3SEEA

Crystal structure of a putative sugar binding protein (bt_4411) from bacteroides thetaiotaomicron vpi-5482 at 1.25 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QNLIKNEKFATEVTNKVTNPSKATAGEWFIMNNEADGVTTIAWEQTGDAKYPNAMKIDNSGAEKNTSWYKAFLGQRITDGLEKGIYVLTFYAKAKEAGTPVSVYIKQTNEEKNDNGKLNTTFFMRRDYDADAQPNASGAQYNFKIKDADKWTKVVVYYDMGQVVNAISSKKSNPALEVSDTDDDAAILKDCYVAILGQNKGGVVEISDVTLKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical sugar binding protein (BT_4411) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords Hypothetical sugar binding protein
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15425 DUF4627 Domain of unknown function (DUF4627)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3seeA00
5JR2A 3SEPA 3ACHA 2XQXA 3JXSA 5DN2A 1UWWA 3LEKA 2YFUA 2C26A 1O8PA 3NQHA 3CDZB 2VMDA 2VMCA 5JMOA 5IJRA 5I0DA 2JE8A 5C71A 3P1IA 2J1EA 4OMDA 2VZ1A 5LCWL 3K4AA 1JHJA 1L7RA 2J1AA 2E26A 3VD9A 4P08A 3BN6A 3WEZA 1JU3A 1NX9A 2QQLA 2BERA 3THCA 2VJXA 3HPNA 3C7FA 3OEBA 2Y6KA 5G05L 3ACIA 3CZUA 3OEAA 3I2KA 2BZDA 5JUVA 3THDA 4W4ZA 3DECA 5HXMA 4HG6B 2J7MA 4ET7A 3HJRA 2XOMA 3OBAA 1UY1A 1DLCA 1CX1A 2XONA 3VD4A 3C7OA 1CZTA 3P6BA 2W87A 2QQIA 1NUKA 4QX1A 1NAEA 2WO2A 1HN1A 4DXSA 1K3IA 1EUTA 3IB3A 1LNSA 3ETPA 2X10A 3ABZA 2W91A 2J22A 2VC9A 5JXIA 3IAPA 3T2OA 2J1VA 2BBAA 5C7GA 4MGQA 4OUEA 3EB7A 4DUWA 3C8XA 1DP0A 1US3A 4LKSA 1J83A 4ZZ5A 5C70A 3CKHA 1US2A 2YC2A 3HOBA 4QB2A 4A42A 3T2QA 4CU8A 1GOFA 2EICA 1I5PA 4XUNA 3K4DA 4W8JA 3WF2A 2EIEA 5JXHA 3WF0A 1GU3A 1JZ3A 1PX3A 3IAQA 3T08A 1CIYA 4TXWA 4XUPA 4CUAA 2WYSA 2YFZA 2E31A 4P5YA 1JYWA 3FHAA 3SKJE 5IHRA 1K12A 3K77A 4AG4A 2ZEYA 2ZEZA 1GOHA 2Z4FA 2W46A 3PUIA 1KGYA 2VQUA 4LPLA 3IDAA 2WO1A 3DYPA 2ID4A 3I2JA 3PUHA 2HYXA 2W95A 4KMQA 4E8CA 2E32A 3HNYM 3I3DA 1ULPA 3MV11 4DXTA 4CU9A 3FL7A 1UMHA 3T0DA 3OB8A 3CMGA 5F7UA 1JZ7A 3A22A 4UI9L 3HEIA 5DMYA 2W47A 3CZJA 4OZOA 1F4HA 4D8MA 1RYYA 4KI5M 4LQRA 3A23A 4XUTA 3NJXA 3FHQA 3WNLA 4A41A 4LHSA 2W92A 4AAXA 2WAOA 4IUGA 4BJ0A 1OH4A 4KWUA 2DCJA 3WF1A 3K4ZA 4M4RA 3T0BA 3T09A 2L9LA 2LS6A 1SHWB 1O59A 2V5DA 1W0NA 1W9WA 3VDBA 1O8SA 3LQCA 3GM8A 2V4VA 2JKXA 2W1WA 5A1AA 1JZ4A 2VZSA 2HLEA 4CUBA 3C7GA 5LA2A 1UXZA 3A7QA 4BK4A 3I3BA 4QX0A 1UYXA 2VMFA 3K75B 4XUOA 4ZY9A 5B4XA 1UZ0A 1W8OA 3MO4A 1OD3A 2WN2A 1SG3A 5JXGA 4JX0A 3T0AA 4TTGA 2VZRA 1JYXA 3HNBM 3I2HA 2VMEA 3D3AA 4MADA 3GDBA 2Y8KA 4ARXA 1KEXA 4JKLA 3NNGA 4P02B 2VZUA 2WAAA 1XNTA 1CZSA 3GXUA 1UY3A 3SKVA 4CU7A 3UNPA 4FI9A 2VZ3A 2W5FA 5HPOA 4BXSV 4E8DA 2VO5A 1W99A 2ORZA 3WF4A 1YQ2A 3MUZ1 4MOAA 2YC4A 1W8NA 3GGLA 5EJ1B 3K46A 2X05A 1JZ8A 1F4AA 2C9KA 4XURA 5B4NA 4PQQA 2VTFA 5JXJA 3ACFA 4XVHA 3SEEA 3MBWA 2VZQA 1XPWA 5IYYA 1EUUA 2VOTA 1OF4A 3I97A 1PX4A 3U37A 3WNOA 2QQOA 2W1SA 4PF1A 3I2IA 2RVAA 4BDVB 1JZ6A 2BGPA 3BGAA 3LEIA 3DYOA 4CU6A 1H6XA 2W9XA 3UETA 2W1QA 1BHGA 4OYUA 2WDBA 2E33A 2JD9A 1PMHX 1D7PM 4MGSA 3OGRA 4QPWA 3DYMA 5DQ0A 4RYDA 2RJ2A 2Y6LA 4UAPA 5IFPA 1PMJX 1OT5A 3AC0A 2BGOA 2RV9A 2VR4A 1K45A 3WNNA 1XC6A 1UYYA 2WZ8A 4DUVA 1CZVA 1H6YA 1L7QA 1NKGA 2EIBA 2QQMA 2OKXA 5EJZB 4BK5A 1JI6A 3CQOA 4QDSA 1JZ2A 4A45A 2VZPA 4A4AA 3I2FA 2VQTA 3I3EA 1UY4A 4CVUA 1UY0A 3W5NA 4M4PA 2ZEXA 2Y6HA 1UYZA 2B9VA 2WQ8A 2XHNA 3NRUA 1UX7A 1GNYA 3WNMA 2EIDA 4L0PA 2DDUA 3F2ZA 2Y64A 1R64A 1GUIA 4CUCA 2ZXQA 1TG7A 1JZ5A 4P00B 2VZTA 4XUQA 3J7HA 2VL4A 4DUXA 1MPXA 1JU4A 2J1RA 4GWIA 5G04L 4ARYA 2VM9A 2QBXA 1UMIA 3ZM8A 3ACGA 1J84A 2J1SA 4JKMA 4RN5A 3HNMA 1JYNA 2CDPA 4A44A 2Y6JA 4XZUG 3OGVA 3HN3A 4DEQA 4W50A 4JKKA 3LPFA 3OGSA 3UESA 2KD7A 1JYVA 5LA0A 2CDOA 2VZVA 3VD5A 1UXXX 1ULOA 2ORXA 2YG0A 3WF3A 4A6OA 1GQPA 4QX3A 3NJVA 2C4XA 4QAWA 5IFTA 4GZ9A 4QDQA 4PT6A 3VDAA 5LA1A 4D0QA 3WQBA 5CZKA 4GWJA 2J1TA 2VCAA 1TVGA 5CYYA 3OG2A 3CIHA 2W3JA 4OMCA 3ECQA 4MO3M 2WUHA 1UY2A 2QQNA 4A3ZA 4QX2A 1IQDC 1T2XA 3VD3A 2QQJA 2LW8A 3I2GA 1W9TA 5FUIA 3W5MA 3C7HA 2QQKA 2ZEWA 2YB7A 4ZZ8A 4UOJA 3E1F1 2J1UA 2WABA 2W94A 4DXRA 3LE0A 4JHZA 2X09A 3T2PA 1SDDB 4QB1A 2DCKA 2WN3A 4YPJA 1WKYA 2WZEA 4DEVA 3MUY1 1XNAA 5DPNA 2WBKA 3FN9A 4Z2AA 3C7EA 1GOGA 2W1UA 2VCBA 5EIYB 3WNKA 3WSOA 1DYOA 2VCCA 2VZOA 5J1XA 2JDAA 3VDCA 1W9SA 3EYPA 2WO3A 3WNPA 1GMMA 2V72A 3MV01 2R7EB 4ZXEA 3VD7A 2Y6GA 3LPGA 2B4KA 2PQSA 4QDRA 4QB6A 1WCQA 3A21A 1K42A 1OF3A 3IIIA 1P8JA 3LEGA
chains in the Genus database with same CATH superfamily
5FV3A 2PAEA 1OQEA 5JPMB 5H9SA 3GHMA 4CCEA 1ASJ2 2D3SA 1SQ4A 1WW7A 5JSRA 2RMU3 1O8PA 3NQHA 2RS13 4XIKA 1XRUA 1I3HA 1C5HA 1ENQA 2HYKA 4J25A 2VOKA 4YWAA 5T5OA 3THPA 1HXS1 2OT7A 4CCKA 2EF6A 2XR4A 4CDWA 4YSFA 1VBC1 1DYKA 1CAWA 3JD73 3UL2A 2WS93 1FXZA 2DV9A 2YV8A 3VD9A 4P08A 3MICA 4AEDC 3WEZA 2QQLA 3PNAA 1YI7A 4Q4V2 2VJXA 1KJLA 4HMZA 3C7FA 3ZSLA 3H8UA 5CFCA 4YGCA 2Y6KA 4CCNA 3M2MA 5G05L 1HRV2 1PVXA 1QJFA 3ZN6A 5C3RA 1X50A 1RUH1 2QTWB 5IAVA 3VHOA 4HL0A 4MH0E 4GXLA 4S2FA 4LBQA 4XC9A 2VMGA 3WDTA 5C5TA 2J7MA 5T5JA 2BV4A 3H1WA 4K9SA 2GH8A 2PHRA 1QH7A 5D1IA 2XVLA 4XW3A 3OBAA 1IKPA 1OLME 5ANQA 1V00A 1CX1A 4M3CE 2XONA 4PBOA 3VD4A 2WNVB 4GH4A 2YROA 5FYTA 3NL1A 2W87A 5H9QA 4BQYA 1AZDA 1LJ7A 1TMF2 4QX1A 2EXHA 1V6KA 2N7GA 3JQWA 3ZFEB 4CEYB 3L9JT 5BNNB 4RHV3 1FOD3 3U07A 1EUTA 1GR3A 1LNSA 3LWCA 1EV12 2X8KA 4LO6B 2VE1A 2W91A 1BQPA 3VBUB 5GKAC 2FDHA 5JVVA 5JXIA 4F8AA 2XLGA 4QMAA 4FXGB 3H8OA 5FZ1A 3VB9A 4CEYA 2JG9B 2J1VA 1J1TA 2BBAA 5C7GA 4MGQA 5FZ7A 1BBT1 4OUEA 3N9MA 4RD7A 4FPOB 3WDUA 4BQ3A 3C8XA 4WZCA 3RZGA 1VAMA 4R9AA 1OOPA 4AEMA 4CDWC 5C70A 3N3HA 3CKHA 3MIDA 3K51A 1I5ZA 2D6MA 3MW4A 5L9VA 3Q9OA 5L7OB 2YC2A 3O1OA 2UU8A 5DZGA 1W90A 1F31A 1GOFA 3RI9A 4AHXA 2ZGKA 2P3KA 5EP9A 1I5PA 5ACA2 2O0OA 4QGMA 2JE7A 2BFUS 5FK8A 5IVBA 1WCDJ 3K4DA 3MFCA 3WF2A 4Y22A 3NVCA 1MR5A 3OUJA 1WW4A 1W3XA 4FP2A 4ZS2A 1JZ3A 3TEXA 3UK9A 1YFXA 2XH6A 4N53C 3O1MA 3RYKA 5FYYA 2WSUA 3IAQA 2XWBB 4L8QA 3BU7A 4CRQA 2HWB2 3OPTA 1G86A 1F5JA 1FATA 2WYSA 4P5YA 4TXWA 4ZU5A 1C1LA 4COZA 4Y4YA 4CUAA 4OHYA 4A7KA 3SKJE 3BU0A 3LB9A 4BPZA 1K12A 3FBYA 1F8VA 1WMXA 2XHKA 2PHDA 2AREA 1D4M2 5FYUA 5EPAA 5FPVA 1PIV2 3LA7A 1WCKA 1RUF2 1OSGA 1U5IA 3JBG3 4N8MA 4EN9B 4NROA 4QKFA 2WLQA 5DUUA 3IDAA 4AEKA 4COUA 4IV3B 1IS6A 2FHRA 2Q1FA 5LRSA 1HQNA 3DYPA 2ID4A 4I02A 4ISQA 4BZ4A 3VZKA 4O7XA 4FQ4A 3PUAA 2HYXA 3LGRA 2RS51 3PUHA 5E8AA 3ZYPA 3I2OA 4IV1C 2VH9A 4E8CA 2H0BA 1G9FA 3D8CA 4GA9A 4OZXA 3SC7X 3WCSA 3WR0A 4LUMA 4DXTA 1X8EA 1KFUL 1RUG1 1LTEA 2WZR3 1U12A 2WWSA 3CMGA 2UYAA 3OB8A 4JGYC 3U78A 3AKPA 2FMDA 3WHTA 4COYA 2GMPA 4NHLA 3HEIA 2YDEA 1JYCA 4I3PA 3RRDA 3ZX7A 3CZJA 1GKBA 1H9WA 1RUI3 2GN7A 2Q30A 2XVKA 1RYYA 4Q4V3 1ZZ9A 4LQRA 4Y3OA 5DDJ2 4B4PA 3WNLA 4A7ZA 4RSUA 4A41A 1QGLA 2WJSA 3PVNA 4AWDA 4CDXA 4OHVA 3FUOA 1QH6A 4IEUA 2IXJA 2QCSB 1OH4A 4BJ0A 4ZS3A 3WF1A 2BJSA 4ORFA 2C0ZA 4QPGC 2E63A 5KBFA 4B1MA 4UXAA 4X8NA 4N53A 3VKLA 4ASLA 4Q0VA 1AYN3 3FC0A 5K9YA 1AR62 1O59A 4ZU7A 3AYCA 1FV2A 1QJY3 5T3NA 1O8SA 2Z5WA 5FLIA 3WP3A 4EWEA 4AF9A 3GM8A 4XQ4A 4GJZA 3DF0A 2BOJA 2JKXA 4XJ9A 5C3SA 2RMU2 1JZ4A 2VZSA 3MW2A 4UFKA 3BPZA 4CUBA 1UXZA 1YI9A 4DY3A 5CKMA 4LBOA 1ULDA 5FP3A 1RUJ1 4AVTA 3BB6A 3M3IA 4YW3A 4YVWB 2DVGA 1X9TA 1HQLA 4LHNA 4ZY9A 5AFBA 1BEV3 