X6GA 3ITPA 1JQYD 3WAPA 2F0WA 3ZJYC 3RNFC 1IYFA 4JE3B 1E1TA 2OTLA 1O80A 4W9LA 1P7FA 5M3MG 3HOUH 1HZCA 3K7AB 3PF5A 1FJGL 4W9JA 4WJQA 3VH4B 4RHRA 1BKBA 2SDFA 2E2IB 1TGZB 5IT9c 4A3BG 3T16A 4N9PA 4HDOA 1KDCA 1STHA 1I4HA 2CWAA 4YWMA 5LMUL 3HOXB 1N63A 3U8ZA 4E74A 1UD7A 3IHPC 1B9MA 3I90A 3QOJA 5AJ3L 4DV3L 2C7NB 2X6LA 5IGEA 1BR9A 2IO2B 1KM7A 1VJKA 1KLUD 2IX3A 1VRAB 5KNDA 1HNZQ 4BFRA 2DYMA 2WXFA 1ZUD2 2NBFA 2DGYA 4H7BA 2IY0B 4C1NI 2MJEA 3QX1A 5BMGA 1XMOQ 3U7ZA 2X8XX 1DZ1A 4E6IA 1E3PA 5M3FB 1GO3E 3I72A 1RF2D 4N8FA 4DAVA 1YJWA 4LF6Q 2J42A 4JW0A 2J0JA 3D8GA 3H09A 3P4PB 3CD6A 4FBJB 4BA1I 2HCCA 1AZPA 1BUIC 4HJGE 4UP7A 5LMNW 2D0PA 1FGBD 1R7SA 5COYA 4DR2Q 5AZGA 1B1ZA 1L0YB 1F9RA 1JMLA 4HSVA 1E8WA 1IP9A 4XQQA 2WB1G 4K6LA 1YHBA 4DFAA 2N3SA 2NB0A 3AU7A 3RT3B 4CJ0B 3W5UB 1JOOA 1SMXA 4IJLA 3TN2A 3VR9B 3M95A 2DNFA 3PCOB 1HA6A 1SNPA 4JVZA 2UXCQ 2WXPA 3UF8A 3TEXA 2MPMA 2JEBI 1VQAA 3OYYA 4P2CB 5GROA 2ZW0A 1F9PA 1PH6A 1SYGA 3ONSA 3S2DB 2BS3B 3A74A 2WKDA 2GN5A 2NUCA 3PZ8A 4Q2JA 4ULLA 3PUWA 4EZKA 1WD1A 2D10A 4IFDH 1KHIA 5JVH3 1V8QA 3HFZB 3TZUA 1I94L 2KAJA 1H9KA 2KWDA 3PIO3 2HDLA 1L2FA 4BY7H 2ON8A 5C5LA 1WRIA 2WWZA 1N62A 3RNEC 1F0ZA 2QMTA 2JA7B 3NS1A 4EOYA 3SK8A 2CJNA 2V3SA 1N34Q 3I4OA 2WAQB 4B9KA 2B63B 1EFWA 3AI5A 4A55A 3NVZA 4I6NB 3MAQA 3M7NA 2E6XA 3ML8A 4XX5A 3NVYA 4KK7A 5NUCA 3N9YC 3M3YH 4DR1Q 1A15A 1SLJA 3KBGA 1LT6D 1JICA 1EQTA 2B2WA 2N49A 4DNTB 4EQPA 4K1RB 5JAVA 5J22A 1GUSA 4TKOB 4KSLC 1XCTL 4A8XC 2A19A 2KLCA 4DXAB 5I9OA 1HTOA 2OQKA 2JF5A 2OT2A 2LGDA 1VQOA 4DV6L 1C76A 3KVFB 1ZXIA 2DZKA 3J81c 3LDZE 3T9LA 1TS4A 4KHZA 3TREA 2CFMA 1G91A 2N4FA 1IL2A 2XVSA 4ZYNA 1PLFA 1Q8IA 1WGYA 1CKNA 4C1NK 2H1EA 4A93G 2ZJDA 1TIID 3I4MG 2CW0C 1YJ9A 2KFKB 3TCAA 1X3PA 4ODGA 3RCZA 2QF7A 4A3DH 2B2YA 1HNXQ 3OJ3A 4TKNA 2JE6I 2K5HA 4FJYA 4NMZA 1TR5A 4HAEA 2E5LQ 2R93H 2IGGA 5C44G 3L0WB 4WQOB 3RZFA 1Z7TA 1WJJA 1CKOA 1B50A 1L0VB 3L2PA 2QCZA 3AU4A 1LTTD 2K04A 2C9WB 4K81A 1X9NA 5KYLA 2ZM6L 1UE7A 1LT3D 1JWUD 3DBLB 3V2TA 3E0EA 3IT4B 3ZXVA 4BBNC 2K5DA 4XTCS 1HFGA 4XYQA 2NZHA 2RCNA 3PHWB 3NQTA 5DM63 1PRTC 2JRHA 3GD7A 4R8NA 3K80C 3HS0C 3QC8B 3FVQA 3NBIA 3VR3A 5IP7H 3AE4B 4HJKA 1C4PA 2J52A 2AQ2B 1EO6A 4B3TL 2K6QA 4XIGS 3A56A 3HM6X 2WXJA 4I6LB 3R8BA 1DM0B 2DENB 1I5FA 1PH9A 3TBLD 2JXMB 2GVAA 4CDDC 1ZGUB 2F4VL 2ZT9C 3S1NH 2D3AA 4BBRG 1LTSD 1XX8A 2ZZPB 2ALYB 4XQNA 2PW5A 1RL2A 3I70A 4II2B 1WTWA 3ZNID 2JA5G 5BMHA 2HJ8A 1WFQA 1EIGA 3JAMc 3T8MA 2AYOB 4QIWB 3S1RH 2KECA 5EAYA 3J81i 2C5LC 2RSUA 3A1QB 1QOAA 3LWUA 4B3SQ 2CHXA 3KUCB 5DM73 4DR3Q 2WQYB 4A3BH 3QHTA 1GJZA 1I3QH 1CM9A 1YHAA 4PK1A 3VA5A 1E7ZA 1PUTA 2N9PC 1N33L 1STYA 1YEZA 4C3JB 4X65Q 2I2YA 3EGRA 1QJOA 4A3JB 4XGAB 1F2YA 1LTBD 2LXCA 2EJGC 2PQAB 4IW0A 2Q2IA 4A3FB 1R9TB 3ZVVA 3GTKH 3W5VB 1X65A 2QILA 4ANUA 1GVPA 2KQ4X 4KKJA 3Q23A 2B2TA 1IGDA 1TYGB 1KF6B 2GBMA 4TV3A 2PE9A 4AOFA 1UUPA 1FFVA 3K5NA 1YVCA 1HR0Q 4BXXG 4XT3B 4NB3A 1EZ6A 5JHAA 1C0AA 2CH4A 4IWQA 5CGKA 2AX5A 1V43A 2YTXA 4KKTA 3AQQA 1A2TA 5T1GA 3E9SA 4QY7A 3P4QB 1R4QB 4HJAA 2RKSA 5M3FH 3VFKA 1EM7A 4CKBA 2Q8RE 2RMMA 3AE8B 4LAAA 3AE5B 1PDXA 2XK5B 5JOBA 4JBKA 3RN9C 3K7UC 1Z47A 2HQEA 4XYCA 2NVYB 1TIFA 1AE2A 5BR8Q 3H9DA 3L54A 3JVZX 2Y0SB 3CCQA 2VUMG 1JOKA 2K32A 4O2DA 1LTLA 3RD4A 1WGHA 4GKJL 1S5DD 5KYIA 2Z6KA 3RNGC 2KUMA 3HOVG 1G6PA 1E7VA 1X1MA 4NP5A 3TS2A 4DR4L 1SYFA 4R4OA 4GLSC 1SRUA 2MBEA 4IUVA 5G2NA 4DV7Q 2VB2X 1T3QA 1UF0A 1SJED 1OGWA 1FVIA 3S2DH 2RSNA 3VAWA 1KFYB 2KENA 4IWPA 3D4DA 2XRQD 5EPLA 3MC0B 1K0RA 2LMCB 2CH4W 4ZRQA 4DHZB 1X3FA 1D2BA 2LFIA 4FXKC 1WXAA 1HUMA 5LXHA 5DNFA 2NBUA 4XDDA 4BKSD 3PUXA 4P74A 2B63H 1NR4A 1ILPA 1H9RA 2V1CC 2GBRA 4ZLTF 1EU3A 1NEKB 3NZSA 3NTIA 3H3VC 2KACA 2GBKA 1CHQD 2CHBD 2KDFB 2K5WA 3WAMA 1CSQA 4N8X1 3DBHI 5A35A 4DAMA 1WVLA 2MJ3A 4JI0L 4JV5L 2M4NA 4W9KA 4A93H 2HDMA 3BDCA 5L37A 4LF4Q 1ML0D 2V3NA 1TWHB 4IALA 1WWTA 3UI3A 1A5RA 4B0EA 1FFUA 4EUTA 2L15A 2CKZB 1V2YA 3B2GA 4LFBL 1SB3C 4JQWC 4LNNA 4X66Q 3DHQA 1BNZA 2UUBQ 3T1YQ 3X23A 2F0HA 3P1HA 5C1ZA 2IWHA 2WXKA 1OXTA 3X3MA 2WXRA 4AS1A 5IP9H 1WGRA 4A3GG 2UXDQ 4IFDJ 5KGUA 3D4WA 2MJDA 1L5PA 1YJ1A 4DK3C 1QF6A 1C7YA 3CQZH 3AEFB 2BVCA 1Y1WG 1MBYA 1TS3A 4P6VF 2WINB 2R7ZB 3FKIG 2BKRB 4DK5A 4JOIA 2KFKA 2KJ6A 2ZW1A 2V4LA 4GSWA 1A2UA 2EY2A 2F0NA 4J6HA 3TRZA 1DJRD 4IURA 2UYZB 2WU2B 1XTDA 4PV1C 3L0OA 2Z0DB 1XXGA 4WAAA 3D4RA 5JJIA 1NUCA 2Q8IB 4RMAA 4OELB 2EOTA 2JEAI 2CS4A 2K1BA 3PRMB 4XWTA 3VUXA 3VVWB 5AZFA 1BCPD 1TY2A 1VMPA 2QW7A 4IFDI 1GHJA 