3SECA

Crystal structure of methanothermobacter thermautotrophicus orotidine 5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
214
structure length
214
Chain Sequence
VMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFRKRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFPGADSVRACLNVAEEMGREVFLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISPGVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methanococcus thermolithotrophicus orotidine 5'-monophosphate decarboxylase complexed with pyrazofurin monophosphate
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Lyase/lyase inhibitor
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 85
structure length 214
sequence length 214
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3secA00
5H2ZA 2J9YA 3LXCA 1H5YA 7TIMA 2ZZ3A 1ADOA 5CZ0A 2OCZA 4WX2A 4PL1A 5KTLA 1E51A 3PBUA 4IXXA 3AO0A 1SR9A 2ZRXA 3SZ8A 1VCFA 3DBPA 3PUDA 3QQ0A 3C2RA 3QFEA 4YWIA 2GQ9A 5HUPA 1AMKA 3WJXA 4ADUA 1RR2A 5HR7A 1KLZA 1TPH1 1I2QA 4JTSA 1W5NA 4NNBA 1XC4A 3AJXA 4MLRA 3W1MA 3P5YA 1RPXA 1UJPA 4MVAA 4TR9A 3W23A 3QSTA 1YXDA 4ZQOA 3LBMA 3PVFA 4Z0JA 3WK0A 3TJXA 3LTSA 2B7NA 3IGXA 1JCLA 4RCXA 5F4WA 4O53A 1C8VA 2OMAA 2QAFA 3O05A 4NZJA 3M44A 3EKLA 3CWOX 1FWTA 2C18A 4Y6GA 5G5IA 5I3IA 4LVBA 3TAKA 2E5BA 2FQIA 4NX0A 4UTIA 1SSGA 4JX5A 2ZA3A 5DCBA 2HS8A 3CIWA 1HO1A 3TFXA 5AHLA 1QFEA 3W71A 2F7FA 1GPWA 1TCDA 2R91A 1QPNA 4NQ1A 5AOUA 4QITA 5CPNA 4JIPA 2XN2A 4HIBA 1L2UA 1IXPA 3PUEA 1XCFA 3EWWA 5LKYA 1LP6A 1AG1O 1H7RA 1DV7A 3BV4A 5HWJA 1JCXA 1W31A 1FDYA 1QAPA 2BLEA 4LVFA 1YXCA 4O10A 1K02A 5CSRA 3QW4B 5F4XA 3THAA 2EHHA 3PWAA 1VS1A 4H6KA 1YDVA 1GTEA 1L9WA 3LOTA 5K9DA 4BF9A 1SUXA 1H50A 1TPUA 4M6PA 1I2RA 2H8XA 1TPC1 1GVRA 4N9EA 4UIOA 4MKNA 5I3FA 1JQXA 3W75A 3LTYA 3BK0A 4UXDA 3W7GA 3G1FA 4CQ9A 1JQVA 5F2MA 2CLHA 2JK2A 3ABOA 2YCEA 2YX0A 3M0ZA 3C6CA 1TTJA 3DKLA 2GJLA 1OVDA 5HMSA 3W2UA 5FEPA 3TW7A 1F7BA 2ALDA 1VR6A 2E6DA 4FNSA 3W7HA 1V7YA 3FS2A 1YPIA 3P62A 4LT9A 3NL2A 5F2LA 1SFLA 3ANYA 1WXJA 4K37A 5AB3A 1S5VA 1VH7A 1Z44A 3T7VA 1LOSA 3NG3A 1SZEA 4FEZA 4KFNA 3R5EA 4WUIA 1QNVA 3CEPA 3W7CA 3F4WA 4DPPA 3TSMA 3C8FA 2WQPA 4IWWA 2QCEA 3O6DA 3IIXA 5FI8A 1VLWA 4LNYA 5HWMA 2QJHA 4ORMA 4KKXA 2YDAA 4FNPA 1X8FA 3ABRA 4QQ3A 4B5NA 4UFKA 5K7JA 4CNOA 3NQVA 2G5WA 2A7PA 1ZAHA 2V2CA 3R2GA 1F6KA 1VRDA 1W5OA 2V5LA 3SFKA 4UR7A 1I45A 2NXGA 3UXDA 3P80A 4O0ZA 3UWWA 2Q3RA 3S5ZA 2X30A 4JY9A 3S0CA 5G2IA 5C5YA 3CT7A 4ADTA 1L6WA 4MLJA 3ZWTA 1O5XA 5BRBA 4IMFA 1NSJA 3IVSA 2O7QA 1LCOA 3W1QA 3BGJA 5KZEA 1LRQA 3CM4A 3ZFHA 3PAJA 5EA9A 3F03K 4RZ4A 3HG5A 1ZJIA 3JR2A 1W5QA 3GK0A 1ZNNA 4EOUA 1JRCA 2DZVA 4UC5A 3W1PA 2B4GA 4LRTA 3MYOA 3FKKA 2RHGA 3RF9A 5LNVA 4FB7A 3N2XA 3GXNA 2X1TA 2NWRA 1W3IA 1UASA 3UWZA 5FF7A 3MP3A 1TREA 4EIVA 1L6SA 2VENA 2NZLA 2QUUA 4M5PA 1B4EA 3W1RA 4YXGA 1F74A 3TX9A 3W7EA 3LLDA 4TIMA 3SECA 2C13A 1KTCA 1O4UA 5LNRA 4YCPA 2QCGA 3EWXA 2TSYA 2FFCA 2CZFA 1X1OA 5F4SA 1OF6A 4HHPA 3NL3A 1KFBA 3PBYA 1H7XA 4XTDA 4IMCA 3LGEA 2P10A 1OFDA 1YDOA 2CFFA 1L6YA 5CSSA 2ZZ6A 1FWNA 2Y88A 1S3HA 2VFFA 3G1VA 2R14A 3I65A 1I2NA 3S1XA 2FPYA 4JTUA 3TUUA 2A21A 2ZRYA 1TRIA 1YTEA 1N7KA 2QEZA 1FX6A 2A1YA 1G7VA 1OK6A 3TXVA 2ZZ5A 4EF8A 4JTFA 5CKSA 3R8RA 3PM6A 2VEKA 5F2IA 1EWDA 2ZA2A 4RR4A 4NJJA 3BGGA 3MI2A 1ALDA 4R33A 3GX9A 1RZMA 4I7VA 2GQAA 3A22A 2DJXA 3UYCA 1OHLA 3UXAA 3W1LA 4O1BA 2J27A 3DHDA 3QZEA 2ZZ1A 3LM7A 2YXGA 2BSLA 2DZXA 2E77A 5HQEA 1GJPA 4C1LA 3MI3A 4WOQA 3TV8A 4UMCA 4RKAA 3F4NA 2J6XA 4LUJA 4JTGA 3O8AA 3W7JA 3ZS4A 4AH7A 2DZUA 4H4IA 1BEUA 1ME8A 1S5WA 4X9SA 3O1NA 3UWVA 3W74A 3G8EA 2NX3A 2G97A 3OG3A 1QO5A 1J2WA 1TIMA 3G24A 3KVKA 2WSQA 3RMJA 1OFOA 3EXRA 1HUVA 3RNDA 3WJZA 5D09A 4BWLC 1SW0A 4YCOA 2ABBA 1TPVA 3E02A 3MWAA 1NVMA 3A24A 3S5YA 3KVLA 3QJAA 2DZWA 1WOBA 1W5PA 2NV2A 4Y96A 1EX5A 4MPQA 1G4PA 1AW1A 1R46A 2Y7GA 4Z1BA 3DFOA 1LM1A 4DXVA 3LTPA 5CPMA 2DU2A 1KM3A 4TO8A 1PCKA 1EP1A 4IGHA 3S1VA 4UNKA 3HO8A 1KW1A 3FKRA 3LBCA 4CCEA 1OYCA 5HNRA 3HMJG 1QMLA 1SO4A 5D2XA 5D02A 1LRNA 5LZLA 4BI7A 3BG3A 1KBJA 1XBVA 4NNCA 3P81A 1GVFA 2VC6A 2GQ8A 2CLFA 4AVFA 5E93A 3C2FA 3NO5A 4E2DA 4HSNA 1DQWA 3SGUA 2ATSA 3TK7A 3UD6A 3W1XA 3PR2A 1FY6A 4FO4A 3S1UA 4QIUA 3W7OA 4NJIA 1K8YA 3TW6A 2C14A 3M9YA 3FIGA 1CI1A 1LZOA 3NL5A 3ZWSA 5E0KA 4Y90A 2J9ZA 4JXCA 1QOQA 5DN1A 1OX4A 4O1DA 1FCUA 4DF1A 4JTHA 2TRSA 4RK8A 1DL3A 4UFJA 2PC4A 1F2JA 1GOXA 3KVMA 3O07A 2CLOA 1QPRA 3E0IA 1KA9F 4GXMA 1XDLA 1Q45A 3GNNA 4IX2A 2ABAA 2RDTA 3LCLA 1TPB1 3W3OA 3C2EA 3GDRA 4DBEA 1G4EA 4M7TA 1AL8A 3K30A 4XZ9A 4FNRA 4UTHA 2ZRUA 2WSYA 3MYPA 3LI0A 2B7QA 3S42A 1TTIA 4A21A 1KFKA 1SPQA 2QCFA 3G1DA 2FTPA 3GXPA 3TH6A 4UTWC 4NUWA 5DXXA 4AXKA 3GNDA 3G1AA 1TV8A 1LROA 3N73A 2PRHA 4BI5A 1Q3NA 1UB3A 4FIRA 2XN1A 1DVJA 3UPBA 3HPZA 2Z2UA 2WSRA 1UBSA 3CHVA 1M5WA 1K8XA 1PV8A 4O52A 4BFAA 4GUGA 1TMHA 2FB3A 5FF2A 3W72A 3C2VA 1MEIA 1ZENA 1WBJA 3SR7A 1TJRA 1PS9A 2V2HA 4PCFA 3KRSA 4JDBA 1NF0A 1O60A 2Y61A 4O14A 3UWQA 3HG4A 3LCIA 3IEBA 2C1HA 1GYLA 1SZNA 4O1AA 4AHPA 1K7XA 4ZQMA 3HGOA 3LV6A 3JS3A 4FF7A 5BW6A 4GUFA 1KBIA 5AHFA 4Y9AA 3IIZA 4DBDA 4JTLA 1SW3A 2CLEA 5CPLA 1OYAA 3USBA 1AL7A 1FUYA 