3GHNA 2YBSA 3MO4A 4L92A 1PK6C 4UFLA 5AC93 1WLCA 2PAKA 3FLRA 2WN2A 2ZA9A 5CAZA 4LLFA 3NMBA 3IM0A 2OS2A 3HNBM 3ME2A 5FP7A 5GLWA 4AEJA 5K7PA 1E57A 2C1FA 2ZAAA 3O5SA 1RB8G 5A3WA 3GDBA 4HBNA 4XZPA 2Y8KA 4JKLA 1QOSA 4NWWA 3NNGA 4P02B 1O4YA 4CPBA 3ES1A 5A3UA 1OI6A 4W6YA 4I01A 1XNTA 1VMFA 3AKTA 1NCRB 2BP6A 3ILRA 4C0HA 4BXFA 5FTTC 4LHKA 1OUXA 5I91A 2K0GA 3GZTB 3ZIXA 4QX7A 1S0GA 3RJRA 1WW5A 3VBHC 3ON7A 1CPMA 1UPIA 1VBB3 2Q0AA 3ZMOA 4EN6B 4Y5Z0 4GALA 3WUCA 1IZ3A 1W8ZA 2ORZA 2W52A 4R8HA 1ALYA 2CTVA 3WF4A 1KRIA 1UIJA 5FPLA 2Z79A 2YC4A 5EJ1B 4XF9A 3R6SA 2ZOEB 5BNOA 4URAA 2VTXA 2BWAA 2C9KA 1Q8VA 3SISA 4IEQA 2ET1A 2VTFA 4PQQA 4YVSC 4OHZA 3WP5A 4BM8A 5B4NA 2D44A 2TNFA 4FPFA 1RUH3 1AVBA 3GBWA 4IE6A 1XPWA 4BYYA 2OZJA 2ET7A 1B35A 5F2SA 3VUOA 4IQPA 1E5HA 3KV6A 1POV3 1V70A 2E51A 4IEPA 2AYHA 2ZGTA 3ZFFA 2C9AA 1S4CA 1ZA4A 4OLLA 1XB9A 2R041 2XUEA 2ZX1A 1VE0A 3U37A 3T1MA 4A6SA 1IPKA 1AHSA 5BPXA 2BWCA 5JWPA 5LK5A 3I2IA 2RVAA 4N90A 1H2KA 5FPAA 1JZ6A 1OUSA 3MIGA 2VVFA 1VP6A 2ZBJA 1VBA1 1NCQB 2ILMA 2YGMA 1BHGA 4S2GA 5SV5A 3RZJA 3WQ0A 3UJOA 3VZMA 4WBBA 4TWTA 1XYNA 4KG0A 4XCAA 5F37A 5FBZA 5GZCA 2JD9A 1WLWA 4KU8A 1TME2 5L9RA 2Y0OA 4IEYA 2WZPP 3IT8A 2WNUC 3DXUA 1ZBE2 4WVWA 5LZ6A 3E5XA 3POIA 4JQTA 3N9PA 1LHOA 5J98B 2IWGB 1RL3A 1VBC2 2O8QA 2ZCWA 1W3VA 4OHXA 1QMJA 1S2EA 4NIHA 4B7KA 3NNLA 1DGLA 1PMJX 2Q5TA 5F5AA 2YXSA 1PK6A 3IDCB 2DUQA 1JN2P 1SFNA 4N53B 4H2AA 2P37A 1XC6A 3E5UA 5FZAA 5A33B 3H3UA 1SBEA 2WZ8A 1F9KA 1ZBA1 1L7QA 1S0DA 2AR6A 2OKXA 3GYDA 2QQPA 3HT2A 1XXNA 5EJZB 1JI6A 3CQOA 4QDSA 2I74A 3PJYA 4FPCA 1VBD2 3I2FA 3I3EA 4A4AA 2X53S 2PFWA 1C3HA 1UY0A 2V73A 3OPWA 2BRTA 1YCIA 5KHGA 2Z69A 1UKGA 1UYZA 4EV0A 4ATFA 5C8CB 1JS9A 2JG8B 4JGZC 3U4SA 2HWC1 4AZZA 4BH9A 2ZTNA 4XHBA 2VNOA 4IV3C 3WD5A 3MEPA 2QNKA 3VDDC 1QIQA 2UURA 2DDUA 2OPWA 3SLIA 2R32A 4META 4MLOA 3HD8B 3RWNA 3NSTA 4CUCA 5JPNB 2UWBA 2OXBA 1TG7A 1YQ6A 3AZVA 3K48A 4RGKA 2JG8A 3I3QA 1GQGA 3ZYBA 1OPMA 4EWDA 3MFAA 1JZ5A 2BW8A 4KGGA 3MIBA 2WFPA 4XUQA 5C3QA 2VL4A 5T54A 2D43A 4FFFA 5FO8B 2CGPA 4X8PA 2R061 1MPXA 1RMU2 1JU4A 4AL9A 4CEWB 2HBUA 1PM4A 2ZGLA 1L3JA 4NRPA 4Y20A 1ZZ6A 4QHZA 5G04L 4ARYA 4BLIA 4RR3C 2RG4A 4YM0A 3B02A 2BDRA 4FFIA 5FZ8A 3ZPYA 2K46A 2R6QA 3ACGA 4G9SB 3KVAA 4CDQC 1STMA 1OLQA 3CHXA 4Q4W1 2XGXA 1I1EA 4CP9B 1UZZA 2CDPA 5JZGC 4LT5A 4FOYA 4XZUG 1CAVA 3VZNA 3OGVA 4HLTA 3HN3A 3O12A 1CWPA 4C0BA 4NPLA 2ETEA 2ES3A 4L11A 2YC0A 4LO8A 1ZA7A 1ENSA 3PLQA 1WBLA 3UESA 1N3QA 2KD7A 1O4TA 1HKDA 5FXVA 1CPNA 4Q4W2 5CADA 1PO11 2CDOA 4BQXA 3M3EA 4BMBA 2ZHNA 2DFBA 2IFWA 2ZX4A 4UBGA 3T1LA 3V0AA 2VW2A 3ZXAC 3NKTA 4I09A 3HQXA 3VHNA 1J1LA 4EE2A 5FP4A 4QX3A 1AR72 2R1BA 3KV9A 3W21A 1MS1A 3NJYA 1W9FA 1UOJA 4HN0A 2DBNA 3BOWA 4YVSA 3THTA 2VD7A 3WG3A 5E89A 2RM23 1JYIA 4GZ9A 1VBB1 1W6NA 2BEOA 2O1QA 1COV3 4D0QA 5DG1A 3UGGA 2JDUA 4PBPA 4QQ2A 4D69A 5DUXA 4NR1A 1S2KA 3GALA 1G6NA 5I8TA 1C28A 1TVGA 4PDWA 1RUE2 5JI9A 2KM2A 2RS31 1UOBA 2PTMA 2W3JA 2FCUA 2OQ7A 5FJHA 1AUYA 2FZ1A 2ZS6B 4W6WA 4MO3M 4XBLA 1VAVA 4QPIA 3VKOA 4IE5A 1SEFA 3CL1A 1G7YA 3V65A 2RR11 2VQAA 4QX2A 4IETA 4PI0A 1VMHA 2ARCA 2QQJA 4Q4X3 1RHI2 3I2GA 4Q5OA 4Z82A 5FXZA 3PTYA 3C7HA 1MQTC 2EAAA 5FP8A 5GLVA 5A3OA 4MHRA 4AR2A 3VBHB 4QQPA 1V6NA 4QPIB 2ZGPA 4F3JA 4XCBA 1R082 4Z2WA 1E5IA 3LSDA 4UOJA 1NY71 3HIFA 4R4XA 5KHHA 1CN1A 1PZ8A 3LE0A 4JHZA 4GH4B 4OUMA 4DXZA 1ND3A 2UY9A 4Y5SA 5L19A 1POV0 2JB8A 4QD2A 3MI8A 4XACA 3URFA 4Z2AA 1AXZA 3LA3A 1RUD2 1GOGA 4CZSA 1LCLA 4M0HA 3R05A 1DQ4A 1TNRA 2WS92 3KHCA 1CONA 1H2MA 5CG8A 2GU9A 4LBQB 2JDAA 3H42B 4Y26A 1W9SA 2AEZA 1SLIA 5DAQA 1YFWA 4M3CF 3VBSC 5C4WB 2I2SA 4YW1A 1W6MB 1OLRA 3NAPB 3LPGA 3TEYA 5GALA 2GDFA 2X5IB 1VBA2 1NZCA 1WCQA 2BVVA 3SHRA 3EO6A 4HKWA 2ZZQA 4RA0A 5A32A 1V9U1 3IIIA 1OA4A 2Y0IA 4EN0A 1P8JA 1YHFA 5JR2A 4F7ZA 5BXXA 1VB2A 2NZ9A 1JTZX 2XQXA 5FQ0B 5FYZA 1HV0A 2HWD1 2R073 5DN2A 3ZPOA 1UZYA 3S30A 4D6RA 2LRPA 4QM8A 5F5QA 1LB2A 1YO8A 2C26A 2VMCA 3VBUA 5FYIA 4GB31 4ISRA 3TNPB 1AR61 2JE8A 4DRVA 1OKOA 4PQ9A 1SCSA 3AZXA 3LIHA 1J3RA 4N9IA 3P1IA 4BIOA 2J1EA 5F5CA 1AF9A 4M0NA 2VUCA 2WL1A 2E26A 1H1MA 3GBFA 5B2GB 2CWSA 3N7JA 1JU3A 1NX9A 4L97A 1J3QA 1IG3A 5AC92 5HCFA 5CFCC 3I7DA 2HWF2 4R9DA 5BNPA 1ZX5A 1ODMA 1W8WA 3I2KA 5APAA 3LD8A 4C1WA 5GZEA 4W4ZA 1PO12 5BNQA 1ODNA 3RZLA 5KXCA 1MEC3 1SFYA 3OYWA 2OPKA 4NPRA 4ET7A 4CP1A 3OY8A 1UY1A 2VQ0A 1ZBA3 5FP9A 2VW1A 4R4ZA 4RFT0 2BBVA 1NA1B 4EZHA 5EZWA 4LKEA 3WW4A 2RS12 1W06A 2ZGMA 5A3NA 4K20A 5BUVA 2K9ZA 2G19A 4AVAA 3T2TA 4NO4A 1T6GC 4Q0UA 4Q4Y1 1W28A 2JKBA 1VBD1 4O9GA 4YW4A 1K3IA 2IZWA 3HQUA 1NA1A 3NJZA 5FWJA 3WDVA 5E88A 2X10A 5LBEA 1UQXA 5LK7B 2GMMA 2ZGNA 4FAHA 1ZZ8A 1GZWB 1SBDA 2J22A 1D4M1 5FYMA 3KQRA 2EXIA 1BCXA 1SCRA 2VUDA 3BCWA 3D4KA 5IW0A 4Q1PA 2GALA 1OHFA 3B93A 1ZBE3 2QZ2A 1QNYA 1QEXA 1LHWA 4LIVA 4LNVA 5BNNC 2RDQA 3GF6A 4GMP3 3RZMA 5FY5A 3VZLA 5A80A 1Q43A 2JJ6A 3WZ1A 1BVP1 1R083 1DP0A 1US3A 4C8DA 1J83A 4GULA 4ZZ5A 1V6IA 1US2A 4JC1A 4N43C 3HOBA 3J4UH 2RM21 4FT8A 2EICA 1GFF2 4NRMA 1V6OA 2DVDA 2YPJA 3I59B 1EAH3 5T5PA 4CCCA 1G9AA 5TSWA 5LASA 1PGL2 1HRI3 2EIEA 3M3QA 3MHZA 3WY6A 1BJQA 5A6XA 1XQNA 4P9WA 1NG0A 2ZZJA 4XJWA 1C57A 1BKZA 5KHKA 1RVF3 3E97A 4XUPA 5EXOA 2E31A 5I8YA 4RQPB 3FHAA 4CUGA 2D97A 1W8HA 1I9RA 3JZVA 3PU8A 1W2NA 1LULA 2CNAA 2ZGQA 2P3IA 4XEZA 3VBFA 5IHRA 2PHTA 2Q8DA 1UNBA 1EPZA 2ZX3A 5C4WA 2ZEYA 4FO9A 2PXJA 5FOJB 2WC2A 1UW8A 1JXNA 2ZEZA 4AW7A 2R0FA 5CVRA 4AI8A 1RUG2 1MS3A 2CYFA 2P3JA 1WMDA 3D82A 3ZLIA 2Z4FA 4YG6A 1OA3A 2W46A 3PUIA 4UBHA 1Q8SA 1FYUA 1LEMA 1KGYA 1X9PA 3BTXA 4YZ3A 2HWE2 1RUI1 2YUEA 3V0BB 5HXVA 3FX3A 1C8M1 5L73A 1H4GA 1QNWA 1OVSA 4K7JA 2DYCA 2W95A 4JV4A 4GWNA 5KHIA 2E32A 3GCXA 3QBQA 5IVJA 3E6BA 2XJTA 1LEDA 3J26N 5CISA 5HCBA 1JZ7A 1EAH2 1S55A 1BBT3 1LHNA 2OIIA 3V64A 3A22A 1O3RA 3ENRA 4MGZE 1JYTA 1DGWX 2JENA 3NW4A 1QXJA 1AX2A 1W8UA 3KZ4C 3D0JA 4QPIC 4S2DA 5CU1A 3MW3A 1QWRA 4OZOA 5LATA 5BNOB 3N36A 1VMJA 5LY1A 2XBO3 3DL3A 2A6YA 2CGNA 4KI5M 4Z1VA 4NUBA 1XOYA 1ST8A 3CJIB 4WM8B 3ZIWA 2XJPA 4KWKA 4JGYB 4O65A 3TRSB 1AJKA 2E7AA 3AP6A 1PO13 1PIV3 4K1YA 1HB4A 2QUOA 2WAOA 1CAXB 1ZZBA 4AAXA 5JMCA 4KWUA 2HWE1 3UGHA 4JQRA 3AXDA 4WVZA 4AYUA 3MPBA 3PDQA 3S5QA 3DGTA 1J58A 3SNMA 1CJPA 4PIZA 1W04A 2WSVA 4MHUA 3VBRB 1Z7S2 2D6NA 2V5DA 3AJZA 5FBJA 1W0NA 1YQ8A 1R093 4LLOA 4XF3A 2DWRA 3VDBA 1W0OA 4Z07A 1XSRA 1QXRA 4Q29A 3AMQA 1AR63 4DIQA 3B9IA 2P1BA 3BVCA 4L9BA 4KWJA 1NQDA 2RHPA 1BBT2 4QPGB 5A1AA 4LO4B 2HLEA 1XU2A 2VVEA 1QQP2 3C7GA 4QX8A 1PZ7A 4HK9A 3POJA 4BK4A 1NOVA 3WUDA 2FZ2A 1RTVA 3UV9A 3JBG1 1XNCA 1Z7S1 4ZONA 4QPYA 2Y33A 5BY5A 2AGSA 2IVJA 1ZRRA 4XUOA 3AFKA 3ZSJA 3TWIA 3DXTA 3U1XA 5CG9A 3TEZA 4TTGA 3PURA 1CESA 1XE7A 2HBTA 4XAEA 1C8M2 3ZOIA 4R52A 3ZYIB 3DPRB 1JYXA 1AYM1 4IEWA 4BA6A 1NLSA 3ITQA 1RUG3 3KT4A 1UYPA 1V9U3 4MADA 4D7YA 4ARXA 5FO9B 4FTSA 4FVVA 4KQ7A 1PK6B 5LEJA 4HPKA 4GD4A 2WAAA 3RZZA 1RINA 2HWD3 1AYN2 2R071 2VPVA 3AFGA 4MGIE 5ABJA 4N7IA 5A3MA 1UY3A 3KHBA 5FUNA 3SKVA 5KC5A 1PO23 3UNPA 4PCRA 5GM0A 1KS5A 2DURA 1O91A 4Y1UA 5GZGA 4XETA 3I3MA 4C90A 4BXSV 1VR3A 2QKDA 1BK0A 3WW2A 5C3PA 3S57A 1HRV1 2XG3A 4P9GA 1SFPA 3O14A 2Q8CA 4IEVA 5FZIA 4MOAA 3EHKA 3H1MA 