2R7FA 1TWAH 4K3CA 3MVVA 5K36G 4JI4L 2A73B 2I5LX 3APCA 5CHWA 5BYQA 2JA6G 4BBRH 2AQ1B 1ZOYB 2VQFL 5J1ZA 1YNTE 3L08A 1PYWD 4GGQA 3L4PA 2QDLA 2RGFA 2PEAA 4USAA 2G5DA 1MI0A 1MJDA 1PFDA 4NXNQ 4C3HB 1IBLL 4O1NA 5IYDH 1WTPA 3D6CA 1PZKD 2MCNB 2EYFA 1E2WA 2OQ0A 3ONAB 2DUDA 1Y1VG 2PO4A 3NSWA 3J80c 4DR6Q 5IWAL 1S5CD 3T51B 1RYJA 3UI2A 3H6MA 3K58A 4MNOA 1LGRA 5IODA 3NPPA 3K5OA 1CJEA 1WYWB 2K75A 2WXIA 5J39A 1SXTA 2B2UA 3PO2B 1QUQA 4C2MH 4FXCA 4K8JA 4HIOA 3CAMA 2F52A 2MFIA 3PUYA 1K8RB 3QK0A 2AEHA 5HFYA 3DBSA 4FVMA 2UU9Q 2K9XA 2I0QA 4GN1A 4OZAA 4ASWC 3U2SC 3RYTA 1WZ3A 5D3DA 1ILQA 1IUEA 1E8ZA 1G2TA 3MA2B 1YNNC 1XLPA 2R2QA 1N32Q 3DOWA 4BZAA 2HDEA 1P16A 2NN6I 4DAPA 4AYBG 3STBD 5FLXc 5EKKA 4OX9L 1KH0A 4GN3B 3ULJA 1EY0A 1Q8KA 2PQAA 3CHBD 4JI1L 4HJ7A 3RN5A 4KHPQ 1K50A 1WMHB 5IGDA 1NI3A 2W55A 1YNJC 1QT9A 2EDGA 3ND9A 4K8IA 1GUGA 1FL0A 5EPJA 4XDCA 2M00A 4IPDA 3K0XA 5A2QL 4IG7B 4WRDA 2V9HA 4OVUA 5FR3A 2MEKA 4NPNA 1T0YA 2PVGC 2MHVA 3J7AF 3I4NB 1WF9A 2UUAL 4HXDA 4MM3B 1RD9D 2RDHA 3S1QB 3HKZB 1ESFA 1J6QA 5C3JB 1EWHA 1IL8A 1WRDB 4RM9A 1YIJA 5MPOA 4CJ1B 4KGTA 4B3RL 4HSPA 3H7PA 2O5JC 3DBRI 1K8MA 2A5UA 2V0GA 1SYBA 1RFAA 3J80i 3CIRB 4A3CG 3BIID 2AMCB 4YTPB 2LXKA 1YHQA 2ZTDA 2PPBC 3A7LA 1SEBD 4RGMA 2K01A 3RD2A 2QC8A 3HHMA 4HCNB 3E56A 2JZZA 1I7HA 3ZJUA 1KRTA 5DPWA 2IZVB 3BVGA 1SMYD 5EBCA 3E9IA 3N32A 1P8LA 4LUZA 1FJGQ 2QIEB 1UE6A 4AJWA 1GPXA 1EWIA 3GS2A 5C4XG 2O2LD 4FF2A 4N9TA 2JX5A 3NZ3A 4LNQA 2OEOA 5DLQE 1YJJA 4WWOA 4FA6A 5LMUQ 3PPAA 4LFCL 1T9HA 1R4PB 1A6XA 2ID0A 1JJGA 2J0KA 4LLGM 3MXGA 4DF7A 5AJ3Q 1BT0A 4V0BA 2G4SA 1HR0W 4DV3Q 2HTHA 1IGCA 2ZXPA 2L00B 1NY4A 4M00A 4BBNF 2LMCA 2KDMA 2NVQB 3DPDA 3KOJA 1HZ5A 1D6EC 2O2VB 4IC7B 4KGSA 3BVZA 2KVMA 3K9PB 1P1AA 2L0CA 5GAHC 3HOUG 2I46A 1CZGA 2LD9A 3QIJA 1IKLA 2H88B 5E6JA 2LSSA 1CUKA 4P16A 2KTRA 3KF8B 5D3IB 4W9DA 4Y7NH 3WOEA 1ZP0B 3N20C 4I7ZC 1T6BX 2F3VA 1XLNA 3ERSX 1PH3A 1DOLA 1SF0A 4PMWA 2IGDA 2I1JA 2GOWA 3DM1A 3UDFA 1PHJA 5A2QE 3PIOA 1FXIA 1WE6A 4LF9L 3BK2A 5KEEA 1V1PA 3CKIB 4YCVA 3PMFA 3RLNA 2H5XA 1Y1WH 4EEWA 4RMFA 4MELA 4K6DA 2FNJB 2ZJQA 1F2ZA 1TQOA 4JPBW 1U4MA 1UGMA 3AB9A 4IUTA 4X3TA 1FD6A 4MZ9A 2KWVB 2FBWB 2JQOA 1YN5A 1VQMA 4MGYE 3I73A 1MG4A 4CDEC 1X55A 2KDIA 2D11A 5G5GA 5I2YA 2R7ZH 1Y8NB 1Q3LA 5C0XH 2NCNA 3ZNHB 4HEA1 3HG9A 3OWFA 3P1MA 5BYRA 4PT5A 3QR8A 5K36H 5T1IA 1UNSA 2JU6X 4A3IG 2K4KA 3VR2A 4UAIA 1I94Q 1PZJD 2D5DA 2Q2UA 3N3KB 2F0QA 3A4SC 4GS3A 4MT5A 5DPSA 3HOZB 3AULA 4MACA 2BYVE 4KN4C 1IYUA 3M85A 4RCOA 4ALPA 4AP4C 1SE8A 1J9OA 3GTGB 1PFNA 2XIWA 2Z1CA 4QL5A 3A55A 4R4TA 1QOFA 3H8HA 4E71A 4MSQB 4AH6A 2BB5A 5E6NA 4B9XA 2CKHB 1F9SA 4PZ7A 3ECIA 1N36L 2K50A 4X3KA 2DNCA 3CP0A 4IUNA 3UINB 3KYCD 4IFDG 2IX1A 1UE1A 1A3UA 1E1OA 2B8FA 4C3HH 2JA8G 4BKGA 1LV9A 4FO2A 4JWSC 1UBQA 4KX6B 2J53A 1RLFA 3N52A 3FEWX 5C3EG 4KJNA 4BY7G 2LHEA 2UWQA 4DV6Q 1VR9A 3ETRA 2DNEA 1C48A 4GXBA 4FULA 1ASZA 1XLOA 1HHVA 3OWEB 1C4CA 5IY0A 2EY6A 4EZJA 3TUOA 1PH5A 3U52E 3U7DA 4YWLA 3MZ5A 1VQHA 4BVUC 1VZ7A 4ZUJA 3A5ZB 3M4OB 3W1GA 4ZRIA 4KY7A 5FO9B 2ZXRA 5BN5A 1PMRA 1T0RC 3H0GB 1TKWB 4CHKA 5KHOA 5IP4D 4FF4A 1XPOA 1BMLC 4A3EG 2MBOA 3W3AA 4WJNA 1HZ9A 1TWGB 2Z4IA 4WJPA 2KJXA 4W9GA 3S17B 1C9OA 2XSCA 2PZWA 2N1WA 4MHEA 4F7XA 5CV6A 2ZCBA 4MGZE 2ZM6Q 1FM0D 1WIAA 1MHHE 3V62A 2VZKD 4JI2L 4YSXB 4NKLA 3TMPB 1SNQA 2LI5A 3QARA 3P75A 1BBWA 4YY3L 1ICWA 1LFDA 2V4IB 1B3AA 4A3DG 4IPCA 3L13A 2K8BA 1R4NI 4W9FA 3RMKC 2M8SA 1IBML 1QOHA 3TJPA 3VUWA 1VQCA 3I3TB 2B2WC 2KQSA 3WOFA 5CV9A 2WDQB 3JSVB 5EE1A 4YCUA 2R93G 4OGQC 4B3TQ 2PJHA 2W54A 3PHXB 1VQPA 2K6AA 3OTOL 1OXUA 2X69A 1LM0A 1WJUA 2K7VA 2FIFA 2BBCA 4EVOA 5CTRC 4IWOA 1K28A 2F4VQ 2BS4B 4JX1C 3RR5A 2NVXB 4IJHA 3M62B 4DR7L 3UE1A 3BZCA 2QEXA 1XPUA 4CYEA 1CT1D 2YU9B 2DJGC 3OMGA 2D3GA 4ICUA 2IW3A 3KQ4A 4TVAB 1X54A 3DMUA 3EN2A 3RLOA 1JT8A 2LGYA 2F0IA 2LJ5A 2N7JA 3PO3B 3ML9A 4QGUA 4G11A 4MM3A 1L0WA 5IE8A 1XJVA 5E3FA 3GTJH 2MRPA 3UDXA 2K3UA 1H4RA 5H1SE 2B2YC 3AE3B 3L3OC 3FKYA 4HTHA 1L6UA 4HMJA 3IG3A 3Q0AA 3DVGY 4MGIE 3DCGA 3VRBB 4C4VA 1N33Q 4A75A 1MGSA 1H8CA 3Q22A 4DR5L 1NDDA 4Q5VA 3MP9A 1C3TA 1YOVB 1F1HA 4JC0A 3BINA 2ZJPA 3H1UA 3X0WA 3MHSD 1BO0A 1RHPA 1PFMA 3N6RA 2PI2E 4G4KA 3FP9A 4ME3A 4KN7C 4RKBA 1AARA 2PMVA 1U5KA 3EJIA 4YWGG 2NVQH 2AWOA 2A6HD 2E2DC 1JWBD 5EE9A 1UELA 1JB7A 4ZOHC 1KLVA 3R7RA 4QUFA 3Q8FA 1DGSA 2WLBA 3PREA 2WACA 2QEJC 1TT2A 2TSSA 4LFAL 4W9HA 5D2MB 1S5ED 1CMXB 1STNA 2Z8LA 3A7AB 2IO3B 1PTOC 4GNXA 3P63A 4ZHPA 2J4XA 1PH4A 4AJYB 2O2VA 