3SEBA

Staphylococcal enterotoxin b
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
238
structure length
238
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
publication title Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 73
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sebA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sebA02
1I4PA 3BYYB 4K6LA 3EA6A 1PRTB 1XTCD 1S5CD 1LTSD 1LTRD 1CK1A 1LO5D 1S5FD 1SJHD 2XN9C 3BVZA 3CHBD 2O2LD 4RGMA 5FKAC 1QILA 1L0XB 3SEBA 1LT4D 1JCKB 1EFID 1AN8A 1T5XD 1V1PA 3W2DA 1CT1D 1YN4A 2QILA 1SJED 1FGBD 1EEFD 4NZLB 2AQ2B 2RDHA 1D5ZC 2IJ0A 3DWQA 2NTTA 4BWGB 2AQ3B 1TS2A 1LT5D 1FNUA 1KTKA 1JQYD 1JWSD 4UDUC 1TY0A 1BXTA 4OHJA 1PRTC 1I4XA 1I4HA 3BVMA 1FD7D 3BYTB 2SEBD 1LTAD 1SXTA 3EFXD 1PRTD 1SE2A 4L6TB 5I4DA 1PZKD 1EWCA 2Z8LA 3BVGA 1HTLD 1LTTD 1SE4A 1UUPA 1I4GA 5D3DA 3V05A 1GOZA 1LTID 1HXYD 1EEID 1PYWD 1FNWA 1YN3A 1CHPD 1ET6A 1ET9A 3R2IA 1RD9D 1LTBD 1TY2A 3R8BA 1PRTF 4Z9CB 4O1NA 2XRQD 1SE3A 4TSSA 5D3IB 5ELCA 1M4VA 1S5BD 4RGNA 1XXGA 3DWAA 1KLUD 1SBBB 2TSSA 1D6EC 3GP7A 1PTOB 2XNAC 1BCPB 1PTOD 1DYQA 3R2TA 4RCOA 5ELDA 1I4QA 2IPKD 1D5MC 1CQVA 1LT3D 1JR0D 3O13A 1RCVD 1S5ED 1JWMD 1B1ZA 1ESFA 3KLSX 1L0YB 1ENFA 1I4RA 4DXGA 4DXFA 4L63B 2WV6D 1MD2D 1LT6D 1D5XC 1S5DD 2NTSA 5ELEA 4C56C 1AW7A 4ZYSA 1G8ZD 2RDGA 3MC0B 1JWUD 4RGOS 1PTOC 1F77A 1BCPC 2XRSD 1B44D 1V1OA 1STEA 1TS5A 1YN5A 3OWEB 1EU3A 1BCPD 1EU4A 1TS4A 1UNSA 4RFBA 1PZJD 1V1PB 1FNVA 1HA5A 1PTOH 1CHQD 1KLGD 1LLRD 1HQRD 2G9HD 3BZDB 1TS3A 1RDPD 4RHSA 3TSSA 1RF2D 1PZID 5FK9C 2R61A 1DJRD 1SEBD 5ELFA 5ELBA 1PTOF 5TSSA 1BCPF 1LTGD 2J4XA 3URYA 4RGTA 4RH6A 2QEJC 4RHRA 2ICIA 3DWPA 2CHBD 2AQ1B 3MFGA
chains in the Genus database with same CATH superfamily
1YNJC 2E8GA 4WJQA 5IYCH 1JJ2A 3BDCA 5I9PA 3GV3A 3K80C 5IN7A 1PMRA 2JEBI 3RD4A 2FXQA 1PVOA 2O6VB 3AE6B 4LFCQ 2M0AA 3PRPB 4EOYA 1V81A 3KYDD 4RF1A 4B95A 1K83H 3OIQA 2HTHA 4REZA 1D8LA 2KX0A 2BTEA 4Q0FA 1LYLA 2CU1A 2WU5B 3S16H 4P72A 4JGHB 3CWIA 4LF9Q 2RSUA 3NTHA 2OEDA 2LHDA 1TKWB 4UDUC 2Q5WD 3ZNID 2HT1A 3RZFA 4JV5Q 5C4XH 1FYCA 2R7DA 3CCQA 1BBXC 3L4PA 4MSQB 4WWNA 4OO1G 4KD4A 4KDIC 4IN3A 1P1AA 4KSKC 1IGDA 3RPFC 1WJNA 1CA6A 1KD1C 3I91A 3ULJA 2Z8LA 2BS4B 1HTLD 4FA6A 2LMCA 4B9KA 1R7SA 1QZEA 2KT7A 3MHSD 2L00B 2UYZB 3NS8A 4HN7A 3T4AC 1IKLA 3GO5A 3J9CA 3UQAA 2J0TD 3KBGA 4L5QA 1K8RB 4XWWA 4CDCC 4O1NA 3TBLD 3K7AB 4A3JG 4EQNA 1GM5A 2RF4A 4KY7A 2D2QA 3RNEC 2F3WA 2KEEA 2XNAC 1WTVA 2M2LA 4X64L 4DNIA 1YNNC 2QDBA 1YJ1A 1N63A 1W6KA 2L32A 2DNEA 1C3TA 1EO6A 1XPOA 5CV9A 4MGZE 1ESFA 4X6AH 4G7ZC 2OF1A 1IL8A 1RYJA 4OWTB 5IAAC 4L63B 1H9RA 1MHXA 3A9JB 4C3HH 4HSVA 3U58A 2UUBL 2R7ZG 3LDZE 2KD0A 3VTWA 3NBHB 4A3DH 3DBHI 1ICWA 1EY6A 1GO3E 3U4ZA 1GUAB 1MG4A 4AS1A 4ZUIA 3NZUA 1TWGH 1Y1VG 1VDVA 3APFA 1A2TA 3ZDTA 5JH5C 1J0GA 2F0FA 5J17A 2R93H 2W54A 4XT3B 1RODA 3U52E 1Z9FA 5DM73 4DV2L 4F87A 4IQZA 3VHTC 2DY7A 3OYYA 4YIJA 4KZCA 3K81C 1UGJA 3VH3B 1E7UA 3V61A 2K04A 3F2DA 3JSVA 4DR6L 5LMUL 4FF1A 1JWBD 1Q1EA 5FK9C 5JHBA 1H9SB 2K4KA 4QUCA 3VR2A 1UBQA 2XK5A 1ZDXA 2WXJA 2JZZA 4WJNA 4RH6A 2LVQA 4JI2L 3OG5A 3GE3C 4EE2A 2CHBD 2M4NA 3PLVA 2MO0A 2DZJA 4K7UA 2JXTA 2ZXRA 1N33Q 1VQ7A 2NN6G 1DOKA 4RM9A 5AUKA 3OTOQ 1KF6B 1WE7A 1IW7D 4GKKL 2G4DB 2Y5CA 1V5TA 3SGIA 3W5OA 3CMAA 1V5OA 1H9JA 2MSED 4RGMA 2X6LA 4JK1C 5FKAC 4DV1L 1FXIA 3KQ4A 4BOSC 1VQHA 3SE0A 4PZ6A 4YHHL 1WFYA 2XIWA 1CT1D 1E2VA 3NXWA 3NE5B 2KLGA 4NZLB 1JRPA 3AH7A 5KNDA 3A1QB 5G5HA 3SHLA 5M3FB 3KYCD 3J7A5 5T1GA 3CCUA 4QCLA 3DM3A 2CHWA 3RI7C 2GBNA 1Y56A 2N9PC 4C3IB 4EZLA 4JI0L 4MTNA 1QT9A 2IO1B 1DM0B 3S1QB 1UE7A 1V9JA 2LI5A 2RDBC 1BQQT 1FD7D 1E24A 3H15A 1CKMA 1SXTA 3EFXD 1SE2A 5C0XI 3GTGB 2SAKA 5IP7G 4WAFA 3VXWA 1T3QA 2KJRA 1ENCA 4L5TA 1CJEA 1FO4A 2MH7A 2NBFA 3T1HQ 3OSOA 2JA9A 4R8IA 2K3UA 1F2RC 4NJCA 3MHZA 4J3OD 5E4XA 2WX0A 3AN1A 1JJCB 4LF5Q 3W5UB 1LFDA 1PGBA 1WFQA 3NOBA 1E0BA 2FCNA 1C48A 1NI2A 4QL5A 4RGNA 3TREA 1XMOQ 4RM8A 1PFSA 5M3FH 2WLBA 4RCNA 3KUDB 4BVUC 4Y7NH 4LAAA 1CZGA 2MUYA 4OELB 4RKLA 2K39A 1H9MA 4KSLC 5IO9A 2B2YA 2DYBA 1JE4A 5J18A 4BS9A 2VUMH 3ZJTA 1LT3D 2OTLA 1H9KA 2L4NA 1HRJA 2MJDA 1FIQA 2Z6KA 5E6OA 3H3VC 1F2LA 4CDEC 1ENFA 3PUXA 3GTGH 4ZDVA 2KVZA 2OCEA 1C77A 2Q2TA 3VR3A 1R9TB 5IYBH 3X3MA 2SNMA 1GUSA 1PYBA 2A6HD 2LJ5A 3VR9B 2Q2IA 2PQAA 4C56C 3D4DA 3GTOH 3A4RA 3K5NA 4KZ0A 2L76A 1BUVT 4LUOA 5I6YA 3HRDD 1P0RA 1BDOA 1X56A 3OW7A 1V2YA 1GPXA 2DJGC 2ZTDA 2IZVB 2UXBL 3TP5A 3PQIA 4JOIA 3W5VB 4GN3B 2E2IH 2WP9B 4IALA 1O7LA 1EY0A 1Q3LA 5CORA 1P9DU 2VRRB 2R3ZA 3QWNA 2WXHA 3PCOB 3I2ZA 4RMAA 5EDSA 1F2MA 2D2CC 1NCVA 3Q8EA 3VUYA 2EJFC 4A3FH 3M7GA 3RN5A 1XLQA 2IHEA 2KKCA 2HIXA 3KWVA 2X38A 1RFKA 3T56B 1UGMA 5D65A 3AEBB 4TKOB 1F9JA 3DVNU 4GMVA 3A8JE 2RHQB 2DGYA 4KVGB 4DHZE 1R9TH 3CP0A 3VDZA 2UU7A 3A74A 1I5FA 1IYUA 1V43A 3TZDA 2CWAA 1PLFA 2HD3A 2AQ1B 5CBAE 3JYUA 4PT5A 3M4OB 3ZTCA 1I6HB 4EQOA 2N9KA 1VQAA 3H94A 3MZ5A 1WGKA 1L2NA 3CC2A 2EYLA 2L5TA 1S5FD 4OEMB 2PMZE 2HE7A 2F4VQ 1J5EL 5FJ8G 2JN4A 3AXCA 4DV5L 2AKWB 1RFAA 3I4MB 2V4IB 3F1ZA 4LFAQ 2O5IC 2BB5A 2EKIA 5J1ZA 1KJTA 3L2PA 1Q7YC 2K8CA 2HIVA 