4FPHA 3VN4A 4YGDA 1W8NA 4LR4A 1Q8OA 1D4M3 3CBNA 2HEVF 4EZ4A 3IZOA 1JZ8A 1F4AA 1GV9A 3RG0A 5J48A 1URXA 2WLPA 1DGRA 4XURA 1N1SA 4CE8A 5JXJA 5FREA 1AXKA 2XPJA 2A75A 2DFCA 2JB4A 2QDNA 1HX6A 1U5ZA 4KH9A 5FZ0A 5JIAA 3MBWA 5A7QA 5HI0A 1X36A 1RVF2 4MXWA 1XNBA 4ASKA 2QFEA 5IYYA 1NXMA 4FTEA 4GMP0 1ULGA 1OQDA 2VOTA 1S0FA 3K2OA 1OF4A 4FPEA 5DUWA 5T5LA 4XBQA 3LDBA 2PHWA 3I97A 1CAUA 1IPSA 1LGNA 1PX4A 2ZPXA 3SCFA 2JIGA 2WNEA 3ZR6A 1KJRA 2QQOA 1MS5A 4MGKE 5EQUA 4A2UA 2XB6C 4PF1A 2JDMA 2NLRA 3LEIA 5D8AA 3DYOA 1DQ2A 5K8SA 2R072 5A6QA 1RUE3 2W9XA 3UETA 5IT6A 4YZ1A 1XU1A 4E9KA 4OYUA 1YLLA 4HT1T 3TN93 2NN8A 1UZVA 3ZN4A 3O0VA 2WNUA 4Y1VA 3PMSA 5D8AB 3KCYA 5D21A 3AL6A 4BWOA 4GB32 4PLNA 3OGRA 1LHUA 3NV3A 4FXKB 3VL8A 4YFZA 1GLHA 2AENA 2AC1A 2LUWA 4DS0A 1DIWA 1HN0A 3KWVA 4FAGA 5A70A 4PI2A 4DRRA 4L99A 3AKSA 5H9RA 1AR83 2D6PA 5LY2A 3T4HB 4CDUB 2UWCA 1RUF3 2RJ2A 5IVEA 1C1FA 3NKGA 4XABA 2BQPA 1QJY2 3JUUA 5IVVA 3D6EA 1OT5A 3VBFC 2D5FA 1IHMA 1EP0A 2HWC3 4KWLA 1NYWA 1V6JA 1KS4A 1UYYA 4CDUA 1H6YA 2ZMNA 1H30A 1NKGA 1W6NB 1LGCA 2EIBA 5F3GA 2F6BA 2NMOA 4XF4A 1DQ6A 1V6MA 2VMIA 4BK5A 2F4PA 1COV2 4QPGA 3TNQA 3WQ7A 3M3CA 5JR7B 4FBFA 1QJX2 2C5DA 4YYOA 4WM7B 1RITA 1MQTA 1GQHA 1WLTA 5FRAA 4FOWA 1HB1A 4V2WA 5EFUA 1RUD1 1UY4A 4V2VA 1FPN1 2IUWA 2VG9A 4M4PA 3WP4A 2R063 1POV1 2Y6HA 3OBTA 5LW9A 3ETQA 5IK4A 1WD4A 4LBJA 1LESA 2B9VA 4AI3A 1GBGA 3BTZA 4AQ2A 2GZWA 1OKQA 1UX7A 2VGDA 1GNYA 4TN7A 2EIDA 4L0PA 4BQ1A 4BCUA 5JAXA 2QQWA 1ZBE1 4LA2A 4HONA 1R64A 3VBHA 2XJVA 1V9U2 2BU9A 1QJU1 3ILNA 3O1UA 4MYEA 3AB0A 3GZEA 1QHDA 3OCPA 4AVBA 2DBIA 4PDWB 4NHYA 3ZFFB 3VDDB 4DUXA 1R091 1MZ6A 4QU2A 1AL23 1PGW1 1TNFA 1YYNA 4CXWA 2NP0A 2DCTA 4QQHA 3M70A 2XLFA 5CNAA 4YW7A 4LA3A 4RGGA 4DY5A 1NT0A 4B29A 4ZKTB 4Q0PA 4XJUA 4WM8C 2R042 5F5IA 4HANA 3ZM8A 3ZYRA 2FDJA 1QXPA 2J1SA 4RN5A 1KQRA 4NIIA 3VDDA 5FMDA 1N1VA 3USSA 2IXKA 3PL0A 5FZKA 4JHTA 2PYTA 4PLOA 3KCCA 4BIFA 4PIYA 3Q8EA 4DEQA 1AX0A 3WVJA 2B8MA 2PLV3 3AP9A 3UKTA 4CXYA 4AFDA 5I0TA 3LPFA 2GAUA 2YY1A 4DO0A 1QDOA 3OGSA 3ZYGA 4CP0A 4BOWA 4CDQB 3MLLA 4MGTA 3ZN6B 5LA0A 3GJAA 2Y6FA 2X29A 2CWMA 3H7JA 1ULOA 1G8WA 2ORXA 5AFEA 2K2SA 1Z0HA 1WLDA 2Y38A 4IXLA 1ZVFA 4QT6A 1DBNA 2UY8A 1RMU1 4KU7A 4OQ9A 1AR93 4CCJA 5FWEA 2YGLA 4UW6A 5FZOB 2XL9A 4BU2A 3AMPA 5FPBA 5FPZA 1WA6X 4YVWC 2RR12 1WMFA 2VNRA 4QDQA 3VDAA 5LA1A 5FZFA 1H1IA 2WT2A 5IATA 4XFAA 4GWJA 2Y34A 1W8FA 2IXCA 2VCAA 1SMVA 5CYYA 2BNOA 5FZOA 3IDEA 2EA7A 4AQSA 4E4HA 4OMCA 2JECA 4Y20B 2RDNA 4A3ZA 1W39A 1YJLA 3PU3A 1GP5A 4Q0QA 1W03A 3SH5A 3SH3A 4E4SA 1W8TA 3VD3A 2GC2A 5FOBB 1XNDA 1A8MA 1NCRC 1QOTA 3DKWA 4HETA 4PHZA 5FQ0A 5J7MA 1W9TA 5FUIA 3ZXKA 1VBC3 4KGQA 4DINB 2TEPA 4IV1A 3AK0A 3AP4A 4YNIA 4EQVA 3ZSKA 4AFAA 5ACA3 3NNJA 3OYWB 2GC0A 2YB7A 3M7AA 5JSPA 3E1F1 2FMYA 3AJYA 1ND2C 1X82A 2Q4SA 2SBAA 3DEMA 3RVHA 2CU5A 1LOCA 2JWPA 3FHIB 4HOOA 1AL22 1YQCA 3PUSA 4NMIA 4CA9A 4DXRA 2X09A 4H7MA 4C91A 3VKFC 3O1RA 1RUE1 1QQP3 5A7OA 3ZXFA 3O1TA 2WN3A 3I8TA 3NNFA 5J3UA 4CSWA 2VBBA 3C3VA 3OGGA 2OW4A 1KITA 5DPNA 4GKXA 1JHNA 1ZRCA 1GANA 1A8DA 1VBB2 2F17A 4D3WA 4LXLA 2W1UA 2VCBA 5A3LA 3IWZA 4Q0SA 3QD6A 3Q8CA 3VV1A 3QH6A 3HQRA 4YW5A 1N1TA 1NXD1 1QF3A 5F9TA 4NWVA 1AR71 3HT1A 2GN3A 1CX4A 1UX6A 2QDRA 2V72A 5IK7A 1FX5A 2WQ4A 3VD7A 4QXKA 1ONAA 3HR9A 4HKLA 4QDRA 1Z78A 3H7YA 2BVBA 4GJYA 4TZDA 1YUDA 3A21A 1OF3A 1SPPA 5JLVA 3AKQA 4K3UA 3ZYHA 1BMV2 2D6OX 4COVA 3RMYA 5FXWA 3RQ0A 5C4WC 3ACHA 3JXSA 2UYBA 2A7AA 1G9BA 2DTYA 1O3SA 4P9JA 3O1SA 1PO21 5DAXA 2RR13 2A5ZA 1AYM2 3CDZB 2WWJA 5JMOA 3MIHA 5IJRA 4Y1ZA 2ZABA 5KXDA 3QOPA 2XDVA 2P2KA 2YHJA 3HWJA 1DHKB 4CDUC 3M4FA 2WA3A 1BXHA 3W59A 4D6SA 3BUCA 4EYUA 5LCWL 3K4AA 1L7RA 2IC1A 3OGJA 4D94A 1YC61 4CDXC 3BN6A 3C2UA 3VBFB 2BERA 4NIAA 1V6LA 3THCA 5CA6A 3Q8BA 3JB8A 3HPNA 3ILFA 3OEBA 4B4RA 1GSLA 2ZX0A 1DQ1A 3CZUA 3OEAA 1ACCA 2WNVC 2BZDA 4WZFA 2AZ5A 3AM2A 3DECA 4XBNA 5F3CA 2FCVA 4IEZA 4P9IA 5FMCA 3A4UA 3ROUA 4BHPA 3NNMA 2XKOA 4Q8LA 1UF2C 1UPSA 2ADDA 2CAVA 2BYVE 1HJFA 1SLAA 2XOMA 3FZ3A 4KNCA 5K0UB 3A0KA 1NLRA 2EXJA 1DLCA 4RGAA 1U5YA 3AYAA 1JUHA 2D6LX 2Y26A 3ZO0B 1H8TC 4AGVA 2D3RA 3ZXEA 5FMOS 5A6ZA 1J3PA 4URTA 5K4LA 5EWSA 2G9FA 1XYPA 2LALA 2JDPA 2ZJCA 3GJBA 3KF3A 1NUKA 4YGBA 1R081 2XBO2 1EPWA 2MEV3 3ATGA 1NAEA 4XOGA 5K0UA 2QJVA 1HN1A 4TLGA 3ST7A 1W2UA 2V09A 3GZAA 3IB3A 2WNVA 3JCIA 3ETPA 3ABZA 3QLQA 3V56A 1Y9MA 4XTPA 1TQ5A 3HAGA 4AVSA 4RFRB 4P5HA 1ZM1A 4UWDA 5T50A 3EXUA 5F1RA 1UOFA 3IAPA 4LKDA 2HKXA 4JGYA 5BNNA 5DABA 4CEWC 1C8NA 5F32A 1MVQA 2RMU1 2Q8OA 4E27A 5ABJC 4LBNA 5HV0A 5FR3A 1EV11 4AVVA 3EB7A 5CB7A 5FLJA 2OVUA 3OD0A 4DUWA 4QGLA 1RMU3 3M8LA 4BB3A 2OUHA 1CR7A 1W6OB 2B45X 2CV6A 2D40A 3JD71 4OI1A 1AXYA 3NV2A 3T2QA 4JDOA 4CU8A 2GMEA 2WA4A 3U14A 3GBGA 5KXBA 2MNGA 4UFIA 5FY4A 5IAXA 5LA9A 4IEOA 4XUNA 1Q8QA 1R092 1ZRFA 4O61A 3ZYFA 3INAA 4C1XA 3CJIA 2VMHA 5JXHA 2YBPA 1GU3A 3MGUA 1YXWA 2A3YA 2YBKA 2FD8A 5DDJ1 3T08A 1YIPA 2FDKA 3DN7A 1RUD3 4CXXA 1QDCA 1MEC1 1TMF3 1RUH2 1VBE1 1UCXA 2YFZA 3AMHA 3OUIA 4BISA 4OULA 1RIRA 4R9CA 1V0AA 3IN9A 4IGOA 5DAPA 3LOBA 3AMMA 3K77A 4IV3A 4PJYA 1PGSA 4RS5A 3AMNA 5FY8A 4IE0A 5LB6A 3U10A 3B5LB 1GOHA 1FPN2 2B46X 1OPOA 5DAVA 5CEHA 1ULEA 4AQ6A 2GNBA 2HWF3 1H8TA 4I30A 5A7SA 1AR91 2RM22 4LPLA 2WO1A 1NZIA 4KBBA 2EVXA 3OUHA 4HPKB 5BV6A 1GP6A 2DU1A 3I2JA 1A34A 3KV4A 4FFHA 4V1PA 1JOPA 1S0JA 5LBBA 1J59A 1GYKA 5A7WA 2ZKNA 2BNNA 1UD1A 2P17A 4UFHA 2WT0A 1MVEA 3MV11 4AHZA 1PIV1 4XMIA 3ZXGA 4CU9A 1S0BA 1FNZA 1RUJ2 3AZZA 4TLFA 5H9PA 5LRRA 3AL5A 2YPDA 4Y5TA 1YRZA 3WQ1A 2Q8EA 5DMYA 3O7OA 4H7LA 4YG0A 1RC6A 1ENXA 1F4HA 4D8MA 1GNHA 5IUQA 1WZXA 4Q4Y2 1ND2B 2GC1A 4XUTA 4YG3A 3KS7A 4XJZA 4Z8BA 2RJLA 3OBRA 3IKWA 4N43A 1BEV2 4CTEA 4FTBA 5GZDA 3FFQA 2YYOA 1R1A3 3GZUC 4LHSA 4OUSA 2W92A 4XFHA 4IUGA 2WZR1 4DOUA 1DDLA 2HH9A 1Q5OA 5JIUA 5ACA1 1Y4WA 3B9CA 3EBRA 4IGQA 4M4RA 3T0BA 3T09A 3KMHA 4OQ8A 1Z7S3 3KT7A 1ND2A 2LS6A 1FNYA 2DU0A 5C9AA 3N9NA 2RDSA 3PJQA 3KV5A 3JBG2 1RJ7A 4JRLA 1W9WA 5KWRA 2A70A 1GZ9A 5CIRA 4LULA 1AR92 4J1XA 4LITA 1KD7A 1ND3C 4A7YA 2VULA 1W2OA 1DZRA 3BODA 3LAGA 4K8FA 2IXHA 4Q1RA 3RNSA 1A78A 5HV4A 3V0BA 1Q8PA 3A7QA 3KM5A 3BTYA 1N3OA 2YU2A 4QX0A 3VBRC 2KR2A 4JCKA 4AFMA 3AXEA 2AH2A 4NIDA 2GP5A 4MVTA 2VMFA 1DQ0A 2UWAA 3K75B 4ONUA 1C8M3 1UZ0A 5B4XA 3KLSA 4HKOA 1F5FA 2JX9A 1N47A 1OD3A 2WO7A 3WP6A 1SG3A 4XAAA 4JX0A 5FYBA 5JOYA 1WCSA 3IPVB 3KB5A 3PMEA 4NE9A 5CFDA 2R49A 3ELNA 5FFOC 1JUIA 4XXAA 3I2HA 5ANNA 4GIQA 1O4ZA 5FZGA 1VLNA 3SMHA 1H2LA 4MG2A 1SZBA 1BLZA 2P5BA 2VZUA 4WM8A 2QQVA 1CZSA 3GXUA 5F3IA 3FUQA 3LF7A 1IGOA 1FI2A 4XJAA 2JDYA 4FI9A 5C33A 5AC91 5FZLA 1R1ZA 1K5JA 4AVCA 2JIJA 3SCHA 4LORA 1W6QA 4BQ4A 4E8DA 1SLCA 4M00A 3MF6A 1VBD3 2B5HA 4XF0A 3BYWA 1APNA 1NCRA 3J7NA 3T0DA 1LAJA 4ZU4A 3LIGA 4XMAA 2R043 3RSJA 1K5MB 1RUI2 3K46A 4AEDA 2W08A 1T6BX 2XXZA 4FP3A 3ZXJA 5FMBA 3N7LA 2VU9A 3ACFA 3LCPA 4XVHA 2DVBA 4HXCA 4QU1A 5AVAA 3SEEA 2P4EA 1M4WA 2XVGA 5CFDC 3USUA 4RS5B 2VZQA 4JVAA 3S7EA 4K8RB 4K6BA 1GWMA 1EUUA 5I8SA 2ZGOA 1Q56A 2SLIA 1ASJ1 1NCQA 4QXCA 1XBFA 4WM7A 3BALA 3AP5A 3BKZA 1U0AA 3WNOA 4QKDA 3WNXA 3VBOB 1ULCA 3WV6A 2E53A 3HBZA 1PM7A 3BGAA 3ES4A 2NMNA 4CU6A 4YZ5A 2DUOA 