2K8CA 4LTUA 5M5XB 2MUYA 3RNUA 3Q6SA 2JPHA 1Y8OB 3SDLC 3CMMB 2HIXA 2G9DA 3OPOA 3A4RA 4NJ6A 1GJXA 3GTQB 2L32A 1XWEA 1TU2B 4K5XA 2N9EB 2R3ZA 4LUOA 5GMVA 3KF8A 1EWCA 2AHOB 4YSYB 1C79A 1SROA 3Q6BA 1HTPA 5D14A 2WP9B 4XWWA 1SIFA 2WGSA 1EY7A 5IOCA 1H95A 1I50B 2K5QA 4GKJQ 1FMAD 1H9MA 5EBDA 4AYBE 5M3FG 4DR4Q 3SHQA 4WJ4A 4TMAB 3FHWA 4A3IH 2BWFA 4P73A 2LRWA 1C9FA 2L83A 2N88A 5M9OA 1KC8C 3TP5A 5EKIA 2KO3A 1ENCA 1FR3A 2JRIB 1JE5A 1V9PA 2KHWB 2A69C 1C1YB 2V1YA 2RR9A 1B53A 1WGKA 3AE2B 2CW0D 1D5ZC 1I42A 2F0MA 4XDXA 2L05A 3VQIA 2LXAA 2REXA 3EVQA 1K52A 2WB1B 3VTUA 2B2TC 3DEPA 4YCWA 4OWXB 1F9JA 2GB1A 4WJOA 1WJNA 1XD3B 3I91A 1BCPF 2WYQA 5LNK1 2VRRB 3KUZA 1GM5A 1X3GA 4XQJA 2INDC 3S2HH 3A9KB 3Q8EA 4E3CA 1G6ZA 4ANVA 4LNIA 2JA8H 1GKHA 1EF5A 4W9EA 4ZHOA 2J7ZA 3UE0A 3AE6B 2ZXOA 3VYTA 1YQBA 5C3EH 1FPYA 2FCQA 4ANWA 5CBAE 3H91A 4DV5L 1E7PB 5KIXA 2NBVB 4XE0A 4X64L 4S17A 2K6DB 3RZDB 2OOBB 1DCZA 4S3SA 2UU7A 2LXJA 4JI0Q 4JV5Q 2EMTA 1PRTD 1KXLA 2LGXA 5IAAC 4HEDA 4K2KA 1FNVA 2KK8A 1K8OA 2RDGA 1Z5SB 2JA7G 1VQJA 3GTLH 3PZDA 2VNUD 4ITKA 2B63G 1FXAA 1LLRD 5H92C 1A0IA 4A3EH 1KJTA 4LFBQ 3K8AA 4A3KB 4GIVA 2Z6KC 1NENB 4K7SA 3W1SC 2MH7A 1SYCA 1LO5D 5C0XJ 3C46A 3S14B 3GTOB 4XZ4A 1VQIA 3NEMA 1CQFA 2VQEL 2K25A 4L2YA 3PS6A 3HRDD 2EYLA 3H0GH 3G48A 3S16B 1JORA 1YN3A 4PS3A 1VQ9A 2YLMA 1TWCB 3TP6A 2K0PA 2JN4A 1TWGH 3AYHB 2A6EC 1P0RA 5LLIA 3WDNA 1AW7A 5D94A 3BG3A 3RN2A 3S17H 3HIZA 3F2CA 4UY8C 4WQMA 1CFMA 2H89B 4P1CC 3W5OA 2F0UA 1TJEA 3GV6A 2BDOA 1HRJA 1NYRA 4NAWB 1EUJA 5IP9G 2PZTA 2BE5C 2F0KA 3ER0A 4R8IA 1RWSA 4OEMB 4JI4Q 3L17A 3K5LA 5LHY1 3P42A 2F0EA 3PSIA 1V9JA 2Q8TA 1WE7A 2G45B 2WDTB 2L4NA 4P75A 2VQFQ 3BWUD 5C44B 3GB1A 1VQNA 3NRZA 5AFWA 3IVFA 3V6CB 3FC4A 2FCSA 1BVSA 3U9OA 1VCBA 3R2TA 4N9F4 3FPUB 1PTOH 1QILA 4RGNA 2O6VD 2IPKD 1B70B 5IT9L 3A8JE 5FKAC 1SN8A 2WHIA 1WTHA 4QJFA 3JSVA 5KRUA 1ZPSA 4CKCA 2E2JB 4KV2A 1EYAA 3KLWA 5IWAQ 4KHVA 1ACCA 3GDEA 4Z9CB 2YU9H 1OEYJ 3NY5A 4NJ7A 3RUIB 1H9JA 2HUGA 2J7QB 3G4SA 1S72A 2FIDA 1TBEA 3SGIA 2L0FA 4AUQC 4DV4L 1D1KA 2TMPA 1QUQB 4LJZC 2EKIA 3AN1A 2R7DA 4DV1L 2HCIA 1WTXA 2EPBA 1OTRB 1ET9A 2GI9A 3HK0A 4HROA 4IM2A 5J17A 2L76A 3F2DA 2LUMA 5IYDG 5C4JB 2KLGA 1E22A 4G57A 2LVPA 2FFKB 3SDZA 1Q1OA 3GZNI 4GLXA 1KDBA 3GP7A 4JOIC 4A6QA 4GOCA 2JA5B 1C77A 3HOWB 2SOBA 1OQYA 1KOTA 1EFID 4HPMB 5HKHA 3AE9B 1RTOA 2N55A 4KD3A 3PGEA 4GN5A 5D7GA 4YSZB 4IN3A 1YJNA 3K7AH 1L4DB 4KD4A 2WDRB 4A3MB 4IO9A 4ZAIA 2WNMA 2DZIA 2Y3AA 3F2BA 2E2IH 3AMZA 2Z6BA 4JI1Q 2KEDA 3MEFA 1GC6A 1QB5D 2V4DA 4QB4A 3HOXH 1GHKA 2JSVX 2HT1A 3PIP3 5GXGB 1Q10A 4C3JG 3P4SB 4A3JG 1EEID 3NXWA 3TS0A 1M1KC 3P4RB 4A3FG 2INNE 1OQRA 2KN5A 3HGBA 1GUWA 2PIAA 4NAMA 2UUAQ 1OQQA 4J8QA 4APVA 1ONLA 3GO5A 2KX0A 1UEBA 3ZNZB 4TSSA 4DN4M 2DAJA 2AUKA 3HP3A 2CU1A 2OEDA 5J2RA 1PH2A 4MN3A 2KJHB 4B3RQ 1A63A 3H7PB 4DDID 2WP8J 3C19A 4EX5A 1EL0A 1WCMB 2B2UC 2G3QB 2F0FA 3IAYA 3BY4B 3QA8A 4DDGD 2KHJA 2BH8A 5CC4A 3I7FA 5JH5C 4JI6L 4LF7L 2DZMA 3JC66 3R93A 1EQQA 2XTIA 5IT9E 2KFJA 4LJPB 1NSNS 2RDFA 1V1OA 1U4RA 4JI8L 3RZOB 2ONQA 3OG5A 5EPKA 3SEBA 4JPSA 4IDIA 3OJ4B 4B3ML 4P72A 2JWUA 3W1SA 1HNWL 1RJTA 4L5RC 3JAMi 2EYMA 3VUYA 3EHVA 3DWAA 3KLSA 4X62L 4FYDA 2K03A 4G3XB 3FAHA 2QGQA 2VUMB 4FLHA 1QCBD 1EF1A 1EYDA 3J81L 2B29A 4LFCQ 1NCVA 1ROEA 1GUOA 2C60A 2KVRA 3E0JA 2LASA 4FF3A 2MA9B 4HKZE 3HOVB 2UXBQ 5CHFA 2R92B 2RA4A 2D9UA 2F0JA 3DHHC 2L5TA 2K33A 3Q69A 5K5PA 2OTJA 1NJIC 3PZ7A 3MFGA 1D4BA 1WI5A 3BS1A 1VQ7A 4C3IB 3I9V1 2A68C 2L3ZA 3Q8DA 2JA7H 4B95A 1EUVB 4YT0B 2WKCA 3A9KA 3T56B 2K1FA 1AEXA 3RZDH 4N6EB 5JJZA 2Q2HA 2X38A 2KTRB 3URYA 4HIMA 4IPHA 5BYSA 1I6VC 1KAWA 1MPEA 1HA5A 4JWUC 3S1MB 1E0BA 3SHLA 1I35A 2D0OA 3M9BA 3ABVB 4IUMB 1DD2A 1T0QC 5D6JB 1UE5A 3A5UA 4LF9Q 2XGTA 3KBXA 4PQXA 2BTEA 1V1PB 4LK1C 1J7BA 5CYUA 1TWFB 2PYKA 1UAPA 1IXRA 1DGJA 2C5CA 2EIFA 1CA6A 3ALBA 1N60A 1TWCH 2QKIC 5EQ0A 1QVGA 3M4PA 3S15B 1YQ3B 4JYAL 1ZDVA 2H4OA 2BWES 4F8CB 4Y52H 5TSSA 3KF6A 2FUHB 4DUZQ 4OZBA 2PNRC 3GTPB 3I8ZA 3K6OA 1WSPA 3M3JA 3AMUA 4HJ5A 2IO0B 2DWQA 2ACZB 2A8VA 3PQIA 3LYYA 3BYTB 1IKMA 1EY5A 2ICEC 3CCVA 4A3GB 2HD3A 4K2LA 1CZPA 1DONA 3SK6A 1A3TA 1CKMA 3KYDD 3RULA 2LHDA 1I4QA 3OHXC 2KWCA 2N9XA 3PUZA 4KZCA 2EY5A 3TL5A 3T1HL 5JJLA 2GBJA 2R7ZG 1FEHA 1L1OB 5C0XG 3J81E 1N36Q 3DWGC 3J7YW 4NAWA 4G50A 4HPLB 2LS01 2WXLA 3NP8A 1TY0A 1B9RA 3WA0A 1VQDA 3J9CA 1HZAA 1V97A 3KWVA 1WGDA 3B0AA 3I63C 3VYRA 3WIMA 4DHJD 1V81A 2LWPA 3D6WA 1BF4A 2DBYA 1C4QA 2E2JH 1WXVA 3TQYA 5G55A 2I1KA 1QVFA 