3SEBA

Staphylococcal enterotoxin b
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
238
structure length
238
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of microbial superantigen staphylococcal enterotoxin B at 1.5 A resolution: implications for superantigen recognition by MHC class II molecules and T-cell receptors.
pubmed doi rcsb
molecule tags Toxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN B
total genus 73
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sebA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3sebA02
1RF2D 2IPKD 2O2LD 3EFXD 1EU3A 1PZID 1V1PB 2R61A 3BVGA 2NTTA 2XNAC 3BVMA 1ET9A 1L0YB 1KLGD 1EEID 3DWPA 4RH6A 1SBBB 1ESFA 1JWSD 1SEBD 1BCPC 1EWCA 1HQRD 2AQ3B 2CHBD 4L6TB 3R2IA 1TS3A 2Z8LA 3BZDB 3CHBD 3R2TA 3EA6A 1TS5A 1B1ZA 5I4DA 1FNWA 1LTAD 1LTBD 1EEFD 1I4HA 3OWEB 1CT1D 1JWUD 1PRTF 1PRTC 2NTSA 1JQYD 2AQ2B 2J4XA 1LT3D 1HA5A 1PZJD 2RDGA 1AW7A 1PTOB 3SEBA 4TSSA 1ENFA 4L63B 1BCPF 1PTOH 2AQ1B 1LTTD 1S5FD 1AN8A 1D6EC 1PTOD 5ELFA 1KTKA 1GOZA 2XRQD 5D3IB 3V05A 1CHQD 3GP7A 1STEA 1DYQA 1FNUA 1XTCD 1JR0D 1TS2A 1PRTB 1SJHD 1I4QA 1DJRD 4RGMA 5D3DA 1YN4A 2XN9C 1SXTA 3URYA 1LT5D 1LTGD 3MFGA 1S5BD 5ELEA 5FKAC 4NZLB 1HXYD 1LTRD 1LTSD 4RFBA 4UDUC 1SJED 3R8BA 1XXGA 1S5CD 1LT4D 1D5XC 3DWAA 3TSSA 1LTID 1PTOF 4RGNA 1LT6D 4RGOS 4RGTA 1EU4A 1JWMD 1PZKD 4C56C 2WV6D 1SE4A 4RHSA 2IJ0A 1D5MC 1RD9D 3KLSX 5TSSA 3W2DA 1I4PA 1B44D 1BCPD 3BYYB 1YN3A 1I4RA 1F77A 3MC0B 1QILA 1RDPD 1CQVA 1TY0A 3BYTB 1TS4A 1I4GA 1G8ZD 1LO5D 1S5DD 1LLRD 1MD2D 1FGBD 1JCKB 1KLUD 2QILA 1S5ED 4Z9CB 1YN5A 4RHRA 2G9HD 2TSSA 1HTLD 1UNSA 1M4VA 4OHJA 4O1NA 4DXGA 1I4XA 1EFID 2ICIA 4BWGB 4DXFA 1BXTA 1FNVA 1PTOC 5ELCA 1L0XB 1RCVD 1PRTD 2RDHA 1CHPD 1V1OA 1FD7D 1CK1A 1ET6A 1UUPA 2QEJC 2SEBD 5ELBA 2XRSD 1V1PA 4RCOA 1SE3A 1T5XD 4ZYSA 3O13A 1TY2A 3BVZA 5ELDA 1PYWD 3DWQA 1SE2A 1BCPB 1D5ZC 4K6LA 5FK9C
chains in the Genus database with same CATH superfamily
5D2MB 3QO2A 2IHEA 4A3EB 4UHVA 1VQ9A 3M95A 4G7ZC 5EKKA 1H9KA 4TKNA 1FM0D 4X64L 3NQTA 3K5NA 3IAM1 2F0EA 4JBKA 3KYDD 1TGZB 1WGDA 1X56A 1SE8A 4BXXH 3GZNB 1PYBA 3AN1A 1NAPA 1C4QA 2K33A 1VF5C 3IAS1 4CKCA 1S3OA 2M19A 2W54A 5AZGA 5L37A 4A3FG 2M0XA 4GIVA 4GDLB 2F4VQ 2IY1B 2N9LA 3W1GA 3KW5B 3KH0A 1K73C 2ZVNA 4DFAA 5BYQA 4PMBA 1E7PB 3DBLI 1K0RA 4XT3B 1PQSA 3MC8A 1WVLA 2C5LC 4HDQA 1LABA 3AMUA 2ASQA 1YHQA 3A74A 2UUAQ 3MJWA 4L63B 2AQ1B 2IGHA 1N9WA 4IUPA 2OXPA 1KH0A 4D2KA 2WS3B 4M0WB 1PLFA 3I73A 4XYQA 2ZJQA 2N0SB 2LGXA 2DNEA 3H09A 4JBWA 3RMKC 3DBSA 5TR5A 5D6JB 4WJNA 1C1YB 1CHQD 4B0MA 3VUWA 2NVXH 5JZEB 2PVOD 1TWHB 1IW7D 3PIOA 2DENB 3X23A 1DOMA 4A3KB 2B63B 1TT5B 3PV0A 1TS2A 4M8AA 4FF3A 1EYCA 2L83A 1F2YA 2K6QA 3EFCA 2L32A 3NRZA 3LWEA 3HOWB 3VH3B 4DR5Q 4L8JA 2F0QA 3RD4A 4KJOA 4NQKE 2F0NA 4QB4A 1CSQA 4MDKE 2CWAA 3CRLC 5DPRA 1I94L 2LMCA 5C4ZA 1KM7A 1RFAA 4MZ9A 3GTLH 4JOIC 1I3QH 1Z47A 2A6HC 2JXMB 1Y1WG 1LTID 2OJRA 4KTAA 2C9WB 4C1NI 2NBFA 1DXMA 4C56C 1VDVA 2PE9A 2PPBC 1KFYB 1NYRA 2EQSA 4K14A 4A3MG 2Y0SB 1JW9D 2IYDB 1BCPD 3I4NH 3FP9A 4GGQA 1DZ1A 3SU8X 3AXCA 4FXGC 2ON8A 3RPFC 4HPLB 1CKNB 3TP8A 3M9BA 5IOIA 1YI2A 2V3SA 5BO4B 5M3MH 2JA5B 2LKVA 2HIVA 3MTNB 2UXBQ 1YNND 4HMIA 4OWWB 3NVVA 2VQEQ 1ZKHA 1SNCA 3E9SA 3TS2A 1JROA 1PH5A 4HSVA 4B9WA 2CWPA 2WB1G 2WAQB 2MH7A 2PEAA 3MHZA 4KSLC 2KDEB 2K9XA 2K50A 3MA2B 1NYQA 5CC4A 4A90A 1Y1VB 1L0XB 2LWPA 4EE2A 3M3JA 4PZ7A 1V1OA 3HS0C 2M0AA 2YLMA 5L83A 2L5TA 5IT9E 4ABNA 1V1PA 2A6EC 3C46A 1NE3A 3S14B 4ZYSA 3DLLA 2RBMA 2DN8A 1KHIA 1IKLA 4LK1C 3H3VI 1XPRA 2CU3A 3OJ4B 2YEPF 1E5WA 1C4PA 4DV7Q 1TWGH 1TKEA 1UWXA 3N1ZC 1D5ZC 3K5LA 4N58A 4IZ8A 2XVSA 4A3FB 1SNMA 1I6HB 1AE2A 2K5HA 4DXAB 1J9OA 1VLBA 1KLGD 3TMPB 2GOWA 5M3FH 1KDCA 4MHEA 5BN4A 3E9IA 2E2IB 3KFUA 4ZUIA 1DOYA 2QDFA 3BZDB 4YTMB 3H94A 2X6GA 1B1ZA 3KUDB 4YWLA 3ZNHB 2L11A 2L0TA 4LNOA 2BYVE 2BF8B 1OXUA 3RN2A 1LTBD 1HRJA 1I4HA 1C4AA 4G0NB 2YYZA 1P7FA 4ZLTF 2G4SA 2DZIA 1ILPA 1NCVA 1MG4A 1ASZA 1A3UA 4FXCA 3M7GA 1K3BC 3AB9A 1GJZA 3QR8A 5D14A 1NENB 3A5ZB 4BY1G 3MJ5A 1VQEA 2AHOB 3TDQA 4F8MA 1BNZA 2Z0DB 3AFPA 1SNDA 4NXMQ 4G50A 2JA8H 1MSGA 5IGGA 4S0RA 4PS8A 1VQJA 3K5OA 2O6VB 4AS1A 2GVBA 1ML0D 3A0JA 2QDBA 1XPUA 4G3XB 5AZFA 1HA6A 1UWVA 3X3NA 1IBXB 1F2ZA 1X9NA 2IO0B 1L6VA 4YWKA 1A3TA 4GDLA 3I91A 1IXRA 1L1OB 4JI4L 2PW9A 1S5BD 1SR3A 4MEMA 1VJKA 4OGQC 4YHHQ 3B9JA 1WGGA 1SJED 5FLXL 1Q3LA 2VY3A 2KQ7A 3S1QH 2Y5CA 4JIOU 1NR2A 1PTOF 3AEDB 1KRTA 1WX7A 4JYAQ 1ZPSA 2J0JA 4WAFA 2FCSA 1PZKD 1CZPA 1HQMC 1ZDVA 4KX6B 4LK0M 1C76A 1VZ7A 2MO1A 4HCEA 5GAHC 4GOPC 5LMNL 4NXNQ 2WXJA 2QF7A 3K7UC 3FAHA 1N5WA 3FILA 3Q3MC 5LLIA 1TY0A 1BQQT 2BE5C 2I38A 4FYDA 1SIJA 2UUCL 4A3GB 3R3MA 4OELB 1H9RA 4UPAA 3JAMc 1FGBD 1U4LA 1JCKB 3T1YL 1RWSA 1CM9A 2REXA 1KLUD 3A7AB 4N9PA 4KSKC 4QMGA 1FFVA 1A8VA 3MZ5A 2NVQB 5IODA 1XWEA 2TSSA 3U2SC 1VQ5A 3T3NA 4W9CA 2LVOA 3A9KA 3WALA 4DXGA 1TZOA 1P8LA 4L23A 4N8X1 3GB1A 4F7ZA 2QMTA 3CC7A 2CFMA 2MJ8A 4A3JG 4BVUC 3FPUB 1MPEA 3SDLC 1HH2P 3NUCA 3RN5A 3OLMD 4FULA 3S1MB 2KECA 4HSPA 3S1NH 5GAGC 3FKIH 3D4DA 2F0FA 4OO1H 1GB1A 1EF1A 2SNMA 3I56A 4M8NA 1TWFH 4IUUA 3AFQA 2BA1A 4YTPB 3DBHI 