1H6XA 4HSLA 4H3WA 1FMD2 2MEV1 2XUMA 2MPFA 1IKQA 2WFF2 1AYM3 5ABJB 1WGPA 1XE0A 3SITA 1TMF1 1VBE3 4UT5A 1JMUB 5FJKA 4YRDA 4QX5A 1PMHX 1GICA 2P6HA 2B39A 2IVIB 4MGSA 4QPWA 2J42A 4IERA 3UT0A 1U5XA 1CGPA 5DUVA 3DYMA 1W9YA 1LOBA 5DQ0A 3APBA 3DPRA 4RYDA 2Y6LA 4JDMA 4QQOA 5T52A 3GCWA 1FPN3 1HRV3 3TBDA 5IFPA 2ARAA 1HW5A 1VAKA 3AC0A 2BGOA 2VR4A 1K45A 1OBNA 3WNNA 4Y33A 5HCHA 4OI0A 5FY9A 2QZ3A 2D7FA 1RHI1 2A3WA 2I45A 4DUVA 3B01A 1BMV1 2GNTA 1SACA 4P9LA 5I0RA 1I6XA 2QQMA 2WT1A 3IBMA 3VBSA 3FWEA 1LENA 3JB4C 5FIXA 5CFCB 5LEKA 3J8F1 4A45A 1PO22 2VZPA 1JOJA 3OD4A 1CAUB 1HXS3 4XILA 4BQWA 1IS5A 2E7TA 3FLTA 3GNEA 3TAYA 3WW3A 4E4DX 4CVUA 3OJBA 2VOXA 3SH4A 2ZACA 4K21A 4TYSA 1DYPA 4UW5A 4Q8KA 4OI4A 4WVMA 3FFZA 4UFJA 2JICA 1SDWA 1W6MA 3H9AA 3LSEA 3NRUA 3ZKYA 1LOFA 1W05A 3ASIA 4IL7A 1OFSA 3ZFEC 3H0OA 3F2ZA 2Y64A 3FBMA 3PVOA 1D2SA 3IPVA 4UFMA 2HWE3 5EYXA 1HDKA 1JW6A 2WIIB 3WG4A 4RR3B 1WBFA 1VBA3 2HWF1 3L2HA 4Y1XA 5A3PA 5C8CA 2FDGA 5C8CC 4JGZB 2CHHA 1BYHA 2RDRA 4CCLA 1YFYA 1QU0A 4P00B 2VZTA 4P9XA 3U0ZA 3J7HA 1SLBA 2JXAA 3RPQA 1LODA 4BLJA 2JG9C 5FY1A 3RI8A 4AGGA 4IE4A 5BNOC 2RS52 3H3LA 4GQ7A 5C5UA 1H4HA 2VM9A 4LBKA 1UMIA 4M01A 5JSOA 3CJIC 1HXS2 1RGSA 2IXLA 4EN8B 1HLCA 4NHXA 1LU2A 4JKMA 1X7NA 3HNMA 5C9AC 4LTAA 2JDKA 3B69A 1LHVA 4YLZA 2VXJA 3ZFFC 1JYNA 5JDBA 2Y6JA 2HJIA 2VOWA 3CJXA 5JOXA 2EIGA 4Q4X2 2EAKA 2WNOA 1S0EA 2OA2A 4W50A 3KGZA 4QXBA 4JKKA 1K5MA 5FXXA 3KGLA 2P34A 1JYVA 1AR82 4OVEA 3L2YA 2ARBA 2LM3A 3P3PA 3MF9A 1DGRN 5JZGB 1A3KA 1UXXX 3U4XA 5M0TA 2V4AA 2A3XA 4B7EA 2B9UA 3S5AA 1ZBA2 1DG6A 2YG0A 1VRBA 1PHMA 4A6OA 4B8EA 2CSGA 1VRH1 3NJVA 1ZRDA 2B7YA 4MXVA 4IE7A 3CF6E 3P5BA 4FOVA 1W2TA 4QAWA 2A6ZA 5IFTA 3VBOA 2XQRA 1Y9GA 4XFFA 4MV2A 3RJ2X 5JOZA 3DV8A 5FPXA 1L7LA 3OOXA 2HWC2 3KD4A 4YZ2A 1ZREA 2FDIA 1DCSA 5CZKA 2WFF3 1F15A 2J1TA 4YGEA 4RHV2 4XFIA 3OG2A 1CAWB 4N7UA 1NQJA 1MQTB 2EXKA 1UKRA 3CIHA 4QKBA 4QHOA 2PHXA 3A0NA 5F6KA 4D7SA 1O7FA 1WUVA 2KXLA 3X29B 4IDZA 1NY72 3RZKA 1CQ9A 1SPPB 3J7MA 4ZPIA 2BGCA 1IQDC 1O6UA 5JI7A 1T2XA 1UN1A 3FLPA 1QJZA 3PVEA 1UU5A 4FPKA 4GB33 3R4DB 4M3CA 3POBA 4B1LA 5CBLA 5FYCA 2QQKA 3MDPA 5HCAA 3JQXA 5HBAA 4JTOA 3T4VA 2ZEWA 2D5HA 4ITCA 4QXHA 5J37A 4Q4W3 3T3YA 3CNAA 2NQYA 4ZZ8A 2A6XA 1XE8A 2J1UA 4ES9A 1HB3A 2XJQA 2PLV1 1LGBA 3PHMA 4PF5A 4KG8A 4XDQA 2HWD2 1K5MC 3KCXA 1SDDB 5FY7A 3T2PA 4QB1A 3MZHA 1RXGA 3ZFGB 4YPJA 2JDZA 3VBSB 3TN91 2BUKA 2WZEA 4JTNA 3POWA 3VHPA 1TME1 2WBKA 2XMLA 3FN9A 1LRHA 3I4IA 3ZFEA 3AVSA 1C4RA 1UL9A 3LZZA 3M1HA 4PIXA 2HWB3 3S6PA 3H8XA 2PLV2 3WNKA 1O5UA 5FLHA 1DYOA 4RQPA 2VZOA 3AYDA 4CCDA 5A1LA 4AE2A 5J1XA 1MS0A 4WVMB 4DFSA 2WO3A 4Q4V1 4UF0B 3VGIA 3WNPA 1SLLA 2JG9A 3ZN5A 2R7EB 2Y6GA 3VBOC 1M06G 2FBEA 2B4KA 4GWMA 4QB6A 3CU7A 2OZ6A 3B7MA 4ATEA 1K42A 1VJ2A 4IW3A 4D6QA 2W0XA 3M3OA 4YM1A 4COWA 4JGZA 1W6OA 2RS33 3AYEA 4NRQA 3SEPA 5J36A 1LECA 3NAPA 5IWFA 1PZ9A 3IDBB 1LOFC 1UWWA 3LEKA 2VW0A 4YM2A 4OFGA 1QJX1 2X5IC 2YFUA 2PAMA 1IQAA 2VMDA 1REDA 1UOGA 5EJ3A 4LOSA 5F2WA 4AHWA 4XFBA 5I0DA 1W2AX 5DG2A 5C71A 3QCWA 1QY4A 1D0GA 2CGOA 2PN5A 3UJQA 3ZXDA 4OMDA 4MUVA 2VZ1A 1H0BA 1OLMA 2VECA 4FPLA 1JHJA 2J1AA 5I0SA 3N4MA 1RUJ3 2H6BA 4EJRA 2CL2A 1UU6A 2E7QA 4MX3A 1HIXA 3BOPA 4HVRA 1BEV1 2BOIA 5T55A 3VKNA 1R1A2 1WCUA 5L36A 3PVBB 4GAZA 3UKVA 3WT3A 5FZ3A 1OFNA 3ACIA 1IG0A 5AVPA 1G9DA 2D98A 5JUVA 1YJKA 3THDA 4Q4Y3 3HVDA 2RS32 4L2NA 5HXMA 4HG6B 4JAAA 3LDKA 3R4SA 1Y43B 5FZCA 2H0VA 3HJRA 3VBRA 4CEYC 3POGA 1FV3A 4YVSB 3LKJA 2A6WA 5C3OA 5LWBA 5A7WB 2QQUA 1SBFA 3AX4A 1CZTA 3C7OA 1EY2A 1AR73 3MYXA 4K40A 3RYRA 3P6BA 5BYNA 4NPMA 2IXIA 2QQIA 3UYJA 1PVC2 5FKBA 1VALA 3OY8B 2WO2A 3O0WA 2ZHLA 3CLPA 2TUNA 4QKNA 4DXSA 5IVFA 1GNZA 1S0IA 3J8F2 1NA1C 1RUC2 2PHLA 4FCAA 4KBZA 4NHKA 1BK1A 1H8TB 3NO8A 4U2AA 3MLKA 2GSYA 1MZEA 4PDWC 3W9AA 2VC9A 3ZDVA 3DUIA 5L7OC 2P6CA 4N43B 1N1YA 1WWYA 2MHFA 4XQWA 3AP7A 5FYVA 1OA2A 3T2OA 3SQOA 4Y4RA 4WV8A 3N35A 1YNAA 1MS9A 3FJSA 1VRH3 3LEMA 5LBCA 4LKSA 2ZAHA 3RZHA 1TZOA 1OC1A 5C9AB 4G4FA 1EYBA 1AX1A 1FOD1 5CKQA 3RDIA 4QB2A 3E6DA 4A42A 3Q8FA 1MACA 5F39A 2G4IA 4XTMA 3H1YA 2ZHKA 3VL9A 3H8RA 4LBQD 1LKNA 4W8JA 2ATFA 5KC6A 3B00A 4UW4A 3ZFGA 2DUPA 3WF0A 3JD72 1PX3A 3J8F3 4XFGA 1WMEA 3LFIA 5EV7A 5F3EA 3VDCA 3VZJA 4I0BA 1AYN1 3W20A 2W2IA 1UAIA 1CIYA 3I59A 4YVWA 3FMGA 2BTVC 2VOVA 5GLZA 3IIAA 4AQTA 5I93A 1JYWA 3O1PA 2LTNA 3QH7A 4R9BA 1OXCA 3WG1A 4LUKA 2NYYA 3B3QE 2A71A 4LBMA 4Y24A 1AL0G 2VBPA 4AG4A 1VPHA 1ZZCA 4FFGA 5EYYA 4MXWB 1FAYA 2IFRA 3CO2A 2D6KA 4XPVA 4JZRA 4IGPA 4W65A 4I3GA 2E6VA 2VQUA 3ZSMA 4FPGA 2QVSB 2XBO1 3MIFA 2A1XA 3OSDA 5FMOL 4N9HA 3I2DA 3WDYA 4KMQA 3HMYA 1GWLA 4X6QB 1QQP1 1IOAA 2GP3A 4HFSA 3HNYM 1TEIA 3I3DA 3WHUA 4LO5B 1ULPA 2WFF1 1B35C 1AJOA 1HJGA 1OOPB 2O14A 1UMHA 2MEV2 3FL7A 4UYBA 1LOEA 4CCOA 2HWB1 1YIFA 1PVC3 2VXRA 2XKPA 3DKQA 4GMP1 3U11A 5F7UA 5L7OA 3O1VA 4I0WB 3E6CC 1RUNA 1EV13 2DVAA 1UMZA 2YMZA 4UI9L 4XF1A 1RJ8A 2BNMA 3RGBA 1QKQA 2W47A 1CAXA 2PELA 4XHXA 1UZWA 2Z42A 3J7LA 2E9QA 3A23A 3RYPA 3LOIA 3NJXA 4Y22B 2JEMA 4B4QA 3FHQA 2PQQA 4QWNA 5FYHA 1EAH1 4XDOA 2GNMA 1JOBA 4EWAA 3I54A 5JOWA 2LROA 3NWKA 3KF5A 4HK8A 2DCJA 4U36A 5ERLA 3ZFGC 3K4ZA 4FQZA 3MIEA 4K1ZA 4AFCA 1X8MA 2ZMKA 1O3QA 2L9LA 1FT9A 3IMMA 3LA2A 2QE3A 2RJKA 4NOTA 3SXWA 2ZKLA 3ZKUA 3PTRB 1SHWB 4YFWA 1FMD3 3AZWA 4MGYE 4PLMA 1ZZ7A 1Q3EA 3LQCA 1OMIA 2ENRA 4BQ2A 1XYOA 2V4VA 1ENRA 3K3NA 2W1WA 3VZOA 1ULFA 4AI1A 4LKFA 1TME3 3UGFA 4DZGA 1REFA 1HB2A 2DCZA 4ZXKA 4DPNA 4XXPA 4DMIA 5LA2A 3IMNA 3D5OA 3DPRC 4HVOA 1KXGA 3I3BA 5DXDA 3USUB 3ZYJB 4E4ZA 4BQ5A 5SV8A 3ZDSA 1RUC1 1UYXA 1Y3TA 1IS4A 1DGWA 1GZCA 1W8OA 2O8OA 3R4UA 1DZTA 4LHLA 3UKNA 4BE3A 1KFXL 1XSQA 3H3ZA 4CP2A 4J1WA 4TSVA 3P3NA 4AGRA 1CJDA 1H8VA 3T0AA 5JXGA 2H6CA 4ES8A 2VZRA 3HN1A 5FZDA 1JBCA 4LO7A 2WQZC 1DZQA 1PGL1 2OUJA 2VMEA 2FCTA 3D3AA 1TE1B 3TB0A 1CD3G 3I49A 1KEXA 5FO7B 2R16A 4YZ4A 4DNYA 2R1DA 2FQPA 2XLAA 1MZFA 2Z2SB 3EQEA 4EROA 4CU7A 2CY6A 5JCTA 1PMIA 4H55A 4OCTA 4AI2A 5FZ6A 4CDXB 3ZMNA 2VZ3A 2W5FA 5FY0A 5HPOA 4DB5A 1BVVA 4FSJA 2ADEA 1W6PB 2VO5A 1W99A 2C24A 3EJKA 4P14A 2FDFA 1R1A1 1BZWA 1UIKA 2DCYA 2R30A 5J09A 1YQ2A 4I0AA 5FZBA 2WRAA 3MUZ1 2Q1MA 1YFUA 5FZ4A 3MLJA 3OF1A 3GGLA 2OYZA 3WDWA 2G9GA 3R0RA 3HBKA 2X05A 3WLUA 2ZGUA 1OURA 1B09A 1W6PA 2DF7A 5LBFA 2R0HA 4CDQA 5DZFA 5IVYA 3SCGA 5K0UC 5BNPC 3POFA 4LBLA 3RMXA 5FPUA 4XDPA 4YARA 3POEA 5IK8A 1NLQA 2GNDA 4XFCA 3FE5A 3BPSA 1JH5A 4O9EA 3WX5A 4FOQA 2VTXJ 2GC3A 4F83A 1CVNA 3F95A 1NCQC 4IEXA 2OQ6A 4RL7A 4JRAA 3ALQA 3POSA 2PHUA 3N9QA 4CEWA 4NAMA 1WD3A 3NAPC 2W1SA 5E1RA 5CFDB 4BDVB 2HEWF 4RS5C 5D8AC 2PHFA 2WNUB 1MS4A 2BGPA 2VY0A 4FPJA 5FAXA 3ZR5A 2D93A 4AI9A 1DFQA 2RS11 2NPIA 1VBE2 1X33A 2W1QA 3H50A 2VAUA 2WDBA 5DDJ3 3ACLA 2E33A 3POYA 4GKYA 4NAOA 1IS3A 4LE4A 3VKMA 4IESA 5IK5A 1YEWA 2VUAA 2TBVA 4HSJA 1LU1A 5CKNA 2BPA2 2A6VA 4AAPA 1POQA 3BI3A 2ZMLA 1D7PM 1FOD2 2DVFA 3PIGA 4Z92B 1Y7BA 4LK6A 4A3XA 2WKKA 2JDNA 4OI2A 1DU3D 1REEA 4HZFA 5A6YA 5IVCA 3V0AB 1PNFA 3AVRA 1G9CA 4Q27A 2VVDA 3WCRA 5FK7A 3QACA 1IPJA 4Y1YA 5EHDA 4ASMB 4UAPA 1S0CA 4AEDB 2AACA 5FYSA 1HV1A 3AKRA 2HEYF 4WM7C 2RV9A 2EALA 4CP9A 3WG2A 2VNVA 3WW1A 1GWKA 1MEC2 4LE3A 4Q2FA 1CZVA 