2YGYA 2A4AA 1Q6QA 3ATYA 3W83A 3G8RA 1SSDA 1XI3A 5AYYA 3L0KA 5F1VA 3A23A 3STCA 1EB3A 3SW6A 4XUGA 3DAQA 2OT0A 4N9BA 1LLZA 4NJGA 1VC4A 2FB2A 1O95A 3UPWA 3BG9A 4XKYA 3QH2A 4MZ8A 4MYXA 3L66A 3THQA 3HJZA 2J9XA 3M5YA 3MW7A 1FXQA 1JUBA 2CZ5A 3L9CA 3HG2A 3Q58A 2LLEA 3N34A 4KWVA 2NV1A 2VFDA 1FWRA 4OGZA 4AAJA 4L4LA 1EA0A 3P74A 3LCXA 4WY0A 2J88A 5GVJA 4DF2A 3IIVA 3TSBA 1LBFA 1JVNA 2X1SA 2TPSA 1EP2A 4IMDA 2ZBTA 3TSDA 1A5AA 5EPDA 3W70A 5DCDA 1K8ZA 3WFAA 3UZ5A 1TV5A 5L6UA 2X1RA 2Z0IA 4FNTA 1PIIA 3HB9A 4MOZA 4LS1A 3C2OA 2Q3OA 1I8JA 2W79A 1CW2A 1I2PA 4MFEA 1VLIA 5EKYA 3GAKA 5K3VA 1F76A 4IMGA 2ZRVA 4WXYA 1A5SA 5AN7A 3L21A 1XDMA 4C1KA 5D2TA 1A53A 4FX7A 3W85A 1P5BA 3RLUA 1MEWA 3UWUA 5J5DA 4UTJA 2ZRZA 3QEZA 4UTUA 5F2GA 1KM2A 2GPTA 3CPRA 5D03A 5HULA 3KAOA 4MUZA 3EWUA 1B3OA 1GYNA 5FEXA 3G22A 1YPFA 1OG0A 2V2DA 3CB8A 4GE8A 1OFEA 3LCWA 1Q6RA 5C2XA 3GDMA 1N8FA 2NUXA 4FX8A 4ZMGA 4N02A 3EWBX 4XTIA 4JTIA 2QUTA 4JTJA 4E38A 2RDUA 3B05A 1B9BA 3TMLA 3YPIA 5HJLA 2CLIA 2QDGA 3VI2A 3G3MA 4NXKA 2BWGA 4CQ8A 4CQAA 2PURA 1TB3A 1FCQA 3OVRA 3HGJA 2QCCA 1TQJA 3VE7A 3ZR4A 4O13A 5CZTA 3RFAA 4RZ6A 1LDCA 2V82A 4XKYB 2VXNA 4O50A 3NL6A 1EEPA 1TO3A 3NQMA 2Y63A 1DJNA 1ZAJA 1FWWA 3KVJA 1IIGA 3LHWA 5H91A 1SO6A 3QPZA 3QC3A 3VKJA 5FESA 3W2KA 1UCWA 1H63A 5SWUA 3NOEA 3NPWA 3L5AA 3T44A 4XWUA 1IXNA 2V0TA 5HR6A 3B03A 3TQKA 2OX1A 4JN6A 4W9TA 5CZJA 2Q8LA 3S6DA 3TMQA 1LORA 3OA3A 1LYXA 3W6YA 2CZEA 3EX6A 5TBOA 4PFMA 4N9DA 5DBUA 5FF0A 2QKFA 5KMYA 1C29A 4D2JA 3CWNA 3DU0A 5U4NA 4HPJA 3WK1A 1GG1A 4OHQA 1SU5A 1WA3A 5KITA 4JD4A 4HPXA 4OWGA 3R89A 5E1QA 1SO5A 3SI9A 1BKSA 1LBLA 4Q32A 1PVNA 3B4UA 1IXQA 1I4NA 1T96A 4GWEA 5FEWA 3TQVA 2VEMA 5HUOA 2NUYA 2WV8A 4A2RA 4O28A 4YMZA 5I3KA 1Y0EA 1ICSA 4ORIA 4QSHA 1P1XA 1QDSA 2F84A 3BW4A 3N9SA 2CU0A 5I3JA 2JGQA 3VNDA 3NQGA 4JX4A 3LRMA 4UFIA 1DORA 4RXGA 3W7DA 5FF3A 1A5BA 1RVGA 2QCMA 3IV3A 2ZZ2A 4GC4A 4ADSA 3GDTA 4UFHA 3MBDA 3RLVA 2EPHA 1ZY9A 3B8DA 5LHFA 3W84A 3WJSA 4JDYA 1G4SA 1VGAA 4TMBA 2DZTA 3B06A 1OFAA 3NZ1A 2E09A 3O6CA 1O5KA 3N14A 3L65A 3SGZA 4LC8A 5G1YA 1HTIA 3S5NA 5IBXA 3S9YA 3M47A 5BMXA 2VFEA 3GAYA 3NPVA 1EUNA 4M6VA 2QCDA 3M43A 3TNOA 1JRBA 4BK9A 3NZRA 4CNNA 2X2GA 1KM5A 3TROA 5EBUA 1H62A 1AW5A 2H3DA 1KV8A 3PG8A 4MYAA 4UFMA 5DCEA 1XBZA 4AWTA 1H7WA 5AC8A 1P0KA 3GLCA 2ZQ0A 2QCHA 1VYPX 2ZYFA 2RKXA 2QCLA 4DF0A 3OBKA 1TTQA 1XBXA 4DELA 4DPQA 1JCYA 1F73A 2WNZA 2A6LA 4KFPA 5DBTA 3MO7A 3LV5A 3BLIA 4PODA 4DQWA 3W7IA 4TMCA 2BX7A 3G1YA 1KM6A 1TPWA 3HF3A 5D05A 1WBHA 4K8HA 2Y7EA 3G1HA 4K36A 5AHNA 2EKCA 1U83A 2VOMA 3A5FA 4M6QA 2WPBA 4X22A 3BG5A 4XBSA 4LC6A 4P61A 3S1WA 2ZZ7A 3QQ1A 2TYSA 4LS2A 4Z1CA 4FXSA 3W7NA 1YXYA 5C54A 5C55A 1M7OA 3G0XA 1JJKA 1AK5A 5K9CA 5AC6A 2B7PA 2VEPA 3GXTA 2QAPA 2G96A 3P7YA 4UR8A 5TIMA 3P61A 3HGRA 2CLMA 2AAMA 1D3GA 1OFPA 4Z08A 3W9ZA 1GZGA 5EYWA 1XBYA 3MJYA 1AW2A 2D73A 1QWGA 2E6YA 2VKZG 1U5JA 3W1UA 4LUIA 3DGRA 1KV5A 3I68A 3T55A 3C3NA 5HINA 2R8WA 1PE1A 1W0MA 1WQ5A 4FX6M 2I1OA 3W88A 4O15A 1H7OA 4OQVA 4UTTC 1F05A 3CLMA 1B57A 3F1QA 2FJKA 5CG7A 4PL2A 1YTDA 2C16A 3C0JA 5BOOA 1QCWA 3W2MA 3HOJA 3B0UX 2QJIA 5DELA 3IGSA 1W3TA 3W7PA 5DLCA 4UMAA 1HO4A 3W1NA 3TDFA 1XM3A 2Y89A 3EX3A 4NVTA 4S1FA 4ZQNA 3NPUA 4O0KA 4LVAA 2P1FA 3EXSA 4QNWA 3W87A 2NX1A 1Q6LA 1QOPA 2YW4A 3NYZA 1JCNA 4AMAA 1ZAIA 2V30A 3EXTA 2E6AA 3LB0A 1OK4A 4JICA 3TJLA 1JCJA 3TCEA 3EB2A 1OABA 4IUOA 2ZFAA 5AHEA 4U4MA 3GDKA 2WOQA 3TR2A 1OX4B 1SFJA 1N55A 2A7RA 5DY3A 3KOFA 4TU1A 1YTKA 5TQLA 3NEVA 2QDHA 2JKEA 1UUOA 4AF0A 4IX0A 2HTMA 4H3DA 3P8JA 5D38A 1RQHA 4Y8FA 3BLEA 3LXAA 5D2VA 1R47A 4MY9A 3NVTA 2BXVA 3O63A 4LV4A 4GUJA 3TE9A 2QF7A 1MO0A 3PF3A 3UY7A 3FLUA 4O8RA 1D3HA 1OX6A 3L68A 1PHWA 3TXZA 3RK8A 3LXBA 1H7NA 4O4WA 1Z48A 1VHNA 3NNTA 4RX0A 1GEQA 4NX5A 1W54A 4N9CA 2WKJA 3TAOA 1GG0A 4JS3A 2GUUA 4LY8A 1I2OA 3LHTA 2NLIA 4IJBA 3TA6A 2A0NA 2VFHA 4DO6A 3N3MA 2Z1BA 1FBAA 3TKFA 3W07A 1IF2A 1W8SA 4MIMA 4X3ZA 1XL9A 1SQ7A 3TIMA 3IVTA 3KRUA 2FPVA 5AC7A 6ALDA 1MEHA 5DY2A 3P8IA 4MJMA 4I9AA 1LBMA 3W2NA 3BW3A 2CWNA 1YADA 1TTPA 5EMUA 3DZ1A 5K4ZA 4S2CA 3M5ZA 2C6QA 3Q37A 3H54A 4J9JA 4LU0A 3GR8A 1OF8A 1K7FA 3LX9A 3NA8A 4UTMA 4GJ1A 4OE7A 1ME7A 1BWKA 4JYDA 1GT8A 2GVLA 3NR0A 4A29A 3B04A 1XFBA 4ZQPA 3DFQA 4JR5A 4O1CA 3HBLA 5D32A 5FEZA 1GVSA 4LWWA 1DKWA 4ONVA 3GB6A 3SJ3A 2V9DA 2A6NA 4K39A 3EKZA 4JTKA 1THFD 3T40A 4WJEA 2A7NA 5I3GA 4N4QA 1BTMA 5G1TA 1LOQA 3QPYA 3UY8A 1WDWA 1XKYA 3UNDA 2H90A 3FJ6A 3G0UA 4EWND 2Y70A 3PY2A 1KFCA 3VE9A 4LVGA 3LRKA 2ISWA 4PTNA 4BI6A 2X16A 3NQAA 3A5VA 1ONRA 5G2WA 4XBKA 2PRMA 2Y6ZA 1PCWA 2OT1A 3PUOA 2C0AA 3Q94A 3W7QA 5LHEA 4K8EA 1GWJA 3G1XA 3U6WA 1IGSA 3LDVA 3I7QA 3DENA 5AYZA 2UV8G 3I7RA 4IXHA 5IBXC 1JUKA 3M16A 2NX9A 2NUWA 3DFNA 4OU1A 2FPTA 3GDLA 4WD0A 3BO9A 2Y85A 1MSSA 1DBTA 3HPXA 3RU6A 1Q6OA 1WX0A 1ICQA 4UTWA 4AHOA 3O6YX 1NF7A 4K38A 1G4TA 5K2ZA 2W6RA 3IGUA 3NDOA 4JTTA 3LHYA 1WYIA 1V5XA 2C3ZA 3QM3A 3W2LA 1KFEA 4NNAA 5D2YA 3CIXA 2YSWA 3PC0A 4JTEA 1OFRA 3W7MA 5IM51 3KXQA 4ZZ9A 1PL9A 4O54A 3QMRA 1TJPA 2ZRWA 3IVUA 5I3HA 1FCVA 2I9EA 4WQ6A 3D0CA 4QM1A 3CEUA 3NQDA 2YFOA 2QR6A 3STGA 2QJGA 1M6JA 2HSAA 3BVJA 4FIQA 5G2HA 4ZL1A 2ISSA 2AGKA 1GTHA 3OHIA 