2WKDA 3TZUA 1HR0W 3IT6B 1U5KA 4BA1I 1YJIA 3SFDB 4OIKA 3AE2B 1R4NB 3B2GA 1CKOA 1BCPB 1P1AA 5FJ8G 2CHZA 3S1QB 4A3LG 3LB8C 2O2LD 2YV5A 1Y8OB 4CDDC 2DBYA 1T9HA 2CKHB 1EEID 3RZDB 2KACA 4G11A 4J8QA 4M00A 1HQRD 1FXTB 1MJCA 2F0OA 4W9KA 3SR1A 1FNWA 3NY5A 4K2LA 5ISRA 3P42A 1QQRA 2EYFA 3GV6A 1HR0Q 3OWEB 4DUZL 1P3QU 1TIFA 3VRAB 1HNZQ 1WYWB 1J8IA 3VR5A 5T1IA 1PGAA 1RLFA 2IZVB 5KHOA 4LF9Q 4C7YA 5C44H 3S15B 5JOBA 3M85A 4DR6L 4P16A 2PW7A 4DDGD 1C3TA 2WXHA 1WM2A 2BOSA 2IHFA 4OONA 4ZQ3A 4NAWB 1EOVA 1S5FD 2RQXA 3ERSX 3OMCA 5D65A 4A3KG 4DR7L 2LGDA 2RKSA 5IWAL 4JV5Q 2KTRA 3C19A 1HZBA 3A9JB 5D3IB 4AWJA 5LXIB 2LRUA 1BF4A 2D2CC 4IQZA 4JI8L 1YJ9A 3HOVB 5JJKA 1WJ6A 1VCIA 3ICEA 3GTKB 1GUAB 1WIAA 4M8MA 4YCVA 3T13A 1V5TA 4XT1B 1N33L 2OCEA 2XK5B 2DUDA 3ZJTA 1F9RA 4CHKA 3P75A 4DR5L 1STHA 1OXTA 4UDUC 4KK7A 5EGTA 4HJAA 2UU9L 2JK8A 2ZNVC 3TP7A 4A3BB 4OZBA 2L00B 4ANWA 4AQYQ 3JAME 4IFDG 4BBRH 4RGOS 1AARA 1JC7A 2QEXA 4M02A 2VZKB 1BOSA 2ZJDA 2L15A 2WV6D 1L0VB 5CV7A 2WQYB 3VR4A 1D5MC 5EQ0A 2FFKB 4P7IA 1UH6A 1O78A 4N8FA 4QGUA 4B3ML 4A3BH 2V1CC 2A1AA 3U52E 1J5EL 2PLPA 2R7FA 3HFZB 1XLQA 2E5LQ 3VA7A 2BB5A 2C7HA 1DOIA 2N88A 1RAXA 3AEGB 3HUIA 1A5RA 5FO7B 1NTGA 5E6NA 3EVQA 4XDDA 2EYJA 4KGTA 2C9OA 4JL9A 4KIKB 1QF6A 3A33B 4KD3A 3CQZB 4HR7B 3M3YB 3JYUA 1WXSA 1HTQA 2INDC 1QB5D 3S1RH 3AE9B 3APFA 1IP9A 1OXXK 4O1NA 4C2MH 1IBLQ 3C3LA 1T6BX 1DOXA 3CCEA 1HFGA 1R4QB 1VCBA 2L8JA 4P75A 4RA8A 4C3JG 3PT2B 4BBRG 3BU2A 5IGFA 1HTOA 1F2RI 2EIFA 1PRTD 3KF8A 2LGIA 2MP2A 2ZW1A 2WXRA 2JVCA 2CHXA 2JJQA 2LUMA 2NWGA 2RDFA 4PZ6A 3S9WA 3CF6E 4C7ZA 4RCOA 1TWHH 1UEBA 3Q6SA 5ELOA 2K5PA 4ZRPA 5JEAJ 4J3OD 4A3PA 1TY2A 3BVZA 3HKZE 1VQKA 1OQQA 3Q8FA 4C3IG 2EELA 1LXDA 1ZP0B 4HJGE 2F0SA 4URKA 2O5IC 3HP3A 3ZRCA 3FHWA 2DNFA 5MPOA 1KAAA 2B29A 1IGCA 1C79A 1EU3A 2UU7A 3FVQA 1FGUA 1PZID 3W1BA 3HOYB 1FEHA 3HOZG 4X3UA 3KUCB 4QCLA 2DNCA 1SBBB 1JWSD 4N9F4 2E2HH 1SEBD 3A54A 4A75A 2N78A 1X3FA 3OW7A 2N4FA 3PTFC 3R2IA 2KCNA 2Z8LA 2I5MX 3QIAA 1VQLA 2JZZA 1TS5A 1PA6A 1VRAB 3FEWX 5M9OA 3AYHB 1IL8A 1EUJA 4MH8A 2NBUA 5IO9A 1XX8A 3I55A 3I72A 4HIDA 3NBHA 2CH4W 3DHHC 2PZUA 2JA6H 3TUOA 3AECB 1G91A 1HE8A 2W82A 4XWTA 3NQIA 1GC6A 3VRBB 2CKZB 2Q5WD 3HOYH 1AW7A 3C1FA 5HG2A 3NVZA 3FKIB 1RKNA 1K8MA 4J15A 2BYTA 1ENFA 2HTHA 1Q1EA 3TEHB 3CAMA 1L1OA 1A2TA 3DWGC 4GU2A 4UP8A 2UWQA 4IUVA 5KNBA 1E7UA 2D0OA 5BR8Q 3K9PB 5FOBB 4I6NB 1L4ZB 1MI0A 5T8IA 3RUZA 1YEZA 1DYQA 1M8AA 4TVAB 3VR8B 4JQWC 3OMGA 2JX5A 1JR0D 1K3RA 2LSSA 5G5HA 2GLSA 3BS1A 2XN9C 4LF7Q 2Q8RE 2F0KA 1HZ9A 2Z6KA 5FKAC 3SXHA 1C9OA 4DV4Q 3AE7B 3RYTA 2CR5A 4DR4Q 3S17B 1ESRA 2EKEC 1IGDA 2RSOA 1NUCA 4A4IA 4NW2A 4B08A 1FFUA 2KVRA 3HVDA 3VXWA 3HOZB 2BTEA 2B2WA 4JWSC 1CJEA 3CU7A 2BT6A 2F4VL 1QJOA 1JJ2A 3M4OB 3ZTCA 1E22A 2Y5PA 2BA0A 3V6CB 2O4XA 2VZKD 3DDCB 1E2ZA 5EPKA 2VL6A 3M4YA 3CCMA 5BMGA 1RTNA 4B9KA 1N63A 2K75A 2LI5A 1N34Q 2Q8TA 5EBCA 1ZOYB 4CGYB 2MBOA 3H7SA 1IYJB 1MSHA 1W6KA 2Q8IB 2KQ3A 1E2WA 1TQOA 4ILWA 1FXIA 1E8WA 2ZTCA 3VYUA 2FAZA 3J81j 3DHGC 3LYYA 4K3CA 3K80C 3PF4A 1E9MA 4FBJB 4HPMB 4II3B 1FJGL 2JA8B 1XTDA 1L7YA 2JZPA 2QEJC 2JQRB 4A3EG 3A4SC 3MHSD 1LM0A 2KCMA 3EBEA 3CKIB 4CJ1B 4A3OA 4LNQA 1U4RA 2VQEL 4BY7B 2V3NA 1UBQA 3CCJA 1ONLA 2BQQA 1H9SA 4KLKA 1SNPA 2LHEA 3C0RB 1D7QA 2EOTA 3WOFA 1YNJD 2N7EA 1X54A 3ULJA 4OO1I 3V3XA 3SK6A 4CKEA 3KLRA 4DV1L 5C1ZA 1E0BA 3EFXD 3OJ3A 2LXJA 5CR3A 1LV9A 5LMNW 2E2IH 1Q46A 2HHHQ 4XE0A 2OEOA 1IBLL 2Q2HA 4JI3L 3VR2A 1E7ZA 5DM73 1JE5A 2KXJA 1YJWA 1TR5A 1WXMA 2KJ6A 1SYDA 1QNKA 2RHSB 4CDCC 5M5XB 4A3CG 3T1HQ 2B63H 2KK8A 3H1UA 3QQ8B 4OVVA 3JC66 1NY4A 2HDMA 3G6JB 2JRHA 2MO0A 1YIJA 1X55A 2VNUD 5C6AA 3RUIB 3JSVA 4MGKE 2JY6A 2L12A 2J4XA 1LYLA 2Q2TA 4JI3Q 5IWAQ 5LXHA 3ULPA 4GN5A 3MAQA 1PTOB 1PH4A 2OEDA 3DXJC 3I4OA 2OJWA 4HXDA 1A3VA 3S1NB 1FRDA 4BZAA 1ILQA 4DUYQ 2B76B 3N3KB 4WIPA 2L52A 3ZJVA 4E71A 4A3DG 2LZ6A 1MHWC 1O7ZA 2ZW0A 2PI2A 4HK2A 3ML9A 1YVCA 4P6VF 1TWCH 1D6EC 1CA6A 2NN6G 4IOAA 1TKYA 4EQNA 1KTKA 1C7YA 1OQRA 3HM6X 3PS6A 3W1SC 4DHZE 3QAQA 1STEA 2IO3B 4APVA 1N8RC 1XTCD 3GTLB 5C3EB 4IM2A 2XTIA 4P72A 1DJRD 3EGRA 1BMLC 2I07B 4EGVA 1N61A 1HEZE 3DPDA 3S16B 4K1RB 2E2HB 3GE3C 3E0EA 4KV6A 2LEKA 2JF5A 1PFSA 4DR1L 2RCNA 2CW0C 4GKKQ 4NZLB 2K5VA 1EZ8A 2K1BA 2L1BA 1FL0A 1VQAA 1TKWB 2G3QB 4GLVB 1UGJA 4GB9A 1B3QA 3KK7A 5IP9H 4A3KH 2BGFA 3AI5A 4E3CA 1WCMB 2DY8A 1RODA 3DWAA 1EOTA 4JI5Q 1E8YA 4A8XC 2BE5D 3T53B 3W9CB 1JWMD 1EY6A 1UE5A 2KT7A 4IKGA 3KBXA 1XMQL 2QIEB 2K6AA 3NENA 1VDZA 1HZCA 2L76A 4LF6L 3M7NA 1SNQA 4ZK9B 2RHQB 1OFFA 3N30A 4IWPA 4DBGA 1XYIA 2QGQA 4C3HB 1JRPA 3GTOH 3DCGA 1QUQA 2YTYA 3F1ZA 1XPOA 4LF4Q 1E8ZA 2LVPA 1A2UA 1DGSA 4JPBW 3CCLA 3M4QA 3JVZX 2XSCA 5EE0A 2EJGC 2KQ4X 2QHOA 5BMHA 5BN5A 4Z9CB 3HVZA 4IUMB 4ICVA 3MFYA 1N36Q 3FILB 4N9TA 4GDKA 4OHJA 2C60A 2PMZB 4UAIA 5JJIA 4I6LB 1VQ8A 5M5YB 5IYCG 3WDNA 2HJ1A 3ZKJC 3ND8A 2IBIB 4BKTA 4AP4C 3I8ZA 1CK1A 5IT9L 3ZJYC 1ICWA 3D6WA 3W3AA 1HHVA 3Q2AC 2EY2A 2G9DA 4DR3L 5L95C 3N1YC 4S17A 2GBKA 2KO3A 2C35B 2KYWA 4PYZA 3NK9A 1K9MC 1BKBA 5ELNA 2JPHA 3NS1A 3VH4B 4LWCA 1UE6A 2NZ1D 4HIOA 1KC8C 1VQ7A 4BKSD 3PIP3 2JA7B 3GTJH 2K25A 3W5VB 1EY9A 2MA9B 5CHVC 