5F8PA 4NIGA 2JG8C 3S7IA 1N3PA 3JU9A 1KDKA 1QOOA 4S2HA 3ZXLA 4HN1A 1PGW2 1PVC1 1W6QB 4E2SA 1UO9A 1O3TA 4QGNA 1JZ2A 2RE9A 3KSCA 3KQ4B 3WDXA 5I0UA 1RUF1 1PNGA 2VQTA 5A7NA 4YW6A 3S0MA 1MZ5A 2F4LA 3W5NA 4HVQA 2ZX2A 5E6HA 4YW2A 2ZEXA 4JDNA 5E16A 1QJU2 2XWJB 2WS91 4XJ8A 2WQ8A 5A3TA 2XHNA 1XJAA 1F2NA 4LK7A 4M3CB 3WNMA 3K3OA 2B42B 3W58A 1GUIA 4LMFA 1UU4A 5J96B 2ZXQA 4E2QA 1WA4A 1VB4A 1B35B 2VBDA 1OOPC 3WINE 5A7PA 3VBUC 1GZTA 5KHJA 1FMD1 4EN7B 2ERFA 1D4VB 2W68A 4Q26A 1VRH2 2OX0A 1DLLA 2J1RA 2AUYA 2XJUA 2ARXA 2XL7A 1JODA 2C6SA 4G3YC 3WOGA 4GWIA 3PUQA 1H2NA 2QBXA 1OVPA 3E5QA 4NJ4A 1ZRIA 5ISLA 4AI0A 4CDWB 1J84A 4ZHNA 3G6JB 1AR81 2WR9A 2ZGRA 1QJU3 5KR7A 4A44A 3ORJA 5FUPA 4AHYA 3KT1A 1DQ5A 5A33A 4P9YA 4RHV1 4J6GA 3MPPG 3WXPA 4CYDA 4AK3A 1OH3A 2G9ZA 1KDMA 2PA7A 2PMWB 1S2BA 1RHI3 2WINB 1SLTA 4LEJA 2VZVA 3VD5A 5F6LB 3ZVXA 5C6CA 1H9PA 4B3NA 2VCMA 1ND3B 4XE9A 1OD5A 4XIOA 3BTAA 4YM3A 5DZEA 3RFRA 3WF3A 4WVVA 5A32B 3LDRA 1Y9QA 1GQPA 1WW6A 1W0PA 1E5RA 4NN0A 4RQPC 4W6XA 3N9OA 2C4XA 2YU1A 5FZMA 3O0XA 4XQDA 3RS6A 1RUOA 2VNGA 4CPBD 1NE6A 3D0SA 3KVBA 1NE4A 3VLBB 2RS53 4PT6A 1D0HA 3DCQA 4OHWA 4RR3A 4LJHA 2JD4A 3OBZA 4NHMA 5DAWA 5GLUA 3WQBA 2CAUA 2VUJA 3TEWA 3TN92 4UF0A 4AOCA 5D2AA 3VHRA 1YWKA 3OTFA 1HRI1 5FZHA 4XYXA 3OPZA 3J9SA 4I2OA 5L9BA 5FDBA 2KA3A 5FKCA 3TYJA 2X5IA 3N9LA 3AZYA 4FPYA 2A73B 3ECQA 2WUHA 2YZ4A 1UY2A 4IV1B 1VIWB 2QQNA 1RVF1 4X6RB 5FZ9A 1ZYBA 2BFUL 1O5LA 1AL21 2LW8A 4INDA 2D3PA 3N7KA 4MSVA 1HQWA 2Y60A 3BIWE 3W5MA 1COV1 1S1AA 1CIWA 1LR5A 2W39A 4GH4C 5GZFA 5KXEA 1H1AA 2JE9A 1D2QA 1GP4A 2ZHMA 4E2GA 1ASJ3 4QHBA 2WYFA 4QQLA 1DF0A 2V5YA 2AEYA 4CCMA 4H14A 4KL1A 2XJSA 3NV1A 5C8WA 2WABA 1A6CA 4D7TA 2W94A 5GLTA 3LFMA 4DQAA 3RWKX 1QJY1 1HRI2 5GJ6A 2DCKA 4Q4X1 3EMRA 2DTWA 1WKYA 3Q8AA 4DEVA 5A1FA 3MUY1 1LOAA 1E5SA 1XNAA 5BNPB 4QM9A 4UW3A 3U75A 4AXOA 3C7EA 4LOTA 5FCCA 2NM1A 5EIYB 1CAVB 2R062 4MZUA 2G1MA 3WSOA 2WZR2 3PIJA 3TOJA 1F35A 2JDHA 2VCCA 1ZNPA 1GZWA 3T30A 1MS8A 1RUC3 1QJEA 1QJX3 4LIUA 3EYPA 1C5IA 1OQ1A 1GMMA 2Q1ZB 4SLIA 1YQ5A 3MV01 1RXFA 3N7MA 4ZXEA 2P3YA 3G7DA 3NV4A 3B94A 1XNKA 2PQSA 2WWUA 2GH2A 2ZGSA 4SBVA 3ZSEA 4BMEA 2XJRA 2I07B 4AFBA 5JZGA 3BIEA 1LOGA 3CEWA 5FZEA 4NVPA 3LEGA
chains in the Genus database with same CATH topology
5JR2A 3SEPA 3ACHA 2XQXA 3JXSA 5DN2A 1UWWA 3LEKA 2YFUA 2C26A 1O8PA 3NQHA 3CDZB 2VMDA 2VMCA 5JMOA 5IJRA 5I0DA 2JE8A 5C71A 3P1IA 2J1EA 4OMDA 2VZ1A 5LCWL 3K4AA 1JHJA 1L7RA 2J1AA 2E26A 3VD9A 4P08A 3BN6A 3WEZA 1JU3A 1NX9A 2QQLA 2BERA 3THCA 2VJXA 3HPNA 3C7FA 3OEBA 2Y6KA 5G05L 3ACIA 3CZUA 3OEAA 3I2KA 2BZDA 5JUVA 3THDA 4W4ZA 3DECA 5HXMA 4HG6B 2J7MA 4ET7A 3HJRA 2XOMA 3OBAA 1UY1A 1DLCA 1CX1A 2XONA 3VD4A 3C7OA 1CZTA 3P6BA 2W87A 2QQIA 1NUKA 4QX1A 1NAEA 2WO2A 1HN1A 4DXSA 1K3IA 1EUTA 3IB3A 1LNSA 3ETPA 2X10A 3ABZA 2W91A 2J22A 2VC9A 5JXIA 3IAPA 3T2OA 2J1VA 2BBAA 5C7GA 4MGQA 4OUEA 3EB7A 4DUWA 3C8XA 1DP0A 1US3A 4LKSA 1J83A 4ZZ5A 5C70A 3CKHA 1US2A 2YC2A 3HOBA 4QB2A 4A42A 3T2QA 4CU8A 1GOFA 2EICA 1I5PA 4XUNA 3K4DA 4W8JA 3WF2A 2EIEA 5JXHA 3WF0A 1GU3A 1JZ3A 1PX3A 3IAQA 3T08A 1CIYA 4TXWA 4XUPA 4CUAA 2WYSA 2YFZA 2E31A 4P5YA 1JYWA 3FHAA 3SKJE 5IHRA 1K12A 3K77A 4AG4A 2ZEYA 2ZEZA 1GOHA 2Z4FA 2W46A 3PUIA 1KGYA 2VQUA 4LPLA 3IDAA 2WO1A 3DYPA 2ID4A 3I2JA 3PUHA 2HYXA 2W95A 4KMQA 4E8CA 2E32A 3HNYM 3I3DA 1ULPA 3MV11 4DXTA 4CU9A 3FL7A 1UMHA 3T0DA 3OB8A 3CMGA 5F7UA 1JZ7A 3A22A 4UI9L 3HEIA 5DMYA 2W47A 3CZJA 4OZOA 1F4HA 4D8MA 1RYYA 4KI5M 4LQRA 3A23A 4XUTA 3NJXA 3FHQA 3WNLA 4A41A 4LHSA 2W92A 4AAXA 2WAOA 4IUGA 4BJ0A 1OH4A 4KWUA 2DCJA 3WF1A 3K4ZA 4M4RA 3T0BA 3T09A 2L9LA 2LS6A 1SHWB 1O59A 2V5DA 1W0NA 1W9WA 3VDBA 1O8SA 3LQCA 3GM8A 2V4VA 2JKXA 2W1WA 5A1AA 1JZ4A 2VZSA 2HLEA 4CUBA 3C7GA 5LA2A 1UXZA 3A7QA 4BK4A 3I3BA 4QX0A 1UYXA 2VMFA 3K75B 4XUOA 4ZY9A 5B4XA 1UZ0A 1W8OA 3MO4A 1OD3A 2WN2A 1SG3A 5JXGA 4JX0A 3T0AA 4TTGA 2VZRA 1JYXA 3HNBM 3I2HA 2VMEA 3D3AA 4MADA 3GDBA 2Y8KA 4ARXA 1KEXA 4JKLA 3NNGA 4P02B 2VZUA 2WAAA 1XNTA 1CZSA 3GXUA 1UY3A 3SKVA 4CU7A 3UNPA 4FI9A 2VZ3A 2W5FA 5HPOA 4BXSV 4E8DA 2VO5A 1W99A 2ORZA 3WF4A 1YQ2A 3MUZ1 4MOAA 2YC4A 1W8NA 3GGLA 5EJ1B 3K46A 2X05A 1JZ8A 1F4AA 2C9KA 4XURA 5B4NA 4PQQA 2VTFA 5JXJA 3ACFA 4XVHA 3SEEA 3MBWA 2VZQA 1XPWA 5IYYA 1EUUA 2VOTA 1OF4A 3I97A 1PX4A 3U37A 3WNOA 2QQOA 2W1SA 4PF1A 3I2IA 2RVAA 4BDVB 1JZ6A 2BGPA 3BGAA 3LEIA 3DYOA 4CU6A 1H6XA 2W9XA 3UETA 2W1QA 1BHGA 4OYUA 2WDBA 2E33A 2JD9A 1PMHX 1D7PM 4MGSA 3OGRA 4QPWA 3DYMA 5DQ0A 4RYDA 2RJ2A 2Y6LA 4UAPA 5IFPA 1PMJX 1OT5A 3AC0A 2BGOA 2RV9A 2VR4A 1K45A 3WNNA 1XC6A 1UYYA 2WZ8A 4DUVA 1CZVA 1H6YA 1L7QA 1NKGA 2EIBA 2QQMA 2OKXA 5EJZB 4BK5A 1JI6A 3CQOA 4QDSA 1JZ2A 4A45A 2VZPA 4A4AA 3I2FA 2VQTA 3I3EA 1UY4A 4CVUA 1UY0A 3W5NA 4M4PA 2ZEXA 2Y6HA 1UYZA 2B9VA 2WQ8A 2XHNA 3NRUA 1UX7A 1GNYA 3WNMA 2EIDA 4L0PA 2DDUA 3F2ZA 2Y64A 1R64A 1GUIA 4CUCA 2ZXQA 1TG7A 1JZ5A 4P00B 2VZTA 4XUQA 3J7HA 2VL4A 4DUXA 1MPXA 1JU4A 2J1RA 4GWIA 5G04L 4ARYA 2VM9A 2QBXA 1UMIA 3ZM8A 3ACGA 1J84A 2J1SA 4JKMA 4RN5A 3HNMA 1JYNA 2CDPA 4A44A 2Y6JA 4XZUG 3OGVA 3HN3A 4DEQA 4W50A 4JKKA 3LPFA 3OGSA 3UESA 2KD7A 1JYVA 5LA0A 2CDOA 2VZVA 3VD5A 1UXXX 1ULOA 2ORXA 2YG0A 3WF3A 4A6OA 1GQPA 4QX3A 3NJVA 2C4XA 4QAWA 5IFTA 4GZ9A 4QDQA 4PT6A 3VDAA 5LA1A 4D0QA 3WQBA 5CZKA 4GWJA 2J1TA 2VCAA 1TVGA 5CYYA 3OG2A 3CIHA 2W3JA 4OMCA 3ECQA 4MO3M 2WUHA 1UY2A 2QQNA 4A3ZA 4QX2A 1IQDC 1T2XA 3VD3A 2QQJA 2LW8A 3I2GA 1W9TA 5FUIA 3W5MA 3C7HA 2QQKA 2ZEWA 2YB7A 4ZZ8A 4UOJA 3E1F1 2J1UA 2WABA 2W94A 4DXRA 3LE0A 4JHZA 2X09A 3T2PA 1SDDB 4QB1A 2DCKA 2WN3A 4YPJA 1WKYA 2WZEA 4DEVA 3MUY1 1XNAA 5DPNA 2WBKA 3FN9A 4Z2AA 3C7EA 1GOGA 2W1UA 2VCBA 5EIYB 3WNKA 3WSOA 1DYOA 2VCCA 2VZOA 5J1XA 2JDAA 3VDCA 1W9SA 3EYPA 2WO3A 3WNPA 1GMMA 2V72A 3MV01 2R7EB 4ZXEA 3VD7A 2Y6GA 3LPGA 2B4KA 2PQSA 4QDRA 4QB6A 1WCQA 3A21A 1K42A 1OF3A 3IIIA 1P8JA 3LEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR2 A;  3SEP A;  3ACH A;  2XQX A;  3JXS A;  5DN2 A;  1UWW A;  3LEK A;  2YFU A;  2C26 A;  1O8P A;  3NQH A;  3CDZ B;  2VMD A;  2VMC A;  5JMO A;  5IJR A;  5I0D A;  2JE8 A;  5C71 A;  3P1I A;  2J1E A;  4OMD A;  2VZ1 A;  5LCW L;  3K4A A;  1JHJ A;  1L7R A;  2J1A A;  2E26 A;  3VD9 A;  4P08 A;  3BN6 A;  3WEZ A;  1JU3 A;  1NX9 A;  2QQL A;  2BER A;  3THC A;  2VJX A;  3HPN A;  3C7F A;  3OEB A;  2Y6K A;  5G05 L;  3ACI A;  3CZU A;  3OEA A;  3I2K A;  2BZD A;  5JUV A;  3THD A;  4W4Z A;  3DEC A;  5HXM A;  4HG6 B;  2J7M A;  4ET7 A;  3HJR A;  2XOM A;  3OBA A;  1UY1 A;  1DLC A;  1CX1 A;  2XON A;  3VD4 A;  3C7O A;  1CZT A;  3P6B A;  2W87 A;  2QQI A;  1NUK A;  4QX1 A;  1NAE A;  2WO2 A;  1HN1 A;  4DXS A;  1K3I A;  1EUT A;  3IB3 A;  1LNS A;  3ETP A;  2X10 A;  3ABZ A;  2W91 A;  2J22 A;  2VC9 A;  5JXI A;  3IAP A;  3T2O A;  2J1V A;  2BBA A;  5C7G A;  4MGQ A;  4OUE A;  3EB7 A;  4DUW A;  3C8X A;  1DP0 A;  1US3 A;  4LKS A;  1J83 A;  4ZZ5 A;  5C70 A;  3CKH A;  1US2 A;  2YC2 A;  3HOB A;  4QB2 A;  4A42 A;  3T2Q A;  4CU8 A;  1GOF A;  2EIC A;  1I5P A;  4XUN A;  3K4D A;  4W8J A;  3WF2 A;  2EIE A;  5JXH A;  3WF0 A;  1GU3 A;  1JZ3 A;  1PX3 A;  3IAQ A;  3T08 A;  1CIY A;  4TXW A;  4XUP A;  4CUA A;  2WYS A;  