2MX2A 3Q2AC 4PS8A 1Q86C 1NYQA 4K7WA 1KL9A 2DAFA 2LKVA 1PA6A 4LF5L 5FLMH 1KQSA 1LT5D 4HIDA 1ENFA 2CWPA 3MXPA 1AZQA 2O4XA 4M02A 2IY1B 1GUAB 4L8JA 2CR5A 2K22A 2EY1A 3D32A 5CV7A 5M5WB 1B3QA 1G2SA 4C3HG 1ZEQX 1ZDXA 2BYTA 4OXPA 1BXTA 3U58A 2AWTA 2KQ7A 1Y1VB 4MIUA 2IHEA 4DKAC 2QDFA 4YWKA 1Q1BA 1WTQA 1UH6A 4PYUA 1U0LA 5IYCH 3UIOB 2CQAA 1YIWA 5HGQA 4DXGA 4AQYQ 3C3LA 4C3JH 2M0AA 4A4IA 2R2OA 4JI2Q 3UDIA 1V86A 2FE8A 4A3JH 3ENEA 5GQOA 4WAFA 3W2DA 4A3MH 2SEBD 3LWEA 4A3FH 1R9TH 4YY3Q 4LF8Q 3Q3JA 1YX6B 2N78A 3DM3A 2KMMA 4L6TB 1IBMQ 4V190 2EXZA 1EIHA 1SBBB 4U68A 3AECB 2K8HA 3KH0A 3Q3FA 4JI5L 4KIKB 5IN7A 2W3RA 5EJWA 1QWYA 2KHSA 4FXGC 3OW2A 3PLUA 3Q8BA 1ZYRD 1FO4A 5BMIA 3OTOQ 1I6HB 2ZCCA 5C4HA 1STBA 1I4RA 2JP1A 2P5ZX 1LM8B 3AXCA 2L55A 1WXMA 4JIOU 4AYBB 3T3NA 2WIIB 5IYBH 1AN8A 2D5GA 3H3VH 4DR7Q 1K0SA 1J5EL 1K9MC 2I07B 4DR3L 1FRDA 1R4MI 4X3SA 3GTMB 1W6JA 3DUZA 2HHHL 4H2AA 1ISNA 3IBEA 2B8GA 4BBSB 3TBIB 2NZOA 3APDA 2JSOA 5I2XA 2JZPA 2MP2B 3CF5A 2OJRA 2NVYH 3GV3A 3AV8A 3LXFA 4YIJA 2AWNA 1EYCA 4P71A 5EE0A 2WDVB 4G7OC 2K5NA 4GLVB 4BOSC 1KABA 3OIPA 2NTTA 3QIAA 4DV0L 3QWZB 3I4NG 4C4VB 2NVTB 2IO1B 1BDOA 3CF6E 1VZ8A 3HKZG 1WR6E 1IBKL 3PTFC 1KDAA 2RHSB 1HR0L 4NXML 3DVNU 2ASBA 3PF4A 4WWPA 5EKLA 4NDXA 5C3XA 1ZKHA 3KWLA 1LTRD 5JPNC 1TZ1A 1JQ4A 1LACA 5E6PA 5EE3A 1I4XA 2CVRA 2F0DA 2F1MA 2R92H 4TQUS 4MTNA 3A54A 3GE8C 4DBGA 4MSMB 4WWMA 2BW2A 5C23A 2KTFA 2W9NA 3Q3NC 5JPMC 1UWVA 4C3IH 1MSGA 1UGJA 2J0MA 4BY1B 3PRZA 3E5SA 3QQ8B 1OTCA 4LFAQ 1FNUA 4DWFA 3JYUA 4RHSA 5LL6X 1Z6HA 3VXWA 1VDZA 3LJ3A 4GNXB 2QDBA 4QAYA 5GAGC 1SR3A 3M4YA 3CC7A 1PRTF 1K83B 3KJPA 1TTNA 1PH7A 3DWMA 3NWSA 1XO3A 4URKA 4G0NB 2ICIA 1TS2A 3CC4A 2DY8A 1QZEA 5CBEE 1WTVA 3D3RA 3ICEA 4HCSA 4XC2A 2KOLA 4MH8A 5GAEC 2FJ2A 3QB3A 1TWHH 5JVG3 3KK7A 4L5SA 4QIWE 3HOUB 4QMGA 1RIPA 1X56A 3IAM1 4ZKBB 3W1YA 2KC1A 4FJVB 3E3XA 1CK1A 3WCQA 5ELOA 3KUDB 2MO0A 2D2QA 2RD0A 4A3OA 4LDTD 3S15H 4HIKA 1Z9FA 1HZ6A 4JI7L 4BKSA 3NTHA 2EQSA 1EIFA 1F2RC 1HTLD 1TZOA 2QJLA 2KYWA 1P98A 2KOXA 2G1EA 3J80L 3DBHB 2KN4A 4KV6A 3HOYB 3HVZA 3I5JC 1G51A 2Q5WD 2NR2A 1EIYB 5DAUA 4HKQA 3AE1B 3I4LA 2WX0A 2K14A 2YEPF 1ICFB 1IBXA 1S3OA 4DK6C 2WXOA 3VDYA 2YVCA 2EJMA 3PUVA 1D5XC 4LNKA 4DV5Q 2DLBA 3QO2A 1F2MA 1CHPD 4GNXC 3CRKC 4X64Q 2M19A 5KNCA 3PO0A 1J7CA 4YL8A 1HH2P 4A9AA 1FCLA 2NYZD 4CJ2C 2N1VA 3B08A 2L0TA 4GDLB 4KVGB 4EFOA 3W1BA 1HXYD 2BCOA 4X66L 3G6JB 4ABNA 1D1IA 4O0AA 1L1OA 1MHXA 3UQBA 1K8AC 2MO1A 3ZRCA 5FLXL 4NPSA 4X6AH 4N58A 2B39A 1IW7C 3MFYA 3ZTCA 1VQEA 1VQFA 2FMMA 4DPGA 5CV4A 1WD0A 2NMQA 2N9LA 1I4PA 5CV8A 2VQEQ 2GLSA 3PSEB 4I6PA 2HTME 4XXEA 5AZHA 4ANXA 4OL7A 2JVCA 3SVMA 5JEAH 5ELEA 5M5WH 3NTKA 3AEBB 3NE5B 4BY7B 4P1BC 4RWSC 4OVVA 1U9RA 3PO2H 3PVLA 3ULPA 4RM8A 3MTNB 4HWIB 4DNRB 4RF0A 3SK4A 3B2FA 2ENBA 1VQ5A 4POGA 2JJQA 1N5XA 4PNYA 1WYDA 3KDFB 4HK2A 2GVBA 4X57B 1XEEA 3M3YB 3IFWB 3H15A 4DHZE 2BF8B 2K52A 1GUNA 1XNRL 3L16A 1SNMA 3NJTA 1AP0A 4RGTA 3H0GG 3PGZA 3G71A 1VQGA 2KT7A 4O42A 1K8GA 4N59A 1KRHA 1P9DU 3MWYW 3AH7A 1HE8A 2BH2A 3J80E 2PPHA 4IOAA 2MLBA 1WTOA 5C5MA 4AIMA 3NZUA 3CPFA 3V6EB 4POFA 1B7YB 4US8A 2E2HB 2E76C 2R6GA 2VW9A 1EYGA 4R1JA 3DBLI 2JA9A 2PW7A 1JRPA 2AL3A 3M4QA 1X6OA 1NAPA 2CQOA 2EYJA 1A62A 4RAUC 3VR5A 2LVQA 5CMDA 4KIKA 2IHFA 3SD5A 4BKTA 2SNMA 1B2TA 2OXPA 4BA2I 4WURA 2ZVNA 4A3DB 5C6AA 1VQ4A 5HI1A 1XNQL 3GTMH 2XEWA 1PTOD 3I4NH 3NK9A 3NUCA 2BGFA 3C8YA 2UU9L 3I57A 2SNSA 2VB3X 3N30A 2F0PA 3E6ZX 3RLFA 3WAOA 2RDBC 4BBSH 2VZKB 1S5FD 4DV4Q 3S1QH 2R93B 4JGHB 2MBHA 5KNBA 5GADC 4DV1Q 1YMHE 2NBWB 1F2LA 4W9IA 1S4ZA 2C9OA 1QKZA 3MHZA 5HG2A 1L0XB 3V60A 1HQRD 3MXNA 3PIPA 1WFYA 2JQRB 3R66C 2UUCL 5FLXE 4ACFA 1LTGD 3A0JA 4DU9A 2FINB 2MP2A 2ZVOA 4MGKE 4I7AA 1MI2A 4XYOA 3U50C 3I56A 1GC7A 4DAYA 5G3LF 2I38A 4IPGA 1ZE3D 5EDSA 2FMCA 3T4AC 4HLEA 4GU2A 4L5TA 1B8AA 1KRSA 4ICVA 2D2CC 4K5VA 2NPTA 1RTNA 4J15A 2ZTEA 4ZUIA 2ZEQA 1OXVA 1WX7A 3NVVA 5FOBB 4QUCA 1HUNA 1NBWA 5FO7B 2EJFC 1Y14B 1Q0WB 1PGXA 2ZNVB 3S1NB 3DBRB 3UDGA 3ZDTA 2F0VA 3RPFC 2K05A 3K5MA 4BY1H 1XTCD 2IBIB 1QOGA 2JT4B 4FHKA 5JHBA 4JBWA 3BYYB 1X32A 3CCSA 1JRUA 1U4AA 5I9PA 2GRIA 3RFZB 1MJCA 3A33B 3V61A 1V8CA 2DHZA 1L7YA 2NZ1D 5C4ZA 4HPPA 3N1XC 3KUPA 3MTSA 5M3MB 2BQQA 3VDZA 1SDFA 3MJ5A 2G4DB 3OW7A 2HIVA 5LMNL 2YYZA 4H13C 4IZ8A 1XF5L 4XT1B 2MBBB 3EECA 2L12A 3M63B 4D2KA 4A3BB 1AWDA 3DVNV 4LMQD 1I3QB 2BB6A 1S40A 5FR6A 1LUZA 4II3B 3HOXG 4DUYL 1RAXA 1BUVT 2KQ3A 3H3VI 1IZ6A 4JI6Q 4LF7Q 3DEOA 3TP8A 5FJ8G 4JI3L 2LGSA 