4DV7Q 1VQ6A 1XNQQ 3DBLB 3NVVA 3TS2A 3A56A 1WRIA 1TWCB 1CA5A 4K1RB 1FR3A 1KTKA 1C8CA 5C3WA 3NZSA 3RLOA 2WYQA 4IWQA 1WJUA 2B29A 3M3JA 3L17A 4CJ2C 4OHJA 1XLNA 4C3IG 1WF9A 4K7SA 3RFZB 1MJEA 3HIZA 4K3BA 1ZKHA 3ICEA 2KDIA 1PXUA 3WALA 3HZXA 4DGZA 2ZNVC 3K0YA 4NJ6A 3K9OB 3AU5A 3BS1A 2WXPA 4GDKA 4PS7A 2KECA 1V86A 5CMDA 5FLMG 1W2BA 2Q2UA 3I4MH 4W9CA 3JAMi 2XSCA 2LRWA 1O7ZA 3C0RB 4IJLA 2BCOA 1SMXA 4MEMA 1S1QB 3OIPA 1NE3A 2D11A 3ENEA 5CHFA 2FCSA 1EOVA 3ZNHB 1TWCH 2SDFA 4P6VF 2F0QA 2TSSA 5M5XH 3Q8BA 1E1OA 1LABA 1BOSA 4IUPA 3LJ3A 5ELDA 4A8XC 3FKIG 1NEKB 1X1MA 4LTUA 5FR3A 3AEAB 1B1ZA 3MXNB 2WQYB 3I57A 4NAMA 1Q8IA 1XLOA 1ASYA 2OXPA 4NAWA 2RDFA 1ACCA 5EBDA 1LACA 4U68A 2FIFA 3UDXA 1PA6A 1X54A 1H4RA 4LNIA 1ASZA 4O42A 2KEDA 1ENAA 1K3RA 2F0DA 1SYEA 1QCBD 4K8JA 5EAYA 3RNCC 4ANUA 5KHOA 3H6NA 1FMAD 3NENA 4ZQ3A 3T9LA 4BBRB 4MT5A 2B2YC 5DPTA 1BCPC 1NNXA 4FXDA 2JWUA 1VQBA 2Z6KC 1L4ZB 1STEA 1ZP0B 4KHPL 3C1FA 3CMEA 1PZJD 3MWYW 2F0PA 3RN9C 1T5EA 4DR3L 4B9WA 2K14A 3VA7A 3AU7A 4AQYL 3TSSA 1ML0D 3QAQA 3TEZA 1EYDA 3T3OA 5JEAG 2NVXB 1B9MA 1VQFA 4HVBA 4KKJA 1OQRA 4TQ1A 4DK0A 4KGTA 1B8AA 3VRAB 2IBIB 1PYSB 4JOIC 2QEJC 1FFUA 1STAA 2NS5A 4A3PA 1B4OA 1YJJA 3PZDA 1TXYA 4BBRH 5JJIA 2W3SA 4K6LA 2JF5A 1PFDA 4B0MA 4FDBA 4DK5A 3U2SC 3EC8A 1YNJD 5AUIA 2WKDA 1C9OA 4HDOA 1G6ZA 3ZUNA 2WDVB 3I4MG 1T5XD 4DHZB 4HEDA 3EFCA 3RNBC 4I6NB 4IPCA 4FADA 2K75A 4JI7Q 2YU9B 4A93B 4DU9A 4C00A 3BJUA 4WRDA 1KLVA 4JPSA 4AYBG 4HMIA 4OONA 2ZM6Q 3M3YB 1AH9A 4OVVA 2R2QA 2FFKB 4C3JH 1E0ZA 2N9LA 2EZVA 2L1BA 2PMZB 4HCSA 5K36G 1TZOA 1IBMQ 3IFTA 4L8JA 3Q0AA 2LXJA 2N9EB 2PZWA 1I4HA 2YEPB 3P1MA 2PQEA 3BVMA 4XT1B 4DPGA 4MJSB 2EE1A 1HQMC 2NVTH 2BWFA 4HJ7A 4TKNA 4A3MB 3UE1A 1JQ4A 2K28A 2WWZA 2WB1E 3B2FA 1I42A 4POGA 2CQOA 2LSSA 4DR7L 4NXNL 2B2WA 3C1EA 4HPMB 2BW2A 2MHJA 4IWPA 5JPMC 2FMCA 2KVMA 4DR5Q 4GB9A 4W9DA 4WWOA 3HOXH 1PH1A 1F0ZA 1ET9A 2C35B 2DX5B 2B63G 4BKSD 4JI8L 1TVXA 1BUIC 1DOYA 3OMCA 2X69A 4X65L 3PF5A 3S2DB 3DBRB 2PW7A 2YU9H 5HY6A 1SE3A 4A93H 1SYCA 4K14A 4R4OA 3ABVB 4FJVB 4DK6C 2L0CA 4LF7Q 5DCNA 3SR1A 4OVUA 3MVVA 1SBBB 2KAJA 4XX5A 1OXXK 2E2DC 1AYFA 4MACA 1P16A 1T0SC 2L83A 4IPGA 2DN8A 3K5LA 1WGDA 4HXDA 3S15H 1STBA 2N9XA 5HHDG 1YQ3B 4CO7A 1IZ6A 1L0YB 1GHJA 2F0WA 1I4RA 2MP1A 1WGYA 1MHWC 1XEEA 2WXFA 4TRDA 3FILA 3HUIA 5EE1A 2JA5B 2MW5A 4ANWA 1E2ZA 3T1YQ 1WR6E 5LXIB 4H7BA 1J19A 3ND9A 2RGFA 3J81c 1PV4A 1WCMG 4ZRZA 1D5XC 1DD2A 4J15A 5C44H 3Q8DA 1PGXA 2NB0A 2KWVB 4W9LA 4A90A 4BBRG 3PPAA 4FHKA 4FLHA 4BZAA 1SRUA 2K5WA 3NEMA 3ZLZA 2QJLA 1SFOB 3LB8C 3DHQA 4IUQA 4WORA 2K6QA 3RZWC 3DHGC 4P73A 4GS3A 2IW3A 4X62Q 1JJGA 2WXRA 4JIOU 2QF7A 3OJ4B 2J0MA 3JC66 1CHQD 3BZDB 3H7PA 1JB7A 4M00A 1B9RA 2FINB 2A5UA 2PJHA 2WXNA 1SDFA 1PZID 2R7FA 2VS1A 2O2VA 3NS1A 1WYGA 3MJ5A 3AE9B 4HKZE 3C8YA 2BS3B 2PTLA 4W9EA 1R4MB 2A19A 1N34Q 4XYOA 3PIP3 4DV4Q 1FXAA 2K1FA 1C79A 1ISNA 2RD0A 5LMNQ 1HFGA 3KOJA 3AFPA 2PI2E 3H6MA 4LF4L 4WIPA 5EKIA 4E6IA 2DJFC 2FCQA 3KW5B 3QOLA 2JA8B 1S5CD 3Q22A 3A9KA 4DUYQ 2LUMA 4YY3L 2OTJA 4PS3A 3BDLA 3LX0A 1HE8A 1JT8A 1JCKB 2M00A 1EF5A 3UF8A 2HHHQ 1QOAA 3UQBA 2EVBA 4F88A 3I3CA 2QILA 2LJIA 2WS3B 3MTSA 1FGBD 3NWTA 2RDHA 4A93G 3HOUB 1E10A 4QF4A 1VRAB 4ULLA 3E56A 5DM63 2F0EA 1JWSD 1UE1A 2UUAL 2UXCQ 3H0GG 3NZ3A 3TEXA 2BE5C 2EJMA 5C2TB 1VZ7A 3QR8A 3KDFB 1N32Q 1FRRA 3HOZB 4XXEA 1VQKA 1VZ6A 1HR0L 4KTAA 5I4DA 1II3A 3S1RB 3A33B 1VQDA 4DR4L 2ZPYA 1FCCC 4NPNA 3ZDMC 4A20A 2EY2A 1I4GA 4A3MG 1VQOA 1ZGUB 1CI3M 1STNA 2VW9A 4ZCKA 1BF4A 1N36L 1L0VB 2RCNA 1ZEQX 4JBKA 4NKLA 1Q1OA 5FO8B 3J81L 3GTMB 4R4QA 2OT2A 4H2AA 4GU2A 4BKSA 1Y1WB 5DAUA 1PH2A 1K53A 1WR1A 2AL3A 2JYEA 2KC1A 3C46A 3HOUH 1QOBA 3VQIA 5C4HA 1O78A 4ARCA 1RTOA 1KLUD 3PUWA 4P2CB 4FBJB 2KHIA 3TMPB 3CCVA 4ANVA 3S2HB 1JC7A 1I94Q 2JK8A 3R2TA 1XMQQ 2JA7B 5LXHA 4LJOB 4DUZL 2B2WC 2CJNA 4K2KA 1I7HA 5IIFA 1UE6A 1MI0A 2LXCA 3ZGZA 4A3KB 3NUCA 1EY4A 1T0QC 4DAVA 1IXRA 5EBCA 5H92C 5AZGA 2KUMA 4DFAA 2JA5G 4R8NA 1SMYD 2AYOB 4A3OA 5EPKA 1HNWQ 3N32A 4UP7A 3TDQA 4ZK9B 3HKSA 3J7AV 5JHAA 5J39A 1EUVB 1QZGA 1G8ZD 1N61A 2JQRB 4YWLA 3X0WA 4R9WA 1GUNA 3GTMH 1BKBA 2HDLA 4JG2A 4RGOS 1XNRQ 3CF5A 3PZ7A 4DV0L 2D3BA 4DV7L 3W9CB 1JICA 1Q81C 3PTFC 3KLWA 2WDQB 3I90A 1IKMA 2WXLA 3S2HH 5H1SE 3PUVA 2IL8A 5BN3A 2UXDQ 1QVGA 1W6JA 4YCWA 3GTPB 1Z2MA 1N5WA 4A3KH 4CHKA 2KN4A 1Q90A 3FPUB 1K51A 4GDLB 3HVZA 2N78A 3GOEA 4HEA1 2DYMA 3PO2G 2MP2B 4Q5VA 1STHA 2ICIA 2O2LD 5A2QL 3OPOA 1AZPA 3W2DA 3RZOH 1K3BC 2GI9A 3R66C 4MM3A 1E3PA 2ZCCA 1IBXB 2NVQB 3BYYB 4OX9Q 1FM0D 3MC9A 4KIKA 2PYKA 4JI3L 1MJDA 3D6WA 2JA8G 1LTRD 4A3JH 3BVZA 1KIXA 1PGAA 1WM2A 2CHZA 1ZXTA 4IKGA 2DAFA 3Q3MC 4EQPA 4L5RC 4GN1A 1MIUA 3PT2B 2KVRA 2D0PA 3SK8A 5T1IA 2C7MB 3NHHA 2EMSA 3AE2B 1I35A 3MXUA 4R4CA 3HOUG 2NPTA 1FEHA 2JSOA 2A5HA 3HOWB 3IG3A 3DVGY 4C4VA 1HZ9A 2R7ZH 2HTME 2LRUA 1TU2B 1J7AA 1IGCA 2XTIA 5DNFA 3DBSA 4MGIE 2AWNA 1SYFA 2FHTA 4LF8Q 1QUQA 2KFKA 1Y1VH 3HOZG 1WI0A 3NTKA 4KJNA 3OLMD 1SE4A 1AE3A 2MQHA 4IFDJ 1NVID 1KHIA 1X9NA 2AX5A 3E9IA 2I1JA 1KRTA 1I3QB 1A2UA 4BBNC 1U4MA 1E7PB 3IAYA 3NP8A 4II3B 5D7GA 1M8AA 3FEWX 1SF0A 1GJZA 4A3LH 3ERSX 2WGSA 