2YFZ A;  2E31 A;  4P5Y A;  1JYW A;  3FHA A;  3SKJ E;  5IHR A;  1K12 A;  3K77 A;  4AG4 A;  2ZEY A;  2ZEZ A;  1GOH A;  2Z4F A;  2W46 A;  3PUI A;  1KGY A;  2VQU A;  4LPL A;  3IDA A;  2WO1 A;  3DYP A;  2ID4 A;  3I2J A;  3PUH A;  2HYX A;  2W95 A;  4KMQ A;  4E8C A;  2E32 A;  3HNY M;  3I3D A;  1ULP A;  3MV1 1;  4DXT A;  4CU9 A;  3FL7 A;  1UMH A;  3T0D A;  3OB8 A;  3CMG A;  5F7U A;  1JZ7 A;  3A22 A;  4UI9 L;  3HEI A;  5DMY A;  2W47 A;  3CZJ A;  4OZO A;  1F4H A;  4D8M A;  1RYY A;  4KI5 M;  4LQR A;  3A23 A;  4XUT A;  3NJX A;  3FHQ A;  3WNL A;  4A41 A;  4LHS A;  2W92 A;  4AAX A;  2WAO A;  4IUG A;  4BJ0 A;  1OH4 A;  4KWU A;  2DCJ A;  3WF1 A;  3K4Z A;  4M4R A;  3T0B A;  3T09 A;  2L9L A;  2LS6 A;  1SHW B;  1O59 A;  2V5D A;  1W0N A;  1W9W A;  3VDB A;  1O8S A;  3LQC A;  3GM8 A;  2V4V A;  2JKX A;  2W1W A;  5A1A A;  1JZ4 A;  2VZS A;  2HLE A;  4CUB A;  3C7G A;  5LA2 A;  1UXZ A;  3A7Q A;  4BK4 A;  3I3B A;  4QX0 A;  1UYX A;  2VMF A;  3K75 B;  4XUO A;  4ZY9 A;  5B4X A;  1UZ0 A;  1W8O A;  3MO4 A;  1OD3 A;  2WN2 A;  1SG3 A;  5JXG A;  4JX0 A;  3T0A A;  4TTG A;  2VZR A;  1JYX A;  3HNB M;  3I2H A;  2VME A;  3D3A A;  4MAD A;  3GDB A;  2Y8K A;  4ARX A;  1KEX A;  4JKL A;  3NNG A;  4P02 B;  2VZU A;  2WAA A;  1XNT A;  1CZS A;  3GXU A;  1UY3 A;  3SKV A;  4CU7 A;  3UNP A;  4FI9 A;  2VZ3 A;  2W5F A;  5HPO A;  4BXS V;  4E8D A;  2VO5 A;  1W99 A;  2ORZ A;  3WF4 A;  1YQ2 A;  3MUZ 1;  4MOA A;  2YC4 A;  1W8N A;  3GGL A;  5EJ1 B;  3K46 A;  2X05 A;  1JZ8 A;  1F4A A;  2C9K A;  4XUR A;  5B4N A;  4PQQ A;  2VTF A;  5JXJ A;  3ACF A;  4XVH A;  3SEE A;  3MBW A;  2VZQ A;  1XPW A;  5IYY A;  1EUU A;  2VOT A;  1OF4 A;  3I97 A;  1PX4 A;  3U37 A;  3WNO A;  2QQO A;  2W1S A;  4PF1 A;  3I2I A;  2RVA A;  4BDV B;  1JZ6 A;  2BGP A;  3BGA A;  3LEI A;  3DYO A;  4CU6 A;  1H6X A;  2W9X A;  3UET A;  2W1Q A;  1BHG A;  4OYU A;  2WDB A;  2E33 A;  2JD9 A;  1PMH X;  1D7P M;  4MGS A;  3OGR A;  4QPW A;  3DYM A;  5DQ0 A;  4RYD A;  2RJ2 A;  2Y6L A;  4UAP A;  5IFP A;  1PMJ X;  1OT5 A;  3AC0 A;  2BGO A;  2RV9 A;  2VR4 A;  1K45 A;  3WNN A;  1XC6 A;  1UYY A;  2WZ8 A;  4DUV A;  1CZV A;  1H6Y A;  1L7Q A;  1NKG A;  2EIB A;  2QQM A;  2OKX A;  5EJZ B;  4BK5 A;  1JI6 A;  3CQO A;  4QDS A;  1JZ2 A;  4A45 A;  2VZP A;  4A4A A;  3I2F A;  2VQT A;  3I3E A;  1UY4 A;  4CVU A;  1UY0 A;  3W5N A;  4M4P A;  2ZEX A;  2Y6H A;  1UYZ A;  2B9V A;  2WQ8 A;  2XHN A;  3NRU A;  1UX7 A;  1GNY A;  3WNM A;  2EID A;  4L0P A;  2DDU A;  3F2Z A;  2Y64 A;  1R64 A;  1GUI A;  4CUC A;  2ZXQ A;  1TG7 A;  1JZ5 A;  4P00 B;  2VZT A;  4XUQ A;  3J7H A;  2VL4 A;  4DUX A;  1MPX A;  1JU4 A;  2J1R A;  4GWI A;  5G04 L;  4ARY A;  2VM9 A;  2QBX A;  1UMI A;  3ZM8 A;  3ACG A;  1J84 A;  2J1S A;  4JKM A;  4RN5 A;  3HNM A;  1JYN A;  2CDP A;  4A44 A;  2Y6J A;  4XZU G;  3OGV A;  3HN3 A;  4DEQ A;  4W50 A;  4JKK A;  3LPF A;  3OGS A;  3UES A;  2KD7 A;  1JYV A;  5LA0 A;  2CDO A;  2VZV A;  3VD5 A;  1UXX X;  1ULO A;  2ORX A;  2YG0 A;  3WF3 A;  4A6O A;  1GQP A;  4QX3 A;  3NJV A;  2C4X A;  4QAW A;  5IFT A;  4GZ9 A;  4QDQ A;  4PT6 A;  3VDA A;  5LA1 A;  4D0Q A;  3WQB A;  5CZK A;  4GWJ A;  2J1T A;  2VCA A;  1TVG A;  5CYY A;  3OG2 A;  3CIH A;  2W3J A;  4OMC A;  3ECQ A;  4MO3 M;  2WUH A;  1UY2 A;  2QQN A;  4A3Z A;  4QX2 A;  1IQD C;  1T2X A;  3VD3 A;  2QQJ A;  2LW8 A;  3I2G A;  1W9T A;  5FUI A;  3W5M A;  3C7H A;  2QQK A;  2ZEW A;  2YB7 A;  4ZZ8 A;  4UOJ A;  3E1F 1;  2J1U A;  2WAB A;  2W94 A;  4DXR A;  3LE0 A;  4JHZ A;  2X09 A;  3T2P A;  1SDD B;  4QB1 A;  2DCK A;  2WN3 A;  4YPJ A;  1WKY A;  2WZE A;  4DEV A;  3MUY 1;  1XNA A;  5DPN A;  2WBK A;  3FN9 A;  4Z2A A;  3C7E A;  1GOG A;  2W1U A;  2VCB A;  5EIY B;  3WNK A;  3WSO A;  1DYO A;  2VCC A;  2VZO A;  5J1X A;  2JDA A;  3VDC A;  1W9S A;  3EYP A;  2WO3 A;  3WNP A;  1GMM A;  2V72 A;  3MV0 1;  2R7E B;  4ZXE A;  3VD7 A;  2Y6G A;  3LPG A;  2B4K A;  2PQS A;  4QDR A;  4QB6 A;  1WCQ A;  3A21 A;  1K42 A;  1OF3 A;  3III A;  1P8J A;  3LEG A; 
#chains in the Genus database with same CATH topology
 5FV3 A;  2PAE A;  1OQE A;  5JPM B;  5H9S A;  3GHM A;  4CCE A;  1ASJ 2;  2D3S A;  1SQ4 A;  1WW7 A;  5JSR A;  2RMU 3;  1O8P A;  3NQH A;  2RS1 3;  4XIK A;  1XRU A;  1I3H A;  1C5H A;  1ENQ A;  2HYK A;  4J25 A;  2VOK A;  4YWA A;  5T5O A;  3THP A;  1HXS 1;  2OT7 A;  4CCK A;  2EF6 A;  2XR4 A;  4CDW A;  4YSF A;  1VBC 1;  1DYK A;  1CAW A;  3JD7 3;  3UL2 A;  2WS9 3;  1FXZ A;  2DV9 A;  2YV8 A;  3VD9 A;  4P08 A;  3MIC A;  4AED C;  3WEZ A;  2QQL A;  3PNA A;  1YI7 A;  4Q4V 2;  2VJX A;  1KJL A;  4HMZ A;  3C7F A;  3ZSL A;  3H8U A;  5CFC A;  4YGC A;  2Y6K A;  4CCN A;  3M2M A;  5G05 L;  1HRV 2;  1PVX A;  1QJF A;  3ZN6 A;  5C3R A;  1X50 A;  1RUH 1;  2QTW B;  5IAV A;  3VHO A;  4HL0 A;  4MH0 E;  4GXL A;  4S2F A;  4LBQ A;  4XC9 A;  2VMG A;  3WDT A;  5C5T A;  2J7M A;  5T5J A;  2BV4 A;  3H1W A;  4K9S A;  2GH8 A;  2PHR A;  1QH7 A;  5D1I A;  2XVL A;  4XW3 A;  3OBA A;  1IKP A;  1OLM E;  5ANQ A;  1V00 A;  1CX1 A;  4M3C E;  2XON A;  4PBO A;  3VD4 A;  2WNV B;  4GH4 A;  2YRO A;  5FYT A;  3NL1 A;  2W87 A;  5H9Q A;  4BQY A;  1AZD A;  1LJ7 A;  1TMF 2;  4QX1 A;  2EXH A;  1V6K A;  2N7G A;  3JQW A;  3ZFE B;  4CEY B;  3L9J T;  5BNN B;  4RHV 3;  1FOD 3;  3U07 A;  1EUT A;  1GR3 A;  1LNS A;  3LWC A;  1EV1 2;  2X8K A;  4LO6 B;  2VE1 A;  2W91 A;  1BQP A;  3VBU B;  5GKA C;  2FDH A;  5JVV A;  5JXI A;  4F8A A;  2XLG A;  4QMA A;  4FXG B;  3H8O A;  5FZ1 A;  3VB9 A;  4CEY A;  2JG9 B;  2J1V A;  1J1T A;  2BBA A;  5C7G A;  4MGQ A;  5FZ7 A;  1BBT 1;  4OUE A;  3N9M A;  4RD7 A;  4FPO B;  3WDU A;  4BQ3 A;  3C8X A;  4WZC A;  3RZG A;  1VAM A;  4R9A A;  1OOP A;  4AEM A;  4CDW C;  5C70 A;  3N3H A;  3CKH A;  3MID A;  3K51 A;  1I5Z A;  2D6M A;  3MW4 A;  5L9V A;  3Q9O A;  5L7O B;  2YC2 A;  3O1O A;  2UU8 A;  5DZG A;  1W90 A;  1F31 A;  1GOF A;  3RI9 A;  4AHX A;  2ZGK A;  2P3K A;  5EP9 A;  1I5P A;  5ACA 2;  2O0O A;  4QGM A;  2JE7 A;  2BFU S;  5FK8 A;  5IVB A;  1WCD J;  3K4D A;  3MFC A;  3WF2 A;  4Y22 A;  3NVC A;  1MR5 A;  3OUJ A;  1WW4 A;  1W3X A;  4FP2 A;  4ZS2 A;  1JZ3 A;  3TEX A;  3UK9 A;  1YFX A;  2XH6 A;  4N53 C;  3O1M A;  3RYK A;  5FYY A;  2WSU A;  3IAQ A;  2XWB B;  4L8Q A;  3BU7 A;  4CRQ A;  2HWB 2;  3OPT A;  1G86 A;  1F5J A;  1FAT A;  2WYS A;  4P5Y A;  4TXW A;  4ZU5 A;  1C1L A;  4COZ A;  4Y4Y A;  4CUA A;  4OHY A;  4A7K A;  3SKJ E;  3BU0 A;  3LB9 A;  4BPZ A;  1K12 A;  3FBY A;  1F8V A;  1WMX A;  2XHK A;  2PHD A;  2ARE A;  1D4M 2;  5FYU A;  5EPA A;  5FPV A;  1PIV 2;  3LA7 A;  1WCK A;  1RUF 2;  1OSG A;  1U5I A;  3JBG 3;  4N8M A;  4EN9 B;  4NRO A;  4QKF A;  2WLQ A;  5DUU A;  3IDA A;  4AEK A;  4COU A;  4IV3 B;  1IS6 A;  2FHR A;  2Q1F A;  5LRS A;  1HQN A;  3DYP A;  2ID4 A;  4I02 A;  4ISQ A;  4BZ4 A;  3VZK A;  4O7X A;  4FQ4 A;  3PUA A;  2HYX A;  3LGR A;  2RS5 1;  3PUH A;  5E8A A;  3ZYP A;  3I2O A;  4IV1 C;  2VH9 A;  4E8C A;  2H0B A;  1G9F A;  3D8C A;  4GA9 A;  4OZX A;  3SC7 X;  3WCS A;  3WR0 A;  4LUM A;  4DXT A;  1X8E A;  1KFU L;  1RUG 1;  1LTE A;  2WZR 3;  1U12 A;  