2AX5A 3KLSA 4H2AA 5D7GA 4KY5A 3U8ZA 3ZGZA 3BY4B 3HEJA 2R61A 1N34L 4X57B 4DR3Q 4N6EB 3DWPA 1KJTA 2BVCA 1HUNA 4H44C 2VQFQ 2BKFA 3IVFA 1BBXC 4BY1B 2ZM6L 1BBUA 3VFKA 4GLXA 3EA6A 5GADC 1Y1WH 1EQVA 2EYHA 1WSPA 2F0DA 4DA2A 2A19A 5G2NA 2VUMG 2BS2B 2BS4B 4QJFA 2EJMA 2A8VA 1B2TA 4I7AA 3U58A 4G7OC 2MSED 3OAWA 4NJ6A 4DR4L 1Q1OA 3T3OA 2RSUA 4OL7A 4WRDA 1VMPA 4EEWA 4HCNB 1WJJA 2MUYA 2Z6BA 3NTKA 2E3TA 2ACZB 3ZQ4A 4YCWA 2MBQA 1UAPA 1HZ5A 1XQQA 3KJOA 2IY5B 1XO3A 4FDBA 3QHTA 2PPHA 4K8JA 3PRMB 1UE1A 4KHVA 1SSOA 2K5NA 2JXXA 1WTHA 1K83H 2HCCA 3T16A 1PTOD 3NVYA 2BKRB 3CXCA 4ZRIA 3AE3B 4I7ZC 3AEFB 4WQOB 3GP7A 3QOJA 2L9HA 2LS01 3S1RB 1XF5L 1YQBA 3R7RA 1F9SA 3D3RA 3KYHC 1I4QA 3T56B 1SMYD 3U50C 2K8CA 1ZXTA 2PQAB 4RWSC 1LFDA 4XYCA 1GKHA 5M3MB 1QZHA 4L5RC 1LTRD 1MHXA 3KF6B 4N59A 2DX5B 4E6IA 1KNEA 1XXGA 2WAQG 2NZHA 3OIQA 3PCOB 4JG2A 3T51B 3T1HL 1XJVA 2D5GA 1LM8B 4DU9A 3HOVH 2KOLA 1BUVT 4RGNA 3Q0AA 4IM3A 4H0LC 4CJ2C 4W9IA 1EU4A 4EQPA 1HZAA 4WJWA 1AE3A 5C3XA 2EZVA 2MW5A 4PV1C 2ASBA 1CZWA 1GUGA 4XWWA 1I6VC 4DNRB 3RR5A 3L0WB 4W9DA 3J7YW 5HY6A 4DNIA 3PF5A 1QZGA 3TZDA 5IKCM 1VQBA 1U4MA 3I2ZA 1V9PA 1MBYA 1B3AA 4BA2I 3F2UA 1LLRD 3N9YC 4RMAA 3VDYA 2HUGA 1K8RB 3J80c 4CO7A 2WFWA 2K1FA 3GZNI 3IRBA 3T1YQ 3H0GH 3J7AF 2G4DB 3VUXA 2M56B 4IUQA 1EIYB 3DBHB 3WOEA 2PNRC 3VR6A 2NVXB 1FO4A 3DVGX 3NHHA 3VR3A 3A1QB 1ISNA 3ECIA 3E6ZX 3AEEB 3SK4A 2O2VB 2CH4A 2I2YA 4K5VA 5ELCA 4CDFC 3C1EA 2J53A 2PE6B 3VTVA 1CHPD 4EQOA 3PZ7A 1WTOA 3IFTA 3KWVA 3PO3H 4TRDA 2A68D 1IYFA 1A63A 2FXQA 1QZEA 2EYPA 1RJTA 4MSMB 4L2YA 4XIGS 1SMXA 2CW0D 1ZYRD 3UDIA 1GM5A 1CKMA 1YJJA 2D3CA 3H7PB 4JE3B 4P1BC 1XMQQ 4O0AA 3IT4B 1SE2A 3EROA 2MBBB 2NVYB 3EQLC 2ZEQA 3L16A 3QJZA 3GO5A 4O2DA 4JI7Q 3RFZB 2DY7A 4HN7A 4J6HA 1WTXA 3L0OA 2N7DA 3HRZC 1WYGA 5AUKA 4DK5A 2XNAC 4IALA 1YIWA 2C7NB 3ZNZB 1NMGA 3CP0A 3EECA 1WGHA 2B2UC 1IZ6A 1TXYA 4A3EH 4KD4A 1R9TH 4HKZE 5E6JA 4A76A 4B3MQ 3NOBA 5HURA 1DM0B 2J0TD 1STGA 4NKLA 1U4PA 5M5XH 3M62B 2JA9A 2JEAI 1VQMA 4QQBX 4NJ7A 1V80A 1I5FA 5CV4A 5A2QE 3PIO3 3AE1B 4IPCA 2B2YC 2NR2A 1S3SG 3R66C 4DV0L 1F9QA 3IG3A 1HA5A 2K7VA 1Q0WB 2GN5A 2F03A 1WF9A 1IBXA 1FPYA 2K52A 3NWSA 2UU9Q 3NHEB 3I4MB 2YTXA 2GI9A 4BFRA 5IP7G 2HQEA 4DUYL 3CSTA 2FHTA 5E1FA 4YSZB 4OWXB 2I0QA 4C3JB 1PHJA 3HM3A 2NVUI 4FJYA 4DV2L 2RF4A 4BY7H 5IT9c 1SN8A 2EY6A 1JE4A 4JI4Q 3APDA 2D0PA 3M63B 2D62A 1QOGA 5HGQA 3A56A 2SOBA 4QIWE 1UELA 1PRTB 1L1OC 1PYSB 3Q23A 2C7MB 5I9PA 2NBWB 2ZVOA 3I4MG 1FCCC 3URYA 3IKJA 4R8NA 3P20A 2AL3A 4LJOB 4A3GH 3K0YA 3UDXA 2IY0B 1LTSD 2VB2X 3HOUG 3KLWA 1B70B 3Q3NC 1KNAA 2BH2A 4TUUA 2IDYA 4DAVA 2ZCCA 4LUOA 2D07B 2JN4A 3HOXH 4ID6A 1Q8KA 2B2TC 1PV4A 1HR0L 1VQNA 3DBRB 4XZ4A 4MTKA 4MIUA 1ZGUB 2WX0A 1C8CA 1PDXA 1AEXA 1A15A 2A68C 2Z4IA 2DJGC 4S3SA 1STNA 2I46A 2IX1A 4FF1A 2XWBB 2YU9B 1WZ3A 5HI1A 2A73B 3GTQH 3BK1A 3EUB2 4JCVE 3N1XC 1VMCA 3JW0X 4PQXA 3S2DB 3VAWA 4GN4B 5AFWA 4KDLB 1AP0A 2RMMA 1ZUD2 3HIZA 1HCZA 4EZJA 3IFDA 1GHKA 3MEFA 4EZLA 2N3SA 3HOZH 5C3EH 5GMVA 3PHXB 2MJ3A 3MC9A 4II2B 2D9UA 1TZ1A 4ARCA 1M1KC 4ODGA 3K8AA 4XQJA 4X64Q 3QARA 2R93B 4DHZB 1F2RC 1WTQA 5M3FB 3VYSA 4ZRJA 1BXTA 3QB3A 3S2DH 2KVMA 5C4XG 4A3IH 2R2QA 2WB1B 2RDHA 2WHIA 4L5QA 3IAYA 2OTJA 4JBJA 4HWIB 2WKCA 4RMFA 2PW5A 4A3JB 3HK0A 3AEBB 4PG3A 2RR9A 1L6UA 4HCPB 2LGSA 1JOKA 1H8CA 3OTOL 3SK8A 2E6XA 5E6OA 2UUBQ 4FJVB 1F9PA 5M3FG 3NWTA 1WGRA 2K5QA 1LGRA 1CMXB 2AUJD 4B3SQ 4XDCA 3B08A 4DR1Q 1V6EA 2QCZA 4C1NK 1ZE3D 2BCOA 3V62A 1VQGA 2EVBA 4B3TL 1N5XA 1V1PB 3R93A 3BVGA 3DQVA 1FRRA 2DGYA 3HZXA 3EFUA 4IC7B 3I3TB 4USAA 1ET9A 2VZAA 4ZDVA 3ERQA 1J7AA 2KCCA 2B2YA 3HOWH 4DPGA 3N6RA 1C48A 1SYBA 4J1MA 5CGKA 3Q69A 4NAWA 1K28A 4X65L 5FR3A 1R9TB 1JWUD 2MBEA 4JYAL 1PRTC 3A9JA 1UEAB 2V3PA 2GMIC 3ZW3A 3Q24A 2VXWA 2KENA 1JWAD 1A0IA 1O7LA 3P7JA 1YJ1A 4YY3Q 3GTMB 4AH6A 1WWTA 2FNJB 4IJLA 4FF2A 4TSSA 3QIJA 2JA7G 4YT0B 1EY0A 3KDFB 4BOSC 3E3XA 2RPQA 1TIID 3TJPA 3UINB 3VYRA 4JK1C 2IO1B 4DR7Q 3RNAC 3V05A 4LFCQ 1QWYA 1QT9A 1N6ZA 2Q2IA 1RRBA 3ZXVA 3ZJUA 2NVQH 4XQNA 3U4ZA 4ZAIA 1A6XA 1HNWL 1CKNA 3P1HA 3D4WA 1JOOA 4QUFA 2Y3AA 1KRHA 3RLNA 4WQMA 4ASWC 3AEVA 2KDBA 2M2LA 5JPMC 2ZJPA 5E4XA 4JI2L 1C78A 5IGCA 3WANA 5FR6A 3UIPB 1Q82C 4BXXG 5EAYA 1KIXA 3U7ZA 4IUNA 4C80A 2VW9A 1EF5A 3L17A 4W9EA 3CQZH 3M3YH 3I4NB 2B8GA 1E2VA 1LT6D 2OF1A 5GXGB 2G1EA 1AH9A 4AYBE 3AULA 5EJWA 3L9AX 1WTWA 1LACA 3PUVA 2VQFL 1Z2MA 5IP9G 5EE1A 1E90A 2NVTH 1CTMA 3NP8A 3RNBC 1CFMA 5JJLA 2EYLA 3C8YA 1CQVA 4GNXC 2KFKB 1GHJA 4FADA 3A1QA 2A69D 3FC4A 1TKGA 5I6YA 2BWFA 2K8BA 2Y0SE 1SLJA 2EE1A 1Y14B 1D1KA 4DV7L 3J81L 1TJEA 3TP5A 5FLMG 1SMYC 2ZTEA 3STBD 3U30A 2JWUA 3CPWA 4GLAC 2JU6X 1H9JA 4KKUA 2HQLA 4KI0A 4IO9A 2R92B 1BO0A 3A5UA 2CVRA 3ULLA 2JA6G 1I4XA 5LMUQ 4BWGB 2ZJRA 2PYKA 1VQPA 1WRIA 4JI0L 2ONQA 3AQQA 3DOWA 3Q8CA 3TEYA 2CJNA 3A8JE 4RF1A 1KLVA 2CQAA 1PTOC 2WXIA 1MJDA 1XT9B 3LJ3A 2CJOA 3ZTDA 4BBNF 2JWZA 2AWNA 5ELBA 3RD2A 3WCQA 2JYTA 4BAXA 4FNFA 3ABVB 2RDBC 2F0LA 4UY8C 1IYUA 2X6LA 3I63C 2KDFB 3PLVA 5IIFA 4TQ1A 3PZ8A 4JI0Q 1K83B 4JI6L 1UBIA 3DWQA 1L0WA 1XNRQ 2LRWA 3NUHB 4YSXB 4HCSA 4EQ5A 3MHBA 2PI2E 5FK9C 2XWJB 3AE5B 4KV2A 3ML8A 4C3IB 1BDOA 