3W76A 3CU2A 1W3NA 4NJHA 5LNWA 5FF4A 4JGDA 3BPWA 2RH9A 5D2WA 1VPXA 3A21A 3ABSA 1T8XA 1UUMA 3W86A 4MZ1A 3LI1A 4ZVJA 1XUZA 1XUUA 3NGJA 3QF0A 1H51A 5AHIA 4PEKA 4UUIA 2KZHA 3LRLA 2QUVA 2VELA 3T4CA 3INPA 4ML9A 1KTBA 4O17A 2ZA1A 4OV9A 3FYPA 1S5TA 2AQWA 2X1UA 3EX1A 3DFSA 4WY0B 4JYFA 3T78A 4I7WA 3BARA 1IXOA 3GR7A 1TPDA 1VZWA 3JRKA 2Y7FA 1X1ZA 1ZFJA 4NU7A 3P82A 3B0VC 3SIZA 1YYAA 2ZTKA 1R2RA 3MP5A 3W2JA 1W1ZA 1D9EA 3UZJA 5LNSA 4UNLA 1SZFA 2JGYA 4MFDA 3G18A 3PBWA 2VEIA 1FQ0A 2JKAA 2Y62A 1OFBA 4LS0A 2ATMA 4O16A 3O06A 1QPOA 1ZHAA 4GUIA 1VQTA 3WJYA 2E5CA 3MHFA 3U2OA 2B7OA 2V5BA 6TIMA 1F5ZA 3KRZA 2JBMA 2YW3A 1EWEA 3STFA 1RQEA 2VFIA 3NQ8A 5EY5A 4N4PA 3EX4A 3QW3A 2WJZA 1SW7A 2A85A 1P0NA 3W7RA 4CCCA 1VYRA 3M5VA 2DORA 4UTTA 1ME9A 2DP3A 2WO5A 5G4EA 1A5CA 1W37A 4LV9A 4L4MA 2FLIA 4NXSA 4U28A 5LNUA 3EEGA 2EF9A 4JX6A 3QMTA 1R2TA 2NXIA 1JR1A 3HG3A 3QMSA 4NJKA 4UFLA 2NWSA 1FWSA 1FDJA 3E9AA 4N6EA 1OJXA 1HG3A 2VFGA 1F6PA 3DHFA 2E6FA 2Z6IA 3LHZA 3EX2A 5MHBA 2PRLA 3FJLA 3DH7A 3G0SA 4I7UA 4HSOA 4FXRA 3PB2A 3P5ZA 4LOCA 1ICPA 5LGZA 1ML1A 4FHAA 1KFLA 4WOZA 1KLYA 1GQNA 3G3DA 5D37A 3NAVA 1IIHA 4JNMA 4X2RA 1RV8A 3P67A 1TPEA 3LHVA 3TC7A 1TPFA 3L0NA 1EIXA 4G1KA 2V81A 2V8ZA 4KWWA 3V1PA 1LTDA 4RV8A 3MI6A 3MMTA 2O7SA 3L0GA 3PBVA 1VHCA 2WNNA 3IIOA 2YR1A 4O12A 4JEQA 3S5OA 4QAIA 3C56A 3N9RA 3I7SA 3MBFA 1H1YA 1GVQA 3S8HA 1NEYA 3W22A 2YFNA 3O15A 4POCA 4JYEA 1JUEA 3TQ0A 3BLFA 1DJQA 5F1UA 3I6RA 4IPJA 4E2BA 3C4UA 3N2MA 5KZMA 3DI0A 3E49A 5J5RA 5CZSA 1K7EA 2E5DA 3M5XA 3GYEA 1J4EA 3WK2A 3FEMA 3OEXA 4UMBA 2EAWA 2YYUA 3HPSA 3R12A 1KFJA 3FFSA 3PSWA 1VCGA 2Z6JA 3HGSA 4UTLA 1QR7A 1FDZA 1R2SA 3EWYA 1KM0A 1Z41A 5KINA 4NZFA 3UQNA 3U8GA 5D30A 4JIQA 4M7SA 1YDNA 3IRDA 4Z0SA 1X6UA 4R34A 4YLWA 3B0PA 4MJZA 5ABTA 4AWSA 1FCBA 4HT3A 2BZNA 2Q8ZA 2YZRA 1WOAA 3LCFA 3N19B 1BWLA 3MUXA 3BW2A 4FNQA 3MHGA 5A5WA 1VCVA 5KZDA 4HNUA 1G6CA 2DJLA 2A5HA 3FOKA 3PS7A 3DFTA 4O11A 4BWLA 3H53A 1R30A 4EVZA 3NM3A 4ZQCA 1G7UA 1NFBA 2P0OA 5AHMA 3DFPA 1EUAA 2PE4A 3NQFA 1B4KA 2QCNA 3P60A 1OYBA 5K4XA 3DXIA 3MP4A 1W56A 4JY8A 3WJWA 1TSIA 2GVGA 1FXPA 3UWYA 1H60A 1H1ZA 4GUHA 2ZZ4A 3PG9A 1QO2A 4CCDA 1OFQA 5D04C 2DZSA 2CW6A 2PCQA 3C61A 1T0OA 4WZHA 2I14A 4R53A 1T99A 1TQXA 2CLKA 3WK3A 1CX9A 4GRSA 3G1SA 3NXFA 3OVQA 5KSWA 4RLIA 2OZ0A 3MHUA 5CPOA 4IQLA 2XN0A 1VYSX 3GKFA 4WY0F 4TX9A 1TRDA 2HS6A 3SY5A 3L5MA 4IMEA 4ICNA 3E12A 2ZTJA 1J5TA 1O94A 2RDWA 3QRHA 3W7LA 1SZGA 2FDSA 5LGXA 4O18A 1HL2A 1K03A 4AHQA 1DOSA 1GVOA 3R13A 3M7WA 4OBTA 4AEOA 3KHJA 5U7SA 3W73A 3LHUA 1X7FA 4GFSA 3ATZA 3GVGA 1PHQA 1WV2A 1TYGA 5BNKA 2GJNA 1EPXA 2A2IA 4LTSA 4CLMA 4LW7A 2YPIA 4Z1AA 4HNNA 4Z1DA 4GNJA 1EP3A 1KTNA 2TMDA 1MXSA 3ABQA 4DEFA 2H3BA 3EWZA 1DHPA 3GZ3A 4MZYA 4IOTA 3NQ7A 2H8ZA 1VJIA 4RJEA 2WNQA 3IIPA 3QSRA 4OV4A 3M6YA 4HN4A 1LRTA 4S2BA 4CNPA 1YLVA 4A2SA 5G4WA 4QJ1A 4K7YA 4ZQRA 5EL1A 2FIQA 3W1TA 4Q33A 2E68A 3LLFA 1OX5A 4PH6A 4QISA 3PSVA 2W0UA 2C19A 3P84A 3W1AA 2R94A 1C9DA 1P4CA 4HNVA 3Q2DA 1Z42A 2J24A 5LSMA 4EF9A 3DKJA 3GIYA 3HQ1A 3OIXA 3M41A 1JCMP 4BR1A 5T26A 4K7VA 2QCDB 3NPXA 1DQXA 1G67A 4LVDA 4GBUA 4E0CA 1JULA 4PA8A 8TIMA 4DO5A 2JKPA 1ZCOA 4A3UA 3GKAA 3KFTA 3TC6A 3VCRA 2Y7DA 4R7JA 3V75A 3DI1A 2E1DA 3FYOA 1WAUA 4OT7A 4K6AA 4FNUA 5AFDA 2C15A 4HKPA 1ZALA 5CGQA 3TFCA 5DXYA 3E96A 4O19A 3PULA 1G69A 4AF0B 4UTKA 1H7PA 4YL2A 4O57A 4HNTA 4RZ5A 1K3UA 2G95A 3O16A 1TV7A 4LRSA 1M7PA 3NQEA 3W7KA 2CLLA 3NM1A 4IPIA 3HIJA 2IQTA 3SSJA 3TU9A 3H55A 1SO3A 1H61A 1W5MA 4NT0A 4PC8A 5BMWA 4RXFA 3FA5A 3L2IA 4AB4A 1XXXA 4MY8A 4M19A 1RD5A 2B0MA 3ELFA 4UCGA 2ZDRA 3C52A 2H6RA 1A50A 3STEA 2XFWA 4MY1A 4N6FA 3A9IA 2GOUA 3LERA 2ZCGA 3CTLA 3L5LA 1MZHA 3VFLA 5A8GA 2DZPA 3QYQA 3NQ2A 4QNEA 5D33A 2OJPA 4Q4KA 1HFBA 1LLWA 2ISVA 5K9XA 1QPQA 3M1ZA 1KM4A 1RQBA 2NXHA 3CC1A 3L67A 2BTMA 1LOLA 2HMCA 2EGZA 2GVJA 3LCHA 5L9FA 3CQ0A 4KFOA 4XQ6A 3PB0A 4P2VA 3NQCA 3OVPA 1KM1A 1NAL1 2RFGA 5C6MA 4A22A 4AWUA 3LCGA 2YYTA 4WXZA 4N2YA 5HWNA 5AYXA 4DO4A 3NQ6A 4ALDA 3KX6A 2CZDA 4O4VA
chains in the Genus database with same CATH superfamily
1B2YA 1V6YA 3WQFA 2J9YA 2J7CA 2GVYA 4DNMA 3K1GA 1BXCA 4CN4A 1ADOA 1X6LA 1F61A 3WBWA 2NQ5A 5KTLA 5I5RA 3PBUA 4ROQA 4GY1A 2ZRXA 3DBPA 2VR5A 1UH4A 3MUCA 5HUPA 4GO9A 3WJXA 4ADUA 2ZUWA 1RR2A 1TPH1 2WWDA 2IW0A 3W1MA 1RPXA 3T2PA 2BVTA 3W23A 1DWHM 3QSTA 1YXDA 3OZYA 3PVFA 4GIEA 4Z0JA 1J2BA 2Z7GA 3WMLA 1KKOA 1UD6A 1GKPA 2EKGA 2QLYA 1JCLA 5F4WA 2QAFA 5EMLA 4W8BA 2YCLB 3CWOX 3U2ZA 1FWTA 5A8PA 4JKMA 1KO0A 3VIIA 4LVBA 3T2QA 4V27A 3TAKA 2PP0A 2E5BA 4PSRA 5I00A 2ALRA 4NX0A 1L6GA 4HP5A 4H9XA 1JFXA 3UERA 2ZA3A 5DCBA 3KS5A 5AHLA 4BQ4A 4FOUA 5ECVA 1DIDA 1Q6GA 3BMXA 5AOUA 4FI4A 4LYRA 2HBXA 3VNLA 2F6UA 1AG1O 5FL1A 1JCXA 1W31A 1QAPA 2BLEA 1RBOB 1I9CB 4LVFA 1RJPA 2VM8A 3THAA 3RUBL 3GNXA 3UJSA 1KD0A 5K9DA 2VP8A 1VBHA 5FD0A 3DHUA 4MKNA 3W75A 1ADSA 1TWWA 3WQ5A 4RPQA 4HMEA 1PYFA 1Z7AA 3SEPA 2QV4A 4Q8PA 2YCEA 2YX0A 3C6CA 3Q45A 2V68A 3DKLA 1DXIA 3SCNA 3W2UA 5FEPA 3TW7A 3ID7A 4J2MA 2D22A 1VR6A 3D46A 1V7YA 3GC4A 2FKPA 2R6OA 1YPIA 3M6DA 5G1MA 4LT9A 3NL2A 5EMYA 2WHMA 4NZ1A 2PD9A 3UCCA 4L56A 1OBAA 1Z44A 1GW9A 1NOUA 1SZEA 3AZRA 2J79A 3CEPA 4DPPA 3TSMA 