2WWS A;  3CMG A;  2UYA A;  3OB8 A;  4JGY C;  3U78 A;  3AKP A;  2FMD A;  3WHT A;  4COY A;  2GMP A;  4NHL A;  3HEI A;  2YDE A;  1JYC A;  4I3P A;  3RRD A;  3ZX7 A;  3CZJ A;  1GKB A;  1H9W A;  1RUI 3;  2GN7 A;  2Q30 A;  2XVK A;  1RYY A;  4Q4V 3;  1ZZ9 A;  4LQR A;  4Y3O A;  5DDJ 2;  4B4P A;  3WNL A;  4A7Z A;  4RSU A;  4A41 A;  1QGL A;  2WJS A;  3PVN A;  4AWD A;  4CDX A;  4OHV A;  3FUO A;  1QH6 A;  4IEU A;  2IXJ A;  2QCS B;  1OH4 A;  4BJ0 A;  4ZS3 A;  3WF1 A;  2BJS A;  4ORF A;  2C0Z A;  4QPG C;  2E63 A;  5KBF A;  4B1M A;  4UXA A;  4X8N A;  4N53 A;  3VKL A;  4ASL A;  4Q0V A;  1AYN 3;  3FC0 A;  5K9Y A;  1AR6 2;  1O59 A;  4ZU7 A;  3AYC A;  1FV2 A;  1QJY 3;  5T3N A;  1O8S A;  2Z5W A;  5FLI A;  3WP3 A;  4EWE A;  4AF9 A;  3GM8 A;  4XQ4 A;  4GJZ A;  3DF0 A;  2BOJ A;  2JKX A;  4XJ9 A;  5C3S A;  2RMU 2;  1JZ4 A;  2VZS A;  3MW2 A;  4UFK A;  3BPZ A;  4CUB A;  1UXZ A;  1YI9 A;  4DY3 A;  5CKM A;  4LBO A;  1ULD A;  5FP3 A;  1RUJ 1;  4AVT A;  3BB6 A;  3M3I A;  4YW3 A;  4YVW B;  2DVG A;  1X9T A;  1HQL A;  4LHN A;  4ZY9 A;  5AFB A;  1BEV 3;  3GHN A;  2YBS A;  3MO4 A;  4L92 A;  1PK6 C;  4UFL A;  5AC9 3;  1WLC A;  2PAK A;  3FLR A;  2WN2 A;  2ZA9 A;  5CAZ A;  4LLF A;  3NMB A;  3IM0 A;  2OS2 A;  3HNB M;  3ME2 A;  5FP7 A;  5GLW A;  4AEJ A;  5K7P A;  1E57 A;  2C1F A;  2ZAA A;  3O5S A;  1RB8 G;  5A3W A;  3GDB A;  4HBN A;  4XZP A;  2Y8K A;  4JKL A;  1QOS A;  4NWW A;  3NNG A;  4P02 B;  1O4Y A;  4CPB A;  3ES1 A;  5A3U A;  1OI6 A;  4W6Y A;  4I01 A;  1XNT A;  1VMF A;  3AKT A;  1NCR B;  2BP6 A;  3ILR A;  4C0H A;  4BXF A;  5FTT C;  4LHK A;  1OUX A;  5I91 A;  2K0G A;  3GZT B;  3ZIX A;  4QX7 A;  1S0G A;  3RJR A;  1WW5 A;  3VBH C;  3ON7 A;  1CPM A;  1UPI A;  1VBB 3;  2Q0A A;  3ZMO A;  4EN6 B;  4Y5Z 0;  4GAL A;  3WUC A;  1IZ3 A;  1W8Z A;  2ORZ A;  2W52 A;  4R8H A;  1ALY A;  2CTV A;  3WF4 A;  1KRI A;  1UIJ A;  5FPL A;  2Z79 A;  2YC4 A;  5EJ1 B;  4XF9 A;  3R6S A;  2ZOE B;  5BNO A;  4URA A;  2VTX A;  2BWA A;  2C9K A;  1Q8V A;  3SIS A;  4IEQ A;  2ET1 A;  2VTF A;  4PQQ A;  4YVS C;  4OHZ A;  3WP5 A;  4BM8 A;  5B4N A;  2D44 A;  2TNF A;  4FPF A;  1RUH 3;  1AVB A;  3GBW A;  4IE6 A;  1XPW A;  4BYY A;  2OZJ A;  2ET7 A;  1B35 A;  5F2S A;  3VUO A;  4IQP A;  1E5H A;  3KV6 A;  1POV 3;  1V70 A;  2E51 A;  4IEP A;  2AYH A;  2ZGT A;  3ZFF A;  2C9A A;  1S4C A;  1ZA4 A;  4OLL A;  1XB9 A;  2R04 1;  2XUE A;  2ZX1 A;  1VE0 A;  3U37 A;  3T1M A;  4A6S A;  1IPK A;  1AHS A;  5BPX A;  2BWC A;  5JWP A;  5LK5 A;  3I2I A;  2RVA A;  4N90 A;  1H2K A;  5FPA A;  1JZ6 A;  1OUS A;  3MIG A;  2VVF A;  1VP6 A;  2ZBJ A;  1VBA 1;  1NCQ B;  2ILM A;  2YGM A;  1BHG A;  4S2G A;  5SV5 A;  3RZJ A;  3WQ0 A;  3UJO A;  3VZM A;  4WBB A;  4TWT A;  1XYN A;  4KG0 A;  4XCA A;  5F37 A;  5FBZ A;  5GZC A;  2JD9 A;  1WLW A;  4KU8 A;  1TME 2;  5L9R A;  2Y0O A;  4IEY A;  2WZP P;  3IT8 A;  2WNU C;  3DXU A;  1ZBE 2;  4WVW A;  5LZ6 A;  3E5X A;  3POI A;  4JQT A;  3N9P A;  1LHO A;  5J98 B;  2IWG B;  1RL3 A;  1VBC 2;  2O8Q A;  2ZCW A;  1W3V A;  4OHX A;  1QMJ A;  1S2E A;  4NIH A;  4B7K A;  3NNL A;  1DGL A;  1PMJ X;  2Q5T A;  5F5A A;  2YXS A;  1PK6 A;  3IDC B;  2DUQ A;  1JN2 P;  1SFN A;  4N53 B;  4H2A A;  2P37 A;  1XC6 A;  3E5U A;  5FZA A;  5A33 B;  3H3U A;  1SBE A;  2WZ8 A;  1F9K A;  1ZBA 1;  1L7Q A;  1S0D A;  2AR6 A;  2OKX A;  3GYD A;  2QQP A;  3HT2 A;  1XXN A;  5EJZ B;  1JI6 A;  3CQO A;  4QDS A;  2I74 A;  3PJY A;  4FPC A;  1VBD 2;  3I2F A;  3I3E A;  4A4A A;  2X53 S;  2PFW A;  1C3H A;  1UY0 A;  2V73 A;  3OPW A;  2BRT A;  1YCI A;  5KHG A;  2Z69 A;  1UKG A;  1UYZ A;  4EV0 A;  4ATF A;  5C8C B;  1JS9 A;  2JG8 B;  4JGZ C;  3U4S A;  2HWC 1;  4AZZ A;  4BH9 A;  2ZTN A;  4XHB A;  2VNO A;  4IV3 C;  3WD5 A;  3MEP A;  2QNK A;  3VDD C;  1QIQ A;  2UUR A;  2DDU A;  2OPW A;  3SLI A;  2R32 A;  4MET A;  4MLO A;  3HD8 B;  3RWN A;  3NST A;  4CUC A;  5JPN B;  2UWB A;  2OXB A;  1TG7 A;  1YQ6 A;  3AZV A;  3K48 A;  4RGK A;  2JG8 A;  3I3Q A;  1GQG A;  3ZYB A;  1OPM A;  4EWD A;  3MFA A;  1JZ5 A;  2BW8 A;  4KGG A;  3MIB A;  2WFP A;  4XUQ A;  5C3Q A;  2VL4 A;  5T54 A;  2D43 A;  4FFF A;  5FO8 B;  2CGP A;  4X8P A;  2R06 1;  1MPX A;  1RMU 2;  1JU4 A;  4AL9 A;  4CEW B;  2HBU A;  1PM4 A;  2ZGL A;  1L3J A;  4NRP A;  4Y20 A;  1ZZ6 A;  4QHZ A;  5G04 L;  4ARY A;  4BLI A;  4RR3 C;  2RG4 A;  4YM0 A;  3B02 A;  2BDR A;  4FFI A;  5FZ8 A;  3ZPY A;  2K46 A;  2R6Q A;  3ACG A;  4G9S B;  3KVA A;  4CDQ C;  1STM A;  1OLQ A;  3CHX A;  4Q4W 1;  2XGX A;  1I1E A;  4CP9 B;  1UZZ A;  2CDP A;  5JZG C;  4LT5 A;  4FOY A;  4XZU G;  1CAV A;  3VZN A;  3OGV A;  4HLT A;  3HN3 A;  3O12 A;  1CWP A;  4C0B A;  4NPL A;  2ETE A;  2ES3 A;  4L11 A;  2YC0 A;  4LO8 A;  1ZA7 A;  1ENS A;  3PLQ A;  1WBL A;  3UES A;  1N3Q A;  2KD7 A;  1O4T A;  1HKD A;  5FXV A;  1CPN A;  4Q4W 2;  5CAD A;  1PO1 1;  2CDO A;  4BQX A;  3M3E A;  4BMB A;  2ZHN A;  2DFB A;  2IFW A;  2ZX4 A;  4UBG A;  3T1L A;  3V0A A;  2VW2 A;  3ZXA C;  3NKT A;  4I09 A;  3HQX A;  3VHN A;  1J1L A;  4EE2 A;  5FP4 A;  4QX3 A;  1AR7 2;  2R1B A;  3KV9 A;  3W21 A;  1MS1 A;  3NJY A;  1W9F A;  1UOJ A;  4HN0 A;  2DBN A;  3BOW A;  4YVS A;  3THT A;  2VD7 A;  3WG3 A;  5E89 A;  2RM2 3;  1JYI A;  4GZ9 A;  1VBB 1;  1W6N A;  2BEO A;  2O1Q A;  1COV 3;  4D0Q A;  5DG1 A;  3UGG A;  2JDU A;  4PBP A;  4QQ2 A;  4D69 A;  5DUX A;  4NR1 A;  1S2K A;  3GAL A;  1G6N A;  5I8T A;  1C28 A;  1TVG A;  4PDW A;  1RUE 2;  5JI9 A;  2KM2 A;  2RS3 1;  1UOB A;  2PTM A;  2W3J A;  2FCU A;  2OQ7 A;  5FJH A;  1AUY A;  2FZ1 A;  2ZS6 B;  4W6W A;  4MO3 M;  4XBL A;  1VAV A;  4QPI A;  3VKO A;  4IE5 A;  1SEF A;  3CL1 A;  1G7Y A;  3V65 A;  2RR1 1;  2VQA A;  4QX2 A;  4IET A;  4PI0 A;  1VMH A;  2ARC A;  2QQJ A;  4Q4X 3;  1RHI 2;  3I2G A;  4Q5O A;  4Z82 A;  5FXZ A;  3PTY A;  3C7H A;  1MQT C;  2EAA A;  5FP8 A;  5GLV A;  5A3O A;  4MHR A;  4AR2 A;  3VBH B;  4QQP A;  1V6N A;  4QPI B;  2ZGP A;  4F3J A;  4XCB A;  1R08 2;  4Z2W A;  1E5I A;  3LSD A;  4UOJ A;  1NY7 1;  3HIF A;  4R4X A;  5KHH A;  1CN1 A;  1PZ8 A;  3LE0 A;  4JHZ A;  4GH4 B;  4OUM A;  4DXZ A;  1ND3 A;  2UY9 A;  4Y5S A;  5L19 A;  1POV 0;  2JB8 A;  4QD2 A;  3MI8 A;  4XAC A;  3URF A;  4Z2A A;  1AXZ A;  3LA3 A;  1RUD 2;  1GOG A;  4CZS A;  1LCL A;  4M0H A;  3R05 A;  1DQ4 A;  1TNR A;  2WS9 2;  3KHC A;  1CON A;  1H2M A;  5CG8 A;  2GU9 A;  4LBQ B;  2JDA A;  3H42 B;  4Y26 A;  1W9S A;  2AEZ A;  1SLI A;  5DAQ A;  1YFW A;  4M3C F;  3VBS C;  5C4W B;  2I2S A;  4YW1 A;  1W6M B;  1OLR A;  3NAP B;  3LPG A;  3TEY A;  5GAL A;  2GDF A;  2X5I B;  1VBA 2;  1NZC A;  1WCQ A;  2BVV A;  3SHR A;  3EO6 A;  4HKW A;  2ZZQ A;  4RA0 A;  5A32 A;  1V9U 1;  3III A;  1OA4 A;  2Y0I A;  4EN0 A;  1P8J A;  1YHF A;  5JR2 A;  4F7Z A;  5BXX A;  1VB2 A;  2NZ9 A;  1JTZ X;  2XQX A;  5FQ0 B;  5FYZ A;  1HV0 A;  2HWD 1;  2R07 3;  5DN2 A;  3ZPO A;  1UZY A;  3S30 A;  4D6R A;  2LRP A;  4QM8 A;  5F5Q A;  1LB2 A;  1YO8 A;  2C26 A;  2VMC A;  3VBU A;  5FYI A;  4GB3 1;  4ISR A;  3TNP B;  1AR6 1;  2JE8 A;  4DRV A;  1OKO A;  4PQ9 A;  1SCS A;  3AZX A;  3LIH A;  1J3R