2BDOA 3E0JA 3MHBA 4DAMA 1MJCA 4A3CG 1TY2A 3I56A 2LXAA 4JQWC 1Y1WG 2XRQD 2D5GA 5IGGA 3AMZA 2VZKB 3ALBA 4OL7A 2F0SA 1KXLA 2FBWB 3HOWH 1HZBA 1D6EC 2WB1G 2FIDA 3PV0A 1B70B 4EZKA 1WGRA 2MJ8A 3QX1A 2GVAA 2JA7G 4LCDE 1P98A 5COYA 2TMPA 1RCVD 2NN6H 1Q86C 4JWUC 4A3KG 5JAVA 1PH7A 2DENB 5I2YA 5ELOA 4XZ4A 1WY8A 2K33A 1NAPA 4EGVA 4ASWC 1WMHA 1VLBA 1VQ4A 1FCLA 4CJ1B 3IAS1 4DBGA 3B2GA 1KDCA 3CC7A 3PF4A 1TGZB 1K73C 3HOYB 2NBWB 4MM3B 3AEEB 4R3DA 4X57B 3R7QA 3ZVVA 2AMCB 4FO2A 3K0XA 3L08A 5HURA 5LMNW 3TJPA 2AL6A 2J0KA 4XE0A 1L1OA 1LM8B 4WQMA 4QJFA 4BY1B 4JI7L 2KFJA 1EY8A 1BCPD 4N6EB 1E7VA 3HOVG 2MBBB 5AJ3Q 1CZPA 3N30A 3T51B 4C1NK 1S40A 1IBKQ 3JVZX 4JI1Q 3C3LA 2LGDA 3BINA 3VR5A 4MZ9A 4PV1C 4RHSA 3GTLB 2A8VA 1E8YA 5IP7H 1MGSA 5KGUA 2KQ3A 3UDFA 5NUCA 2R61A 3M4PA 1SEBD 1QF6A 1IBLQ 3A8IE 2J4XA 1UE5A 2B2TA 4KHVA 2E2JB 3G71A 4PK1A 2N55A 2H5XA 1SLJA 2NBUA 2MBOA 4B3ML 5JJLA 2KDEB 4IW0A 5EGTA 1E6EB 3K7AH 1LTSD 3I4NB 2L7RA 3CCSA 1Y69U 1GUOA 3EIVA 3FRPB 1N62A 1YI2A 3BDOA 3SK5A 2OQ0A 2KJHB 4BA2I 3J81E 3ZKJC 1CFMA 2D5DA 3D0FA 4A3LG 1BMLC 1FFVA 2KCCA 1FPYA 1YJIA 4I6LB 1YEZA 3ZYYX 4H13C 5G3LF 1GHKA 2HQLA 1D5ZC 1GUWA 1FVIA 3HFZB 4B6WA 4XYQA 2FJ2A 2QMTA 4LF6L 2QHOA 1Q82C 2WP8J 3ECIA 3I55A 3HOWG 4X3SA 3Q3JA 4TVAB 2VQFL 4BBSG 4DNTB 2GBMA 2BPSA 4EKUA 2I5MX 2JZ3B 1OXTA 1I4XA 5HGQA 4AYBE 4DR2L 3DVGX 4LNOA 2EPBA 2LMCB 4TV3A 2HDEA 5H8YE 4IOIE 4GNXA 3PS6A 3A7LA 1UUPA 3KUCB 3U4EG 1V97A 2L15A 4KMUC 3VR6A 4DNRB 1M90C 3WIMA 1Y8NB 2SNSA 2F0VA 1YIWA 1LTBD 4M0WA 3VUXA 3NVWA 2QDFA 1DZ1A 4JI6Q 3DWAA 1XYIA 2HJ8A 4II2B 2F0JA 5M3MG 4J6HA 2QW7A 2H89B 2Z0EB 3ZW3A 4ANXA 1DYQA 4A9AA 4HCPB 5D6JB 4HRSA 4DR1Q 2IPKD 4DN4M 1TKYA 4G4KA 1CQVA 1UEBA 3VYRA 4ZKCB 2CCZA 1UELA 1MSHA 3AQQA 4PQXA 3P20A 2IY0B 3P63A 4AOFA 2D9UA 4HLEA 5BN5A 3N1YC 3KLSX 2F0KA 4CGYB 4XGAB 4B3RQ 4O2DA 4R1JA 4RKBA 5FJ8H 1VQ5A 4P71A 5A2QE 1GAQB 1LT6D 1YJNA 2ATWA 1QG7A 1HFNA 1WXQA 1CUKA 2WKCA 2KHWB 3H3VH 4M8MA 3T13A 1S5DD 2XEWA 5GXGB 2A73B 2NCNA 5EQ0A 3HOYG 4M8AA 4MH8A 1G2SA 5EPLA 1ZPSA 3PMFA 4C7YA 1PFBA 2G45B 2DZIA 2XRSD 4OGQC 2W3RA 4NMZA 3A8KE 4DV3L 2NMQA 4RF0A 2INDC 1I50B 2AWTA 5E7NA 4BY1G 1RRBA 1NDDA 1YN5A 3I4LA 2MX2A 4WFN3 3DM1A 4MNOA 3HM3A 4C3IH 3NHEB 3JSVB 4GOPA 4BFRA 2F0NA 3S1QH 2RQXA 3FKIB 1HQRD 3M4QA 3MEHA 3JAMc 3NRZA 2JEAI 4PYZA 2HUGA 3SFEB 2G3QB 4M02A 4C80A 2J42A 4YTNB 2XWBB 1SMYC 2K5NA 3CKIB 1TT5B 1QOFA 5ELNA 2XK5B 1N32L 4A3GG 5EE0A 1UWXA 1DJRD 3SD5A 1ICFB 3DUZA 3N3KB 1E90A 5FLMH 1BCPF 3J80i 2E5LQ 1L1OC 2INCC 2K1BA 4YXDB 3OMGA 2L9HA 4HDQA 2JE6I 4ZUJA 1FL0A 3B6YA 3NTIA 4I7ZC 2LVOA 1K50A 4DQOC 4LMQD 4IPHA 3U9SA 1WH3A 3IHPC 4WURA 3VRBB 2K8HA 5IT9c 2XN9C 3I4NG 4PS8A 1C4QA 1YVCA 2F0UA 3HG9A 1I50H 4FXCA 2F0GA 4WJ3M 2ZNVB 4KKTA 3Q8AA 3AEFB 5KNBA 1XD3B 2L1AA 2LGYA 1SJED 1E22A 2B2TC 4HJGE 2YV5A 3FKIH 3GD7A 4F8MA 4B3SQ 4FF4A 2YTXA 2ASQA 3NJTA 2L11A 1PH5A 2WINB 1KNEA 1OXUA 4FN2A 1WXVA 2KCNA 3U9OA 1IUEA 1J8CA 1JOQA 3NELA 5FO7B 2KMMA 2Z59B 4DHJD 1KDBA 2VY3A 3ZJVA 2L55A 4FF2A 4IUUA 1FD6A 4DAYA 3IBEA 4AIMA 2W82A 1PHJA 1FXTB 4DV6Q 4LFBL 3QWZB 4JBMA 1F9SA 2K0PA 3U30A 2DNFA 1XX8A 2CH4W 3T53B 2ZJRA 4JI4Q 2LHEA 3DBHB 2PNHA 4FJYA 4NQKE 3ZJYC 4A76A 2MEKA 4IUTA 2IX1A 3NQTA 2H88B 2BE5D 3PV1A 3ZJUA 2LY7A 3DEPA 4K0KQ 1HNWL 2ZEQA 3P4RB 1QZHA 5LLIA 1WJ4A 2N3SA 2AEHA 3Q3NC 1NY4A 1NTGA 1SYDA 4FULA 4CDFC 3G48A 2QGQA 4MN3A 1VQPA 5AZFA 2PE6B 2JWZA 1U9RA 3HKZG 2UUCQ 1BBUA 2LASA 1YD8U 1FJGQ 4ZRQA 3WAOA 3ZRCA 1VCIA 3C2PA 4JYAQ 1UZXB 4YT0B 3NQIA 4IUVA 3SDZA 4K3CA 2BKFA 2BKRB 4AYBB 5IWAQ 3D32A 4X3KA 4DDID 2JT4B 1K9MC 5JEAH 2KTRA 4ARIA 3EVQA 1M4VA 1C9FA 5LNK1 2DYOA 3U7ZA 3I5JC 2D07B 5GADC 1YHBA 2L8JA 2WXGA 1WGGA 4MSMB 4GNXC 4OIKA 3V2TA 4X66Q 4MGKE 1BCPB 1PTOD 2KK8A 1G2TA 4ICVA 3RUZA 4FP5D 1XLPA 2EXDA 1B3AA 4ZAIA 2KCMA 1JR0D 1QVFA 3M4OH 1I6HH 3DVNV 4MELA 3TEYA 2MFIA 3JAML 3TP7A 1SROA 3GTKB 4RNAA 5EE3A 2A69C 4G11A 1CMXB 3K7UC 2IX3A 1WTWA 4JBWA 1RWSA 2KNBA 1HNZQ 4OX9L 1XTDA 4LW1A 1XCQL 3LXFA 2PQAB 1VQEA 2LKVA 2B63B 1QKZA 1NJIC 5MPOA 1AW7A 5LL6X 4H02A 4GKJL 1NMFA 1PFMA 2BH2A 4QIWE 1UWMA 3NUHB 2R92G 4K5VA 1SNOA 2V3NA 2OQKA 5CV5A 2I38A 3T3NA 2BOSA 2KA7A 4W9JA 4NP5A 5K36H 5IT9L 2INPE 2QDLA 2KO3A 1E8ZA 1JMLA 4YWMA 3KF6A 3LYYA 1FNVA 2I5LX 1HNXQ 1WE6A 4DWFA 3K8AA 1PH6A 4OVZA 2EXZA 1MI2A 1VJKA 2M1MA 3AE8B 5TR5A 3O65B 3NY5A 3P4SB 5BR8L 4GGQA 1L6VA 2B8FA 2JXMB 3M95A 5DLQE 1EIFA 3U4VA 2ZPNA 4FJZA 1X6OA 3L7ZC 2YEPF 1WCMB 1K8OA 1EWHA 4ILWA 2PIAA 4LFCL 2JA6B 3RUIB 4EQ5A 1AEXA 1EQQA 2B63H 4E74A 4KHZA 5HFYA 1F2YA 4GOPC 4JLCA 5BYQA 3CAMA 4A55A 5AEKB 2K52A 4N9PA 3OJ3A 3ZNZB 1CKNA 1LO5D 1SJHD 5KNCA 3L54A 5C5LA 2N88A 2OEOA 3F2BA 4LF9L 2HDMA 3S17B 3QHTA 1O7YA 1U5KA 2C5CA 4NXMQ 1LT4D 2K7VA 3EJIA 2F0MA 2K5VA 4E3CA 2GVBA 3GTQB 4AQ7A 4JV5L 4KKSA 1UAPA 2A1AA 2PNRC 2VB3X 3DWQA 5C0XH 3CW2C 1N8RC 3AMUA 2MCNB 3KJPA 4V0BA 3BK2A 1TKEA 4A3EB 3K59A 3RNAC 2NR2A 4I6PA 4G7OC 1MG8A 1WCMH 1IL2A 4LWCA 4IFDI 3SK4A 5BMGA 3FMCA 4EVOA 1TKGA 3CIRB 4HCNB 4GDKB 1QNUA 1XPUA 2GOWA 3AEGB 5G5GA 1EWCA 1JALA 3TP8A 3SFDB 1A5RA 4ZKBB 1GOZA 2IT1A 3L16A 2CVRA 2DWQA 4ZYNA 1M94A 4GLXA 1SB3C 3UINB 