2YL9A 3C8FA 2WQPA 1PX4A 2IUZA 2F2KA 4CN6A 2PWDA 4LYPA 1UC4A 2OYMA 4L6HA 2ZICA 1ISZA 3WUFA 2GUBA 4D6FA 2Y1HA 4B4FA 3RPMA 2PTWA 1ZAHA 5EMMA 2V5LA 2PDHA 5LIUX 2NXGA 1FP9A 2XJ7A 2X30A 4B5TA 1DP0A 2VRJA 4PUNA 2G3JA 4F2TA 1GOMA 4AZ7A 5G2IA 2CPUA 3ZWTA 1QI3A 4BJHA 5C2CA 1QNOA 2VZSA 5KZEA 1LRQA 4E8CA 3PAJA 5EA9A 3GH5A 1W5QA 3WMBA 4EOUA 1ZNNA 1XSJA 2B4GA 2DIEA 4HOWA 1VAHA 5DO8A 1BVZA 1RY0A 4WHBA 2J25A 3N2XA 3GHUA 3WH6A 2X1TA 3MP3A 3HMCA 2QUUA 3W1RA 1F74A 1R5YA 1ZB5A 2C13A 2YL8A 1O4UA 2QIWA 5DMYA 2EJAA 2GK1A 1T8QA 1WE5A 1DTNA 1SJDA 1OF6A 3NL3A 1KFBA 1H7XA 2OSWA 2AL2B 1JI1A 1RK5A 4WR3A 2P10A 1OFDA 1YDOA 2RJGA 4LBSA 4C7FA 1XSKA 2OPJA 2OOGA 1L6YA 1FWNA 2PDCA 2VFFA 2EJ1A 1AVAA 2Y88A 3S1XA 1Q66A 4F0LA 2AL2A 3TUUA 2ZRYA 1YTEA 1G7VA 3TXVA 4JTFA 4GY0A 2VEKA 1EWDA 2ZA2A 3QV7A 5GQBA 3UR2A 4IIHA 3EDDA 4I7VA 5HANA 4QJ4B 2DJXA 3UYCA 3CL6A 3UXAA 4O1BA 4AEFA 2QJNA 2X41A 3DHDA 3VIOA 1GJPA 1RLCL 3MI3A 5A6JA 1L2QA 4Z2GA 2Z1KA 1M41A 4UMCA 1FWBC 4RKAA 3ALGA 3F4NA 2D3LA 4LUJA 1E71M 4IISA 3IK4A 4L1GA 3UZZA 1ME8A 2OEKA 4RDVA 2G8ZA 3NSMA 1OFOA 3RNDA 3MSRA 4DAIA 2ABBA 1TPVA 3H2EA 3MWAA 1NVMA 1AQHA 2VQTA 3N4EA 1J6PA 2DZWA 3IARA 2E4TA 3TJ4A 1G4PA 5GJMA 1IT8A 1VBUA 4LF2A 2POTA 3DFOA 2WC7A 5CPMA 4HYVA 5JU6A 1KM3A 3QV6A 1PCKA 1EP1A 4IGHA 1VEMA 4S39A 3S1VA 3HO8A 4RPPA 3TEVA 4PB3A 2BVDA 1OYCA 4C1NB 3HMJG 2VO5A 2J7BA 1MDLA 3SFWA 3QV8A 2QUNA 1XBVA 4NNCA 1GVFA 2CLFA 1BYBA 2PEVA 4E2OA 1ITUA 4S3DA 5E93A 1HJQA 3C2FA 4E2DA 1EHAA 1IEWA 2GSHA 2WZHA 3N6HA 3RYSA 4FXJA 5AC5A 3PR2A 4NZ3A 4FO4A 3S1UA 5CEWA 5HNUA 3ECQA 5HXMA 4Q8TA 4JFUA 2HNHA 3WLKX 2C14A 2GJRA 5CGMA 1CI1A 4Y90A 2A3AA 4DBWA 4O1DA 1FCUA 3B40A 3T9PA 1UD4A 3VKBA 1F2JA 1GOXA 1DQUA 2NQ9A 3EB4A 3E0IA 5I2UA 1OC5A 1RY8A 4Q8MA 4GXMA 4G2DA 1YNPA 3GNNA 4NP7A 4GH1A 1TPB1 3KS6A 4M7TA 4UTHA 3MYPA 2WSPA 3A4AA 3S42A 1TTIA 4M80A 1KFKA 1SGJA 1SPQA 4IGMA 1B54A 2FTPA 3GXPA 4Q6JA 3TH6A 4NUWA 4W89A 3PUGA 4AXKA 3SUUA 1OCQA 5A95A 2J7FA 3R10A 3PWGA 2ZDSA 3N73A 4BI5A 1E6NA 1Q3NA 4PMYA 1I75A 3R1ZA 4IHCA 4E4PA 1EFZA 4EXAA 1M5WA 4AC1X 1RPKA 4F8XA 2FB3A 3H2OA 1IWBA 5FF2A 3C2VA 1E0XA 1ZTVA 4JDBA 3I10A 1E72M 1NF0A 1O60A 4GX9A 3WF0A 4JCMA 5LIWX 4DXXA 1GW1A 3IEBA 3LCIA 1F4AA 1MQPA 1D7FA 4OIFA 3KEHA 2FGZA 4E4FA 4GUFA 3VIJA 2PDUA 1YBQB 1SW3A 1FUYA 3BQ5A 1WXYA 1MUWA 3MDUA 5JQ9A 2PDGA 2PDNA 2XVGA 3A23A 3SW6A 4XUGA 2PMQA 4ZSTA 4IM4A 1LLZA 1FH9A 1XLLA 3W24A 1VC4A 2FB2A 4G7EB 1SMAA 3L66A 1FFRA 3KUMA 1PBGA 4G7EA 4X0NA 2OSYA 2E3ZA 3VKDA 4NAFA 2VFDA 1FWRA 4L4LA 2VCAA 3AHXA 3AXKA 4WY0A 1KC7A 2J88A 3B9AA 3WLHA 3OZOA 4DZIA 2X1SA 2TPSA 1EP2A 4IMDA 3S2JA 1AJ0A 1A5AA 4Q7NA 2X1RA 2Z0IA 5JBFA 4MOZA 3C2OA 2Q3OA 4WKHA 1XG3A 5M3WA 4I9TA 4IMGA 1R3QA 4WXYA 1A5SA 2L5HA 1OB0A 2FMOA 3GW0A 4C1KA 1Z6KA 4EPDC 3E2RA 1A53A 1P5BA 2D2GA 3SY1A 3UWUA 2CXGA 4K1GA 1IWPA 5D03A 5HULA 3KAOA 3NO3A 2RGLA 1XKJA 3KWSA 1B3OA 3G22A 4GE8A 4AY7A 1OFEA 3PHAA 3GDMA 4XAFA 5DQPA 1N8FA 3VGHA 4FX8A 5DRCA 3EWBX 4QQUA 4C6NA 2QUTA 3DC8A 2ZVRA 2J8TA 3TMLA 3SY8A 1R85A 1Y65A 5HJLA 3R0UA 5DMMA 1HN1A 3G3MA 4GINA 2BWGA 1TB3A 4FPSA 3AHVA 3HGJA 4X2PA 1VJSA 1W3KA 3UCQA 1LDCA 2QHAA 9RUBA 3H2MA 3PJWA 1TO3A 3KL0A 1DJNA 3UW6A 3HURA 3LHWA 2XIMA 3QPZA 4JTDA 3QC3A 1KCXA 3IJLA 3TLLA 5FESA 3CAVA 3FA3A 3NPWA 4WJ8A 3L5AA 4XWUA 3WQDA 3LPFA 2Z24A 5HR6A 4JN6A 2VQUA 2Q8LA 3S6DA 4S23A 1LORA 1XYBA 2OZTA 1PYMA 2CZEA 4KRZA 3WEMA 1S38A 5TBOA 4PFMA 2XVPA 4LFYA 3OPSA 4NSBA 1ENUA 2P53A 3QZ6A 1A47A 4D6GA 5U4NA 4TOQA 4ZFMA 3PFRA 1J0IA 2WC4A 4RW3A 3I4KA 1AD1A 5KITA 4JD4A 4JHZA 5BZAA 3SI9A 4OJYA 3QV9A 1HKMA 4PCTA 1GQIA 4GWEA 3W25A 3RIKA 7A3HA 5CC7A 1HP5A 4GIYA 5I3KA 3EZ4A 1Y0EA 4QSHA 4MWAA 1GK8A 3NQGA 1A0CA 1DE6A 2C0HA 3BSGA 3T42A 5FF3A 4IIDA 1A5BA 1RVGA 2QCMA 4UFHA 3MBDA 4TTUA 4HBKA 1ZSXA 2EPHA 3UU0A 3B8DA 3DG6A 1EIBA 1CB2A 3HN3A 1VFTA 1P7TA 2AKMA 5HBFA 1VGAA 4TMBA 4PRWA 2DZTA 1FHLA 3OB8A 2Y8VA 1OFAA 3RLHA 1H5VA 3W82A 5I77A 3OLIA 3A47A 3SN4A 8XIAA 1HTIA 5IBXA 1W1YA 3M47A 3NPVA 1EUNA 2J62A 3NZRA 4CNNA 1A5LC 1H62A 3BUVA 1KV8A 1UOZA 5AC8A 2QCHA 2ZQ0A 2ZYFA 1QT1A 1S2CA 1TTQA 1XBXA 4B2DD 3MCOA 4DELA 2X09A 2Z1XA 4DPQA 2ZC1A 3S4TA 4D71A 1W1IE 5DBTA 1XIDA 4AZHA 3W7IA 3G1YA 2IPJA 4UR9A 1C7SA 3HF3A 1VF8A 2Y7EA 3TTEA 4K36A 3VA8A 1V6XA 3A5FA 1U83A 4UBPC 4X22A 3BG5A 3S1WA 2R82A 1GQKA 3O6AA 2TYSA 3WNKA 1R6WA 4KQNA 1KB3A 4FLSA 5C55A 3G0XA 1W32A 1POKA 1AK5A 3TA9A 4D8LA 1WZKA 5AC6A 2PDXA 4EAMA 1NOFA 1R87A 3GXTA 2QAPA 1HJSA 4AWEA 2XVLA 5TIMA 1MNZA 2REQA 4QG6A 4LCSA 1U5JA 3T55A 1W0MA 2JEQA 1H7OA 2BOEX 1TWZA 4UTTC 4C6EA 4DWSA 4UOJA 5C9WA 4PL2A 2ZVIA 3CNYA 3C0JA 3HQPA 1JPKA 4RV3A 3W2MA 4PSPA 3HOJA 4M51A 3BZJA 3R79A 5DELA 4ILSA 1R3VA 3W7PA 3AFBA 5BXPA 3W29A 1DIKA 3W1NA 4DY1A 2Y89A 2F61A 4NVTA 1QU4A 4S1FA 1PPIA 3PJUA 3RM4A 5FAGA 4LVAA 2WZIA 3EXSA 5JIWA 3AZTA 4DM2A 2V63A 4AX7A 1JGIA 1JCNA 1KRAC 2PTYA 1ZAIA 4AMAA 5FKYA 5A2BA 1OK4A 4DJEA 2PAJA 4JICA 1JCJA 3TCEA 1OABA 3FK4A 2ZFAA 4U4MA 1OX4B 4PCNA 2A7RA 3KOFA 4D9PA 4TU1A 1HF6A 2IXVA 1D8WA 2R9RA 4AF0A 2IQDA 5EMKA 2GZXA 4IX0A 5DF0A 4H3DA 3KTXA 4QE4A 4XUYA 4AVNA 2WCGA 3S6OA 5A6KA 2XZ9A 4MY9A 1B9ZA 2PI6A 2XIOA 4XZWA 4G6CA 1I60A 5DMLA 4O8RA 1V0KA 2DUAA 