3J81E 2ICEC 4ZRKA 3CIRB 2FIFA 3UE1A 5IP7H 1EIHA 3TEWA 1S4ZA 2PQEA 3BINA 1Y8NB 5M5WB 2F0IA 1OGWA 4DGZA 4HIMA 3GTPH 1STAA 3TQYA 1ACCA 4NAMA 4K0KQ 1J8CA 3TRZA 2BS3B 3ZNID 2KJXA 1J6QA 2INCC 2A6ED 3ZYYX 3W1YA 1STYA 4K7WA 3QCAA 4P73A 2PMZE 4IPDA 4R4TA 4WWNA 1I6HH 4LJPB 3R7QA 1MKHA 1SYGA 3CW2C 3OPOA 1XMOQ 3S15H 5FLXE 1WGYA 4K7UA 4WURA 1CUKA 3BDCA 4HPPA 1VS0A 1XNQQ 3MTSA 1Y1VG 1CA5A 1QKZA 5J3BA 1N32Q 2DYBA 2WU5B 4KGRA 3FPPA 3N52A 5JVH3 3I5JC 4R4IA 5CV9A 1T0SC 4JPSA 3VQIA 3B0AA 3K7AB 1K8AC 1H95A 1YNNC 3DBRI 4X3KA 2XEWA 3J81c 3PVLA 1UZXB 4W9LA 1FD6A 4RGMA 3GV3A 4ARIA 2K28A 4TQUS 1SXTA 4E74A 2EPBA 4RG1A 1CI3M 5I2YA 5IYDH 1Q7YC 4C4VB 2M4NA 4DHJD 3P4QB 1Q8IA 1RYJA 5HKHA 4JW0A 1Q81C 4DF7A 4B3RL 4BBSG 1X65A 5IY0A 4YHHL 1T0QC 3RT3B 2R7DA 2JSVX 2MFIA 1LT4D 2ZM6Q 3OTOQ 3GTJB 2B63G 3NZSA 4I65A 1M90C 1MIUA 4K0KL 1JOQA 3UF8A 3HOUB 5BN3A 4ULLA 1A62A 1KAWA 3GDEA 4MGZE 5DLQE 4WWMA 2LASA 4C00A 1KRSA 4W9JA 4PK1A 4AQ7A 2F0MA 1JB7A 2YU9H 2M00A 5AJ3Q 4FHJA 2DHZA 3BYTB 3T9LA 1L2FA 2MJEA 5KRUA 1E8XA 1O7IA 2QKIC 1S5DD 2ZPNA 3F2BA 2CQOA 2QJLA 4P71A 4DK3C 5JJZA 5HFYA 1S5ED 3J80E 1PH6A 4B3TQ 5A35A 1YN5A 4JX1C 1WCMH 4K8IA 2LFNA 4KHZA 1N62A 2HD5B 1EZ6A 2KBNA 1GD7A 2DWQA 1PH8A 3OW2A 3VDZA 4UP9A 3S16H 4WWPA 3NSWA 1RTOA 2PCFB 2AL6A 3H0GG 2V4LA 3A55A 4NDXA 1EM7A 4R1JA 3OIPA 3Q22A 2J42A 3EHVA 3D0FA 4KIKA 2NVYH 2D11A 1QVFA 1GUTA 4HEA1 2PO4A 3OSOA 1Q90A 3O13A 4DV3Q 4LFAQ 5ELDA 1BT0A 2WXLA 2F0PA 2WWZA 2ZCBA 1JMCA 1II3A 2JQOA 1QG7A 2OTLA 4BY7G 1MGSA 3DMUA 4ZRZA 5JHBA 1W3SA 2NTTA 2PZTA 1EFWA 2R7ZH 5EBDA 1T3QA 3LWUA 1L4DB 5F2DA 2LJ5A 1YHAA 1IL2A 2H89B 3AU4A 3KF8B 2MP2B 2L4NA 3X3MA 1Y69U 2CHBD 2BYEA 1OEYJ 4WJ4A 3MXNA 2MGSA 3VTUA 5I4DA 2EJFC 3K7AH 2K03A 3PRZA 1MI2A 3VA5A 1YJNA 2A5HA 1EYDA 1WXAA 2BYFA 3I9V1 1NJIC 1IKMA 3QWZB 5IGEA 4Y7NB 4A93H 1E0ZA 2AQ2B 4EKUA 2SAKA 1DOKA 4AQYL 2A4ZA 4DV5L 4FA6A 3A7LA 1ASYA 4OWTB 5KGUA 4V190 2M17A 4DUZQ 3PHWB 1BCPF 1PTOH 5C4HA 1NNXA 3S2HH 1L5PA 4WJQA 2QCPX 4K5WA 1XLNA 1TYGB 2KFJA 1GUOA 1HNWQ 5ELFA 5J39A 1PH9A 3RI7C 4P1CC 2C5CA 2ZPYA 1SAPA 1FNUA 3KOJA 4ME3A 4JI1L 4OEMB 3CCQA 5DAUA 1SJHD 3HKZB 4A3LH 4KN7C 1GC7A 4HRSA 4JI7L 3DM3A 4A3IB 4LNFA 5C23A 1C77A 3OWFA 3E0JA 5FO8B 3CD6A 1K0SA 1CQFA 4K3BA 1EUVB 4C2MB 1BR9A 4DAYA 2KFKA 3CC2A 1YX5B 2SDFA 3QWNA 3NJTA 2ID0A 3PMFA 4XXEA 1ZXHA 1SSNA 4U68A 2FMMA 1UE7A 5KNCA 1Y8RC 1ZDXA 3HOUH 1C4CA 2DZMA 2L1AA 4PMWA 1MHHE 2WXFA 2WXGA 2EXZA 3GTQB 1EWIA 1PH7A 1X3GA 1F77A 4GDKB 1QILA 1HFNA 3K5MA 4BS9A 5CX3A 4YSYB 3TL5A 4OIJA 1I4GA 2B3GA 3QA8A 1XMOL 4JI6Q 2NUCA 2IX3A 3SFEB 3NTHA 1MD2D 5C0XJ 4TKOB 3PZDA 4KJNA 1YBYA 3AE8B 3ZXRA 2LXKA 3IFWB 2QILA 4OVZA 4U673 2DAJA 2KHSA 1AWDA 1PUTA 2G9HD 2FE8A 3A8IE 4NPSA 1HTLD 2IGGA 2WU2B 3ZDTA 1SE9A 3UQAA 1F52A 1N36L 4OZAA 1GB4A 3BG3A 3ZRFA 1UGMA 1U4AA 1FJGQ 4AJWA 1PFBA 1WXVA 1H9MA 3L13A 2NZOA 5K36H 3NEMA 3DVNU 2VB3X 3PO0A 1Y56A 2V4IB 3NZ3A 3OYYA 3BIID 4XTCS 3J9CA 1NBWA 1VQOA 2VUMB 4HROA 1SGHA 2BB6A 1U9RA 1NI2A 5IGDA 2KDMA 2E76C 5COYA 5EPJA 3TEXA 3L2PA 4MT5A 2JA8G 2KWUB 3GE8C 3KBGA 2PZWA 2OOBB 4LF6Q 2KWVB 1XEEA 1Y8PB 4DR2Q 2A5UA 4LNIA 4FLHA 2L7RA 5DEHA 1XNRL 4K7SA 1J7BA 1EO6A 2J52A 4ALPA 3WAPA 1SROA 3M4PA 4LF8L 4HVBA 3AV8A 4GS3A 3DEOA 1IW7C 2K05A 2JXTA 2KNBA 5LHY1 4V0BA 1L0YB 2BH8A 4K6DA 2X38A 2FIDA 4M0WA 2JRIB 2MQHA 2R3ZA 3NG0A 2JA6B 1BCPC 1WI5A 5CHWA 1EWCA 1H9SB 2R92H 1G2TA 1TS3A 4GOPA 3T8MA 1YQ3B 4DK0A 1G291 4IFDH 1NMFA 1JORA 3B6YA 1WR1A 4BY1H 1AZQA 3RNCC 5J2RA 3NXWA 2MWSB 4ACFA 1PRTF 2A6HD 4BBSB 1B9RA 5G55A 1EYAA 1X3EA 1PZJD 2NMQA 1TBEA 2A74C 3DBLB 2N55A 4F87A 4H02A 2JEBI 1R4PB 2WAQE 3Q8EA 4RF0A 2V9HA 4W9HA 3RLFA 5J17A 3P2BA 3J80L 1WD0A 1EQTA 1LTTD 4US9A 2PIAA 3BWUD 1B8AA 3KF6A 2K32A 2VS1A 1WFYA 1JRUA 3PPAA 1GOZA 2XRQD 2FJ2A 1WE6A 4JC0A 4B6WA 1GAQB 3B1LX 1QLBB 2E2JB 3CF5A 3G7LA 2AUKA 2FCNA 1UWMA 1WD1A 2GA4B 2KWCA 4F8CB 1L2NA 1KXLA 1LTLA 4KKSA 1R4MB 4YCUA 3AU7A 4LAAA 4JV5L 3S24A 3TS0A 5CV5A 3CCRA 2FUG1 5CORA 2N1VA 3MFGA 3OHXC 4TQ0A 3RZOH 3SD5A 5C3EG 4LTUA 4KKIA 2R6GA 1JWBD 3CRKC 5FO9B 4L5SA 5M5YH 2W55A 2L0FA 2CU1A 2NB0A 4OO1G 2D3GA 1B53A 3E56A 4DV1Q 4LF7L 3RNUA 1WRDB 4RGTA 1I35A 2D3BA 3PUXA 1E24A 3H91A 3LX0A 1MVKA 3SHLA 2IJ0A 1Z9FA 3S2HB 4RKBA 2TMPA 3Q14C 3RULA 1QOBA 2YVCA 2KHIA 3MC0B 4IUTA 4EVOA 4DNTB 1F1HA 1KDBA 1G8ZD 2L55A 2KVZA 1YQ4B 3PV1A 3N20C 1LO5D 3MEHA 3ND9A 4BBSH 2ALYB 1P0RA 2N49A 1YZ6A 3NELA 4XDXA 5CV6A 4QAYA 3K81C 2PNHA 2Z0EB 2G45B 3PLUA 3CMMB 1JALA 4IG7B 2IX0A 3L10B 4JLCA 4KN4C 5C0XH 1B4OA 2QDLA 2ICIA 4KKTA 5IGBA 2OT2A 5EKLA 1JB3A 2QSDA 4LUZA 3NTIA 5A2QL 5E6PA 4MACA 4R8IA 4LW1A 2KN4A 2VRRB 1ET6A 2K22A 3J7AV 1G51A 1X32A 1GUSA 4DK1A 3W5UB 3P1MA 1NI3A 4JI5L 1YNXA 3V96A 1A70A 2EY1A 2A69C 1TWCB 3NVWA 1R4MI 1STBA 4AUQC 1PYWD 3HRDD 2KEDA 3WIMA 3APCA 4GKKL 2P5ZX 4BBRB 2J7ZA 2I1JA 4A93G 4K6LA 1IPGA 1NVID 4YWGG 1RF2D 1V8QA 1IYVA 4A3BG 4AOFA 5E3FA 2F0UA 2DYOA 4CHTB 4ZUJA 4OX9Q 1HNXQ 4RM8A 1WR6E 2ZNVB 2BBCA 5DCNA 2H1EA 3NBIA 3UE0A 3P4PB 5J22A 3R2TA 3EJIA 3HKSA 4X6AH 5H92C 2RA4A 3SGIA 2D5DA 2Z6KC 2GBRA 3CPFA 4ITKA 1EEFD 1S72A 2HJ8A 2NTSA 1G6ZA 5C5MA 4LFCL 4OW0A 5IOCA 1V1QA 1WOCA 1LT3D 1KQSA 