1HUMA 2AUJD 4IJHA 2LS01 5JEAJ 1IP9A 1PQSA 1QOHA 2K6AA 1HPCA 3GTQH 1GG3A 4GIVA 1Q8KA 3TUOA 2QEXA 4TMAB 2L0FA 4BA1I 1CQFA 2NZOA 5AJ3L 4TUUA 3H09A 1OO9B 2EDGA 3BZKA 1UEAB 1IBKL 3H0GB 2NVXH 1A0IA 4JI1L 1MVKA 1OEYJ 2K6DB 3A54A 5FLXc 2N1WA 5IY0A 4LUVA 2CJOA 3AI5A 2ZW1A 4WAAA 4H44C 3ER0A 3J7AF 2K50A 5JVG3 4LDTD 1S5ED 4MIUA 2KOXA 4JW0A 1U4PA 5JJKA 3Q3OC 4NAWB 3M62B 2XWJB 4XTCS 5IYDH 4GN4B 4PZ7A 2HCIA 1AARA 2L05A 3E9SA 3GB1A 4G3XB 2B2UA 3W1SC 4OZBA 4X64Q 1ONLA 1OXVA 4IG7B 1XQQA 1XF5L 1P3QU 1L4DB 2CU3A 2NTSA 2C60A 3EFUA 1UD7A 3PO0A 4HPPA 3TZUA 4OO1I 2PVOD 4XDXA 4M8NA 1M1KC 1XWEA 4W9GA 1EIYB 5GAEC 3GZNI 3M3YH 1DONA 2MA9B 3OAWA 3N9YC 4JPBW 4R4TA 2ON8A 2UUBQ 1BBWA 1HJPA 3H0GH 1B9NA 2DBYA 3IL8A 3BK1A 2VL6A 4RWSC 3F2UA 5GAHC 2CW0C 1WTXA 5IP4D 2N0SB 3A5ZB 2LXKA 1RDPD 4RAUC 1VZ8A 1RF2D 1JOOA 5C0XG 5CHWA 2KENA 2VB2X 4DV2Q 2IHFA 1J7CA 4A3MH 4QIWB 3BG3A 4ODGA 1N33L 2KYWA 1DOIA 3L10B 4DHJB 3I70A 3UDIA 3OTOL 1WIAA 3QJYA 1LUZA 1QLBB 3URYA 4A3IB 2JVCA 1X3PA 1Y8PB 4DR6Q 2V3SA 2JA6G 2WDRB 1NMGA 2DY8A 2Z0SA 3S2DH 4X3TA 4GSWA 5KRUA 3PIO3 3CCEA 2B76B 3KBXA 2K5HA 3EA6A 2WDTB 2ENBA 2RBMA 2KACA 4L1BA 3SVMA 3DWMA 2KBNA 5L95C 1DXMA 3EN2A 2O6VD 4GLAC 3S2AA 1JOKA 4JI2Q 4YSYB 4J8QA 3SEBA 1WTHA 1YBYA 4JI6L 1VDZA 1AN8A 2MLBA 2PO4A 2KQSA 3GQBA 1EEFD 2ACZB 3KYHC 3UDGA 4GKKQ 2I1KA 2WXKA 3VR4A 4EX5A 1TS2A 4DV1Q 1LT5D 1FNUA 4B3TQ 4YHHQ 3PO2B 1B2TA 2JA5H 1JQYD 4CKBA 1N60A 3SDLC 3FC4A 5FLXL 1TY0A 4A3EG 1MFWA 5M5YB 4PZ8A 1PH4A 4KGSA 4B3RL 3J7YW 1WJ6A 3JAME 1QWYA 1OTRB 3T1HL 1GVPA 4N9TA 2CQAA 1BT0A 4CDDC 2ZJDA 4L6TB 4DDGD 5IYDG 3VDYA 4LF5L 2G5DA 1SFOH 2QCPX 5D3DA 1C4PA 5E6NA 4B08A 3VR8B 3GTJB 1LTID 1V6EA 3H9DA 5D2MB 4JI0Q 4JI5Q 2N7DA 3STBC 1XMOL 3CSTA 5C3EB 2MNAA 1ET6A 3OHXC 4UHVA 2K5PA 3BWUD 3NG0A 3R2IA 4M1UB 3VYSA 3AE5B 1O80A 1VQCA 1OGWA 2WX1A 2NN6I 3PRMB 5IT9E 1NI3A 3RULA 4WJPA 1UBIA 5E3FA 3PO2H 1IYVA 1XO3A 1WSPA 2JYOA 3IAM1 1XT9B 3KF8A 1PDXA 5CGKA 5M5YH 4BBNF 4C2MB 2EMTA 2IGDA 2K22A 3O13A 1R4NI 3QARA 3FILB 2EOTA 2JA8H 2HD5B 5IGEA 4KD3A 3GS2A 2ZXOA 2A68D 2DLBA 4TQUS 5HI1A 3GTJH 4HIDA 1PFNA 1IYJB 1L0WA 1MD2D 3ZRFA 4ME3A 3FHWA 1VS0A 3V96A 1A6XA 1WXAA 3APDA 5J2RA 3P75A 1A8VA 3MXGA 5C3EH 3WOFA 2PE9A 2RDGA 3MC0B 4AH6A 1ZW7A 3S1NB 4PNYA 4A4IA 1ZYRC 1NUCA 1PTOC 2A6ED 3MP9A 3LNNA 1KABA 3PO3B 5CV4A 3TBIB 2WB1B 3OWFA 4LNFA 1QB5D 2XVSA 3AE4B 4BY7B 4JBJA 3S1MB 3H7PB 2NYZD 4FYDA 4IURA 2B2UC 3IFDA 3A5UA 1PUTA 4OWXB 4WJ4A 2ZVNA 1LM0A 1OXSC 1EQTA 2G9HD 4C2MH 3HOZH 1GJXA 2J0JA 2O2VB 4GXBA 3P7JA 4HK2A 2UXBQ 2I2YA 1RL2A 3S1RH 3U7DA 1VD2A 1EZ6A 2N8NA 1VR9A 5ELBA 3WA0A 4KDLB 5JZEB 1GC7A 2BF8B 4QQBX 4PMWA 2I07B 1F9RA 4NPSA 4A3IG 2F4VL 2JY6A 4XDCA 2ZJQA 2BA1A 4A3CH 3DWPA 1TZ1A 2PLPA 4NW2A 4WJOA 4LFAL 3MFGA 4N9F4 4XQQA 3A9KB 3W1GA 1Y1WH 2RSOA 5D14A 3S1NH 2CKZB 2NZHA 4NJ7A 5KIXA 2JSVX 4ICUA 3GZNB 1XNQL 2C9OA 1S72A 2C7HA 2PPHA 1GD7A 1J8IA 2OHFA 2F0IA 2NVYB 2N49A 3G7LA 3HOVB 1IYFA 3KUZA 1YJWA 4FNFA 4ZRPA 2O6VA 1EFID 1BVSA 1VCBA 2JA7H 2Y5BB 3RYTA 1YN4A 4PMCA 4HIOA 3S1MH 2FNJB 3CSFA 5M5WB 2L12A 3GE8C 4YTMB 5C4ZA 1B53A 1NSNS 2AQ2B 2F1MA 3HS0C 2Q8IB 2EY5A 1Z6HA 2IJ0A 1HHVA 2MBQA 3B08A 2F0LA 1J5EQ 2BT6A 3PGEA 1NENB 2LZ6A 3A4SC 4URKA 2BS2B 3CRKC 3S14B 3PHXB 5IGBA 1ZUD2 1GC6A 2N7JA 2KXJA 4LNQA 1K0RA 1Y14B 2GB1A 1PRTC 3T8MA 4BKGA 1K8AC 2VQEQ 4ZRJA 2LD9A 2L52A 3RT3B 1HNZL 3QCAA 2I46A 3BIID 4LDTB 2KQ7A 3EGRA 4RA8A 1RIPA 1PH9A 3PUYA 1ZXIA 4U673 5CBEE 5DPRA 1LTTD 3A7AB 2ZJPA 3DQVA 4J6IA 4POFA 3QG1A 4KN7C 1D7QA 2CS4A 2KHJA 2LGSA 3AU4A 4HROA 4WWMA 2IGGA 5C23A 4B0EA 3Q8FA 1STGA 5GMVA 3SK6A 3HOVH 2NVYH 1FNWA 2VXWA 3UE0A 3DLLA 3WCQA 5C3EG 3N1XC 1KH0A 2LVPA 1H95A 4NDXA 5ISRA 4KJOA 3JW0X 2Y3AA 4HIMA 4A3BB 1Y8RC 2LWPA 2MJ3A 2GN5A 1J7BA 3KLRA 1N5XA 3GTPH 4W9IA 2XGTA 1HNXL 3AFQA 3HKZE 3I73A 5IOCA 3RNUA 5CV8A 1K8MA 1XXGA 1XJVA 4BBSB 4XDDA 1DOLA 2L3ZA 5BYRA 5G2NA 4C7ZA 4AWJA 3I63C 4Q2JA 1K83B 4OWWB 3ND8A 3Q24A 2E3TA 2R2OA 4KLKA 1SYGA 4H0LC 4JX1C 4G50A 3DPDA 4OZCA 3TCAA 4IFDG 3ONSA 2NVQH 1JWMD 1GNUA 3K58A 2JU6X 5J22A 3CXCA 3MC8A 3QK0A 5JOBA 4MDKE 4BXXG 1NR4A 3CPFA 2KLCA 2YLMA 2KHSA 3KLSA 2PMVA 4HJ9A 3VH4B 2PZTA 4HJ8A 4ABNA 1OTCA 2PVGC 4BAXA 5C3JB 3HK0A 4NB3A 2A69D 3TQYA 1WD0A 1JRUA 1RTNA 5C4XB 1X3EA 3RN2A 2ZCBA 3A9JA 1A3UA 1KQSA 1S3OA 2H4OA 2PCFB 4ID6A 4UY8C 2WIIB 3NBHA 4N58A 1D1IA 1Q12A 3IKJA 4MH0E 1A3VA 3U50C 3PO3G 1LGRA 4HMJA 5M3MB 3FKYA 1TS5A 1EWIA 4BBSH 5T8IA 1PH3A 2KOLA 3ZTDA 1YOVB 3HEJA 4JE3B 3FDTA 4YWKA 4BY7G 2BYFA 3CRLC 4N8X1 1QQRA 5HKHA 3KVFB 3R7RA 3FP9A 5L83A 4JVZA 2JJQA 3I7FA 1R4NB 2J7QB 1YQ4B 3B1LX 1V8QA 1C7YA 1HEZE 2F0OA 5FLXE 4KHPQ 1G6JA 4ZHOA 1X65A 1I3QH 1STYA 1A15A 4DKAC 4DR3Q 3WANA 1H9SA 4FVMA 5JJZA 3TEHB 2NWGA 4RGTA 1ZKOA 4AQYQ 5IOIA 3GV6A 1U4RA 2YYZA 4OIJA 4KIKB 2GA4B 1QVCA 3ZXRA 1G6PA 2FUHB 1XTCD 1L7YA 1KNAA 5F2DA 1EM7A 1MHHE 2W9NA 2EJGC 4CHTB 2XBBC 5M3MH 2ZM6L 2EYOA 2F03A 2BVCA 2RHSB 4C3HB 2BA0A 2BB6A 4IM0A 3RLFA 1V1PA 3DWGC 2GBKA 4A3DB 1IBML 3MEFA 4KI0A 4HWIB 1AE2A 4F7ZA 2NPTB 4YSZB 2F0HA 4GLSC 1SNMA 4A3GB 1SSNA 1TWGB 1WM3A 2FAZA 3AECB 4GOCA 4AP4C 3RD2A 4C4VB 3FVQA 3LWUA 2R93B 3A1QA 