3RK8A 1RCXB 5BROA 4O4WA 4ZB0A 4L9YA 2BHZA 3N2TA 5TNVA 3POHA 3QY6A 3FJ4A 2NLIA 1JF5A 3U57A 3A64A 2VFHA 4DO6A 4S3KA 2Z1BA 1KR1A 1IF2A 1R86A 4X63A 4MIMA 4X3ZA 3TIMA 2ZXQA 3IVTA 2FPVA 1MEHA 1S2AA 1Y5XA 3P8IA 2YB1A 1DWIM 3ES7A 3UEQA 4B90A 4NRRA 3W2NA 1J11A 1VB9A 4J27A 3WDPP 1J12A 5EMUA 5K4ZA 2C6QA 1DIOA 1XRFA 3GR8A 1OF8A 2E67A 1XPGA 1R9ZA 1TR1A 3G77A 4UTMA 3LK6A 3CL8A 1ME7A 1BWKA 1CXFA 1UWIA 4MF4A 2CERA 1LLOA 4JR5A 1PTGA 4C6JA 1GVSA 4ONVA 3WBAA 3M0VA 3EKZA 3TR9A 1THFD 1XC6A 3T40A 4GZIA 4HHLA 4FF5A 4XZIA 4N4QA 2ZADA 4AUBA 3AIQA 3QPYA 1XKYA 1AD4A 4MB4A 4LVGA 2ISWA 3N6JA 2X16A 6REQB 3WNNA 3V3WA 2EG7A 1CXKA 2Y6ZA 5I23A 3G1XA 3TYDA 3RMEA 1BGAA 1L0PA 1XLFA 5AYZA 3AROA 2UV8G 3RRAA 3VD5A 4IXHA 3Q67A 4D8ZA 4JQ1A 4CU6A 3WD1A 2PGFA 3HPXA 3RU6A 4DX3A 2AGTA 1V0NA 1WX0A 3ZJ7A 2R1KA 1ICQA 1OWQA 4UTWA 4AHOA 4TVCA 1G4TA 5K2ZA 1DTUA 2W6RA 3NVDA 3IGUA 3UR8A 5CSYA 3IRSA 1TE6A 5GPRA 2REQB 4JIHA 4XKMA 2YSWA 4JTEA 2WBKA 3B97A 5JIPA 1I6NA 5HMDA 2XZ7A 2HROA 5JUVA 2CKSA 2XH7A 1N8WA 2OTDA 3AI0A 3C86A 4QM1A 3ME3A 3VYLA 3EMCA 4PCSA 2R24A 3B9NA 1IGWA 1DJGA 2ISSA 2QMKA 4GZ7A 1GTHA 1Q63A 1W3NA 5T9CE 4NJHA 5D2WA 3GHSA 5H1WA 3TJIA 3K1DA 3VX0A 2DSKA 3LI1A 1UR9A 4ZVJA 2VUNA 3NGJA 4FK9A 2ACQA 1WKDA 3UJ2A 2GQ3A 3T4CA 1F3XA 4Q4MA 4FMVA 2NQJA 3FYPA 4GA8A 2ZWYA 1S5TA 2AQWA 4JFVA 3EX1A 3F2DA 4MAVA 2O9RA 4QBXA 5LA2A 3NURA 2ANUA 3GR7A 1TPDA 4JFSA 4BF5A 2ZXDA 4Y9PA 3S3GA 1Q5MA 5EMJA 3HA1A 1HNYA 4GKTA 3SIZA 1R2RA 3EDEA 4ACYA 3VMPA 2E9LA 2V38A 3CO8A 5LNSA 2DT0A 2JGYA 2GSJA 5E9AA 1P6CA 4XG1A 4MFDA 5A3HA 3VXGA 4RL3A 3WF4A 4ATLA 1JD9A 2VHLA 3C0LA 4S3CA 3R58A 3TYAA 1EGZA 2E5CA 3U2OA 2V5BA 4UNIA 6TIMA 2VT0A 1F5ZA 2JQXA 4ML4A 4CVWA 4AQLA 1TV4A 1JI2A 2JBMA 2YW3A 2YL5A 1RQEA 2JIWA 1GHRA 4DZ5A 4GIAA 3EX4A 1MMFA 2AKZA 3CZLA 1XLIA 3QW3A 1QJWA 1SW7A 3DBNA 3M5VA 1PZ3A 3R25A 2DP3A 2WO5A 2XSAA 4LV9A 3VUPA 1R7OA 2YBUA 4NXSA 3TCSA 4H7VA 3QMTA 2FHFA 1R2TA 1WZLA 1S46A 1VP5A 3HG3A 5D9MA 2W61A 5CC6A 5AY7A 1UJQA 1FDJA 4DVOA 4N6EA 1OJXA 3VD9A 1YHTA 1FVPA 2EO7A 2E6FA 5MHBA 4S3FA 1V3KA 2H9AA 1EC9A 4NZCA 1CDGA 2W63A 1ICPA 2J77A 4IPLA 1ML1A 2V6AA 1KLYA 4QE5A 2GJPA 3NAVA 1IIHA 3MCNA 4X2RA 3MZ2A 2WMIB 4LY4A 3CS2A 4JFWA 4AYGA 1KCLA 3C0SA 2OZ8A 2V8ZA 1LTDA 3UESA 4RV8A 9CGTA 2O7SA 3U7VA 3O3RA 3W28A 1QRQA 1R8LA 3IIOA 3BCJA 1DWJM 4QRNA 4NZ4A 1J9YA 1EJWC 3MBFA 1GVQA 4CD6A 2DT2A 3SQMA 4D6DA 1KNWA 3O15A 4JYEA 3VAVA 2NSOA 2P3ZA 5F1UA 2QPXA 1TV2A 5C9RA 5CZSA 4TQTA 3CHDA 3F4DA 5I6SA 4TXEA 1Q2SA 1BG9A 3NGFA 1NWUA 4H8HA 1X7IA 1ZBKA 1RHCA 3FFSA 3WSUA 3ES8A 4XBJA 4L5ZA 4IQEA 3C0QA 1FDZA 1KM0A 1Z41A 4NZFA 5D30A 3H8AA 1YDNA 1EGVA 3ARZA 1BGGA 4LX4A 3L2LA 4R34A 4YLWA 5ABTA 2DUZA 2DDXA 3MWCA 4AZCB 2YZRA 3E5BA 1WOAA 1SR0A 1XX1A 3ARUA 4QP0A 4FNQA 1VCVA 5KZDA 2CIPA 3FOKA 4O11A 5RUBA 4LAMA 3H53A 2BXZA 2ZE0A 3NM3A 4MDPA 2P0OA 3DFPA 1JXJA 1CXIA 2PE4A 3IJ9A 2QCNA 2FH6A 3P60A 4H6EA 1GOIA 5C8BB 1XGDA 3DXIA 2OWCA 1W56A 2NQLA 1FXPA 5T9BG 3ICJA 4EAYA 1H1ZA 2BBFA 4GUHA 4JHOA 4CCDA 4REQA 1EQPA 4Q7IA 3DC0A 2OYLA 1JF6A 2CW6A 1NFPA 3PWIA 1T99A 3ARVA 3MTWA 2CLKA 3WK3A 3LG3A 2P5NA 3G1SA 1AH0A 3OVQA 3QHOA 1BPLB 5CPOA 2F6XA 4H9MA 3SRKA 2D0HA 2ZX5A 2BODX 4PGLA 3UXLA 1J01A 3SY5A 3WDRA 5HNNA 2AMXA 3ITLA 5JMUA 1J0ZA 5BOEA 2RDWA 1SJBA 1ZCCA 3W7LA 3WBEA 5LGXA 3GZAA 2YCJA 5U7SA 4YN5A 3E5PA 1EXBA 2VZVA 4EKJA 4DI9A 5BNKA 1T40A 2GJNA 2A2IA 4Z1AA 1KTNA 5A8QA 1HIZA 1QK2A 4MSSA 4FLRA 3UFYA 3WH8A 3EWZA 4NI8A 1V3LA 3V18A 4EE9A 3GZ3A 4MZYA 4IOTA 4NAEB 1VJIA 2ZUSA 2CLPA 1H0IA 3E2QA 4MB1A 3M6YA 1OM0A 3AMLA 4HYRA 1LRTA 1A3WA 5G4WA 1MWOA 2R1MA 8CGTA 4QAWA 4IIFA 2OLSA 1EYWA 3QR1A 3LLFA 1OX5A 2D1ZA 3IAQA 2C19A 4ICCX 4BEQA 1P4CA 4HNVA 3V0TA 1Z42A 4EF9A 2O9PA 3VK5A 3OIXA 4KWSA 4Z17A 5T26A 4K7VA 2X42A 2QCDB 3AISA 4GO8A 3MMDA 4L9XA 1KBBA 5DMNA 5REQB 3FYOA 1WAUA 3NEHA 3OYXA 4FNUA 2XIQA 2DT3A 4HKPA 4AD0A 6REQA 1ZALA 1JFHA 1XLKA 3TFCA 5DXYA 2G50A 3CUIA 2HVOA 1E6ZA 1H7PA 4UOZA 4HOXA 3DG3A 3CV2A 3KDNA 4O57A 2F6KA 3VKCA 4GK8A 4L9ZA 1QVBA 2CLLA 3NM1A 4DYEA 5FOOA 2IQTA 4A05A 2W9MA 1UA7A 3AIRA 1VPYA 3GHRA 4J35A 1XXXA 4B5VA 4M19A 3EPMA 1R3TA 1RD5A 3ELFA 2ZDRA 2H6RA 2PTXA 3SUTA 3QHMA 1UKTA 4F0SA 4N6FA 1K6AA 1MZHA 4LEQA 5A8GA 3QYQA 1XQLA 2J13A 5K9XA 1QPQA 3E0FA 3I3BA 1KM4A 1O7AA 4ZE5A 4DYJA 2NXHA 3VNJA 1YMYA 1X38A 2EGZA 2IPWA 3CQ0A 5TF0A 5A8NA 1QBBA 3PB0A 2E40A 4QTGA 3CYJA 5HQLA 2GDQA 4A22A 1W91A 4YTRA 3GU1A 2BASA 2YYTA 1UKSA 5IFPA 1QI2A 3OIHA 2J75A 1UBPC 5H2ZA 5CJNA 3UETA 1NQKA 3LXCA 1H5YA 7TIMA 2ZZ3A 5ABGA 3TTYA 4U2ZA 1XLAA 1E1CB 2OCZA 2YBTA 4PL1A 5M03A 5FIPA 3AO0A 2VEGA 3CQKA 3AHZA 4V28A 3USZA 1PX3A 3C2RA 1UH3A 2NW0A 3SCVA 1XLBA 4YWIA 2W66A 2HVMA 5LXXA 1BFNA 2BHUA 4QSFA 2C8NA 2PUZA 3IJ7A 5BYWA 4J4KA 2VX7A 4NNBA 1S2VA 4LAKA 4A8LA 3B8WA 2F38A 1V93A 3BLKA 4PN2A 5A2CA 1TJ0A 2OEJA 3WK0A 2CHNA 3IGXA 1X39A 4I6VA 4RCXA 1C8VA 1C91A 2W3ZA 1UWRA 5J8LA 5AVNA 5I78A 3V16A 4B5WA 1OCJA 1HP4A 3DYOA 3IJ6A 5CZKA 4R3UA 1CYGA 2FQIA 3LD5A 2DIJA 3T07A 1SSGA 4LBUA 4GBDA 3CIWA 4QROA 3TFXA 7ODCA 3CIVA 1QFEA 3UR7A 1HW6A 2R91A 4D6JA 3BMVA 4QITA 3RLGA 4HJWA 1XCFA 1WO2A 1H7RA 1DV7A 4MWAB 3VZZA 1KXTA 4DWSD 1ZP3A 1JG9A 3PTKA 1YXCA 1GJWA 1J0KA 