3FRPB 3V3XA 4JI8Q 3GTKB 1XT9B 2FUG1 2B2VA 2PVOD 2WX1A 2EKEC 1N5WA 3B1LX 2E74C 4B3MQ 5J3BA 2KDBA 3R3MA 3U4ZA 1M4VA 2JYOA 4NZLB 2NWGA 1JB3A 1HNWQ 5L83A 2NVUI 2IYDB 3TZDA 1CSPA 4X62Q 4JLCA 4L1BA 4WFN3 4HCPB 5IGCA 4KZ0A 2OF1A 1PGAA 2MJ8A 3AEVA 3HOYH 5AEKB 4Q0FA 5EGTA 3KLSX 2Y5CA 1Y56A 5LL6S 4QQBX 3GOEA 3UIPB 2A6ED 2ZNVC 1C8CA 3ZXRA 2FHTA 2C7MB 3EUB2 4TUUA 1YI2A 5ELNA 1OO9B 3K0YA 4H02A 3H7SA 4OO1H 2EXDA 3VR4A 4HVBA 3HOZH 1LABA 2Q2TA 3KLRA 1C78A 2DYBA 3GTGH 2VL6A 1WJ6A 3AM9A 2D3BA 2OCEA 1QNUA 3CCJA 2M2LA 2BE5D 2MWSB 2ZPNA 4HDQA 1LTID 4KMUC 1QLBB 4RNAA 4ZRKA 3NBHB 1HJPA 4ZRJA 4GOPA 4F88A 2BKFA 5HY6A 1LQBA 1Q90A 4A76A 3HKZE 1PVOA 5IGBA 1V1QA 1T0SC 4GDLA 1VDVA 2L1AA 2Z0SA 1EEFD 3SFDB 2L11A 2A6HC 2WAQG 1KNEA 2Y5PA 2EYOA 2L52A 3VTWA 4WWNA 3R7QA 1K51A 1FGUA 5DEHA 2R61A 1MJEA 2MW5A 1K53A 1YBYA 5JZEB 2VY3A 4JYAQ 3M4OH 2K5PA 3NQIA 4RCNA 1NMFA 1VQKA 4YHHL 4DXFA 3KF6B 1E6EB 3FDTA 2HE7A 1IHZA 3GQBA 1YNXA 4YTNB 1SJHD 4A3KG 1K3BC 3P7JA 2E3TA 4HMIA 4DV2L 1F52A 1X3QA 1PRTB 4EQOA 1F9QA 1GAQB 5T8IA 3ZQ4A 4L63B 1M90C 1WOCA 1YJIA 4BS9A 5IGGA 4FHJA 3DLLA 2HQLA 3KDFA 3NELA 1NTGA 1RODA 4A93B 5C0XI 2PLPA 4IUUA 1W3SA 1G8ZD 3T1HQ 3I4MB 1E90A 1HEZE 2XWJB 3IFDA 3L10B 2F0LA 3L9AX 1UEAB 2F3WA 4HCEA 1O7YA 4TQ1A 3VYUA 1WI0A 3DHIC 2E2HH 4A20A 1D8LA 3QOLA 2GMIC 4FXDA 4GMVA 4OWTB 3HVDA 3DQVA 1F77A 3C2PA 1PDQA 3LX0A 5E1FA 3G7LA 2VS1A 5I4DA 1G6JA 2K28A 1WJ4A 3V96A 1SE3A 2E8GA 1PZID 5JEAJ 1IBLQ 2B3GA 1EY8A 3CQZB 3KJOA 1ENAA 3HZXA 3AFPA 5D65A 4LF5Q 2M56B 1NR2A 3RMHA 4LJOB 3RNBC 2NTSA 3BZKA 2NVXH 1VQ8A 1Q46A 2NN6H 3MXUA 2OHFA 3Q3OC 1E2VA 2INPE 3IL8A 2YEPB 1V80A 2WU5B 3OLMD 1J7AA 1VQBA 3RZWC 2F0SA 4GDKA 3PO3H 1XMQL 5C2TB 1R4NB 3I55A 5AUKA 3NENA 4DNIA 5J18A 3HRZC 3DWPA 1TWAB 3ULLA 3J7A5 4EE2A 4F8MA 4WIPA 3K9OB 4R4IA 1CA5A 2BT6A 4BBRB 2O6VB 2VXWA 4ZRZA 5FLMG 1NNXA 1JJ2A 2ZTCA 4FADA 4LUVA 2QA4A 3H94A 1VMCA 3BU2A 1Q7YC 4M8MA 3OOCA 1TKGA 1PYBA 4GKKL 4A3LH 4JI5Q 4OX9Q 4J1MA 5E4XA 4K0KL 1JALA 1E10A 4J3OD 2JYTA 1MIUA 4OVZA 3HOWG 1V49A 4REZA 1S1QB 3P2BA 5IYCG 1CZWA 2YV5A 3J81j 5ELBA 3A8IE 4RG1A 1KAAA 4ID6A 2N0SB 5M3MH 1SE2A 2LEKA 2IDYA 1MFWA 2A68D 2PKOA 5FJ8H 3P20A 4C2MB 3AEDB 4A3MG 2F0GA 3HEJA 1J5EQ 3U30A 1DOMA 1DOKA 3ZIMA 4GB9A 2RHQB 3ZNGC 4M0WA 2MGSA 3X3NA 1T5XD 1II3A 4ZQ3A 1H9SB 5M5XH 1QZGA 2HHHQ 1EY9A 2EMSA 1YITA 2ASQA 3CU7A 1SE9A 3CMAA 2WFWA 4UDUC 1ET6A 3GTQH 3C1EA 2GBNA 1WXSA 1MSHA 4B08A 3IAS1 1E9MA 1YN4A 2IGHA 4DV0Q 3FPPA 3CXCA 1NE3A 2RQXA 1I50H 5IYBG 5AUIA 1JOQA 3QCAA 1IBKQ 1STGA 4HR7B 4NXMQ 4KKSA 4QF4A 5CR3A 2N7DA 1PH1A 3EROA 1JCKB 5HGTA 4KDLB 1ZKOA 1WCMG 4RFBA 4FF1A 1V5TA 1F2RI 2K39A 2KA7A 1WGGA 5G3LD 2Y0SG 2A4ZA 3QWNA 1VQ6A 3PRPB 4I65A 1HNZL 4MEMA 1J0GA 1ESRA 1JWMD 2ATWA 5L95C 2XWBB 3TIXA 3QJZA 1XMOL 4ZKCB 2F4IA 5E4WC 2B76B 4LF6L 1OXXK 4LK0M 5ELDA 2LRUA 3RI7C 1SSNA 5H8YE 1GXDC 4NQKE 3AEGB 3U4EG 4G7ZC 4JCVE 4KY6A 1AH9A 2Z59B 4RKLA 3AU5A 1B4OA 4KLKA 4UPAA 4DR2L 3T53B 2R92G 1ZXHA 4WH4A 5E6OA 3TEZA 2RBMA 2BOSA 4EQ5A 1JROA 4YXDB 1O78A 2F3IA 1MKHA 3NBHA 3PV0A 3DDCB 3J7ZC 1Y8PB 4C3IG 4AQ7A 2IJ0A 4CDCC 1PQSA 2LGIA 1NMGA 3ZUNA 1EU4A 3PV1A 4PS7A 2PZUA 1XCQL 3VRAB 4R4CA 4IM0A 2UXCL 4UP8A 3C1FA 1B44D 2F03A 4A3KH 5ELFA 3S14H 3EA6A 3L7ZC 4JI7Q 1X3EA 1Q12A 3VA7A 2PMZE 3MHBA 3GTOH 1LXDA 2CU3A 3H6NA 2CJOA 1S5BD 3HKSA 4UHVA 3ZTDA 2EELA 3S16H 4DK1A 2IX0A 2KX3A 1PGBA 1ZW7A 4R9WA 2C7HA 3BDLA 2KCNA 2Z4HA 2D07B 1WX8A 1N34L 2M0XA 3HUIA 1IYVA 1EOVA 2F0TA 3JW0X 3ZDMC 1GUTA 2EYPA 3GE3C 1IBXB 4Y7NB 1PV4A 4KJOA 1WTRA 1N6ZA 4DQOC 4IUPA 1QG7A 2XNAC 4DR1L 2LJIA 2JUOA 3I4MH 3AE7B 3JAML 1CTMA 5CHVC 2HJ1A 1YNND 1Y1WB 2XN9C 4OO1I 1W6KA 1C4AA 4FDBA 1XLQA 2QHOA 3FKIB 3VTVA 2KKCA 4KSKC 5C44H 3A9JB 2WS3B 5BO4B 3DXJC 4A3PA 2JXTA 3IKJA 1JWAD 4OIKA 4CHTB 1RKNA 3TMEA 1J19A 4JBMA 2FAZA 1VF5C 4OZCA 1PTOF 4ARIA 5CV5A 1YNJD 3TEYA 1JMCA 1TS5A 1DOYA 2KXJA 2B3AA 2EVBA 4MDKE 1FXTB 3EC8A 2YTVA 1NI2A 4MJSB 1KLGD 3IRBA 1HNXL 1O7LA 2JA6B 4LCDE 5KHQA 4R3DA 1JR0D 3CCUA 2E5LL 1W2BA 1BCPB 4CO7A 2O5IC 1STEA 1SNCA 1PFSA 5HHDG 4GLAC 3SR6A 4WORA 1NBFC 5FK9C 2GA4B 1STAA 3CRLC 2D62A 5C4JH 3NVWA 2EE1A 1V6EA 4DHJB 2C35B 4KI0A 2WB1E 4KGRA 2KCMA 1XNRQ 5IO9A 2JA5H 1XPRA 1GB4A 1U4PA 3M7GA 2ZJRA 3HOWH 5CORA 1Q81C 2A74C 4EZLA 3F1ZA 3T3OA 5JEAG 4CGYB 2A1AA 1KTKA 2O6VA 1YD8U 4WJWA 4JG2A 3NOBA 3TEHB 1A70A 1JE4A 4M8NA 4TRDA 3NHEB 3MC8A 3PO2G 1N9WA 1GD7A 2WXQA 2BYFA 2G9HD 2WAQE 1KIXA 3T13A 3NUHB 3BZDB 3NHHA 4GZYC 3BDOA 1Y69U 5LXIB 1BQQT 1L1OC 2MBQA 4CQNA 