4L5SA 4YCVA 5KYLA 3SR6A 2PKOA 3MTNB 1QUQB 1BXTA 3EQLC 3UIOB 2KFKB 2IWHA 3RZDB 3HOYH 3ZNGC 3KFUA 2RSNA 3J81j 4E71A 4DR5L 1D3ZA 2Y0SE 1NR2A 2ZZPB 4OZAA 1PZKD 1JORA 1SAPA 3B9JA 4BY1H 2Q2HA 1SNCA 4HIKA 5E6PA 1IPGA 1HXYD 1JWAD 1PYWD 2EQSA 4LF7L 3J80c 3IT4B 4A6QA 3ZIMA 3HVDA 1X32A 4QGUA 2IO2B 3QOJA 1KRHA 1YX6B 1HCZA 2ZTEA 2D0OA 1V49A 1YMHE 3GTLH 4A3BG 3W1YA 3G6EA 3PZ8A 4ITKA 5IYCG 1ZOYB 2GBRA 4A3GH 2OJRA 1HZCA 3WOEA 4DR7Q 1KDAA 4NXNQ 4Y52H 4KV2A 4L2YA 2Z4HA 2YVCA 2W55A 4G0NB 2YTYA 3GP7A 2E2JH 3AM9A 4JI8Q 2HJ1A 4X65Q 3VYUA 3DXJC 1UH6A 3OOCA 3T1YL 2C9WB 4XQJA 3Q69A 1FRDA 4PMBA 3RZDH 1VQ8A 4S3SA 1ILPA 3DDCB 3DBLI 2ZW0A 4LJPB 5CTRC 3I4NH 1EY5A 1WMHB 1A62A 3DOWA 3HKZB 3ERQA 2GMIC 2E2HB 1B7YB 4F8CB 1X3QA 3HRZC 3RCZA 4X62L 5C4XG 3KH0A 4ZYSA 2HQEA 4QY7A 2JZPA 1X55A 2PW9A 1L1OB 1RAXA 2WXMA 3SXHA 1SGHA 2BYEA 3WAMA 1WWTA 2KCTA 2MRPA 5BMIA 3GDEA 3ZXVA 1WZ0A 3OW2A 1E8WA 4RFBA 3IT6B 5C6AA 1U0LA 4KGRA 2BWES 1RKNA 3QIJA 1V1PB 4JWSC 3I9V1 4LNNA 4B3TL 1N34L 2A68C 1KLGD 1LLRD 1IHZA 2HCCA 4DV4L 1TBEA 2CR5A 2DAJA 2QSDA 4KKIA 3VTUA 5EJWA 5LMNL 4EEWA 2ZT9C 2PPBC 4EFOA 1WTRA 1EYGA 2CW0D 3EUB2 3NVZA 3DEOA 3X3NA 2M0XA 2NBVB 1YNTE 3H7SA 4DF7A 2V4DA 4AUQC 4Y7NB 1CSQA 1VQMA 1JB3A 4DUYL 2A6EC 2E2HH 3NVYA 1WTOA 1VQJA 2KDFB 4KK7A 1XPRA 2ZVOA 2SEBD 2VUMB 4JI5L 2R92B 2EYJA 1I4PA 2HHHL 1NBFC 1OEYA 1SNDA 2M19A 4LJZC 4XC2A 3TL5A 2KTFA 3HHMA 4FF3A 2EYFA 3W3AA 3V62A 4ZHPA 3SU8X 1C4AA 3CPWA 4JC0A 2JPHA 4LF4Q 3CMMB 3R3OA 4G7HC 3HGBA 2RPVA 4C3HG 2UXCL 3J80L 3PUZA 5CV6A 2E76C 1GXDC 4A3DG 3GTOB 5FOBB 2KQ4X 2QKIC 3EECA 1ROEA 2D3AA 1HH2P 2NTTA 4YY3Q 1WRDB 3F8TA 2BBCA 2V3PA 1BR9A 4AJYB 4GZYC 2R93G 5IA7A 3KJOA 2E2IB 1EF1A 4F7XA 2CKHB 2KMCA 5IODA 1TWFB 3LWEA 4CKCA 1O7IA 2PZUA 1QE6A 1WX8A 1YNXA 5KEEA 4ZOHC 3TEWA 2N1VA 3FPPA 1YZ6A 4GNXB 4A3FB 2R92H 1A63A 1WOCA 3L3OC 3IRBA 4G57A 3V05A 4KY5A 1VQLA 2UUAQ 1K0SA 1Q10A 4ZRIA 2KWDA 2IYDB 2QC8A 1VF5C 4EZJA 4W9HA 1EEID 2P5ZX 1YN3A 1EIHA 1HR0Q 1C4CA 2EYMA 3ULLA 4M0WB 3M7NA 2Z0DB 3FAHA 2V4LA 3STBD 1RD9D 2ES2A 4DR4Q 1H8CA 1I94L 1HZ5A 3E3XA 1XMQL 2NZ1D 4QMGA 2CHXA 4JCVE 4TSSA 2Y0SB 1N36Q 3V6CB 3NSWA 1A70A 2EYHA 3QB3A 2UU9Q 2RKSA 1E9MA 3K5MA 2J53A 1AFPA 2PEAA 1JMCA 2NVUI 5C5MA 5DPWA 1B50A 5C3XA 3V60A 3G6JB 4NNJB 1PDQA 2Z6BA 3NBIA 3NK9A 1TWFH 5D94A 1KM7A 2BH8A 1RLFA 4WQOB 2Z1CA 4US9A 1E2WA 2FMMA 4APVA 1TWHB 3MXNA 1XNRL 1C78A 2A4ZA 5KHQA 1ILQA 3ZO5B 2WV6D 3ULPA 4DUZQ 3J7ZC 1X3FA 5GROA 1WVLA 4WH4A 1TT2A 5BYSA 3HM6X 1D4BA 4DA2A 2ID0A 2EYPA 4N8FA 1V8CA 1GKHA 3VVWB 5AFWA 3W1SA 1S4ZA 1RM6C 4RMFA 3I3TB 3Q3FA 1LXDA 4L23A 2UXDL 1CSPA 1MPEA 2BQQA 3QQ8B 2D10A 1B44D 3MA2B 1KAWA 5I6WA 3P42A 1ZYRD 4GOPB 1SYBA 1TR5A 3QO2A 4LLGM 4BOZB 4MHEA 4WJWA 2JUOA 1DOMA 2E75C 4DV0Q 4ALPA 3EBEA 2WNMA 1HUNA 3DBRI 2VQEL 4KX6B 3DMUA 5ELFA 2IO3B 5TSSA 5M3FG 1TWHH 4F1SA 4QAYA 1EFWA 1WYWB 5M5XB 1E5WA 1L5PA 1YHAA 4K6DA 5GQOA 3U8ZA 1U4LA 4K7WA 4ZRKA 4FXGC 1NYQA 1MSGA 2VUMG 5EPJA 2JQOA 3H8HA 2LUEA 1WTQA 2M17A 3LGJA 4IDIA 3Q6BA 4K5XA 1UF0A 1AWDA 4K5WA 4KN4C 2JRIB 4DK3C 4IO9A 5IYBG 3R93A 2GLSA 2EELA 3CCMA 4M01A 1YITA 1WI5A 4B9XA 4JI3Q 3MFYA 3D3RA 4K2LA 3CCJA 4LF8L 3GTKH 4BWGB 2K25A 5EKLA 4WWPA 2AQ3B 2H1EA 2FUG1 4DAYB 4N59A 1F9PA 2SOBA 3VFKA 4IPDA 1P7EA 2L0TA 2MO1A 2MHVA 4UP9A 2KC2A 3C19A 4RG1A 4LUZA 4P16A 1GB1A 4O0AA 1ZXHA 1Z7TA 2J7ZA 2AUKA 2RA4A 1F2ZA 2K5QA 1LTAD 2IY1B 3ML9A 1PRTD 4A3FG 1G291 3UI2A 4MJSA 2G9DA 3BVGA 3ZQ4A 3I72A 4P7IA 2VH2A 2KDMA 2BGFA 4DAPA 3PSEB 2RVLA 3AEVA 3P4PB 1R4MI 2B2VA 2LFIA 2K03A 1LQBA 2K01A 2G4SA 1DGSA 1EQRA 1WYDA 2WXOA 4AJWA 2KTRB 2N4FA 3AULA 1HTQA 2F52A 1Y8OB 5HG2A 3ML8A 1TJEA 2B8GA 5D3IB 2KANA 5E1FA 1D2BA 2MJEA 2WXQA 3TN2A 2Y0SG 2LGXA 3IVFA 4IOAA 1WXMA 2RR9A 4XYCA 1EL0A 1G91A 5CC4A 2JA6H 1Q46A 2DNCA 1ZE3D 4C1NI 3TS0A 4UP8A 1EYAA 3N52A 1HTOA 3QA8A 4S17A 2IY5B 4CBVA 3BU2A 1C0AA 3N20C 2F3IA 4HAEA 2YTVA 1T0RC 3Q14C 1S3SG 2MWSB 3V3XA 3PGZA 2RMMA 5C1ZA 2WAQE 5DEHA 4C3JB 4DXFA 2Z4IA 1SE9A 3S17H 1L2FA 2WXIA 5IGCA 5IGFA 5ELEA 3D31A 1WX7A 3UGBB 1KC8C 4IOCA 2KWUB 3RMHA 5LL6S 2NVTB 1Q5WB 1F52A 1F77A 1OQYA 1LTLA 4FHJA 4LNKA 3D4RA 4OW0A 3E5SA 1N9WA 2BYTA 1SIJA 1JW9D 3KF6B 5L37A 3M85A 1JROA 1TYGB 4P1CC 5HGTA 3J80E 4A3EH 3E0EA 3HP3A 2JXXA 5CX3A 2PW5A 1WJJA 3PREA 1EZ8A 2DZMA 1HA5A 1IBLL 5DPSA 1P8LA 2F0TA 3HOXB 4UPAA 2R6GA 3QC8B 4IM3A 2IDYA 1I6VC 1K28A 2WHIA 3CF6E 4HCEA 3I8ZA 3P1HA 1Z5SB 1WGHA 4NQLB 2QIEB 2O5JC 2MPMA 1EY7A 2IX0A 1SNQA 4OXPA 1SIFA 1PTOF 3AV8A 4YWGG 1LTGD 1NBWA 1YX5B 3TIXA 3D6CA 4ZLTF 2ALYB 2LGIA 1ZDVA 2CFMA 2M8SA 3AE1B 3S15B 1IW7C 2JP1A 1CKNB 3SHQA 3VUWA 3M63B 3E6ZX 1CK1A 4LK0M 2MGSA 3CHBD 1QOGA 3WWVA 1JE5A 3NPPA 2KWCA 1LV9A 4GN5A 2K5DA 2V1CC 3ITPA 5CR3A 3F2CA 2LFNA 1T9HA 4B3MQ 2INNE 1J6QA 4YSXB 5C44B 2E6XA 1TIFA 2REXA 5FR6A 4YCUA 1A3TA 1SNPA 1HR0W 3S9WA 3WAPA 4W9FA 2RPQA 3A55A 4TQ0A 4XQNA 1WTPA 3CCRA 3P2BA 4CKEA 5LMUQ 1SSOA 1HZ6A 3CU7A 1CM9A 3TMEA 2JYTA 3TRZA 1HA6A 4A75A 3P4QB 4LF6Q 2CWPA 3KDFA 2WU2B 4KKUA 3PLUA 3G4SA 2VQFQ 1J9OA 1YNND 3ONAB 5FO9B 2RCFA 2VH1A 2KZRA 2EY1A 2MQJA 3MJWA 4DR2Q 2KX3A 4D2KA 4P1BC 5C0XJ 1CHPD 1YIJA 4YL8A 1KOTA 2ICEC 