2FGLA 1K02A 4A8IA 3QW4B 3BLPX 4KCUA 1YDVA 1K9TA 3LOTA 4W8AA 1E3XA 1TPUA 3POCA 4QCFA 3WF3A 3RAOA 1TPC1 1ISYA 1GVRA 5I3FA 2XTKA 4TVDA 4JKLA 3OQEA 1JDDA 4GACA 1KBLA 4CQDA 5J04A 3HPAA 5F2MA 2JK2A 3ABOA 1V0MA 3RJXA 3W6MA 2XIJA 4ZEPA 3VOGA 3IK2A 5HMSA 3UPMA 3KCJA 3GS6A 1F7BA 2RAGA 3VZXA 5ABHA 4IIBA 3ANYA 4K37A 2E1WA 1W9UA 3T7VA 1LOSA 3NG3A 4Z2IA 4FEZA 3QBUA 1VFUA 1N8IA 3AXIA 4ZO6A 2QCEA 3OZMA 2VZTA 1TZ7A 3IIXA 2BOGX 1VLWA 1TE1A 1BAGA 4P8XA 2QJHA 4FAMA 2UY4A 3DFYA 4FNPA 1EJRC 1WDQA 4A3YA 3LA4A 2ZXBA 1V08A 1M3UA 4UFKA 2WW5A 9XIAA 2V2CA 1Q6CA 3EKGA 4NL1A 2EPOA 3DUGA 1F6KA 3SFKA 4Q4QA 8A3HA 3UXDA 3H4XA 1M65A 3UWWA 3CB3A 3S5ZA 4DJDC 2C79A 1N82A 3URBA 5C5YA 3CT7A 5E09A 2I5QA 4CEUC 4ADTA 3W26A 3TYUA 4PR4A 2PLKA 3WNLA 4IMFA 1NSJA 3IVSA 4C7DA 2O7QA 4ECLA 3T0DA 4JOMA 2WNWA 3TNBA 1G9HA 3AMGA 3HG5A 1E9YB 3JR2A 3GK0A 2DZVA 4ZOBA 4LRTA 3R8HA 4PYSA 3VKKA 5CJ5A 2DSWA 3RF9A 4Q7BA 4L4OA 4R7OA 5LIYX 1E6QM 2YLAA 3FHAA 5HPOA 4LH8A 3BOXA 3APYA 2VENA 1GKRA 4YXGA 1K6WA 3TX9A 3O0KA 3W7EA 1IZKA 3LLDA 4TIMA 4DLFA 3EGJA 1KTCA 2X1IA 5LNRA 4YCPA 3N13A 2WZTA 3F5JA 2QCGA 3MY9A 2FFCA 5F4SA 4XTDA 2FVKA 4HHHA 3EAUA 1UP0A 4W7UA 4C65A 3G1VA 3MMWA 2R14A 1I2NA 4JTUA 2A21A 1PAMA 4AIEA 3BQ6A 2P76A 1UD8A 3EOEA 1TUFA 4ZO8A 1OK6A 5H6HA 3WG6A 3SDOA 3CAWA 3R8RA 3PM6A 1E1EA 5F2IA 4RR4A 4NJJA 3OHMB 4TV5A 1B1YA 3GX9A 1RZMA 3QGKC 2GQAA 2HEJA 3A22A 3PBMA 1OHLA 1KXQA 2J27A 2JEPA 8XIMA 2VCBA 1PKLA 4HU4A 1UH2A 2DZAA 2NT0A 3TV8A 2JIEA 3IWPA 4J3VA 3V5CA 1WZAA 3O8AA 3ZS4A 4AH7A 3VZYA 5HK4A 4GPNA 4NASA 3EWCA 4AZ5A 4X9SA 1S5WA 3CXOA 3P0XA 2WXDM 3UWVA 2G97A 3WQEA 1TV3A 7REQA 1J2WA 1PTAA 4WDXA 1TIMA 4X61A 2PDIA 2WSQA 3EXRA 2ZUTA 1Q85A 3WJZA 3M46A 5D09A 4F48A 2JF6A 1SW0A 1XF0A 4YCOA 2QVHA 3TWBA 2ICSA 5D8ZA 3A24A 3R0KA 1OT1A 4CD4A 1WOBA 1W5PA 2YCIX 1AW1A 3E0LA 4P8WA 2OX4A 3DIPA 3VKAA 3VGEA 1XIHA 4TO8A 3M0HA 3GC5A 2HK1A 5E9XA 3CAQA 4XAZA 1MDRA 2P0IA 2WB5A 1XGZA 3QKEA 3B9OA 1LRNA 4PE8A 4ZB5A 2GFTA 1IZCA 1S3TC 1VJZA 1GOWA 2DH2A 1FHDA 4F0HA 4L61A 3ISIX 2BHYA 4AVFA 4W88A 4HSNA 2WMIA 3B0YA 2ATSA 3QGAC 3W1XA 3BMWA 3D47A 4IP4A 1PZ0A 4HPNA 1K8YA 1SZRA 3M9YA 3ZWSA 2ZOXA 1BQCA 3WL0A 3ORWA 4JQAA 5DN1A 9XIMA 3WKZA 1AJZA 4LF1A 2TRSA 1DL3A 1XINA 2PC4A 3MUAA 2CLOA 3DCPA 4HYWA 4H8VA 2ABAA 4UZUA 3S6TA 3K30A 4EANA 3F2CA 3VOCA 4XZ9A 4FNRA 3LI0A 4A21A 2GGJA 4X9YA 2FDMA 2XH0A 4UTWC 3GNDA 1C8YA 3GXFA 2PRHA 4FIRA 1DVJA 4Z2JA 4BEUA 1K8XA 1BXNA 1M7JA 4GUGA 1TMHA 3RJYA 1LT7A 5FACA 3UXIA 3H7RA 2RJHA 4L6OA 1WBJA 4YYFA 4GABA 3SR7A 4GFIA 3KRSA 4PCFA 4AZCA 1GORA 2XFFA 5CCZA 3L7RA 2X7VA 2WKLA 1SZNA 1K7XA 4ZQMA 3HGOA 4NI3A 2WHKA 4JTRA 3JS3A 3KBMA 3PJTA 1KR0A 4QGCA 4JTLA 3DDMA 3FGCB 2A4AA 4W8LA 2O92A 4P7LA 3ZR5A 3W83A 1SSDA 5F1VA 1OC7A 2WJEA 1EB3A 4D6EA 3KRBA 2OT0A 4BQ3A 4W7VA 5ECUA 2G37A 1J93A 3UPWA 1Z3NA 1LWJA 2MANA 2J9XA 5C71A 3GXDA 3NSNA 1JUBA 1WUFA 1XH0A 2PC8A 4OVXA 3Q58A 3N34A 3D6NA 1LQAA 1POJA 4OGZA 4GXPA 2A3HA 3DFHA 4Y2WA 5GVJA 5IDIA 4DF2A 3GW3A 3IIVA 1UZ4A 4GMEA 3VIPA 3PN8A 2BNJA 2JF7A 2HPMA 5EPDA 3MZNA 5DT5A 3WFAA 4N7QA 1TV5A 3WL1A 1PIIA 4YWSA 4LS1A 2W79A 1I2PA 3SSZA 1VLIA 2ZX8A 4Z2HA 1UA3A 2R1LA 5AN7A 4US6A 1V3MA 4DHGA 1KXVA 4WCJA 2G3NA 4CGTA 5J5DA 5C0QA 4UTJA 2ZRZA 4UTUA 4JTCA 3EYPA 1GVYA 4AG0A 2GPTA 2XIIA 3EWUA 1QNSA 2XM2A 1GYNA 1OG0A 4BKNA 2V2DA 2WLYA 3CB8A 4DWSC 3LCWA 1A5UA 5C2XA 2Q6ZA 4A4AA 3WQWA 2W27A 1XW8A 4V15A 2INEA 2JFEX 4JTJA 4E38A 3B05A 1B9BA 3VMOA 3YPIA 4IFRA 3QGVA 4W84A 3WBXA 2QDGA 3IJQA 1FWHC 5DX7A 4CQ8A 3EPOA 1A3XA 3TN3A 1BWVA 1TQJA 5LA0A 5CZTA 3U5UA 2VDGA 1VBRA 2GK1B 4RZ6A 1GZJA 5CBJA 3WZ0E 4O50A 3THCA 4IP7A 3NQMA 2G0WA 2Y63A 2G3IA 3KVJA 4GLEA 5H91A 3CHEA 1BRLB 3AYRA 3VKJA 3REQA 3W2KA 3PBGA 2DT1A 3RU8X 3FVDA 3G1RA 1XLDA 2NT1A 1A4MA 4URIA 2V0TA 1MW0A 1IQ8A 3TQKA 3P3BA 2OX1A 1CENA 4GI9A 3TMQA 1KFWA 3VIHA 1PXGA 3HQNA 4B2DA 1W1PA 1E0WA 4RW5A 4N9DA 3KLKA 2WMJA 3SUSA 1KRBC 1H09A 3V7PA 3DU0A 1K70A 2X05A 4D6IA 2V5JA 1WA3A 2BY3A 3FDGA 3MKVA 4HPXA 2PBGA 5E1QA 4H2HA 4HOZA 1BKSA 4M29A 2QVNA 3TQVA 5HUOA 4K8GA 2NUYA 4A2RA 4YMZA 2QJJA 4GOAA 4ORIA 3OLGA 2XISA 2CU0A 4IGSA 5FJOA 1DORA 4RXGA 1F3TA 4MNMA 3MT1A 3DEQA 1UD3A 3VIMA 3RLVA 4WLCA 3AXMA 5CPTA 5LHFA 4B15A 1W9PA 3W84A 4JNZA 3STPA 3QZAA 3S47A 1TWIA 3DHPA 3N1AA 3O6CA 2I9UA 1LWIA 1TELA 1BYAA 2A79A 2VFEA 4KH2A 4M6VA 1ZU8A 4RDYA 1WB0A 2X2GA 1DJHA 1KM5A 4JFTA 5EBUA 3TROA 1X6NA 2H3DA 4MYAA 3U2CA 4AWTA 1H7WA 1P0KA 1VYPX 4H00A 3OBKA 2D69A 2DQXA 4CKQA 3ARWA 2YXOA 3CMFA 1Q7ZA 4WKAA 4B3LA 2WNZA 3H4WA 2A6LA 1HKVA 2D20A 4ZE4A 4FOJA 5BXSA 3BLIA 4PODA 4F9JA 3W0KA 2R1NA 4S3BA 1JPMA 1NQ6A 5D05A 3G1HA 5AHNA 5BRQA 2EKCA 1VBGA 2WPBA 2CBIA 3R4IA 4HNOA 2PWFA 3GG8A 4RE0A 2QIIA 3PFMA 3GG7A 4YJ5A 2MNRA 4FXSA 1YXYA 1M7OA 5CG0A 4XZHA 2CYGA 3UF9A 3VNMA 2VEPA 3KZPA 1UR1A 4UR8A 4HA3A 3WD2A 3B3DA 3VPLA 1OFPA 3VCCA 4Z08A 3W9ZA 1GZGA 1FKWA 1XBYA 4K1WA 2VKZG 4LUIA 3DGRA 3XISA 3W38A 2WVTA 1KRCC 1XIJA 3AQUA 3S2NA 5HINA 4PBEA 1UP3A 3TYBA 2I1OA 3W88A 4O15A 2VCCA 2FGBA 4OQVA 4H1ZA 1F05A 3VD7A 2WBGA 1JAKA 1E43A 1YTDA 3T81A 2Z29A 1W3HA 3PNUA 1RP9A 3IGSA 3S2LA 2QDDA 3AIVA 4XIAA 2CHRA 2OKOA 3ZSTA 3NDYA 1J96A 3BICA 4XV0A 5H8MA 1QOPA 2YW4A 