4HN7A 1D5MC 4KY5A 1LYLA 3GZNB 1Q5WB 2KC2A 3MJWA 1YZ6A 3JAME 3B6YA 3DVGX 3TDQA 4IUQA 4PYZA 1XNQQ 4WJ3M 2M1MA 1MHWC 2VZAA 3OAWA 1TXYA 1N8RC 1XYIA 4US9A 3A1QA 1L6VA 2IL8A 2KEEA 4B3SL 2LUEA 3K81C 4BXXH 3MEHA 3ZJTA 1VS0A 2JZ3B 4IM3A 1H9SA 3MXNB 1FD7D 2UUCQ 1WCMH 1BCPC 4B9WA 1YX5B 4ZDVA 1SYDA 4X65L 4RA8A 3CWIA 4FJZA 3FILB 3F2UA 3K59A 1QNKA 2KHIA 4DAYB 1AYFA 3RZOH 2RVLA 3SE0A 2KCTA 1VD2A 1WX9A 2XBBC 3CPWA 1WH3A 3ERQA 3W9CB 2DY7A 1SNDA 4BBSG 3ZKJC 3U9SA 1FIQA 4DR5Q 2NPTB 1L2NA 3O65B 1QZHA 5BN4A 1NVID 2A5HA 2JWZA 1CQVA 4FN2A 2VUMH 1PYSB 2Y5BB 3APFA 4K5WA 2VH1A 5DCNA 1EOTA 1JJCB 2J0TD 2L1BA 4CDFC 3HOVH 2RPVA 3Q8AA 3IFTA 4LW1A 2LVOA 1TKYA 1SNOA 4DA2A
chains in the Genus database with same CATH topology
1SFOB 2WXGA 1SAPA 1VCIA 5FO8B 1WYGA 4TQ0A 1EQVA 3SFEB 1WXQA 4RF1A 3GTJB 5G5HA 5ELCA 1OXSC 3SK5A 5C4XB 3QG1A 5F2DA 3OMCA 4NJCA 4CKEA 5IIFA 1P7EA 5I6WA 3AB5A 4EGVA 1SSOA 3BVMA 4ZK9B 5M5YB 1HFNA 2RSOA 5JXVA 1RM6C 1HQMC 4H44C 4ILWA 2PTLA 2N9KA 3SXHA 3NWTA 1IW7D 3S9WA 1ZYRC 5IGFA 1SIJA 4IQZA 1HPCA 4U673 5ISRA 3VR6A 1LT4D 2IT1A 5C3WA 1U4LA 3VYSA 4ME5A 2W82A 3B9JA 2LFNA 4B0MA 4OHJA 3OSOA 1SE4A 4M1UB 1QE6A 4C7YA 2BA1A 1TKEA 2DN8A 1G291 1L4ZB 1RDPD 3ZYYX 2WXNA 1DOIA 3EQLC 2QSDA 3TSSA 3Q8CA 3ZJVA 2W3SA 2PCFB 4IOIE 1PFBA 1TVXA 1RFKA 4A3IB 1EY4A 1O7ZA 3A8KE 1SMYC 1DOXA 1EZ8A 1JWSD 4OO1G 1VLBA 4K14A 3ZGZA 4PMBA 2B2VC 1AFPA 1B9NA 4C7ZA 1QQRA 1N61A 3LNNA 4QCLA 3TEWA 4G7HC 5HURA 3FMCA 3S2HB 1VZ6A 2EZVA 2JYEA 2LY7A 2WV6D 2JA8B 1YQ4B 1Q1EA 5C3EB 4FNFA 3I3CA 4NW2A 1JC7A 2L9HA 4DK0A 2XRSD 1T5EA 3LB8C 3AEAB 1E2ZA 1HCZA 1FRRA 3D31A 2SAKA 4X3UA 1UWMA 4KKUA 4IKGA 1UWXA 1DYQA 3GTLB 2M9VA 4PMCA 4RGOS 1CI3M 2BA0A 4M8AA 3RUZA 4A3EB 1GOZA 2F0OA 4YTMB 2MP1A 1FNWA 3R2IA 2EYHA 2PW9A 3OIQA 3J7AV 4H0LC 1OFFA 3AEEB 1MD2D 3TP7A 2BS2B 4EQNA 3K57A 1GB1A 3QJYA 1QOBA 1M8AA 3ND8A 2V3PA 4GDKB 2WXMA 2WXHA 3BK1A 2BDNA 2KCCA 3Q24A 1JW9D 1BBXC 3EFXD 3DWQA 4JK1C 3SR1A 2AUJD 1E0ZA 1LTAD 5I6YA 2DYOA 2QCPX 1EWYC 3IXSA 1FYCA 3V05A 3FILA 2NN6G 1SYEA 4ZRPA 4KTAA 1KNAA 4FP5D 2PQEA 4BWGB 1PTOB 1RCVD 3R3OA 4A90A 4ARCA 2A69D 4RH6A 2AQ3B 1EY6A 1J8IA 1FCCC 4CBVA 3O13A 4L23A 3VR8B 1MVKA 4KKIA 4F87A 4OW0A 4C56C 4OIJA 1A3VA 1I4GA 5BN3A 1BOSA 3IT6B 1DXMA 1ZXTA 2PMZB 3S1RB 4DGZA 4ZYSA 2E75C 4HRSA 1VF7A 1PXUA 2X6GA 3ITPA 1JQYD 2F0WA 4JE3B 1O80A 1P7FA 3K7AB 4RHRA 2SDFA 2E2IB 3T16A 4N9PA 1KDCA 1STHA 1I4HA 3HOXB 1N63A 1B9MA 3I90A 3QOJA 2X6LA 5IGEA 1BR9A 1VJKA 1KLUD 2IX3A 1VRAB 5KNDA 2DYMA 2WXFA 1ZUD2 2NBFA 4H7BA 2MJEA 4C1NI 5BMGA 3U7ZA 1DZ1A 4E6IA 5M3FB 3I72A 1RF2D 2J42A 4DAVA 3D8GA 3H09A 3P4PB 4BA1I 2HCCA 1AZPA 1BUIC 4HJGE 1FGBD 1R7SA 5COYA 1B1ZA 1L0YB 1F9RA 1JMLA 4HSVA 4XQQA 4K6LA 4DFAA 2NB0A 3AU7A 3W5UB 4CJ0B 1JOOA 3TN2A 3VR9B 1HA6A 1SNPA 2WXPA 3TEXA 2MPMA 2JEBI 4P2CB 2ZW0A 1F9PA 1SYGA 3PZ8A 3S2DB 2BS3B 2WKDA 4Q2JA 2NUCA 4ULLA 3PUWA 1WD1A 4IFDH 5JVH3 1V8QA 3TZUA 2KAJA 1H9KA 2KWDA 3PIO3 2HDLA 2ON8A 5C5LA 1WRIA 1N62A 1F0ZA 2QMTA 2JA7B 3NS1A 3SK8A 2CJNA 2WAQB 2B63B 4A55A 3NVZA 3MAQA 3M7NA 2E6XA 3NVYA 4KK7A 5NUCA 3N9YC 1A15A 3KBGA 1LT6D 1JICA 1EQTA 2B2WA 4DNTB 4EQPA 5JAVA 5J22A 1GUSA 4TKOB 4A8XC 1XCTL 5I9OA 2OT2A 1C76A 1ZXIA 1TS4A 4KHZA 1G91A 2XVSA 1PLFA 1Q8IA 4C1NK 2H1EA 1TIID 2CW0C 1X3PA 4ODGA 2QF7A 2B2YA 2JE6I 4NMZA 1TR5A 4HAEA 2IGGA 1Z7TA 1B50A 1L0VB 1LTTD 2K04A 5KYLA 1LT3D 1JWUD 3V2TA 3IT4B 2K5DA 4XTCS 1HFGA 4XYQA 3NQTA 5DM63 1PRTC 3GD7A 4R8NA 3HS0C 3FVQA 3NBIA 3VR3A 3AE4B 1C4PA 2J52A 2AQ2B 4XIGS 3A56A 2WXJA 3R8BA 1DM0B 2JXMB 2ZT9C 1LTSD 1XX8A 4XQNA 2PW5A 3I70A 1WTWA 5BMHA 1EIGA 4QIWB 2KECA 1QOAA 3LWUA 5DM73 2WQYB 1CM9A 3VA5A 1PUTA 1STYA 4C3JB 2I2YA 3EGRA 1QJOA 4A3JB 1F2YA 1LTBD 2EJGC 4A3FB 1R9TB 3W5VB 2QILA 2KQ4X 4KKJA 3Q23A 2B2TA 1IGDA 1TYGB 1KF6B 1UUPA 1FFVA 3K5NA 4XT3B 1EZ6A 5CGKA 2AX5A 1V43A 4KKTA 5T1GA 1A2TA 3E9SA 3P4QB 1R4QB 2RKSA 1EM7A 4CKBA 2Q8RE 2RMMA 3AE8B 4LAAA 3AE5B 1PDXA 5JOBA 1Z47A 2HQEA 2NVYB 2Y0SB 1JOKA 2K32A 3RD4A 1S5DD 5KYIA 2KUMA 4NP5A 1SYFA 4GLSC 4IUVA 2VB2X 1T3QA 1SJED 2RSNA 1KFYB 2XRQD 3D4DA 5EPLA 3MC0B 2LMCB 4ZRQA 1D2BA 2LFIA 4FXKC 1HUMA 5DNFA 4XDDA 3PUXA 1NR4A 1ILPA 1H9RA 4ZLTF 1EU3A 1NEKB 3NTIA 3H3VC 2KACA 1CHQD 2CHBD 2K5WA 5A35A 1WVLA 2MJ3A 2HDMA 3BDCA 1ML0D 2V3NA 1TWHB 4IALA 1WWTA 3UI3A 4B0EA 1FFUA 3B2GA 1SB3C 3DHQA 1BNZA 2F0HA 3P1HA 2IWHA 2WXKA 1OXTA 3X3MA 2WXRA 4AS1A 4IFDJ 5KGUA 3D4WA 2MJDA 1L5PA 1QF6A 3AEFB 1MBYA 1TS3A 4P6VF 2WINB 2R7ZB 2ZW1A 1A2UA 2EY2A 2F0NA 4J6HA 2WU2B 1DJRD 