4BKGA 2KEEA 3S14H 2OQKA 2RDGA 3OOCA 1V2YA 4PNYA 3IBEA 3BK2A 3GD7A 2Z1CA 4JWUC 4R4QA 2MQJA 2GBJA 3GTGB 1TWGB 1LQBA 5HGTA 4IPHA 3B2FA 1AN8A 1KD1C 4FJZA 2MNAA 1YITA 1TWFB 4DAYB 3Q8BA 1HUMA 4X62Q 2DZKA 4MN3A 1SDFA 3Q3FA 3S17H 2ES2A 4YIJA 5DPSA 1LT5D 1WTPA 4NXML 2LJIA 2N9PC 2WXKA 4HMJA 4ZRQA 1SIFA 2V4DA 5EE3A 4KZCA 5JEAG 4GZYC 2V1YA 3R8BA 1WY8A 3AE6B 5KNDA 2F0VA 2K5DA 2EMTA 1WTRA 4FHKA 2F3WA 2RD0A 1WYDA 5IYDG 4GNXA 4K5XA 4GN1A 1N33Q 3KUPA 1ZEQX 1IHZA 4LF5Q 1WJUA 2FUHB 4PS3A 2XIWA 1RIPA 2Z4HA 2KMCA 5KIXA 2JA5H 1GO3E 1RD9D 3KLSX 2DAFA 2NS5A 2ATWA 3J80i 1G6PA 3GTOB 3I4MH 2KMMA 4NY0A 4EOYA 4YY3L 3PUWA 2RSNA 4HJ8A 2I5HA 5LMUL 2XK5A 1IBMQ 2B2TA 3ENEA 2YEPB 2F0WA 3F8TA 4DR2L 2JT4B 4HJ9A 3QX1A 2IT1A 2LD9A 2Z9HA 1JMLA 4YTNB 3DM1A 1QOFA 3AH7A 4P74A 4DR6Q 4LFAL 3ITPA 4FO2A 4DV0Q 4IPGA 1FYCA 1B9NA 4RHRA 2SNSA 2F1MA 1EL0A 3FKIG 1HNZL 2N9XA 3WA0A 4DV3L 1IBML 4OX9L 2KWDA 1EFID 2B2WC 4J6IA 4GN3B 3BZKA 1PGBA 2INPE 2AWTA 5KYLA 4IFDI 3EIVA 1DCZA 1VQ4A 1K8OA 4C3IH 1E3PA 4IFDJ 1ZXIA 3QC8B 1J7CA 4C3HH 2R93G 4LFBL 2JYOA 4B3SL 3KQ4A 1RHPA 5IN7A 2JA7H 4OXPA 1W2BA 4DAPA 4QIWB 3ZVVA 4Q0FA 1RL2A 4IJHA 2MX2A 2PVGC 4GOCA 2D2QA 4O42A 4JOIA 1XCQL 2GBNA 3TBLD 5NUCA 1B50A 4DHJB 3PO2G 4GOPB 5C3JB 3CMEA 3H6NA 1N60A 1C0AA 4A3MH 4LNKA 3WAOA 1JQ4A 3VVWB 4TV3A 2IPKD 2WB1E 3I70A 3PGEA 1FXAA 3Q3JA 3Q6BA 3PGZA 5T1GA 4IDIA 3LNNA 1I7HA 3QOLA 4ZHPA 4Q5VA 2GVAA 2K0PA 3O65B 5AZHA 4EX5A 1G2SA 1KABA 3Q8DA 1WMHA 3PQIA 3CHBD 5EKIA 4DWFA 4UP7A 5G5GA 4ZOHC 4K2KA 1VQHA 3RNGC 5BYSA 3KDFA 5JHAA 1T0YA 1V86A 2B3AA 5JAVA 4M01A 3ETRA 3U4VA 1CT1D 3RCZA 2BW2A 1I94Q 2KQSA 2KC1A 4RM9A 1YOVB 1PFNA 3I4NG 2E8GA 3ZUNA 1M94A 2ZXOA 4POFA 1LUZA 5I2XA 4JI1Q 1KF6B 3PRPB 1CSPA 1OEYA 2EY5A 4BBNC 2GB1A 4MNOA 2WIIB 4BOZB 3TEZA 1DGJA 2KX3A 3TBIB 4DV6L 4LLGM 4FN2A 1F9JA 1I50H 2J0MA 3J81i 3CSFA 3PIPA 2KHWB 4GMVA 2K8HA 4ANXA 2QW7A 2PKOA 2V0GA 1JJCB 1Z5SB 2MHJA 2HCIA 1QOAA 3RN9C 4ANUA 4X62L 1D8LA 3NPPA 3X0WA 2KJRA 2F3VA 2UUAL 4IWOA 2KKCA 2WNMA 1HXYD 3ALBA 3ZO5B 1HPCA 2K4KA 5H8YE 1EY5A 1NDDA 1GVPA 3AM9A 4JBMA 2WXQA 1TU2B 3CC4A 1OQYA 4MM3A 3UDGA 5K36G 4ZKBB 2M9VA 1YNTE 4POGA 2WYQA 1FR3A 4DV2Q 2UXCQ 2KA7A 4PZ8A 3L4PA 1U0LA 5TSSA 1SFOH 2Z59B 3GTGH 2RVLA 3BYYB 3W1SA 2UYZB 4NB3A 1WGKA 3GQBA 3LGJA 5LNK1 3H6MA 2LY7A 4WJ3M 3HOXG 3QJYA 2WINB 4A6QA 2X69A 3DHQA 3FDTA 4NMZA 4PT5A 2D10A 2F3IA 4PS7A 4DDID 4IURA 3RLOA 3W5OA 2K3UA 5C2TB 2WX1A 1I42A 4NJCA 2KLGA 1D4BA 2JZ3B 3PUYA 4FXKC 2WDQB 4YWMA 3U4EG 1I3QB 1Q12A 4CBVA 1E10A 5K5PA 4ZCKA 4X66Q 2E5LL 3LDZE 2EDGA 1T0RC 1SF0A 4R3DA 5FJ8H 2UUBL 2L3ZA 2QC8A 1FNVA 4TMAB 3ZLZA 2RPVA 5CYUA 1ENAA 1RCVD 5D94A 3SVMA 2E74C 2FINB 4HDOA 2SEBD 1GNUA 3GTKH 3RNEC 3TREA 5C4XB 4QL5A 1GJXA 1PH3A 1GUWA 1K53A 1IBKL 1V9JA 1OO9B 2HDLA 2MHVA 2W3SA 2E2DC 3A9KB 4MGYE 5FLMH 3NBHB 2K5WA 2L0CA 2AEHA 2I1KA 4KMUC 3IHPC 3TCAA 1D1IA 3P63A 2EYMA 5M3MG 5EPLA 1R4NI 3WAMA 5AJ3L 1Y1WB 1FVIA 5GQOA 1OXSC 2OHFA 3D31A 2CCZA 4GKJQ 2NN6I 1GXDC 5E4WC 4IOCA 4W9GA 4ZYNA 1Q5WB 4MGIE 1VQ6A 4RCNA 5E7NA 2DYMA 4A93B 4KHPQ 3D32A 2KD0A 1E1TA 3K9OB 2HTME 1C9FA 2VH1A 4A55A 3SR6A 1V43A 4NNJB 5J18A 1J5EQ 2WXMA 4HKQA 1EIGA 3RZFA 1G6JA 2MRPA 3ONSA 2HDEA 1LTAD 4A3GG 5LL6S 4G57A 5AEKB 4HJ7A 1PXUA 2KZRA 4X66L 3ZIMA 3NZUA 3NE5B 1SRUA 2UUCQ 3I90A 3VHTC 1F0ZA 4MTNA 5IYCH 2N1WA 3VTWA 1EY4A 1PMRA 4DV4L 4LF9L 4B95A 4US8A 5IYBH 1YX6B 2UXDL 3C2PA 5LMNQ 3OG5A 5GROA 1NR4A 1JJGA 1YHBA 3M4OH 3DHIC 4DV5Q 3GTMH 4EZKA 3FRPB 3DEPA 4LJZC 1O7YA 4HEDA 1XLOA 4MH0E 3MP9A 3RNFC 1XNQL 2LMCB 3HOYG 4R4CA 1WCMG 4A3DB 2WP9B 4XGAB 3AB5A 3LXFA 2JA5G 2N7JA 3L7ZC 4XC2A 2H5XA 5D3DA 4ANVA 2MCNB 4FP5D 2ZXPA 1WJ4A 4GSWA 4REZA 5ELEA 3GOEA 1BUIC 3SHQA 3I3CA 4RFBA 1R7SA 4EUTA 2KTRB 4B3RQ 2JUOA 3UI2A 4GXBA 1K8GA 2R2OA 4FF4A 3G71A 2PJHA 1Q10A 4PMCA 3E9HA 1ZKOA 3H8HA 2B2VA 3TSSA 5DNFA 2WXOA 4G4KA 1ICFB 2J0KA 1QVCA 3I57A 4CDEC 4KY7A 5DM63 2ZT9C 1BBWA 3W2DA 1B44D 2JP1A 1ZYRC 2XBBC 4QUCA 1AFPA 1CZGA 2WLBA 4F1SA 1J19A 1UD7A 4DV6Q 5CV8A 1SFOB 3RZOB 1EWHA 2KC2A 5JPNC 1TVXA 3P4RB 4X3TA 3SE0A 2NPTB 1P9DU 2AMCB 3MWYW 5G3LD 4B9XA 4DKAC 2Q2UA 4L5TA 1IUEA 3H9DA 2W9NA 1WE7A 3KYCD 4I6PA 4BKSA 3H3VH 5CHFA 5JVG3 1M4VA 3PO2H 3V60A 4DAMA 3QK0A 3ZDMC 5KHQA 4OVUA 4NP5A 2O6VD 4LDTB 3S2AA 4H7BA 4XYOA 3H3VC 4KVGB 1P7EA 5C44G 2J7QB 1OTCA 2F0JA 2WXNA 1YD8U 3MXGA 1Z6HA 1FD7D 2FMCA 2YTVA 3JAML 1KDAA 1UUPA 3F2DA 3CCSA 2KOXA 4ME5A 3DVGY 2IGDA 1SE3A 1QUQB 5CBAE 4HJ5A 2WDRB 4MELA 1J0GA 2KAJA 1H4RA 3CMAA 4MJSA 3K58A 2F0TA 3J7ZC 2K14A 5C4JB 5C0XI 1WH3A 5EE9A 2LHDA 4HLEA 4AYBB 2NBVB 4WFN3 1KL9A 3K0XA 1EY7A 5IE8A 4LCDE 1WXQA 2CHWA 3AU5A 3BVMA 4GLSC 2OWOA 3G48A 3KWLA 2R93H 1HZ6A 3I7FA 3CCUA 2WXPA 3TMEA 4B0EA 3G4SA 2JYEA 1QCBD 1KOTA 3UIOB 4ZHOA 2KX0A 2MLBA 5GAEC 3Q3OC 5I9OA 3MXUA 2B39A 5M5WH 5C4JH 3D4RA 2KDIA 4IW0A 5LL6X 1SB3C 4CYEA 2EYOA 2B2VC 3SDZA 3RZDH 2CS4A 1NSNS 1JQYD 2ZXRA 1N32L 4C3JH 4YXDB 4HAEA 4RKLA 1UF0A 3K6OA 2Y5BB 2G5DA 2R7ZG 1TT2A 1T5EA 4KY6A 3SEBA 1K51A 2LXCA 3HG9A 5J1ZA 4MM3B 4FXDA 1YMHE 2Y0SG 2Z0SA 4HJKA 3UGBB 1E7VA 4JI8Q 4XQQA 1ROEA 5AUIA 3G6EA 1FIQA 1QNUA 1RFKA 3ONAB 3HOXB 2H4OA 1MG8A 2MJDA 4WJPA 1P16A 3TIXA 