3NYZA 2DY3A 3EXTA 3TN6A 1EC8A 1OINA 1QNRA 1KCKA 5FJRA 1L6FA 1NOWA 5AHEA 5REQA 2WOQA 3TR2A 3BV7A 4DM1A 1SFJA 3PPGA 1VPQA 2J7HA 2XINA 2XG9A 1YTKA 3TYEA 2F2HA 3GTHA 2PF0A 4F3HA 1ZBVA 2YB4A 5C9UA 5FJTA 3LXAA 2PWEA 2XGZA 3S5SA 2DW7A 2UY3A 3GM8A 2VUYA 3IUIA 3O63A 1CZ1A 3PTDA 2CZVA 3TE9A 2QF7A 4F66A 1MO0A 3PF3A 3FLUA 4TX6A 2OU4A 1H7NA 4GHRA 1HKJA 4J5NA 3NNTA 1GEQA 3KE0A 2G41A 1R3SA 4JS3A 2GUUA 1TJ2A 1JZ4A 2BFGA 1XYMA 1I2OA 3DG7A 1S1RA 3KOYA 3PJXA 3H70A 4R88A 6PTDA 1ZS2A 2QPSA 1NTHA 1W8SA 2HBVA 2GWNA 5AC7A 5DY2A 1OZMA 4Z2LA 4I9AA 4MWAD 3WMCA 3IACA 2PCEA 4Q6XA 5IOBA 3CZGA 3ARXA 1JL8A 3GBEA 2JE8A 1YADA 2P50A 1Q6DA 4J1OA 1U1JA 3DZ1A 2OO6A 4JCLA 3Q37A 4LU0A 3LX9A 3M0JA 3CUGA 4JYDA 4XO7A 4A29A 1B90A 1XFBA 1JDFA 1W9XA 1HJXA 2FJUB 3GIQA 3WEOA 5D32A 3S46A 2SFPA 1NJJA 3L2MA 3RM9A 2V9DA 4WJEA 2BGNE 2A7NA 4S3JA 4S38A 4B3ZA 1UPPA 1WDDA 3C3UA 3LPGA 5E0FA 1LOQA 2PDMA 4OBSA 2BB0A 4LQ1A 3UY8A 2H90A 4EWND 2Y70A 4KRUA 2X0YA 5CGTA 2DZBA 4BI6A 4D72A 2OOFA 4H9ZA 2Z28A 3A5VA 4HU3A 4BS0A 3ZVHA 5LHEA 4K8EA 1GWJA 3QTGA 1KWKA 2F8QA 3B8VA 4WIWA 1BVNP 1IGSA 1SFTA 3I7QA 1JUKA 1XLJA 4I3GA 4WD0A 3AIEA 1DBTA 1E4LA 3QOKA 4DJED 2J66A 1EA9C 3PP7A 3U7BA 4PB5A 3KP1A 4K38A 3V4BA 3GTXA 3NDOA 3LHYA 1LL7A 3UXKA 4EX4A 3H2AA 4CVUA 1R3WA 1V5XA 2C3ZA 2V67A 3QM3A 2Y8KA 4Q4OA 3RCYA 1KFEA 3PC0A 1EO7A 4YIWA 3W7MA 4G9PA 3SB0A 2BMBA 2ZXAA 5FJUA 1PL9A 3SCWA 2BS9A 1FCVA 2I9EA 3D0CA 3NQDA 2QR6A 3STGA 1W2VA 2QJGA 1M6JA 5JH2A 3N2BA 1IT7A 4U3CA 5G2HA 2AGKA 4YYCA 1VFFA 3AS0A 3E0WA 1QPKA 3W27A 3OHIA 3GFYA 3NIYA 4AY1A 1YQ2A 3NO1A 1T8XA 2YA0A 4QX4A 2OYKA 3BOLA 1A5KC 1EJXC 2OLHA 4J3TA 2P3EA 2VR4A 3LZ5A 1FTXA 1Y7VA 2QUVA 4HZ6A 1KTBA 1VFOA 4OV9A 3URQA 2WJFA 2X1UA 3SRDA 4I7WA 3GE7A 3BARA 4M24A 3QY7A 3JRKA 1X1ZA 1XLCA 3WD4A 5A8OA 2PDBA 4KRTA 3MP5A 1W1ZA 1WDRA 1UWQA 1QTWA 3OO2A 5C7HA 5C9ZA 2ZKMX 4R27A 1G0CA 1S2WA 3PBWA 3VDHA 3K8LA 1FQ0A 1KGWA 1K9FA 4XD6A 4GUIA 1VQTA 3MHFA 1R38A 2B7OA 2OGYA 3OU8A 1OD8A 4CD7A 3HV9A 2HDJA 1QATA 3ABXA 1AODA 3I3DA 2VFIA 5EY5A 1PZ2A 4N4PA 2IMRA 2PDLA 2WJZA 2AQVA 2A85A 1E55A 1P0NA 4MWAC 1KKRA 3P93A 4CCCA 3G6MA 4UTTA 3OW1A 5IRPA 2J78A 2Z26A 3BTNA 1G01A 5G4EA 1W37A 1ZJAA 3CQHA 4QLKA 4CCZA 2FLIA 4U28A 2WHLA 5LNUA 2EF9A 6A3HA 1A5OC 1JR1A 2VC9A 3QMSA 4NJKA 4UFLA 4C91A 1CNVA 3CK5A 4JKKA 1FWEC 3BAIA 1HG3A 3SUVA 6ENLA 3DHFA 3LHZA 1CLVA 2PRLA 4PUJA 3BAJA 4LOCA 5LGZA 5FA5A 4F79A 4WOZA 2PP1A 4M1RA 3LY0A 3FNDA 1E6XM 4UQEA 2C1GA 1TPEA 2GDUA 3TC7A 2V81A 3FCPA 2WZEA 3ENLA 2EQDA 4JQ4A 1GNXA 3MI6A 1E6RA 1OSEA 1JPIA 3MMTA 1PJ9A 5B7YA 3PBVA 1LQ2A 2WNNA 4Q4RA 3M0LA 1O68A 4QAIA 3N9RA 4I5XA 1REQB 1OIFA 1V7AA 3S8HA 3UGRA 1B5TA 2C1IA 3W22A 4INFA 5CSUA 1JUEA 3TQ0A 4HPHA 2JALA 3ZQ9A 2DSUA 1ZUAX 4IPJA 1IEXA 3N2MA 3DI0A 7CGTA 4HPGA 5DT7A 1EBHA 1K7EA 3M5XA 4EPEC 3HTWA 1J4EA 1RSCA 2WMHA 3OEXA 4UMBA 1OT2A 3CV6A 2WVUA 3R12A 1WKEA 3DERA 4E2VA 3PSWA 1RH9A 2Z6JA 1QR7A 3GTIA 2VDHA 3EWYA 1TUXA 4WGXA 3VOFA 2GJXA 3U8GA 4JIQA 1P48A 1ADDA 4MJZA 5KEZA 1EF3A 1MQRA 1FCBA 1UKOA 2BZNA 3GNOA 4J40A 3SADA 3BW2A 3ZSSA 1XYAA 4OOZA 1JDEA 4HNUA 2WCAA 3AXHA 2DJLA 2XFYA 4Z2KA 4BWLA 2YDSA 4ZQCA 2O56A 1DXEA 5I02A 4C60A 1OYBA 1LJYA 1RXOB 3MP4A 1HL9A 4C6IA 2EPLX 3WJWA 1TSIA 3TTOA 1B31A 3R94A 4O0QA 3JZUA 3PG9A 1QO2A 4D6HA 1AFSA 1PZ1A 3WDHA 5D04C 3BC9A 5IHSA 3C61A 3N4FA 3WBYA 1NWSA 5CXPA 3D5HA 5ABFB 1ZBCA 1XS2A 3NXFA 3B0XA 2PDYA 3TP4A 1ONEA 5KSWA 4HK5A 2OZ0A 1E1FA 3WQCA 2NV9A 3CLWA 1VYSX 3URNA 4WY0F 1QBAA 4EP8C 4NILA 1B3YA 3SGGA 2PDQA 5I3DA 4MHBA 5A6SA 4E3VA 1W2PA 4IMEA 2ZTJA 1O94A 4GQQA 1YPXA 1K9DA 4AHQA 1DOSA 3KHJA 4HSHA 3VIFA 1RBAA 2FVMA 3W6LA 4GFSA 4S3GA 1WV2A 5EFFA 1E0VA 2OKTA 1DJYA 4E5TA 3CGTA 2PDPA 3QY8A 1FH7A 2YZ5A 4DUVA 2H3BA 4FALA 2VGFA 3KBJA 3NZPA 3G6LA 1UD2A 1JZ6A 1V51A 2WNQA 3QSRA 1B3ZA 5M17A 1YLVA 1PKYA 3B8IA 2QT3A 4LYQA 3AIBA 4Q33A 2OQYA 2W0UA 4DIAA 4ENLA 2OSXA 4DO7A 2R94A 1C9DA 1AMYA 3DKJA 1ZL1A 5FCZA 3GIYA 3HQ1A 4ATWA 2QULA 1P43A 1JCMP 2WMKA 5D9PA 3H23A 1JULA 1V8EA 5BRPA 4DO5A 3H6OA 1KRMA 1CB7B 4KPLA 1ZCOA 3DYPA 3GKAA 3TC6A 2PWVA 2Y7DA 4R7JA 3BWWA 3V75A 3VMNA 1H3GA 3ARSA 4GKLA 4I9JA 3B8UA 2AL1A 4OTKA 1PUDA 4O19A 1NWRA 4FP1A 2E25A 3PULA 1V03A 1XV8A 4IUGA 3OGRA 4LALA 4AF0B 4P8VA 1WNOA 2VX5A 3ZVHB 2C91A 1DPMA 1K3UA 2G95A 1TV7A 2WKGA 1CGVA 3W7KA 1MVYA 4KBXA 4IPIA 1OQFA 3LPPA 2VI0A 4L1WA 1H61A 1W5MA 4PC8A 3FA5A 4RE3A 2XWDA 3R43A 4TUFA 3AHYA 2B0MA 3K2GA 1TR9A 3C52A 1A50A 3MPGA 5EFDA 3RR4A 1EDTA 5I7GA 3PTQA 3UBPC 3A9IA 3M0YA 3RXZA 4WKFA 4IP5A 4LUTB 4Q4KA 1LLWA 3JVAA 1CXHA 3QR0A 3M1ZA 2OWWA 1PDZA 1E15A 4FOKA 2GJXB 3L67A 3GDBA 5HJYA 4PMNA 3MSGA 2HMCA 1NDYA 3B9EA 2GVJA 3LCHA 4XQ6A 3F7JA 2HK0A 1W3LA 1KM1A 4WVXA 3N12A 1V79A 4UQBA 1J5SA 3A4XA 3LCGA 2WC3A 4WXZA 1UR8A 5HWNA 1YBQA 5CLWA 1S2UA 2GGHA 3KX6A 2XH2A 2CZDA 2D0FA 1JZ7A 1FWIC 2WAGA 2ZUMA 4RZBA 3RITA 3UA3A 5CZ0A 3S9ZA 1R0MA 4B5UA 4WX2A 3KWXA 4IXXA 1YNQA 3SZ8A 1HVXA 1H0GA 3PUDA 1H49A 3QQ0A 3QFEA 4JPGA 4YTQA 3H7VA 1AMKA 1SM9A 3GTNA 1UQZA 2HE8A 1BG4A 3O0FA 5HR7A 1KLZA 3THUA 1I2QA 1W5NA 2PLCA 3QPEA 4YTSA 5FAJA 3OZPA 3AJXA 4MLRA 3UG4A 1UJPA 1D8CA 4MVAA 4TR9A 2HXTA 4ZQOA 4US5A 3M0MA 1E0TA 3VGDA 3VINA 4H8NA 4LPCA 