4IURA 4PV1C 1XXGA 3D4RA 1NUCA 2Q8IB 2JEAI 2EOTA 2K1BA 4XWTA 1BCPD 1TY2A 1VMPA 4IFDI 1GHJA 3MVVA 5K36G 2A73B 5BYQA 2AQ1B 1ZOYB 5J1ZA 1YNTE 1PYWD 3L4PA 4USAA 1MI0A 1PFDA 4C3HB 4O1NA 1WTPA 3D6CA 1PZKD 2EYFA 1E2WA 3ONAB 3NSWA 2PO4A 1S5CD 3T51B 1RYJA 3UI2A 3H6MA 3K58A 5IODA 3NPPA 3K5OA 1CJEA 2WXIA 5J39A 1SXTA 2B2UA 3PO2B 4FXCA 4K8JA 3PUYA 5HFYA 4FVMA 2K9XA 4OZAA 3U2SC 5D3DA 1ILQA 1IUEA 1G2TA 3MA2B 1YNNC 1XLPA 2HDEA 4DAPA 2NN6I 5EKKA 1KH0A 1EY0A 3CHBD 1K50A 5IGDA 1NI3A 2W55A 1YNJC 1QT9A 2EDGA 3ND9A 4K8IA 1GUGA 5EPJA 4XDCA 2M00A 5A2QL 4WRDA 5FR3A 2MEKA 2PVGC 2MHVA 3J7AF 3I4NB 4MM3B 1RD9D 2RDHA 3S1QB 3HKZB 1ESFA 5C3JB 1EWHA 1IL8A 5MPOA 4CJ1B 4KGTA 4HSPA 2O5JC 1K8MA 2V0GA 1SYBA 3CIRB 4YTPB 3BIID 2PPBC 3A7LA 1SEBD 4RGMA 2K01A 3E56A 1I7HA 3ZJUA 3BVGA 1SMYD 5EBCA 1GPXA 2QIEB 3GS2A 2O2LD 4FF2A 4N9TA 2JX5A 3NZ3A 2OEOA 1YJJA 1R4PB 1A6XA 2ID0A 4LLGM 3MXGA 4DF7A 3PO0A 4V0BA 1IGCA 2ZXPA 2LMCA 2KDMA 2NVQB 1HZ5A 1D6EC 4KGSA 3BVZA 2KVMA 2L0CA 5E6JA 2I46A 1CZGA 1IKLA 2H88B 4P16A 5D3IB 3WOEA 1ZP0B 4I7ZC 1T6BX 2F3VA 1XLNA 1DOLA 1SF0A 4PMWA 2IGDA 3DM1A 5A2QE 1FXIA 3BK2A 5KEEA 1V1PA 3CKIB 3PMFA 4K6DA 1F2ZA 1TQOA 1U4MA 3AB9A 4IUTA 4X3TA 1FD6A 2FBWB 1YN5A 3I73A 5G5GA 5I2YA 1Y8NB 1Q3LA 5C0XH 4HEA1 3HG9A 3OWFA 3P1MA 5BYRA 4PT5A 5K36H 5T1IA 1UNSA 2JU6X 3VR2A 4UAIA 1PZJD 2D5DA 2F0QA 4MT5A 3HOZB 4MACA 4KN4C 1IYUA 3M85A 4RCOA 1J9OA 3GTGB 1PFNA 2XIWA 2Z1CA 3A55A 1QOFA 3H8HA 2BB5A 4B9XA 1F9SA 4X3KA 2DNCA 4IUNA 4IFDG 2IX1A 1A3UA 2B8FA 1LV9A 4FO2A 4JWSC 4KX6B 2J53A 3N52A 3FEWX 4KJNA 2LHEA 1VR9A 3ETRA 2DNEA 1C48A 1XLOA 1HHVA 3OWEB 1C4CA 2EY6A 3TUOA 3U52E 3MZ5A 1VZ7A 4ZUJA 3M4OB 4KY7A 5FO9B 2ZXRA 5BN5A 1PMRA 3H0GB 1TKWB 4FF4A 1BMLC 3W3AA 1TWGB 2Z4IA 2KJXA 3S17B 2XSCA 2PZWA 4MHEA 4F7XA 5CV6A 1FM0D 1MHHE 2VZKD 4YSXB 4NKLA 1SNQA 3P75A 1ICWA 2V4IB 1B3AA 1QOHA 4C80A 2B2WC 5EE1A 3WOFA 5CV9A 2WDQB 4OGQC 2W54A 2K6AA 1OXUA 2X69A 2K7VA 2BBCA 4EVOA 2BS4B 4JX1C 2NVXB 1CT1D 2YU9B 3OMGA 2IW3A 3KQ4A 3DMUA 2N7JA 2F0IA 3PO3B 5E3FA 2K3UA 2B2YC 3AE3B 3L3OC 4HTHA 1L6UA 4HMJA 3Q0AA 3VRBB 1MGSA 3Q22A 4Q5VA 3MP9A 1BO0A 1RHPA 1PFMA 3N6RA 4G4KA 4RKBA 4KN7C 2PMVA 3EJIA 4YWGG 2AWOA 2A6HD 2E2DC 1JWBD 5EE9A 4ZOHC 4QUFA 3Q8FA 2WLBA 2WACA 2QEJC 1TT2A 2TSSA 1S5ED 1STNA 2Z8LA 3A7AB 3P63A 1PTOC 4ZHPA 2J4XA 4LTUA 5M5XB 2MUYA 3Q6SA 1Y8OB 2G9DA 3OPOA 1GJXA 3GTQB 2L32A 1XWEA 1TU2B 4K5XA 2R3ZA 3KF8A 1EWCA 4YSYB 1C79A 1HTPA 5D14A 2WP9B 4XWWA 5IOCA 1EY7A 1I50B 2K5QA 1FMAD 1H9MA 5EBDA 4TMAB 1C9FA 2L83A 2N88A 5M9OA 3TP5A 5EKIA 1ENCA 1FR3A 2A69C 1B53A 1WGKA 3AE2B 2CW0D 1D5ZC 2F0MA 4XDXA 3VQIA 3EVQA 1K52A 2WB1B 2B2TC 3DEPA 2GB1A 5LNK1 3I91A 1BCPF 4XQJA 3Q8EA 1G6ZA 4ZHOA 2J7ZA 3AE6B 2ZXOA 3VYTA 5CBAE 3H91A 1E7PB 5KIXA 4XE0A 3RZDB 1DCZA 4S3SA 1PRTD 4HEDA 4K2KA 1FNVA 1K8OA 2RDGA 2VNUD 4ITKA 1FXAA 1LLRD 5H92C 4A3KB 1NENB 2MH7A 1SYCA 1LO5D 5C0XJ 3C46A 3S14B 3GTOB 1CQFA 4L2YA 3HRDD 2EYLA 3S16B 1JORA 1YN3A 1TWCB 3TP6A 2K0PA 2A6EC 3WDNA 1AW7A 3BG3A 4WQMA 1CFMA 2H89B 2F0UA 1TJEA 3GV6A 2BDOA 1HRJA 1NYRA 4NAWB 2PZTA 2BE5C 2F0KA 4R8IA 1RWSA 3K5LA 5LHY1 3P42A 2F0EA 2Q8TA 2L4NA 3BWUD 5C44B 3GB1A 3NRZA 5AFWA 3FC4A 3U9OA 3R2TA 3FPUB 1PTOH 1QILA 4RGNA 2IPKD 5IT9L 3A8JE 5FKAC 5KRUA 1ZPSA 4CKCA 2E2JB 1EYAA 4KHVA 1ACCA 4Z9CB 1H9JA 2HUGA 1D1KA 2TMPA 4LJZC 2EKIA 3AN1A 1WTXA 2HCIA 2EPBA 1ET9A 2GI9A 4HROA 2LUMA 5C4JB 4G57A 2FFKB 3SDZA 1KDBA 3GP7A 4A6QA 2JA5B 1C77A 3HOWB 2SOBA 1EFID 3AE9B 1RTOA 2N55A 4KD3A 5D7GA 4YSZB 4IN3A 1L4DB 2WDRB 2WNMA 4KD4A 3DWMA 4A3MB 4ZAIA 3AMZA 2Y3AA 2KEDA 1QB5D 2V4DA 4QB4A 1GHKA 2JSVX 3PIP3 5GXGB 1Q10A 4C3JG 3P4SB 1EEID 3NXWA 3P4RB 2INNE 1OQRA 3HGBA 1GUWA 2PIAA 4NAMA 1OQQA 4J8QA 1ONLA 3GO5A 4TSSA 4DN4M 2AUKA 3HP3A 2OEDA 4MN3A 2WP8J 1EL0A 1WCMB 2B2UC 2F0FA 3IAYA 5CC4A 3R93A 5IT9E 1NSNS 2RDFA 1V1OA 1U4RA 3RZOB 2ONQA 5EPKA 3SEBA 4JPSA 4IDIA 2JWUA 3W1SA 1RJTA 2EYMA 3DWAA 3KLSA 4FYDA 2K03A 3FAHA 2VUMB 1QCBD 1EYDA 3J81L 1ROEA 1NCVA 1GUOA 4HKZE 3E0JA 4FF3A 3HOVB 2R92B 2RA4A 2D9UA 2F0JA 2L5TA 2K33A 3Q69A 5K5PA 3PZ7A 3MFGA 1D4BA 3BS1A 4C3IB 3I9V1 2A68C 4YT0B 2WKCA 3T56B 1AEXA 4N6EB 5JJZA 2X38A 3URYA 5BYSA 1I6VC 1MPEA 1HA5A 4JWUC 3S1MB 1E0BA 3SHLA 3ABVB 1DD2A 3KBXA 4PQXA 2BTEA 1V1PB 4LK1C 1J7BA 5CYUA 1TWFB 2PYKA 1UAPA 1DGJA 2C5CA 1CA6A 1N60A 2QKIC 5EQ0A 3S15B 1YQ3B 1ZDVA 2H4OA 5TSSA 4OZBA 2PNRC 3GTPB 3I8ZA 3K6OA 1WSPA 3AMUA 2DWQA 2ACZB 3LYYA 3BYTB 1IKMA 1EY5A 2ICEC 4A3GB 4K2LA 1CZPA 1DONA 3SK6A 1A3TA 2LHDA 1I4QA 3OHXC 3PUZA 