4KV6A 3K6OA 3WDNA 4JL9A 1ESRA 4IUNA 1PRTF 2A74C 1R4PB 5LHY1 4Z9CB 4DR1L 4I65A 3BZCA 2N7EA 4W9KA 3MXPA 3DCGA 4J1MA 2VZKD 3PIOA 5I2XA 1V1QA 3PSIA 2ASBA 3KUPA 5I9OA 4A3IH 1PTOB 5M9OA 3TP6A 4RCOA 1MBYA 1F9QA 2D62A 5BO4B 2B2VC 1KFYB 4QB4A 4KY6A 3V6EB 3UIPB 3D8GA 4P75A 3VAWA 2OOBB 1QNKA 2JX5A 2A6HC 2K05A 4DXGA 2K9XA 5G55A 3Q6SA 2FCMA 1B3QA 2NUCA 4C3JG 2IGHA 3DHHC 1EY9A 4FXKC 3PIPA 3T16A 4US8A 2QCZA 3RNFC 5JXVA 4HJ5A 1JWUD 1QJOA 1NYRA 1YHQA 1WZ3A 2C5LC 2VNUD 2KJ6A 3R3MA 1C1YB 2EIFA 1VQ9A 3PRZA 1V1OA 1X3GA 3EHVA 2KN5A 1E7ZA 1PH8A 4PG3A 1EU3A 2LEKA 1SN8A 1CZWA 1TS4A 1W3SA 2WAQB 1OQQA 1FGUA 1T0YA 5IGDA 3BY4B 3AYHB 1PTOH 2E5LL 1V80A 3HOXG 5KYIA 5CYUA 2DUDA 1TS3A 4V190 1Q0WB 3K9PB 4DV3Q 1HTPA 2AHOB 1TIID 3QIAA 1AZQA 3KK7A 2ZXPA 4NY0A 1CTMA 2B39A 3I4OA 1Q1BA 2KDBA 1TWAB 2ZTCA 5BMHA 1E8XA 3L13A 5EKKA 4GDLA 1HZAA 2Q8RE 3DHIC 1N6ZA 1KL9A 4HKQA 1EIGA 1VQIA 4RHRA 3AB5A 3PHWB 2MP2A 4ME5A 3CQZB 1E1TA 4DK1A 1G51A 4UAIA 4IWOA 2O4XA 3RNGC 1IBXA 1PRTB 4B3SL 1EUJA 5GAGC 5K5PA 4PYUA 2OWOA 1Z47A 4HR7B 2V0GA 4IM2A 3W1BA 2DHZA 1D1KA 2Z9HA 1QILA 5A35A 1L0XB 5C4JB 2X6GA 2BDNA 4K8IA 1DOXA 1EOTA 1GUTA 4IFDH 4DV6L 2UU9L 3RMKC 3S24A 5C44G 1EWYC 3AB9A 4JI4L 3CD6A 1OFFA 1RJTA 1WX9A 4K81A 4BXXH 5IP9H 1VQNA 2PI2A 5IE8A 5E6JA 3AE7B 4K0KL 3M4YA 2Q8TA 1BO0A 2BYVE 3H91A 1TWAH 1WD1A 5EE9A 3J81i 5IKCM 2AWOA 4BKTA 1GUGA 1V9PA 5BN4A 3B0AA 4GLVB 2UWQA 1DCZA 1TQOA 2UUCL 2G1EA 2V1YA 3BYTB 4LK1C 1FJGL 1XCTL 3CQZH 2WACA 4JYAL 2GBJA 3EROA 5JVH3 1WXSA 3PO3H 3H1UA 1EYCA 5IWAL 5J3BA 1K52A 4USAA 1SR3A 4LFBQ 3M9BA 4HSPA 4EUTA 2EKEC 1L6UA 4BY7H 1RHPA 3KWLA 3CCLA 1GB4A 3Q8CA 1VF7A 5C4JH 2B3GA 3AE3B 4X66L 3K57A 5AZHA 2JRHA 2EY6A 3NWSA 4IZ8A 3R8BA 3RZOB 1VMPA 4XWTA 4HJAA 3RLNA 4DV5Q 5ELCA 2WFWA 2B3AA 2MBEA 1S5BD 3E9HA 2GRIA 2M9VA 4A3JB 1BNZA 2C7NB 3KF8B 2CH4A 2D3GA 2VZAA 3ETRA 1VMCA 2MBHA 3Q2AC 1I4QA 1D5MC 4MTKA 3L9AX 2ONQA 3VA5A 1CKOA 4OO1H 4QUFA 5CHVC 4MGYE 1YQBA 1UWVA 1KRSA 1F2RI 3Q23A 4R4IA 4HPLB 1P7FA 2I0QA 3VTVA 2R7ZB 2DZKA 2KMAA 4P74A 4IC7B 2F3VA 2K8BA 5M5WH 4IUMB 1YJ9A 2F4IA 1Y1VB 3VYTA 4HTHA 3MAQA 2IO0B 1AP0A 4DXAB 2KJXA 3APCA 4S0RA 5G3LD 2D3CA 2M56B 4CYEA 3IXSA 4HJKA 3PVLA 2I5HA 5JPNC 4I7AA 1K8GA 3S14H 3A0JA 3RR5A 3OWEB 2V9HA 3IFWB 1UNSA 1EU4A 3D4WA 1EQVA 2WAQG 3H3VI 4GKJQ 3N1ZC 4CJ0B 3K5OA 3N6RA 3S16B 1U4AA 4ACFA 4XIGS 2K32A 1C76A 1SE8A 1DGJA 2FE8A 2J52A 2X8XX 3QJZA 4CQNA 1T6BX 1VQGA 3X23A 5IP9G 1R4QB 3L0WB 1F1HA 2OJWA 3L0OA 2Y5PA 2QA4A 1KAAA 3UI3A 3CC4A 4X3UA 4YTPB 2E74C 1TTNA 4NXML 5CV7A 3AEDB 1MKHA 4A3BH 5E4WC 5BR8Q
chains in the Genus database with same CATH topology
1YNJC 3BDCA 5I9PA 3GV3A 1PMRA 2JEBI 3RD4A 3AE6B 2M0AA 4RF1A 3OIQA 4REZA 2BTEA 4Q0FA 2WU5B 3CWIA 3NTHA 2OEDA 2LHDA 1TKWB 4UDUC 2Q5WD 1FYCA 3L4PA 1BBXC 4OO1G 4KD4A 4IN3A 1IGDA 3RPFC 1CA6A 3I91A 2BS4B 2Z8LA 1HTLD 2LMCA 1R7SA 4HN7A 3T4AC 1IKLA 3GO5A 3J9CA 2J0TD 3KBGA 4XWWA 4O1NA 3K7AB 4EQNA 4KY7A 2F3WA 2KEEA 2XNAC 1WTVA 2M2LA 1YNNC 2QDBA 2L32A 1N63A 1W6KA 2DNEA 5CV9A 1ESFA 4G7ZC 2OF1A 1IL8A 1RYJA 4L63B 1H9RA 1MHXA 4HSVA 1ICWA 1EY6A 4AS1A 4ZUIA 1VDVA 1A2TA 2F0FA 2W54A 4XT3B 1RODA 3U52E 5DM73 4F87A 4IQZA 2DY7A 4YIJA 1UGJA 2K04A 4FF1A 1JWBD 1Q1EA 5FK9C 1H9SB 4QUCA 3VR2A 1ZDXA 2WXJA 4RH6A 4EE2A 2CHBD 2JXTA 2ZXRA 2NN6G 1DOKA 5AUKA 1KF6B 1IW7D 2Y5CA 1H9JA 4RGMA 2X6LA 4JK1C 5FKAC 1FXIA 3KQ4A 3SE0A 2XIWA 1CT1D 1E2VA 3NXWA 3NE5B 4NZLB 1JRPA 3AH7A 5KNDA 5G5HA 3SHLA 5M3FB 5T1GA 4QCLA 1Y56A 4C3IB 1QT9A 1DM0B 3S1QB 1BQQT 1FD7D 1SXTA 3EFXD 3GTGB 1SE2A 5C0XI 2SAKA 4WAFA 1T3QA 1ENCA 1CJEA 1FO4A 2MH7A 2NBFA 2K3UA 3OSOA 4R8IA 1F2RC 4NJCA 3MHZA 4J3OD 5E4XA 3AN1A 3W5UB 1PGBA 1E0BA 1C48A 4RGNA 2WLBA 4RCNA 4LAAA 1CZGA 2MUYA 4RKLA 1H9MA 2B2YA 1JE4A 4BS9A 3ZJTA 1LT3D 1H9KA 2L4NA 1HRJA 2MJDA 1FIQA 3H3VC 1F2LA 1ENFA 3PUXA 1C77A 3VR3A 1R9TB 3X3MA 2SNMA 1GUSA 2A6HD 3VR9B 4C56C 3D4DA 3K5NA 5I6YA 1BUVT 3HRDD 1BDOA 3OW7A 1GPXA 3TP5A 3W5VB 2WP9B 4IALA 1O7LA 1EY0A 1Q3LA 5CORA 2R3ZA 3QWNA 2WXHA 1F2MA 2D2CC 1NCVA 3Q8EA 2EJFC 3M7GA 1XLQA 3KWVA 2X38A 1RFKA 3T56B 5D65A 3AEBB 4TKOB 3A8JE 1IYUA 1V43A 3TZDA 1PLFA 2AQ1B 5CBAE 4PT5A 3M4OB 1I6HB 4EQOA 2N9KA 3H94A 3MZ5A 1WGKA 2EYLA 2L5TA 1S5FD 2V4IB 3I4MB 2O5IC 2BB5A 2EKIA 5J1ZA 3NVVA 3A56A 1WRIA 1TWCB 1CA5A 1FR3A 1KTKA 1C8CA 5C3WA 4CJ2C 4OHJA 1XLNA 4C3IG 3RFZB 1PXUA 3HZXA 4DGZA 3K0YA 3BS1A 2WXPA 2KECA 5CMDA 2XSCA 1O7ZA 2BCOA 3OIPA 2SDFA 4P6VF 2F0QA 2TSSA 3Q8BA 1LABA 1BOSA 4IUPA 5ELDA 4A8XC 1NEKB 4LTUA 5FR3A 3AEAB 1B1ZA 4NAMA 2WQYB 3I57A 1Q8IA 1XLOA 2OXPA 2RDFA 1ACCA 5EBDA 1LACA 4U68A 4O42A 2KEDA 4K8JA 1ENAA 2F0DA 1SYEA 1QCBD 1FMAD 4ZQ3A 4BBRB 4MT5A 2B2YC 1BCPC 4FXDA 2JWUA 1L4ZB 1STEA 1ZP0B 3C1FA 1PZJD 3MWYW 2F0PA 1T5EA 4B9WA 3VA7A 3AU7A 3TSSA 1ML0D 3TEZA 1EYDA 3T3OA 5JEAG 2NVXB 1B9MA 4KKJA 1OQRA 4TQ1A 4DK0A 4KGTA 2QEJC 1FFUA 1STAA 1B4OA 1YJJA 2W3SA 4K6LA 1PFDA 4B0MA 3U2SC 1YNJD 5AUIA 2WKDA 1G6ZA 2WDVB 1T5XD 4HEDA 2YU9B 4A93B 4DU9A 4WRDA 4JPSA 4HMIA 3M3YB 2FFKB 1E0ZA 2N9LA 2EZVA 2L1BA 2PMZB 4HCSA 5K36G 1TZOA 3IFTA 4L8JA 3Q0AA 2PZWA 1I4HA 2YEPB 3P1MA 2PQEA 3BVMA 4XT1B 2EE1A 1HQMC 4A3MB 1JQ4A 