2B7NA 3VNKA 4O53A 2OMAA 4NZJA 3M44A 3TC3A 1E40A 3WLRA 3WDIA 4KF1A 1MQQA 5I3IA 3WX7A 1GVIA 1QOXA 1UPMB 5BOFA 2ACSA 1JYXA 1HZYA 3F4CA 3BJSA 2PLMA 3MSYA 4H01A 1A0DA 3FX4A 2Z1WA 4U3AA 3KHDA 3W71A 4FS9A 2F7FA 4ZO7A 3IJ8A 1QPNA 4NQ1A 2AOSA 3ITTA 2XN2A 4HIBA 4QG8A 3ZZ1A 4PMXA 4C6FA 3PUEA 3UJFA 3EWWA 5CBIA 4DN1A 5LKYA 1LP6A 5CBBA 1FHUA 3AYVA 1R9YA 2YLLA 3F4VA 4O10A 1CXEA 5CSRA 1PIFA 1A4LA 4L64A 1BXBA 3IJDA 4EXQA 3UZWA 5DRIA 1GTEA 1L9WA 5AECA 4DWSB 1E56A 4NZ5A 1H50A 2HQAA 2O9TA 1I2RA 3V0SA 4N9EA 4UIOA 1JQXA 2G4JA 3LTYA 4QHRA 4UXDA 4PMUA 3W7GA 1TKKA 4CQBA 1JQVA 1SJCA 2CLHA 4IFKB 1GJUA 2BP1A 1H41A 1V6WA 2GJLA 1FWJC 3DYMA 3CH9A 1P6WA 1OVDA 3H22A 4CNUA 4IFKA 3FSTA 2C71A 2CXEA 1XLGA 4TV6A 1GZ1A 2E6DA 2V3DA 3FS2A 2WM1A 3P62A 4QJ5B 5F2LA 1UUQA 4GCXA 2VC7A 1S5VA 4KGLA 1VH7A 1US3A 1NDVA 3N11A 4KFNA 2ODOA 3GY1A 3W7CA 3FEQA 4OFCA 4IWWA 5FI8A 5HWMA 3V1HA 3EOLA 3VGBA 5CPQA 4GQBA 3ABRA 5DFAA 4B5NA 3ZLGA 5K7JA 4CNOA 3NQVA 3R2GA 3GVRA 1W5OA 4U31A 4NRSA 3CAKA 4OKDA 4UR7A 2X0HA 4ERIA 1S5NA 1R7AA 3BSHA 4HVXA 4FZIA 3P80A 2Q3RA 2WJDA 3GU9A 2Q02A 4LUTA 3F2BA 3HFYA 3ZT7A 2ON3A 1L6WA 3FHQA 4MLJA 2VGBA 5BRBA 3AS3A 3UGVA 1LCOA 4A6GA 3K13A 1JDCA 3W1QA 4U5KA 3BGJA 3LSBA 3VOJA 1ZJIA 4HMDA 3MYOA 3FKKA 2RHGA 2XFRA 4ATDA 3ITXA 3VDGA 1J0JA 4FB7A 4H9YA 1UR2A 4FLOA 1BSLA 1EKOA 1W3IA 2ACRA 5FF7A 2J8GA 4GI8A 1TREA 4AD3A 1CGUA 4IZGA 2GVEA 4YPJA 1L6SA 4EIVA 2GOKA 4WSJA 1Q7MA 3QHNA 1Y5VA 4KESA 2NVDA 1TA3A 3TZNA 4ERAA 1QUMA 4XZNX 2CZFA 1X1OA 1TVPA 4HHPA 2PSNA 2Z1SA 2FZDA 4J3XA 2GWGA 4QDPA 1U1UA 1JEZA 1MI3A 4HNCA 1XIIA 3FAXA 2VX4A 5CSSA 2ZZ6A 3I65A 2FPYA 3B9DA 4B91A 3CV1A 5MF5A 2NQHA 2QEZA 1FX6A 2A1YA 3O2LA 4EF8A 2ZZ5A 3WLMA 2BDQA 5CKSA 3O9NA 3L12A 5D9NA 3MI2A 1C8QA 1LG2A 4UQDA 3M4HA 3WDQA 1U5HA 1XYLA 3SUWA 3ANUA 5MKGB 5HQEA 3M7SA 1E9LA 1SVDA 4C1LA 4WOQA 3A6OA 1W8GA 2CNCA 4W93A 4WEVX 2J6XA 2Q71A 1EQCA 3GVWA 3W7JA 1JD7A 2DZUA 4JQ2A 1CIUA 2VZOA 2PGWA 1O6IA 3O1NA 3B8SA 3W74A 3G8EA 1XLEA 4P5UA 3VNYA 3CZEA 2IPGA 4WF7A 2OGJA 1VFHA 1X98A 3CWHA 3GR4A 5A1AA 2HNEA 3S5YA 3VC6A 2W62A 1VRXA 3KTCA 1P6BA 1WCGA 4PZVA 4HK6A 4KT2A 4MPQA 1GOQA 1R46A 2Y7GA 3ZJ8A 4O1FA 4WK9A 7ENLA 4Z1BA 1LM1A 3EDJA 3QQWA 3LSCA 3WLIA 4OOUA 1XISA 2DU2A 3C8NA 1HX0A 2BY2A 2XVNA 3FKRA 3LBCA 2GDVA 5HNRA 1QMLA 1RJQA 2Y8UA 1SO4A 1P0BA 2ZIDA 4AEEA 5D2XA 6CGTA 3LQLA 5D02A 4A8RA 2Z4GA 4C1NA 2IXUA 1FP8A 5LZLA 3OA5A 4BI7A 1KBJA 3SURA 3P81A 5D9OA 5E0CA 2ADAA 4Q4PA 4CNSA 5M1TA 1D2KA 3PTMA 5A8MA 3NCOA 1OD0A 1ODZA 1DQWA 3FW6A 2GUYA 3UD6A 2PBOA 2IS7A 1CTNA 4A35A 3UR5A 1LT8A 4GVIA 3TW6A 4KEMA 3VM5A 3ZOAA 3EA1A 1MYRA 4H04A 5E0KA 3WLLA 1BSIA 3GUGA 1QOQA 4JXCA 5I03A 1OX4A 2A3CA 4DF1A 1XCWA 4RK8A 3TN4A 4UFJA 3GXIA 4QCEA 1QNQA 1UZDA 3O07A 4XVDA 3IPWA 1LQ0A 2VNCA 4C6OA 1KA9F 4IX2A 1RA5A 4ZENA 3LCLA 3C2EA 1EF2A 2HRWA 3GDRA 3KW3A 4R9XA 1AL8A 2CETA 1YW1A 1QNPA 1ONXA 4Q22A 3KL5A 1U22A 3GD6A 2B7QA 1E3ZA 4ZTYA 1EJ7L 4LYKA 4B16A 5DXXA 3RM8A 4ZO9A 3G1AA 1TV8A 1NWTA 1LROA 3H24A 4I90A 4J3UA 1UB3A 2XN1A 4C6KA 1TMLA 3UPBA 3HPZA 2WSRA 1RUSA 1UBSA 2DEPA 3CHVA 1GEHA 4NAEA 1PV8A 4O52A 2PFHA 2PZNA 1OCNA 3EOSA 4HZMA 1EDQA 1PS9A 4JL2A 4PBGA 2QW5A 3HG4A 2C1HA 3ARPA 4HK7A 1S39A 2Z7KA 4FF7A 5BW6A 1KBIA 5AHFA 4XD3A 2OB3A 4DBDA 4AD4A 3SM0A 1AL7A 2V3FA 4NHVA 1Q6QA 3G8RA 4GYKA 3L0KA 4HTBA 4Q8OA 3BDKA 1O95A 3BG9A 4XKYA 3SCOA 1OGBA 3VNZA 3K4AA 1WUEA 1DWFM 3HJZA 2XGIA 3M5YA 1VIWA 4R9OA 4I8DA 1FXQA 2CZ5A 1KCZA 1TWDA 5C7VA 2LLEA 4XSLA 1BQGA 5JH1A 1K1DA 2VMFA 2NV1A 1E70M 1EH9A 3LCXA 4G1NA 4ACZB 1JGMA 3GU2A 3XIMA 3M0KA 1J8VA 1LBFA 2WZMA 1JVNA 2ZBTA 3TSDA 4ACZA 4AZGA 5DCDA 1K8ZA 3UZ5A 3AOFA 5L6UA 3E2SA 3HB9A 4Y7EA 1PKNA 1CW2A 4MFEA 4IG2B 3FJNA 4LXFA 1F76A 3TLQA 1B3WA 3L21A 3D3AA 3GFXA 3VX1A 5XIMA 3W85A 3RLUA 1G94A 3TQPA 4MMWA 1DJXA 5F2GA 4XX6A 4MUZA 1CECA 4V1YA 1K8CA 4IL0A 5FEXA 1YPFA 2PU1A 2PLJA 1E73M 4ZODA 3FY1A 1OY0A 5A2AA 4QS5A 2NUXA 1CT5A 1W3JA 4ZMGA 1G1YA 4OUEA 3P14A 4YHEA 1UWUA 4JTIA 2RDUA 1WKYA 3QXBA 2CLIA 2VGIA 3S2MA 1EDGA 2AAAA 4RE4A 4NXKA 3WLSA 5FSDC 2PURA 4H41A 3UWEA 4KCWA 2G3MA 5IFTA 3ZR4A 3VE7A 3RFAA 3I4EA 5M5DA 3NL6A 1CXLA 1ZAJA 1FWWA 4REQB 5HMEA 3GNPA 1H63A 2O9OA 4BF7A 3NOEA 3UVIA 1QI5A 3OGVA 4E4UA 1K77A 5CZJA 4MKSA 4JN7A 1L8NA 5CC5A 3OA3A 3OGSA 1LYXA 4DJFA 1XH1A 3W6YA 1JZ5A 2VGGA 2X7WA 3OTRA 3EX6A 3EOOA 5FF0A 2QKFA 1C29A 4IJRA 1DJZA 3WK1A 1GG1A 3RGTA 4PBFA 4AU0A 3UA4A 1E9IA 4GYPC 1LG1A 4OWGA 4U33A 3R89A 1IEVA 1C8XA 3ITCA 4Q32A 1PVNA 4ZXOA 1I4NA 2VEMA 1HKKA 2WVVA 5AYIA 3PZGA 4O28A 3E3HA 1LF1A 1QDSA 5IXEA 3BW4A 3N9SA 5I3JA 2JGQA 3VNDA 2Y24A 3PPFA 2E9MA 1W1TA 4F0MA 4JX4A 3WLJA 3UZYA 4AD5A 5KZ6A 3W7DA 1EJSC 2HWGA 1Q65A 3IV3A 4GC4A 3VC5A 1XYCA 1L8PA 1ZY9A 2E9BA 4XD5A 3C2YA 4PFHA 1EJTC 1V4YA 2Z1VA 3BJFA 2P88A 2ASHA 3WJSA 3OQ8A 1G4SA 3S1GA 3VO0A 1W1B1 3L65A 3SGZA 3FYYA 2H9AB 4GISA 5G1YA 3S5NA 3CT2A 3EMZA 3WQOA 3GAYA 2HJPA 2QCDA 3ITVA 4EXBA 3TNOA 1JRBA 4LUSA 3WF1A 2PGEA 3PG8A 1BYCA 4UFMA 5DCEA 4K68A 1XBZA 4GY7A 3ZM8A 2VD9A 1TZZA 5AKQA 4LUSB 4AIUA 4PMDA 2RKXA 3WH5A 2QCLA 3MUZ1 4LAUA 3WLNA 1PSCA 1VEOA 3F5KA 1F73A 2YCKX 3QLLA 3ZLHA 4KFPA 5EGRA 3MO7A 3WLTA 3TZFA 1M7XA 2BX7A 3NTYA 1AJ2A 2GGEA 2WYSA</