2EY5A 1FEHA 5C0XG 3J81E 3DWGC 3J7YW 2LS01 2WXLA 3NP8A 1TY0A 1B9RA 3J9CA 1V97A 3KWVA 3VYRA 3D6WA 1BF4A 2DBYA 1C4QA 1NYQA 2LKVA 1LT5D 1ENFA 3MXPA 1AZQA 2O4XA 4L8JA 2K22A 2EY1A 5CV7A 5M5WB 4C3HG 1G2SA 1ZEQX 1ZDXA 2BYTA 1BXTA 1Y1VB 4MIUA 1Q1BA 1WTQA 2CQAA 4DXGA 3C3LA 2M0AA 2FE8A 4WAFA 3W2DA 2SEBD 3LWEA 2KMMA 4L6TB 1EIHA 4V190 2EXZA 1SBBB 4U68A 3AECB 2W3RA 5EJWA 1QWYA 2KHSA 4FXGC 3Q8BA 1ZYRD 1FO4A 5BMIA 1I6HB 5C4HA 1STBA 1I4RA 2JP1A 2L55A 4AYBB 3T3NA 2WIIB 1AN8A 2D5GA 2I07B 1FRDA 4X3SA 3GTMB 1W6JA 3DUZA 4H2AA 2B8GA 4BBSB 3TBIB 2JSOA 5I2XA 2JZPA 3AV8A 3GV3A 3LXFA 4YIJA 2AWNA 1EYCA 5EE0A 2WDVB 4G7OC 1KABA 3OIPA 2NTTA 3QIAA 2NVTB 1BDOA 1VZ8A 1KDAA 5EKLA 4NDXA 5C3XA 3KWLA 1LTRD 5JPNC 1JQ4A 1LACA 5EE3A 1I4XA 2CVRA 2F0DA 2F1MA 4TQUS 3A54A 4WWMA 2BW2A 5JPMC 1MSGA 1UGJA 4BY1B 3E5SA 1FNUA 4RHSA 5LL6X 1Z6HA 1VDZA 2QDBA 3M4YA 1PRTF 1K83B 3NWSA 1XO3A 2ICIA 1TS2A 2DY8A 5CBEE 1WTVA 3D3RA 4HCSA 2KOLA 4MH8A 2FJ2A 3QB3A 5JVG3 3HOUB 3KK7A 4QMGA 3IAM1 4ZKBB 1CK1A 3WCQA 1HZ6A 3NTHA 1F2RC 1HTLD 1TZOA 2QJLA 2G1EA 3J80L 2KN4A 4KV6A 3HOYB 3HVZA 2Q5WD 5DAUA 4HKQA 3AE1B 3I4LA 2YEPF 1IBXA 2WXOA 2EJMA 3PUVA 1D5XC 2DLBA 3QO2A 1F2MA 1CHPD 2M19A 3CRKC 4A9AA 5KNCA 1J7CA 1FCLA 2NYZD 4CJ2C 4GDLB 1HXYD 2BCOA 3G6JB 4ABNA 1D1IA 1MHXA 5FLXL 4N58A 2B39A 1IW7C 3MFYA 2FMMA 5CV4A 1WD0A 2NMQA 2N9LA 1I4PA 5CV8A 2HTME 4XXEA 4OL7A 3SVMA 5JEAH 5ELEA 3NTKA 3AEBB 3NE5B 4BY7B 4RWSC 1U9RA 4DNRB 4RF0A 3SK4A 3B2FA 2ENBA 1N5XA 4PNYA 1XEEA 3M3YB 1GUNA 1SNMA 1AP0A 4RGTA 4O42A 4N59A 1KRHA 3MWYW 3AH7A 3J80E 1WTOA 5C5MA 4US8A 2E2HB 2E76C 2R6GA 2PW7A 1JRPA 1NAPA 4RAUC 2EYJA 3VR5A 5CMDA 2SNMA 1B2TA 2OXPA 4BA2I 4WURA 4A3DB 5C6AA 5HI1A 3I57A 1PTOD 3NK9A 3NUCA 3C8YA 2SNSA 2VB3X 2F0PA 3E6ZX 3RLFA 2VZKB 1S5FD 2R93B 5KNBA 1YMHE 1F2LA 1S4ZA 2C9OA 1QKZA 3MHZA 5HG2A 1L0XB 1HQRD 3MXNA 2JQRB 5FLXE 1LTGD 4DU9A 2FINB 1MI2A 4XYOA 4DAYA 5G3LF 2I38A 1ZE3D 2FMCA 3T4AC 2D2CC 4K5VA 1RTNA 4ZUIA 1OXVA 3NVVA 5FOBB 4QUCA 1HUNA 5FO7B 2EJFC 1PGXA 3S1NB 2F0VA 3RPFC 2K05A 3K5MA 1XTCD 1QOGA 4JBWA 3BYYB 1X32A 3RFZB 5I9PA 2GRIA 1V8CA 2NZ1D 5C4ZA 3KUPA 3MTSA 5M3MB 1SDFA 3MJ5A 3OW7A 1XF5L 2YYZA 4H13C 4IZ8A 4XT1B 2L12A 4D2KA 4A3BB 1AWDA 4LMQD 1I3QB 2BB6A 1BUVT 2KQ3A 3DEOA 3TP8A 3FRPB 3V3XA 3GTKB 2FUG1 2PVOD 2B2VA 1N5WA 2E74C 1M4VA 2JYOA 4NZLB 2NWGA 1JB3A 3TZDA 4L1BA 4WFN3 5IGCA 2OF1A 1PGAA 2MJ8A 4Q0FA 5EGTA 3KLSX 2Y5CA 1Y56A 5LL6S 2A6ED 1C8CA 2FHTA 3EUB2 1OO9B 3K0YA 4OO1H 3VR4A 1LABA 1C78A 3KLRA 3AM9A 1QNUA 2M2LA 2BE5D 1LTID 4KMUC 1QLBB 4RNAA 4F88A 1Q90A 5IGBA 1VDVA 2L1AA 1EEFD 3SFDB 2L11A 2A6HC 1KNEA 2Y5PA 2EYOA 2L52A 1K51A 5DEHA 2R61A 1K53A 2K5PA 3NQIA 4RCNA 4DXFA 1E6EB 3FDTA 1IHZA 3GQBA 4YTNB 1SJHD 2E3TA 3P7JA 5T8IA 4HMIA 1GAQB 1X3QA 1PRTB 4EQOA 1F9QA 3ZQ4A 4L63B 1YJIA 4BS9A 5IGGA 1RODA 4A93B 5C0XI 2PLPA 4IUUA 1G8ZD 3I4MB 1HEZE 2XWJB 3IFDA 2F0LA 3L9AX 1UEAB 2F3WA 4HCEA 1O7YA 4TQ1A 3VYUA 3QOLA 4FXDA 3HVDA 1F77A 3C2PA 1PDQA 3LX0A 5E1FA 3G7LA 5I4DA 2K28A 3V96A 1SE3A 1PZID 5JEAJ 1EY8A 3CQZB 1ENAA 3HZXA 5D65A 2M56B 1NR2A 3RMHA 2NTSA 2NN6H 3MXUA 2OHFA 1E2VA 2INPE 3IL8A 2YEPB 2WU5B 1J7AA 2F0SA 5C2TB 5AUKA 3HRZC 3DWPA 1TWAB 4EE2A 4F8MA 4WIPA 1CA5A 2BT6A 4BBRB 2VXWA 4ZRZA 3H94A 1VMCA 3OOCA 1TKGA 4J1MA 5E4XA 1JALA 1E10A 4J3OD 2JYTA 4OVZA 4REZA 1CZWA 5ELBA 3A8IE 1KAAA 4ID6A 2N0SB 1SE2A 2LEKA 2IDYA 2PKOA 2A68D 4C2MB 3P20A 3AEDB 2F0GA 3HEJA 1DOMA 1DOKA 4M0WA 2MGSA 3X3NA 1T5XD 1II3A 4ZQ3A 1H9SB 1EY9A 3CU7A 4UDUC 1ET6A 3C1EA 1MSHA 4B08A 3IAS1 1E9MA 1YN4A 2IGHA 3FPPA 2RQXA 5AUIA 1JOQA 1STGA 4HR7B 4KKSA 4QF4A 5CR3A 3EROA 1JCKB 5HGTA 1ZKOA 4RFBA 4FF1A 1F2RI 2KA7A 5G3LD 3QWNA 4I65A 1ESRA 1JWMD 2XWBB 4ZKCB 2F4IA 5E4WC 2B76B 1OXXK 4LK0M 5ELDA 1SSNA 5H8YE 1GXDC 3AEGB 3U4EG 4G7ZC 4KY6A 4RKLA 1B4OA 4WH4A 3T53B 1ZXHA 3TEZA 2RBMA 2BOSA 1JROA 4YXDB 1O78A 3NBHA 3PV0A 1Y8PB 4C3IG 4AQ7A 2IJ0A 2LGIA 1EU4A 2PZUA 1XCQL 3VRAB 3C1FA 1B44D 2F03A 5ELFA 3EA6A 3L7ZC 1Q12A 3VA7A 3MHBA 2CU3A 2CJOA 1S5BD 2EELA 4DK1A 2IX0A 1PGBA 4R9WA 3BDLA 2KCNA 2Z4HA 3HUIA 1IYVA 2F0TA 1GUTA 2EYPA 1IBXB 4Y7NB 4KJOA 1WTRA 4DQOC 4IUPA 1QG7A 2XNAC 2LJIA 3AE7B 3JAML 1CTMA 1YNND 1Y1WB 2XN9C 4OO1I 1W6KA 1C4AA 1XLQA 3FKIB 2WS3B 3DXJC 2JXTA 3IKJA 1JWAD 4OIKA 4CHTB 1RKNA 3TMEA 4OZCA 1VF5C 1PTOF 4ARIA 5CV5A 1YNJD 3TEYA 1TS5A 1DOYA 2EVBA 1KLGD 1O7LA 2JA6B 4R3DA 1JR0D 1BCPB 2O5IC 1STEA 1SNCA 5HHDG 3SR6A 4WORA 5FK9C 2GA4B 1STAA 3CRLC 2D62A 3NVWA 2EE1A 4KI0A 4KGRA 1GB4A 1U4PA 3M7GA 5CORA 2A74C 3T3OA