2K6DB 4RAUC 2H88B 2KMAA 1TWAH 3QG1A 4WAAA 5G3LF 1YN4A 1V5OA 1WM3A 5KYIA 1PH2A 3AE4B 1VR9A 1LTGD 2F0GA 4WJOA 3STBC 4H13C 3D8GA 1X6OA 3DVNV 4AJYB 4ICUA 3HKZG 1E1OA 3F2CA 4AYBG 3V2TA 1MJEA 1OTRB 4P2CB 1S5CD 5C0XG 2OQ0A 2MP1A 1EYGA 1E6EB 3A4RA 3KVFB 2WACA 2N8NA 4IM0A 1D5XC 1F2LA 2KHJA 2KCTA 4A3MB 1IBKQ 2UXDQ 3IL8A 1DD2A 3TP6A 3PSEB 3Q8AA 1VF7A 4JVZA 3HHMA 2BDOA 1SYCA 1EIFA 4C4VA 5JEAH 1XD3B 2AYOB 2M8SA 2HT1A 1SE4A 4RHSA 3TN2A 1QVGA 4KGSA 4MSQB 1I4RA 3WWVA 5BR8L 2AKWB 5DPWA 3S1MH 2EMSA 1DOLA 1TS4A 4LFBQ 2RGFA 4LF8Q 2INNE 4QF4A 4HTHA 2X8XX 5IAAC 3K57A 4GNXB 4KDIC 3VR9B 2GBMA 5JXVA 5C5LA 2R92G 1FCLA 1XCTL 3HOWG 1S40A 2WP8J 1VZ6A 4L1BA 4AIMA 4GKJL 1NBFC 1PDQA 3T4AC 5CBEE 2E2JH 2KTFA 1Q86C 4K81A 3H0GB 2MPMA 4LF4L 2NYZD 2JSOA 1EWYC 2BDNA 2HHHL 1PFDA 3HOVG 3JAMi 2ZZPB 1PH1A 3MXPA 2KJHB 1V8CA 4CKBA 5HHDG 2WDTB 4Q2JA 4A20A 3U7DA 2UXCL 3EN2A 2NVTB 1T5XD 3L54A 4X3SA 1WTVA 1NEKB 4CJ0B 4A9AA 2O5JC 3ER0A 3KJPA 5FLXc 2N9KA 4YL8A 4Y7NH 2PMVA 4WH4A 3I4LA 1VQDA 4LNNA 4NPNA 4LMQD 3KUZA 4EFOA 4LF5L 2I5LX 1Z7TA 3R3OA 1AZPA 1VD2A 1JICA 2DJFC 2KANA 1BVSA 3PREA 1GPXA 2D3AA 1WFQA 2HE7A 1AYFA 4WWOA 2HIXA 4RH6A 2WDVB 3DWMA 4NXNL 1ESFA 3L3OC 4Y52H 2R7ZB 1VQFA 5CMDA 4KZ0A 4FVMA 2AQ3B 4L6TB 3VYTA 1V81A 2ZTDA 4QY7A 5C3WA 2NN6H 2QA4A 1PGXA 4OZCA 4F7XA 3H15A 5H1SE 4LDTD 4NQLB 1ZW7A 2JE6I 3H7PA 1W6JA 1DONA 4R4OA 1XLPA 4PYUA 4W9FA 3UQBA 1FMAD 2VH2A 5BYRA 2K01A 5C4XH 1WI0A 2AWOA 4XX5A 1RM6C 1OXVA 1X1MA 3PO3B 1WMHB 2VUMH 1GG3A 1SNOA 2EXDA 3E5SA 2F52A 2KLCA 2PQAA 1EQRA 2E75C 2FBWB 4F88A 3U9SA 3JSVB 4CQNA 1X3PA 4IN3A 2B8FA 1PVOA 2EKIA 5JH5C 5BMIA 2N9EB 3AEAB 3RMHA 3P4SB 2M1MA 5KEEA 2WGSA 3GTPB 2IWHA 1SYFA 2IW3A 5CTRC 1JT8A 4IWQA 4DN4M 1Y1VH 3PSIA 4JGHB 4IOIE 1YNJC 3BDLA 1VQIA 1MFWA 1TWAB 4ZKCB 3BDOA 1X3QA 3PO2B 1ENCA 2DZJA 3L08A 3NS8A 1O80A 3AMZA 4A3CH 1K52A 5EDSA 2K04A 5I6WA 1WJNA 3HGBA 1F2MA 2MEKA 2O6VA 2NPTA 1WX9A 2DLBA 3N32A 1K50A 4C3HG 2GRIA 3D6CA 2LXAA 2O2VA 4KHPL 1I4PA 1YN3A 3EC8A 4A3JH 3PUZA 1WZ0A 3MVVA 1RDPD 4HIKA 4LUVA 2BWES 4R9WA 2FCMA 2NCNA 2IO2B 1PFMA 2KUMA 3DUZA 2FCQA 1V49A 3ZNGC 4X65Q 2F0HA 4MJSB 1HTPA 3IXSA 1Q1BA 3BJUA 3FMCA 1QE6A 2LUEA 3UI3A 4A3IG 4DQOC 3CWIA 3BZCA 4RNAA 1UNSA 1V97A 3GS2A 3PO3G 3U9OA 1VQCA 1HNXL 2XGTA 2RCFA 1QOHA 4DK6C 1GUNA 4DXFA 2LVQA 3CCVA 1TTNA 1P98A 1I50B 2F4IA 1S1QB 1EQQA 1SYEA 1HJPA 3FKYA 5DPTA 3V6EB 4A3FH 2LFIA 5IA7A 2IL8A 1VZ8A 2K39A 2BPSA 2XRSD 3MXNB 3V61A 3VUYA 5IP4D 1B9MA 4A3DH 5C44B 4G7HC 4KKJA 2PTLA 3J7A5 1EY8A 3RZWC 2ENBA 3UDFA 5IYBG 2MBHA 1B7YB 4WORA 3SK5A 2UXBL 2L05A 2HD3A 2B2UA 3A8KE 2LGYA 4JI2Q 3K59A 2KN5A 4M1UB 1WX8A 2W3RA 1D3ZA 1D2BA
chains in the Genus database with same CATH topology
3QO2A 4A3EB 4G7ZC 5EKKA 1H9KA 1FM0D 3NQTA 3K5NA 3IAM1 2F0EA 3AN1A 1NAPA 1C4QA 2K33A 1VF5C 3IAS1 4CKCA 2M19A 2W54A 4GDLB 2N9LA 4DFAA 5BYQA 4PMBA 1E7PB 4XT3B 1WVLA 1LABA 3AMUA 4L63B 2AQ1B 2IGHA 4IUPA 2OXPA 1KH0A 4D2KA 2WS3B 1PLFA 3I73A 4XYQA 2N0SB 2DNEA 3H09A 4JBWA 1CHQD 2PVOD 1TWHB 1IW7D 1DOMA 4A3KB 2B63B 3PV0A 1TS2A 4M8AA 4FF3A 1EYCA 2L83A 1F2YA 3NRZA 2L32A 3LWEA 3HOWB 4L8JA 2F0QA 3RD4A 4KJOA 2F0NA 4QB4A 3CRLC 2LMCA 5C4ZA 1Z47A 2A6HC 2JXMB 1LTID 4KTAA 4C1NI 2NBFA 1DXMA 4C56C 1VDVA 2PPBC 1KFYB 1NYRA 4K14A 2Y0SB 1JW9D 1BCPD 1DZ1A 4FXGC 2ON8A 3RPFC 3TP8A 2JA5B 2LKVA 1YNND 4HMIA 3NVVA 1SNCA 3E9SA 1JROA 4HSVA 4B9WA 2WAQB 2MH7A 3MHZA 2K9XA 3MA2B 1NYQA 5CC4A 4A90A 1Y1VB 1L0XB 4EE2A 1V1OA 3HS0C 2M0AA 2L5TA 5IT9E 4ABNA 1V1PA 2A6EC 3C46A 3S14B 4ZYSA 2RBMA 2DN8A 1IKLA 4LK1C 2CU3A 2YEPF 1C4PA 1TKEA 1UWXA 1D5ZC 3K5LA 4N58A 4IZ8A 2XVSA 4A3FB 1SNMA 1I6HB 1J9OA 1VLBA 1KLGD 1KDCA 4MHEA 5BN4A 2E2IB 4ZUIA 1DOYA 3BZDB 4YTMB 3H94A 2X6GA 1B1ZA 2L11A 1OXUA 1LTBD 1HRJA 1I4HA 1C4AA 2YYZA 1P7FA 4ZLTF 1ILPA 1NCVA 1A3UA 4FXCA 3M7GA 3AB9A 5D14A 1NENB 3MJ5A 1BNZA 3TDQA 4F8MA 1SNDA 1MSGA 5IGGA 3K5OA 4AS1A 1ML0D 2QDBA 1HA6A 3X3NA 1IBXB 1F2ZA 1L6VA 1A3TA 3I91A 2PW9A 1S5BD 1VJKA 4OGQC 3B9JA 1SJED 5FLXL 1Q3LA 2Y5CA 1NR2A 1PTOF 3AEDB 4WAFA 1ZPSA 1PZKD 1CZPA 1HQMC 1ZDVA 4KX6B 4LK0M 1C76A 1VZ7A 4HCEA 2WXJA 3FAHA 2QF7A 1N5WA 3FILA 1TY0A 1BQQT 2BE5C 2I38A 4FYDA 1SIJA 4A3GB 1H9RA 1FGBD 1U4LA 1JCKB 1RWSA 1CM9A 1KLUD 3A7AB 4N9PA 4QMGA 1FFVA 3MZ5A 2NVQB 5IODA 1XWEA 2TSSA 3U2SC 3T3NA 4DXGA 1TZOA 4L23A 3GB1A 2QMTA 2MJ8A 3FPUB 1MPEA 3NUCA 3S1MB 2KECA 4HSPA 3D4DA 2F0FA 4OO1H 1GB1A 2SNMA 4IUUA 2BA1A 4YTPB 2WKDA 3TZUA 3IT6B 4BA1I 1YJIA 3SFDB 4OIKA 3AE2B 3B2GA 1BCPB 3S1QB 3LB8C 2O2LD 1Y8OB 2DBYA 1EEID 3RZDB 2KACA 4J8QA 1HQRD 2F0OA 3SR1A 1FNWA 4K2LA 5ISRA 3P42A 1QQRA 2EYFA 3GV6A 3OWEB 3VRAB 1J8IA 3VR5A 5T1IA 1PGAA 4C7YA 3S15B 5JOBA 3M85A 4P16A 2PW7A 2WXHA 2BOSA 4ZQ3A 4NAWB 1S5FD 2RQXA 3OMCA 5D65A 2RKSA 5D3IB 1BF4A 2D2CC 4IQZA 3HOVB 1VCIA 3GTKB 3T13A 4XT1B 3ZJTA 1F9RA 3P75A 1STHA 1OXTA 4UDUC 4KK7A 5EGTA 3TP7A 4A3BB 4OZBA 3JAME 4IFDG 4RGOS 1JC7A 2VZKB 1BOSA 2WV6D 1L0VB 5CV7A 2WQYB 3VR4A 1D5MC 5EQ0A 2FFKB 1O78A 3U52E 2PLPA 1XLQA 3VA7A 2BB5A 1DOIA 2N88A 3AEGB 3HUIA 5FO7B 3EVQA 4XDDA 2EYJA 4KGTA 2C9OA 1QF6A 4KD3A 3CQZB 4HR7B 3M3YB 1QB5D 3AE9B 1OXXK 4O1NA 1T6BX 1DOXA 3C3LA 1HFGA 1R4QB 4RA8A 4C3JG 5IGFA 