2K28A 3B2FA 2B2WA 3C1EA 2BW2A 5JPMC 2FMCA 2KVMA 1F0ZA 1ET9A 1DOYA 1TVXA 1BUIC 3OMCA 2X69A 3S2DB 2PW7A 1SE3A 3ABVB 1SYCA 4K14A 2L0CA 3SR1A 3MVVA 1SBBB 2KAJA 1OXXK 2E2DC 1AYFA 4MACA 2L83A 2DN8A 3K5LA 1STBA 5HHDG 1YQ3B 1L0YB 1GHJA 2F0WA 1I4RA 2MP1A 1XEEA 3HUIA 2WXFA 3FILA 4TRDA 5EE1A 2JA5B 1E2ZA 4H7BA 3ND9A 4ZRZA 1D5XC 1DD2A 4A90A 1PGXA 2NB0A 2K5WA 2QJLA 1SFOB 3LB8C 3DHQA 4IUQA 4WORA 2IW3A 2WXRA 2QF7A 1CHQD 3BZDB 1B9RA 2FINB 2WXNA 1SDFA 1PZID 3NS1A 1WYGA 3MJ5A 3AE9B 4HKZE 3C8YA 2BS3B 2PTLA 4XYOA 3PIP3 1FXAA 1C79A 4WIPA 1HFGA 3H6MA 5EKIA 4E6IA 3QOLA 2JA8B 1S5CD 3Q22A 2LUMA 3BDLA 3LX0A 1JCKB 2M00A 1QOAA 2EVBA 4F88A 3I3CA 2QILA 2LJIA 2WS3B 3MTSA 1FGBD 3NWTA 2RDHA 3HOUB 1E10A 4QF4A 1VRAB 4ULLA 3E56A 5DM63 2F0EA 1JWSD 3NZ3A 3TEXA 2BE5C 2EJMA 5C2TB 1VZ7A 1FRRA 3HOZB 4XXEA 1VZ6A 4KTAA 5I4DA 1II3A 3S1RB 1FCCC 2EY2A 1I4GA 1CI3M 1STNA 1BF4A 1L0VB 1ZEQX 4NKLA 5FO8B 3J81L 3GTMB 2OT2A 4H2AA 1Y1WB 5DAUA 1K53A 2JYEA 3C46A 1QOBA 3VQIA 5C4HA 1O78A 4ARCA 1RTOA 1KLUD 3PUWA 4P2CB 3S2HB 1JC7A 2JA7B 3R2TA 2B2WC 2CJNA 4K2KA 1I7HA 5IIFA 1MI0A 3ZGZA 4A3KB 3NUCA 1EY4A 4DAVA 5EBCA 5H92C 2KUMA 4DFAA 4R8NA 1SMYD 5EPKA 3TDQA 4ZK9B 3J7AV 5J39A 1G8ZD 1N61A 2JQRB 4R9WA 1GUNA 2HDLA 4RGOS 3PZ7A 3W9CB 1JICA 2WDQB 3I90A 1IKMA 2WXLA 3PUVA 2IL8A 5BN3A 1W6JA 3GTPB 1N5WA 2KN4A 1Q90A 3FPUB 1K51A 4GDLB 3HVZA 4HEA1 2DYMA 4Q5VA 1STHA 2ICIA 2O2LD 5A2QL 3OPOA 1AZPA 3W2DA 2GI9A 1IBXB 2NVQB 3BYYB 1FM0D 2PYKA 1PGAA 3D6WA 1LTRD 3BVZA 1ZXTA 4IKGA 4EQPA 3SK8A 5T1IA 3NHHA 3AE2B 3MXUA 1FEHA 2JSOA 2A5HA 3HOWB 2HTME 1TU2B 1J7AA 1IGCA 5DNFA 2AWNA 1SYFA 2FHTA 3NTKA 4KJNA 1SE4A 4IFDJ 1NVID 2AX5A 1I3QB 1A2UA 1U4MA 1E7PB 3IAYA 3NP8A 5D7GA 1M8AA 3FEWX 1SF0A 2BDOA 3E0JA 3MHBA 1TY2A 2D5GA 2XRQD 5IGGA 3AMZA 2VZKB 4OL7A 2F0SA 2FBWB 1D6EC 3PV0A 2MJ8A 5COYA 2TMPA 1RCVD 2NN6H 4JWUC 5JAVA 5I2YA 2K33A 1NAPA 4EGVA 1VLBA 1FCLA 4CJ1B 3IAS1 3B2GA 1KDCA 4MM3B 3HOYB 4R3DA 3AEEB 4FO2A 5HURA 4XE0A 4WQMA 4BY1B 1EY8A 1BCPD 4N6EB 1CZPA 3T51B 4C1NK 3C3LA 3VR5A 4RHSA 4PV1C 3GTLB 1MGSA 5KGUA 2KQ3A 5NUCA 2R61A 1SEBD 1QF6A 3A8IE 2J4XA 4KHVA 2B2TA 2E2JB 2N55A 5EGTA 1E6EB 1LTSD 3I4NB 1Y69U 1GUOA 3FRPB 1N62A 3BDOA 3SK5A 4BA2I 3J81E 1CFMA 2D5DA 1BMLC 1FFVA 1YJIA 2KCCA 3ZYYX 4H13C 5G3LF 1GHKA 1D5ZC 1GUWA 4XYQA 2FJ2A 2QMTA 2WP8J 4X3SA 4DNTB 1OXTA 1I4XA 2EPBA 2LMCB 2HDEA 5H8YE 3A7LA 1UUPA 3U4EG 1V97A 4KMUC 3VR6A 4DNRB 1Y8NB 2SNSA 2F0VA 1LTBD 4M0WA 3NVWA 1DZ1A 3DWAA 1XYIA 2F0JA 4J6HA 2H89B 1DYQA 4A9AA 4HRSA 2IPKD 4DN4M 1TKYA 4G4KA 1CQVA 3VYRA 4ZKCB 1MSHA 4PQXA 3P20A 3P63A 2D9UA 5BN5A 3KLSX 2F0KA 4CGYB 4RKBA 5A2QE 1GAQB 1LT6D 1HFNA 1WXQA 1QG7A 2WKCA 3T13A 1S5DD 5GXGB 2A73B 5EQ0A 4MH8A 4M8AA 1G2SA 5EPLA 1ZPSA 3PMFA 4C7YA 1PFBA 2W3RA 3VRAB 2XRSD 4OGQC 4NMZA 3A8KE 2NMQA 4RF0A 1I50B 1YN5A 3I4LA 4WFN3 3DM1A 2F0NA 2RQXA 3FKIB 1HQRD 3MEHA 3SFEB 3NRZA 2JEAI 2HUGA 4C80A 2J42A 4YTNB 2XWBB 1SMYC 3CKIB 1QOFA 5EE0A 1UWXA 1DJRD 3DUZA 1BCPF 2K1BA 4YXDB 3OMGA 2L9HA 2JE6I 4ZUJA 4I7ZC 3NTIA 1K50A 4DQOC 4LMQD 3U9SA 4WURA 3VRBB 2XN9C 1C4QA 2F0UA 3HG9A 4FXCA 2F0GA 3Q8AA 4KKTA 3AEFB 5KNBA 4IOIE 2L1AA 3VR8B 1SJED 2B2TC 4HJGE 3GD7A 4F8MA 4FF4A 2L11A 2WINB 1KNEA 1OXUA 2KCNA 3U9OA 1IUEA 1JOQA 5FO7B 2KMMA 1KDBA 3ZJVA 2L55A 4FF2A 4IUUA 1FD6A 4DAYA 2W82A 1F9SA 2K0PA 1XX8A 2LHEA 3T53B 2MEKA 4IUTA 2IX1A 3NQTA 2H88B 2BE5D 3ZJUA 2LY7A 3DEPA 3P4RB 1SYDA 4MN3A 1U9RA 4ZRQA 1VCIA 3C2PA 4YT0B 3NQIA 4IUVA 3SDZA 4AYBB 4X3KA 5JEAH 4ARIA 3EVQA 1M4VA 1C9FA 5LNK1 2DYOA 3U7ZA 2WXGA 4OIKA 3V2TA 1BCPB 1PTOD 1G2TA 3RUZA 4FP5D 1XLPA 1B3AA 4ZAIA 1JR0D 3TEYA 3JAML 3GTKB 3TP7A 4RNAA 5EE3A 2A69C 2IX3A 1WTWA 4JBWA 1RWSA 3LXFA 1XCQL 2LKVA 2B63B 1QKZA 5MPOA 1AW7A 5LL6X 1PFMA 1UWMA 3NUHB 4K5VA 1SNOA 2V3NA 5CV5A 2I38A 3T3NA 2BOSA 2KA7A 4NP5A 5K36H 5IT9L 2INPE 1JMLA 3LYYA 1FNVA 4OVZA 2EXZA 1MI2A 1VJKA 3AE8B 3P4SB 1L6VA 2B8FA 2JXMB 3L7ZC 2YEPF 1WCMB 1K8OA 1EWHA 4ILWA 2PIAA 2JA6B 1AEXA 4KHZA 5HFYA 1F2YA 5BYQA 4A55A 4N9PA 1LO5D 5KNCA 1SJHD 5C5LA 2N88A 2OEOA 2HDMA 3S17B 1O7YA 2C5CA 1LT4D 2K7VA 3EJIA 2F0MA 3GTQB 4AQ7A 4KKSA 1UAPA 2PNRC 2VB3X 3DWQA 5C0XH 3AMUA 4V0BA 3BK2A 1TKEA 4A3EB 3K59A 4G7OC 4IFDI 3SK4A 5BMGA 3FMCA 4EVOA 1TKGA 3CIRB 4GDKB 1QNUA 3AEGB 5G5GA 1EWCA 1JALA 3TP8A 3SFDB 4ZKBB 1GOZA 2IT1A 2CVRA 2DWQA 1SB3C 1HUMA 2AUJD 2LS01 5JEAJ 1QOHA 2K6AA 1HPCA 3TUOA 4TMAB 4BA1I 1CQFA 3H09A 1OO9B 2EDGA 1UEAB 1MVKA 3H0GB 3A54A 2CJOA 2ZW1A 4H44C 3J7AF 5JVG3 1S5ED 4MIUA 1U4PA 4NAWB 2XWJB 4XTCS 3E9SA 3GB1A 2HCIA 2B2UA 4OZBA 1ONLA 1OXVA 1XF5L 1L4DB 2CU3A 2NTSA 3PO0A 3TZUA 4OO1I 2PVOD 4XDXA 1XWEA 1DONA 3N9YC 2ON8A 1B9NA 2DBYA 3IL8A 3BK1A 4RWSC 3F2UA 2CW0C 1WTXA 2N0SB 4RAUC 1RDPD 1VZ8A 1RF2D 1JOOA 5C0XG 2VB2X 1J7CA 4QIWB 3BG3A 4ODGA 1DOIA 3I70A 3QJYA 1QLBB 3URYA 4A3IB 1X3PA 1Y8PB 2WDRB 2DY8A 4X3TA 5KRUA 3PIO3 2B76B 3KBXA 3EA6A 2ENBA 2RBMA 2KACA 4L1BA 3SVMA 3DWMA 1DXMA 1JOKA 4YSYB 4J8QA 3SEBA 1VDZA 1AN8A 2PO4A 3GQBA 1EEFD 2ACZB 2WXKA 3VR4A 1TS2A 1LT5D 1FNUA 3PO2B 1B2TA 1JQYD 4CKBA 1N60A 3FC4A 5FLXL 1TY0A 5M5YB 4KGSA 3J7YW 3JAME 1QWYA 4N9TA 2CQAA 4L6TB 2QCPX 5D3DA 1C4PA 4B08A 3GTJB 