1F2RI 1PRTD 3KF8A 2LGIA 2ZW1A 2WXRA 2LUMA 2NWGA 2RDFA 3S9WA 4C7ZA 4RCOA 2K5PA 3Q6SA 4ZRPA 5JEAJ 4J3OD 1TY2A 3BVZA 1OQQA 3Q8FA 4C3IG 2EELA 1ZP0B 4HJGE 2F0SA 2O5IC 3HP3A 5MPOA 1KAAA 1IGCA 1C79A 1EU3A 3FVQA 1PZID 3HOYB 1FEHA 4X3UA 4QCLA 2DNCA 1SBBB 1JWSD 1SEBD 3A54A 3OW7A 2KCNA 2Z8LA 3R2IA 3QIAA 1TS5A 1VRAB 3FEWX 5M9OA 1IL8A 4MH8A 1XX8A 3I72A 3NBHA 3TUOA 2PZUA 3AECB 1G91A 2W82A 3NQIA 3VRBB 2Q5WD 1AW7A 3C1FA 5HG2A 3NVZA 3FKIB 1RKNA 1K8MA 2BYTA 1ENFA 1Q1EA 1A2TA 3DWGC 4IUVA 5KNBA 5FOBB 1L4ZB 1MI0A 5T8IA 3RUZA 1DYQA 1M8AA 3VR8B 3OMGA 2JX5A 1JR0D 5G5HA 3BS1A 2XN9C 2Q8RE 2F0KA 5FKAC 3SXHA 3AE7B 3S17B 1ESRA 1IGDA 2RSOA 1NUCA 4B08A 4NW2A 1FFUA 3HVDA 3HOZB 2BTEA 2B2WA 4JWSC 1CJEA 3CU7A 2BT6A 1QJOA 3M4OB 2Y5PA 2BA0A 2O4XA 2VZKD 1E2ZA 5EPKA 3M4YA 5BMGA 1RTNA 1N63A 2Q8TA 5EBCA 1ZOYB 4CGYB 1MSHA 1W6KA 2Q8IB 2KQ3A 1E2WA 1TQOA 4ILWA 1FXIA 3VYUA 3LYYA 1E9MA 2JA8B 2JZPA 2QEJC 2JQRB 3CKIB 4CJ1B 1U4RA 4BY7B 2V3NA 1ONLA 1H9SA 2LHEA 1SNPA 2EOTA 3WOFA 1YNJD 4OO1I 3V3XA 3SK6A 4CKEA 3KLRA 1E0BA 3EFXD 5CR3A 1LV9A 4XE0A 2OEOA 3VR2A 5DM73 1TR5A 1SYDA 1QNKA 5M5XB 2HDMA 3G6JB 2VNUD 5C6AA 2L12A 2J4XA 3MAQA 1PTOB 2OEDA 3DXJC 1A3VA 3S1NB 1FRDA 1ILQA 2B76B 4WIPA 2L52A 3ZJVA 1O7ZA 2ZW0A 4P6VF 1D6EC 1CA6A 2NN6G 1TKYA 4EQNA 1KTKA 1OQRA 1STEA 1XTCD 3GTLB 5C3EB 1DJRD 3EGRA 1BMLC 2I07B 4EGVA 1N61A 1HEZE 3S16B 2E2HB 4KV6A 4NZLB 2LEKA 2CW0C 1EZ8A 2K1BA 2L1BA 1TKWB 1UGJA 3KK7A 1WCMB 2DY8A 1RODA 3DWAA 1EOTA 4A8XC 2BE5D 3T53B 3W9CB 1JWMD 1EY6A 4IKGA 3KBXA 2QIEB 2K6AA 1VDZA 3M7NA 1SNQA 4ZK9B 1OFFA 1XYIA 4C3HB 1JRPA 1A2UA 2XSCA 5EE0A 2EJGC 2KQ4X 5BMHA 5BN5A 4Z9CB 3HVZA 3MFYA 3FILB 4N9TA 4OHJA 2PMZB 4UAIA 5M5YB 3WDNA 3ND8A 3I8ZA 1CK1A 5IT9L 1ICWA 3D6WA 3W3AA 1HHVA 2EY2A 2G9DA 3NK9A 3NS1A 2NZ1D 3PIP3 2JA7B 3W5VB 1EY9A 2AX5A 3KLSA 4H2AA 5D7GA 4KY5A 3ZGZA 3HEJA 2R61A 4N6EB 3DWPA 1HUNA 4H44C 1BBXC 4BY1B 3EA6A 1EQVA 2EYHA 1WSPA 2F0DA 4DA2A 2BS2B 2BS4B 2EJMA 1B2TA 4G7OC 3T3OA 4OL7A 4WRDA 1VMPA 2MUYA 3NTKA 2E3TA 2ACZB 3ZQ4A 1UAPA 1HZ5A 1XO3A 4K8JA 4KHVA 1SSOA 3NVYA 2HCCA 3T16A 1PTOD 3AE3B 4I7ZC 3AEFB 3GP7A 3QOJA 2L9HA 2LS01 3S1RB 1XF5L 1F9SA 3D3RA 1I4QA 3T56B 1SMYD 1ZXTA 4RWSC 5M3MB 1LTRD 1MHXA 4N59A 4E6IA 1KNEA 1XXGA 3OIQA 3T51B 2D5GA 4DU9A 2KOLA 1BUVT 4RGNA 3Q0AA 4H0LC 4CJ2C 1EU4A 4EQPA 4WJWA 5C3XA 2EZVA 4PV1C 1CZWA 1GUGA 4XWWA 1I6VC 4DNRB 3J7YW 3TZDA 1U4MA 1MBYA 1B3AA 4BA2I 3F2UA 1LLRD 3N9YC 2HUGA 3J7AF 2M56B 4IUQA 3WOEA 2PNRC 3VR6A 2NVXB 1FO4A 3NHHA 3VR3A 3E6ZX 3AEEB 3SK4A 2I2YA 4K5VA 5ELCA 3C1EA 2J53A 1CHPD 4EQOA 3PZ7A 1WTOA 3IFTA 3KWVA 4TRDA 2A68D 2EYPA 1RJTA 4L2YA 4XIGS 2CW0D 1ZYRD 1YJJA 4JE3B 3IT4B 1SE2A 3EROA 2NVYB 3EQLC 3GO5A 3RFZB 2DY7A 4HN7A 4J6HA 1WTXA 3HRZC 1WYGA 5AUKA 2XNAC 4IALA 2B2UC 4HKZE 5E6JA 4KD4A 5HURA 1DM0B 2J0TD 1STGA 4NKLA 1U4PA 2JEAI 5CV4A 5A2QE 3PIO3 3AE1B 2B2YC 1F9QA 1HA5A 2K7VA 1IBXA 2F03A 3NWSA 3I4MB 2GI9A 2HQEA 4YSZB 2FHTA 5E1FA 4C3JB 2EY6A 1JE4A 2D62A 1QOGA 3A56A 2SOBA 1PRTB 3Q23A 5I9PA 1FCCC 3URYA 3IKJA 4R8NA 3P20A 3K0YA 1LTSD 2VB2X 1KNAA 2IDYA 4DAVA 4ID6A 2B2TC 4MIUA 1C8CA 1PDXA 1AEXA 1A15A 2A68C 2Z4IA 4S3SA 1STNA 2I46A 2IX1A 4FF1A 2XWBB 2YU9B 5HI1A 2A73B 3BK1A 3EUB2 1VMCA 4PQXA 3S2DB 5AFWA 1AP0A 2RMMA 1ZUD2 1HCZA 3IFDA 1GHKA 2MJ3A 2D9UA 4ARCA 4ODGA 4XQJA 2R93B 1F2RC 1WTQA 5M3FB 3VYSA 1BXTA 3QB3A 2KVMA 2WB1B 2RDHA 3IAYA 2WKCA 2PW5A 4A3JB 3AEBB 1L6UA 1JOKA 3SK8A 2E6XA 1F9PA 3NWTA 2K5QA 4XDCA 2AUJD 4C1NK 1ZE3D 2BCOA 2EVBA 1N5XA 1V1PB 3R93A 3BVGA 4B0MA 1FRRA 3HZXA 4USAA 1ET9A 3ERQA 1J7AA 2KCCA 2B2YA 3N6RA 1C48A 1SYBA 4J1MA 5CGKA 3Q69A 5FR3A 1R9TB 1JWUD 1PRTC 1UEAB 2V3PA 3Q24A 2VXWA 1JWAD 1O7LA 3P7JA 3GTMB 1WWTA 4FF2A 4TSSA 4YT0B 1EY0A 1TIID 3VYRA 4JK1C 3V05A 1QWYA 1QT9A 3ZJUA 4XQNA 4ZAIA 1A6XA 2Y3AA 3P1HA 3D4WA 1JOOA 4QUFA 4WQMA 1KRHA 2M2LA 5JPMC 5E4XA 1C78A 5IGCA 3U7ZA 4IUNA 4C80A 3I4NB 2B8GA 1E2VA 1LT6D 2OF1A 5GXGB 2G1EA 5EJWA 3L9AX 1WTWA 1LACA 3PUVA 5EE1A 1CTMA 3NP8A 1CFMA 3C8YA 2EYLA 1CQVA 1GHJA 2A69D 3FC4A 1TKGA 5I6YA 2EE1A 1D1KA 3J81L 1TJEA 3TP5A 1SMYC 2JWUA 2JU6X 1H9JA 4KKUA 4KI0A 2R92B 1BO0A 2CVRA 1WRIA 1I4XA 2ONQA 4BWGB 3Q8CA 2PYKA 4XWTA 3TEYA 2CJNA 3A8JE 4RF1A 2CQAA 1PTOC 2WXIA 2CJOA 2AWNA 5ELBA 3WCQA 2JYTA 4FNFA 3ABVB 2F0LA 1IYUA 2X6LA 5IIFA 4TQ1A 3PZ8A 1K83B 3DWQA 3NUHB 4YSXB 4HCSA 3MHBA 5FK9C 2XWJB 3AE5B 4C3IB 1BDOA 3J81E 2ICEC 3CIRB 1EIHA 3TEWA 1S4ZA 2PQEA 1Y8NB 5M5WB 2F0IA 4DGZA 1STAA 1ACCA 4NAMA 2BS3B 2KJXA 2A6ED 3ZYYX 1STYA 1SYGA 3OPOA 5FLXE 4WURA 3BDCA 3MTSA 1CA5A 1QKZA 2WU5B 4KGRA 3FPPA 3N52A 5JVH3 4JPSA 5CV9A 3VQIA 3K7AB 1YNNC 4X3KA 1FD6A 4RGMA 3GV3A 4ARIA 2K28A 4TQUS 1SXTA 2EPBA 5I2YA 1CI3M 3P4QB 1Q8IA 1RYJA 4DF7A 2JSVX 1LT4D 3GTJB 4I65A 1JOQA 3HOUB 5BN3A 4ULLA 4WWMA 4AQ7A 2F0MA 2M00A 3BYTB 2MJEA 5KRUA 2QKIC 1S5DD 2QJLA 5HFYA 5JJZA 1S5ED 3J80E 5A35A 1YN5A 4JX1C 4K8IA 2LFNA 4KHZA 1N62A 1EZ6A 2DWQA 3NSWA 1RTOA 2PCFB 3A55A 4NDXA 1EM7A 3OIPA 3Q22A 2J42A 4HEA1 1GUTA 2PO4A 3OSOA 1Q90A 3O13A 5ELDA 2WXLA 2F0PA 1II3A 1QG7A 1MGSA 3DMUA 4ZRZA 2NTTA 2PZTA 1T3QA 5EBDA 3LWUA 1L4DB 5F2DA 2H89B 2L4NA 3X3MA 1Y69U 2CHBD 3MXNA 2MGSA 5I4DA 2EJFC 2K03A 1MI2A 3VA5A 2A5HA 1EYDA 3I9V1 1IKMA 5IGEA 4Y7NB 1E0ZA 2AQ2B 2SAKA 1DOKA 3A7LA 5KGUA 4V190 1BCPF 1PTOH 5C4HA 1L5PA 2QCPX 4K5WA 1XLNA 1TYGB 1GUOA 5ELFA 5J39A 2C5CA 1SAPA 1FNUA 5DAUA 1SJHD 3HKZB 4KN7C 4HRSA 4A3IB 1C77A 3OWFA 3E0JA 5FO8B 1CQFA 4C2MB 1BR9A 4DAYA 2SDFA 3QWNA 2ID0A 3PMFA 4XXEA 1ZXHA 1SSNA 4U68A 2FMMA 5KNCA 1ZDXA 1C4CA 2L1AA 4PMWA 1MHHE 2WXFA 2WXGA 2EXZA 3GTQB 1F77A 4GDKB 1QILA 1HFNA 3K5MA 4BS9A 4YSYB 4OIJA 1I4GA 2NUCA 2IX3A 3SFEB 3NTHA 5C0XJ 1MD2D 4TKOB 4KJNA 3AE8B 2QILA 4OVZA 4U673 2KHSA 1AWDA 1PUTA 2G9HD 2FE8A 3A8IE 2IGGA 1HTLD 2WU2B 1GB4A 4OZAA 3BG3A 1PFBA 1H9MA 5K36H 2VB3X 3PO0A 1Y56A 2V4IB 3NZ3A 3BIID 4XTCS 3J9CA 4HROA 2VUMB 2BB6A 1U9RA 5IGDA 2KDMA 2E76C 5COYA 5EPJA 3TEXA 4MT5A 3KBGA 2PZWA 1XEEA 1Y8PB 5DEHA 1J7BA 2J52A 3AV8A 3DEOA 1IW7C 2K05A 2JXTA 5LHY1 4V0BA 1L0YB 4K6DA 2X38A 4M0WA 2R3ZA 2JA6B 1BCPC 1EWCA 1H9SB 1G2TA 1TS3A 1YQ3B 4DK0A 1G291 4IFDH 1JORA 1AZQA 3NXWA 1PRTF 2A6HD 4BBSB 1B9RA 1EYAA 1PZJD 2NMQA 2A74C 2N55A 4F87A 2JEBI 1R4PB 3Q8EA 4RF0A 3RLFA 3J80L 1WD0A 1EQTA 1LTTD 4US9A 2PIAA 3BWUD 2K32A 1GOZA 2XRQD 2FJ2A 1GAQB 1QLBB 2E2JB 3G7LA 2AUKA 1UWMA 1WD1A 2GA4B 4KKSA 3AU7A 4LAAA 5CV5A 2FUG1 4TQ0A 5CORA 3MFGA 3OHXC 4LTUA 4KKIA 2R6GA 1JWBD 3CRKC 5FO9B 2W55A 2NB0A 4OO1G 1B53A 3E56A 4RGTA 3PUXA 3H91A 3LX0A 1MVKA 3SHLA 2IJ0A 3S2HB 4RKBA 2TMPA 1QOBA 4IUTA 3MC0B 4EVOA 4DNTB 1KDBA 1G8ZD 2L55A 1YQ4B 1LO5D 3MEHA 3ND9A 4XDXA 5CV6A 1JALA 2IX0A 4KN4C 5C0XH 1B4OA 2ICIA 4KKTA 5IGBA 2OT2A 5EKLA 1JB3A 2QSDA 3NTIA 5A2QL 4MACA 4R8IA 2KN4A 1ET6A 2K22A 3J7AV 1X32A 1GUSA 4DK1A 3W5UB 3P1MA 1NI3A 3V96A 1A70A 2EY1A 2A69C 1TWCB 3NVWA 1STBA 1PYWD 3HRDD 2KEDA 4BBRB 2J7ZA 1NVID 4K6LA 4YWGG 1RF2D 1V8QA 1IYVA 5E3FA 2F0UA 2DYOA 4CHTB 4ZUJA 2BBCA 2H1EA 3NBIA 3P4PB 5J22A 3R2TA 3EJIA 5H92C 2RA4A 2D5DA 4ITKA 1EEFD 2NTSA 1G6ZA 5C5MA 4OW0A 5IOCA 1LT3D 2KEEA 3OOCA 2RDGA 4PNYA 3BK2A 3GD7A 2Z1CA 4JWUC 3GTGB 1TWGB 5HGTA 3B2FA 1AN8A 1TWFB 3Q8BA 1HUMA 4MN3A 1SDFA 4YIJA 1LT5D 1WTPA 2LJIA 2WXKA 4ZRQA 4HMJA 2V4DA 5EE3A 5JEAG 4GZYC 3R8BA 3AE6B 5KNDA 2F0VA 2K5DA 1WTRA 2F3WA 4K5XA 3KUPA 1ZEQX 1IHZA 2XIWA 2Z4HA 5KIXA 3KLSX 1RD9D 3GTOB 2KMMA 3PUWA 2RSNA 2B2TA 2YEPB 2F0WA 2IT1A 1JMLA 4YTNB 3DM1A 1QOFA 3AH7A 3ITPA 4FO2A 1FYCA 1B9NA 4RHRA 2SNSA 2F1MA 1EL0A 2KWDA 1EFID 2B2WC 1PGBA 2INPE 5KYLA 4IFDI 1DCZA 1K8OA 4IFDJ 1ZXIA 1J7CA 3KQ4A 2JYOA 1RHPA 4DAPA 4QIWB 4Q0FA 2PVGC 4O42A 1XCQL 5NUCA 1B50A 5C3JB 1N60A 1JQ4A 2IPKD 3I70A 1FXAA 5T1GA 4IDIA 3LNNA 1I7HA 3QOLA 4ZHPA 4Q5VA 2K0PA 1G2SA 1KABA 3CHBD 5EKIA 5G5GA 4ZOHC 4K2KA 5BYSA 5JAVA 3ETRA 1CT1D 2BW2A 1PFNA 2ZXOA 5I2XA 1KF6B 2EY5A 2GB1A 3TEZA 2WIIB 1DGJA 3TBIB 4LLGM 2PKOA 2V0GA 2HCIA 1QOAA 3NPPA 2F3VA 2WNMA 1HXYD 1HPCA 5H8YE 1EY5A 3AM9A 2WXQA 1TU2B 5K36G 4ZKBB 2M9VA 1YNTE 1FR3A 2KA7A 3L4PA 5TSSA 2RVLA 3BYYB 3W1SA 1WGKA 3GQBA 5LNK1 3H6MA 2LY7A 3QJYA 2WINB 4A6QA 2X69A 3DHQA 3FDTA 4NMZA 4PT5A 4IURA 2K3UA 5C2TB 4NJCA 1D4BA 3PUYA 4FXKC 2WDQB 3U4EG 1E10A 1I3QB 1Q12A 4CBVA 5K5PA 2EDGA 1SF0A 4R3DA 1FNVA 4TMAB 2RPVA 5CYUA 1ENAA 1RCVD 3SVMA 2E74C 2FINB 2SEBD 1GJXA 5C4XB 1K53A 1GUWA 1OO9B 2HDLA 2MHVA 2W3SA 2E2DC 2K5WA 2L0CA 4KMUC 1D1IA 3P63A 2EYMA 5EPLA 1Y1WB 1OXSC 2OHFA 3D31A 2NN6I 1GXDC 5E4WC 4RCNA 2DYMA 4A93B 2HTME 1C9FA 4A55A 3SR6A 1V43A 2WXMA 4HKQA 1EIGA 2HDEA 1LTAD 5LL6S 4G57A 1PXUA 3NE5B 3I90A 1F0ZA 1EY4A 1PMRA 4US8A 3C2PA 1NR4A 3FRPB 3DEPA 4HEDA 1O7YA 4LJZC 1XLOA 3MP9A 2LMCB 4A3DB 2WP9B 3AB5A 3LXFA 2N7JA 3L7ZC 5D3DA 4FP5D 2ZXPA 4REZA 5ELEA 1BUIC 3I3CA 4RFBA 1R7SA 3UI2A 4FF4A 1Q10A 4PMCA 1ZKOA 3H8HA 2B2VA 3TSSA 5DNFA 2WXOA 4G4KA 3I57A 4KY7A 5DM63 2ZT9C 3W2DA 1B44D 2JP1A 1ZYRC 4QUCA 1AFPA 1CZGA 2WLBA 5CV8A 1SFOB 3RZOB 1EWHA 5JPNC 1TVXA 3P4RB 4X3TA 3SE0A 3MWYW 5G3LD 4B9XA 1IUEA 5JVG3 1M4VA 4NP5A 4H7BA 4XYOA 3H3VC 1P7EA 2F0JA 2WXNA 3MXGA 3JAML 1Z6HA 1FD7D 2FMCA 1KDAA 1UUPA 4ME5A 2IGDA 1SE3A 5CBAE 2WDRB 2KAJA 3K58A 2F0TA 5C4JB 5C0XI 5EE9A 2LHDA 4AYBB 4WFN3 1EY7A 1WXQA 3BVMA 4GLSC 3KWLA 1HZ6A 2WXPA 3TMEA 4B0EA 2JYEA 1QCBD 4ZHOA 5I9OA 3MXUA 2B39A 3D4RA 5LL6X 1SB3C 2EYOA 2B2VC 3SDZA 1NSNS 1JQYD 2ZXRA 4YXDB 4HAEA 4RKLA 3K6OA 1TT2A 1T5EA 4KY6A 3SEBA 1K51A 3HG9A 5J1ZA 4MM3B 4FXDA 1YMHE 4XQQA 5AUIA 1ROEA 1FIQA 1QNUA 1RFKA 3ONAB 3HOXB 2H4OA 2MJDA 4RAUC 2H88B 3QG1A 5G3LF 1YN4A 5KYIA 3AE4B 1VR9A 1LTGD 2F0GA 4H13C 3D8GA 3V2TA 4P2CB 1S5CD 5C0XG 1E6EB 2MP1A 2WACA 1D5XC 1F2LA 1DD2A 4A3MB 3IL8A 3TP6A 3Q8AA 1VF7A 2BDOA 1SYCA 5JEAH 1SE4A 4RHSA 3TN2A 4KGSA 1I4RA 1DOLA 1TS4A 2INNE 4QF4A 4HTHA 3K57A 3VR9B 1FCLA 5JXVA 5C5LA 1XCTL 2WP8J 1VZ6A 4L1BA 1PDQA 3T4AC 5CBEE 3H0GB 2MPMA 2NYZD 2JSOA 1EWYC 2BDNA 1PFDA 3MXPA 1V8CA 4CKBA 5HHDG 4Q2JA 2NVTB 1T5XD 4A9AA 4X3SA 1WTVA 1NEKB 4CJ0B 2O5JC 2N9KA 2PMVA 4WH4A 3I4LA 4LMQD 1Z7TA 3R3OA 1AZPA 1JICA 1GPXA 1AYFA 4RH6A 2WDVB 3DWMA 1ESFA 3L3OC 2R7ZB 5CMDA 4FVMA 2AQ3B 4L6TB 3VYTA 5C3WA 2NN6H 4OZCA 1PGXA 4F7XA 2JE6I 1W6JA 1DONA 1XLPA 1FMAD 5BYRA 2K01A 2AWOA 1RM6C 1OXVA 3PO3B 1SNOA 3E5SA 2FBWB 2E75C 4F88A 3U9SA 4CQNA 1X3PA 4IN3A 2B8FA 2EKIA 5BMIA 3AEAB 3RMHA 3P4SB 5KEEA 3GTPB 2IWHA 1SYFA 2IW3A 4DN4M 4IOIE 1YNJC 3BDLA 1TWAB 4ZKCB