1LTID 5C3EB 1ET6A 3OHXC 3BWUD 2K5PA 3R2IA 4M1UB 3VYSA 3AE5B 1O80A 2NN6I 5IT9E 1NI3A 5E3FA 1IYVA 1XO3A 1WSPA 2JYOA 3IAM1 3KF8A 1PDXA 5CGKA 4C2MB 2IGDA 2K22A 3O13A 3FILB 2EOTA 5IGEA 4KD3A 3GS2A 2ZXOA 2A68D 2DLBA 4TQUS 5HI1A 1PFNA 1MD2D 3V96A 1A6XA 3P75A 3MXGA 3WOFA 2RDGA 3MC0B 3S1NB 4PNYA 1ZYRC 1NUCA 1PTOC 2A6ED 3MP9A 3LNNA 1KABA 3PO3B 5CV4A 3TBIB 2WB1B 3OWFA 1QB5D 2XVSA 3AE4B 4BY7B 3S1MB 2NYZD 4FYDA 4IURA 2B2UC 3IFDA 1PUTA 2G9HD 1OXSC 1EQTA 1GJXA 2I2YA 3P7JA 1EZ6A 1VR9A 5ELBA 4PMWA 2I07B 1F9RA 4XDCA 2BA1A 2PLPA 3DWPA 4NW2A 3MFGA 4XQQA 2RSOA 5D14A 5KIXA 2JSVX 2C9OA 1J8IA 2OHFA 2F0IA 2NVYB 3HOVB 3G7LA 4ZRPA 4FNFA 1EFID 1YN4A 4PMCA 5M5WB 2L12A 4YTMB 5C4ZA 1B53A 1NSNS 2AQ2B 2F1MA 3HS0C 2Q8IB 2EY5A 1Z6HA 2IJ0A 1HHVA 2F0LA 2BT6A 1NENB 2BS2B 3CRKC 3S14B 5IGBA 1ZUD2 2N7JA 2GB1A 1PRTC 2L52A 2I46A 3BIID 3EGRA 4RA8A 3PUYA 1ZXIA 4U673 5CBEE 1LTTD 3A7AB 3QG1A 4KN7C 4WWMA 4HROA 4B0EA 2IGGA 3Q8FA 1STGA 3SK6A 1FNWA 2VXWA 3WCQA 1KH0A 4NDXA 5ISRA 4KJOA 2Y3AA 4A3BB 2MJ3A 1J7BA 3KLRA 1N5XA 5IOCA 3I73A 4XDDA 5CV8A 1K8MA 1XXGA 4BBSB 1DOLA 5BYRA 4C7ZA 4Q2JA 1K83B 3ND8A 3Q24A 2E3TA 4OZCA 1SYGA 4H0LC 4JX1C 4IFDG 1JWMD 2JU6X 3K58A 5J22A 5JOBA 1NR4A 2KHSA 3KLSA 2PMVA 2PZTA 4ABNA 2PVGC 5C3JB 2A69D 1WD0A 1RTNA 5C4XB 1A3UA 2H4OA 4ID6A 2PCFB 2WIIB 3NBHA 4N58A 1D1IA 1Q12A 3IKJA 1A3VA 4HMJA 5M3MB 1TS5A 5T8IA 2KOLA 4JE3B 3HEJA 3FDTA 3CRLC 1QQRA 1YQ4B 1V8QA 1HEZE 2F0OA 5FLXE 4ZHOA 1STYA 1A15A 1H9SA 4FVMA 5JJZA 2NWGA 4RGTA 1ZKOA 3GV6A 1U4RA 2YYZA 4OIJA 2GA4B 1XTCD 1KNAA 5F2DA 1EM7A 1MHHE 2EJGC 4CHTB 2EYOA 2F03A 4C3HB 2BB6A 2BA0A 3RLFA 1V1PA 3DWGC 4A3DB 4KI0A 4YSZB 2F0HA 4GLSC 1SNMA 4A3GB 1SSNA 1TWGB 3AECB 3FVQA 3LWUA 2R93B 5KYLA 3SR6A 2PKOA 1BXTA 3EQLC 2IWHA 3RZDB 2RSNA 1NR2A 4OZAA 1PZKD 1JORA 1SAPA 3B9JA 1SNCA 1JWAD 1HXYD 1PYWD 3IT4B 4A6QA 3HVDA 1X32A 3QOJA 1KRHA 1HCZA 1YMHE 3PZ8A 4ITKA 1ZOYB 3WOEA 1KDAA 4L2YA 2Z4HA 2W55A 3GP7A 3AM9A 3VYUA 3DXJC 3OOCA 4XQJA 3Q69A 1FRDA 4PMBA 4S3SA 1ILPA 2ZW0A 1EY5A 3HKZB 3ERQA 2E2HB 1X3QA 3HRZC 4ZYSA 2HQEA 2JZPA 2PW9A 2WXMA 3SXHA 1WWTA 5BMIA 4RFBA 3IT6B 5C6AA 4KGRA 1RKNA 4JWSC 1V1PB 3I9V1 2A68C 1KLGD 1LLRD 1IHZA 2HCCA 2QSDA 4KKIA 5EJWA 2ZT9C 2PPBC 1WTRA 3EUB2 2CW0D 3NVZA 3DEOA 3X3NA 1YNTE 4DF7A 2V4DA 4Y7NB 1JB3A 2A6EC 3NVYA 1WTOA 4KK7A 2SEBD 2VUMB 2R92B 2EYJA 1I4PA 2M19A 1SNDA 4LJZC 4FF3A 2EYFA 3W3AA 4ZHPA 1C4AA 3R3OA 4G7HC 3HGBA 2RPVA 4C3HG 3J80L 3PUZA 5CV6A 2E76C 1GXDC 3GTOB 5FOBB 2KQ4X 2QKIC 1ROEA 2NTTA 2BBCA 2V3PA 1BR9A 4GZYC 2E2IB 4F7XA 5IODA 1TWFB 3LWEA 4CKCA 2PZUA 1QE6A 4ZOHC 5KEEA 3TEWA 3FPPA 4A3FB 3L3OC 1Q10A 3V05A 4G57A 4KY5A 2KWDA 1VF5C 1EEID 1YN3A 1EIHA 1C4CA 2EYMA 3M7NA 3FAHA 1RD9D 1HZ5A 2NZ1D 4QMGA 4TSSA 2Y0SB 3NSWA 1A70A 2EYHA 3QB3A 1E9MA 2RKSA 3K5MA 2J53A 1AFPA 5C5MA 1B50A 5C3XA 3G6JB 1PDQA 3NBIA 3NK9A 2Z1CA 4US9A 1E2WA 2FMMA 1TWHB 3MXNA 1C78A 1ILQA 2WV6D 1WVLA 4WH4A 1TT2A 5BYSA 1D4BA 4DA2A 2ID0A 2EYPA 1V8CA 5AFWA 3W1SA 1S4ZA 1RM6C 4L23A 1MPEA 1B44D 3MA2B 5I6WA 3P42A 1ZYRD 1SYBA 1TR5A 3QO2A 4LLGM 4MHEA 4WJWA 2WNMA 1DOMA 2E75C 1HUNA 4KX6B 3DMUA 5ELFA 5TSSA 5M5XB 1L5PA 4K6DA 1U4LA 4FXGC 1NYQA 1MSGA 5EPJA 3H8HA 1WTQA 4IDIA 4K5XA 1AWDA 4K5WA 4KN4C 3R93A 2EELA 4B9XA 3MFYA 3D3RA 4K2LA 4BWGB 5EKLA 2AQ3B 2H1EA 2FUG1 4N59A 1F9PA 2SOBA 1P7EA 2MHVA 4P16A 1GB1A 1ZXHA 1Z7TA 2J7ZA 2AUKA 2RA4A 1F2ZA 2K5QA 1LTAD 1PRTD 1G291 3UI2A 2G9DA 3BVGA 3ZQ4A 3I72A 2KDMA 4DAPA 2RVLA 3P4PB 2B2VA 2LFIA 2K03A 2K01A 2WXOA 1Y8OB 5HG2A 1TJEA 2B8GA 5D3IB 2MJEA 5E1FA 1D2BA 2WXQA 3TN2A 1EL0A 1G91A 5CC4A 2DNCA 1ZE3D 4C1NI 1EYAA 3N52A 4CBVA 4HAEA 3V3XA 2RMMA 5DEHA 4C3JB 4DXFA 2Z4IA 2WXIA 5IGCA 5IGFA 5ELEA 3D31A 3RMHA 5LL6S 2NVTB 1F77A 3D4RA 4OW0A 3E5SA 2BYTA 1SIJA 1JW9D 1JROA 3M85A 1TYGB 5HGTA 3J80E 3HP3A 2PW5A 1EZ8A 1HA5A 2F0TA 3HOXB 2R6GA 2IDYA 1I6VC 4HCEA 3I8ZA 3P1HA 2QIEB 2O5JC 2MPMA 1EY7A 2IX0A 1SNQA 3AV8A 4YWGG 1PTOF 1LTGD 3D6CA 4ZLTF 2LGIA 1ZDVA 3AE1B 3S15B 1IW7C 2JP1A 3E6ZX 1CK1A 4LK0M 2MGSA 3CHBD 1QOGA 3NPPA 1LV9A 2K5DA 3ITPA 5CR3A 2LFNA 2INNE 4YSXB 5C44B 2E6XA 1A3TA 1SNPA 3S9WA 3A55A 4TQ0A 4XQNA 1WTPA 4CKEA 1SSOA 1HZ6A 3CU7A 1CM9A 3TMEA 2JYTA 1HA6A 3P4QB 2WU2B 4KKUA 1J9OA 1YNND 3ONAB 5FO9B 2EY1A 4D2KA 5C0XJ 1CHPD 2ICEC 4KV6A 3K6OA 3WDNA 1ESRA 4IUNA 1PRTF 2A74C 1R4PB 5LHY1 4Z9CB 4I65A 3MXPA 4J1MA 2VZKD 5I2XA 3KUPA 5I9OA 1PTOB 5M9OA 3TP6A 4RCOA 1MBYA 1F9QA 2D62A 2B2VC 1KFYB 4QB4A 4KY6A 3D8GA 1QNKA 2JX5A 2A6HC 2K05A 4DXGA 2K9XA 3Q6SA 2NUCA 4C3JG 2IGHA 1EY9A 4FXKC 3T16A 4US8A 5JXVA 1JWUD 1QJOA 1NYRA 2VNUD 1V1OA 2LEKA 1EU3A 1TS4A 1CZWA 2WAQB 1OQQA 5IGDA 1PTOH 5KYIA 5CYUA 4V190 1TS3A 1HTPA 1TIID 3QIAA 1AZQA 3KK7A 2ZXPA 1CTMA 2B39A 1Q1BA 1TWAB 5BMHA 5EKKA 2Q8RE 4HKQA 1EIGA 4RHRA 3AB5A 4ME5A 3CQZB 4DK1A 4UAIA 2O4XA 1IBXA 1PRTB 5K5PA 1Z47A 4HR7B 2V0GA 1D1KA 1QILA 5A35A 1L0XB 5C4JB 2X6GA 2BDNA 4K8IA 1DOXA 1EOTA 1GUTA 4IFDH 1EWYC 3AB9A 1OFFA 1RJTA 5E6JA 3AE7B 3M4YA 2Q8TA 1BO0A 3H91A 1WD1A 5EE9A 2AWOA 1GUGA 5BN4A 1DCZA 1TQOA 2G1EA 3BYTB 4LK1C 1XCTL 2WACA 3EROA 5JVH3 1EYCA 1K52A 4USAA 4HSPA 1L6UA 1RHPA 3KWLA 1GB4A 3Q8CA 1VF7A 3AE3B 3K57A