A;  4N9I A;  3P1I A;  4BIO A;  2J1E A;  5F5C A;  1AF9 A;  4M0N A;  2VUC A;  2WL1 A;  2E26 A;  1H1M A;  3GBF A;  5B2G B;  2CWS A;  3N7J A;  1JU3 A;  1NX9 A;  4L97 A;  1J3Q A;  1IG3 A;  5AC9 2;  5HCF A;  5CFC C;  3I7D A;  2HWF 2;  4R9D A;  5BNP A;  1ZX5 A;  1ODM A;  1W8W A;  3I2K A;  5APA A;  3LD8 A;  4C1W A;  5GZE A;  4W4Z A;  1PO1 2;  5BNQ A;  1ODN A;  3RZL A;  5KXC A;  1MEC 3;  1SFY A;  3OYW A;  2OPK A;  4NPR A;  4ET7 A;  4CP1 A;  3OY8 A;  1UY1 A;  2VQ0 A;  1ZBA 3;  5FP9 A;  2VW1 A;  4R4Z A;  4RFT 0;  2BBV A;  1NA1 B;  4EZH A;  5EZW A;  4LKE A;  3WW4 A;  2RS1 2;  1W06 A;  2ZGM A;  5A3N A;  4K20 A;  5BUV A;  2K9Z A;  2G19 A;  4AVA A;  3T2T A;  4NO4 A;  1T6G C;  4Q0U A;  4Q4Y 1;  1W28 A;  2JKB A;  1VBD 1;  4O9G A;  4YW4 A;  1K3I A;  2IZW A;  3HQU A;  1NA1 A;  3NJZ A;  5FWJ A;  3WDV A;  5E88 A;  2X10 A;  5LBE A;  1UQX A;  5LK7 B;  2GMM A;  2ZGN A;  4FAH A;  1ZZ8 A;  1GZW B;  1SBD A;  2J22 A;  1D4M 1;  5FYM A;  3KQR A;  2EXI A;  1BCX A;  1SCR A;  2VUD A;  3BCW A;  3D4K A;  5IW0 A;  4Q1P A;  2GAL A;  1OHF A;  3B93 A;  1ZBE 3;  2QZ2 A;  1QNY A;  1QEX A;  1LHW A;  4LIV A;  4LNV A;  5BNN C;  2RDQ A;  3GF6 A;  4GMP 3;  3RZM A;  5FY5 A;  3VZL A;  5A80 A;  1Q43 A;  2JJ6 A;  3WZ1 A;  1BVP 1;  1R08 3;  1DP0 A;  1US3 A;  4C8D A;  1J83 A;  4GUL A;  4ZZ5 A;  1V6I A;  1US2 A;  4JC1 A;  4N43 C;  3HOB A;  3J4U H;  2RM2 1;  4FT8 A;  2EIC A;  1GFF 2;  4NRM A;  1V6O A;  2DVD A;  2YPJ A;  3I59 B;  1EAH 3;  5T5P A;  4CCC A;  1G9A A;  5TSW A;  5LAS A;  1PGL 2;  1HRI 3;  2EIE A;  3M3Q A;  3MHZ A;  3WY6 A;  1BJQ A;  5A6X A;  1XQN A;  4P9W A;  1NG0 A;  2ZZJ A;  4XJW A;  1C57 A;  1BKZ A;  5KHK A;  1RVF 3;  3E97 A;  4XUP A;  5EXO A;  2E31 A;  5I8Y A;  4RQP B;  3FHA A;  4CUG A;  2D97 A;  1W8H A;  1I9R A;  3JZV A;  3PU8 A;  1W2N A;  1LUL A;  2CNA A;  2ZGQ A;  2P3I A;  4XEZ A;  3VBF A;  5IHR A;  2PHT A;  2Q8D A;  1UNB A;  1EPZ A;  2ZX3 A;  5C4W A;  2ZEY A;  4FO9 A;  2PXJ A;  5FOJ B;  2WC2 A;  1UW8 A;  1JXN A;  2ZEZ A;  4AW7 A;  2R0F A;  5CVR A;  4AI8 A;  1RUG 2;  1MS3 A;  2CYF A;  2P3J A;  1WMD A;  3D82 A;  3ZLI A;  2Z4F A;  4YG6 A;  1OA3 A;  2W46 A;  3PUI A;  4UBH A;  1Q8S A;  1FYU A;  1LEM A;  1KGY A;  1X9P A;  3BTX A;  4YZ3 A;  2HWE 2;  1RUI 1;  2YUE A;  3V0B B;  5HXV A;  3FX3 A;  1C8M 1;  5L73 A;  1H4G A;  1QNW A;  1OVS A;  4K7J A;  2DYC A;  2W95 A;  4JV4 A;  4GWN A;  5KHI A;  2E32 A;  3GCX A;  3QBQ A;  5IVJ A;  3E6B A;  2XJT A;  1LED A;  3J26 N;  5CIS A;  5HCB A;  1JZ7 A;  1EAH 2;  1S55 A;  1BBT 3;  1LHN A;  2OII A;  3V64 A;  3A22 A;  1O3R A;  3ENR A;  4MGZ E;  1JYT A;  1DGW X;  2JEN A;  3NW4 A;  1QXJ A;  1AX2 A;  1W8U A;  3KZ4 C;  3D0J A;  4QPI C;  4S2D A;  5CU1 A;  3MW3 A;  1QWR A;  4OZO A;  5LAT A;  5BNO B;  3N36 A;  1VMJ A;  5LY1 A;  2XBO 3;  3DL3 A;  2A6Y A;  2CGN A;  4KI5 M;  4Z1V A;  4NUB A;  1XOY A;  1ST8 A;  3CJI B;  4WM8 B;  3ZIW A;  2XJP A;  4KWK A;  4JGY B;  4O65 A;  3TRS B;  1AJK A;  2E7A A;  3AP6 A;  1PO1 3;  1PIV 3;  4K1Y A;  1HB4 A;  2QUO A;  2WAO A;  1CAX B;  1ZZB A;  4AAX A;  5JMC A;  4KWU A;  2HWE 1;  3UGH A;  4JQR A;  3AXD A;  4WVZ A;  4AYU A;  3MPB A;  3PDQ A;  3S5Q A;  3DGT A;  1J58 A;  3SNM A;  1CJP A;  4PIZ A;  1W04 A;  2WSV A;  4MHU A;  3VBR B;  1Z7S 2;  2D6N A;  2V5D A;  3AJZ A;  5FBJ A;  1W0N A;  1YQ8 A;  1R09 3;  4LLO A;  4XF3 A;  2DWR A;  3VDB A;  1W0O A;  4Z07 A;  1XSR A;  1QXR A;  4Q29 A;  3AMQ A;  1AR6 3;  4DIQ A;  3B9I A;  2P1B A;  3BVC A;  4L9B A;  4KWJ A;  1NQD A;  2RHP A;  1BBT 2;  4QPG B;  5A1A A;  4LO4 B;  2HLE A;  1XU2 A;  2VVE A;  1QQP 2;  3C7G A;  4QX8 A;  1PZ7 A;  4HK9 A;  3POJ A;  4BK4 A;  1NOV A;  3WUD A;  2FZ2 A;  1RTV A;  3UV9 A;  3JBG 1;  1XNC A;  1Z7S 1;  4ZON A;  4QPY A;  2Y33 A;  5BY5 A;  2AGS A;  2IVJ A;  1ZRR A;  4XUO A;  3AFK A;  3ZSJ A;  3TWI A;  3DXT A;  3U1X A;  5CG9 A;  3TEZ A;  4TTG A;  3PUR A;  1CES A;  1XE7 A;  2HBT A;  4XAE A;  1C8M 2;  3ZOI A;  4R52 A;  3ZYI B;  3DPR B;  1JYX A;  1AYM 1;  4IEW A;  4BA6 A;  1NLS A;  3ITQ A;  1RUG 3;  3KT4 A;  1UYP A;  1V9U 3;  4MAD A;  4D7Y A;  4ARX A;  5FO9 B;  4FTS A;  4FVV A;  4KQ7 A;  1PK6 B;  5LEJ A;  4HPK A;  4GD4 A;  2WAA A;  3RZZ A;  1RIN A;  2HWD 3;  1AYN 2;  2R07 1;  2VPV A;  3AFG A;  4MGI E;  5ABJ A;  4N7I A;  5A3M A;  1UY3 A;  3KHB A;  5FUN A;  3SKV A;  5KC5 A;  1PO2 3;  3UNP A;  4PCR A;  5GM0 A;  1KS5 A;  2DUR A;  1O91 A;  4Y1U A;  5GZG A;  4XET A;  3I3M A;  4C90 A;  4BXS V;  1VR3 A;  2QKD A;  1BK0 A;  3WW2 A;  5C3P A;  3S57 A;  1HRV 1;  2XG3 A;  4P9G A;  1SFP A;  3O14 A;  2Q8C A;  4IEV A;  5FZI A;  4MOA A;  3EHK A;  3H1M A;  4FPH A;  3VN4 A;  4YGD A;  1W8N A;  4LR4 A;  1Q8O A;  1D4M 3;  3CBN A;  2HEV F;  4EZ4 A;  3IZO A;  1JZ8 A;  1F4A A;  1GV9 A;  3RG0 A;  5J48 A;  1URX A;  2WLP A;  1DGR A;  4XUR A;  1N1S A;  4CE8 A;  5JXJ A;  5FRE A;  1AXK A;  2XPJ A;  2A75 A;  2DFC A;  2JB4 A;  2QDN A;  1HX6 A;  1U5Z A;  4KH9 A;  5FZ0 A;  5JIA A;  3MBW A;  5A7Q A;  5HI0 A;  1X36 A;  1RVF 2;  4MXW A;  1XNB A;  4ASK A;  2QFE A;  5IYY A;  1NXM A;  4FTE A;  4GMP 0;  1ULG A;  1OQD A;  2VOT A;  1S0F A;  3K2O A;  1OF4 A;  4FPE A;  5DUW A;  5T5L A;  4XBQ A;  3LDB A;  2PHW A;  3I97 A;  1CAU A;  1IPS A;  1LGN A;  1PX4 A;  2ZPX A;  3SCF A;  2JIG A;  2WNE A;  3ZR6 A;  1KJR A;  2QQO A;  1MS5 A;  4MGK E;  5EQU A;  4A2U A;  2XB6 C;  4PF1 A;  2JDM A;  2NLR A;  3LEI A;  5D8A A;  3DYO A;  1DQ2 A;  5K8S A;  2R07 2;  5A6Q A;  1RUE 3;  2W9X A;  3UET A;  5IT6 A;  4YZ1 A;  1XU1 A;  4E9K A;  4OYU A;  1YLL A;  4HT1 T;  3TN9 3;  2NN8 A;  1UZV A;  3ZN4 A;  3O0V A;  2WNU A;  4Y1V A;  3PMS A;  5D8A B;  3KCY A;  5D21 A;  3AL6 A;  4BWO A;  4GB3 2;  4PLN A;  3OGR A;  1LHU A;  3NV3 A;  4FXK B;  3VL8 A;  4YFZ A;  1GLH A;  2AEN A;  2AC1 A;  2LUW A;  4DS0 A;  1DIW A;  1HN0 A;  3KWV A;  4FAG A;  5A70 A;  4PI2 A;  4DRR A;  4L99 A;  3AKS A;  5H9R A;  1AR8 3;  2D6P A;  5LY2 A;  3T4H B;  4CDU B;  2UWC A;  1RUF 3;  2RJ2 A;  5IVE A;  1C1F A;  3NKG A;  4XAB A;  2BQP A;  1QJY 2;  3JUU A;  5IVV A;  3D6E A;  1OT5 A;  3VBF C;  2D5F A;  1IHM A;  1EP0 A;  2HWC 3;  4KWL A;  1NYW A;  1V6J A;  1KS4 A;  1UYY A;  4CDU A;  1H6Y A;  2ZMN A;  1H30 A;  1NKG A;  1W6N B;  1LGC A;  2EIB A;  5F3G A;  2F6B A;  2NMO A;  4XF4 A;  1DQ6 A;  1V6M A;  2VMI A;  4BK5 A;  2F4P A;  1COV 2;  4QPG A;  3TNQ A;  3WQ7 A;  3M3C A;  5JR7 B;  4FBF A;  1QJX 2;  2C5D A;  4YYO A;  4WM7 B;  1RIT A;  1MQT A;  1GQH A;  1WLT A;  5FRA A;  4FOW A;  1HB1 A;  4V2W A;  5EFU A;  1RUD 1;  1UY4 A;  4V2V A;  1FPN 1;  2IUW A;  2VG9 A;  4M4P A;  3WP4 A;  2R06 3;  1POV 1;  2Y6H A;  3OBT A;  5LW9 A;  3ETQ A;  5IK4 A;  1WD4 A;  4LBJ A;  1LES A;  2B9V A;  4AI3 A;  1GBG A;  3BTZ A;  4AQ2 A;  2GZW A;  1OKQ A;  1UX7 A;  2VGD A;  1GNY A;  4TN7 A;  2EID A;  4L0P A;  4BQ1 A;  4BCU A;  5JAX A;  2QQW A;  1ZBE 1;  4LA2 A;  4HON A;  1R64 A;  3VBH A;  2XJV A;  1V9U 2;  2BU9 A;  1QJU 1;  3ILN A;  3O1U A;  4MYE A;  3AB0 A;  3GZE A;  1QHD A;  3OCP A;  4AVB A;  2DBI A;  4PDW B;  4NHY A;  3ZFF B;  3VDD B;  4DUX A;  1R09 1;  1MZ6 A;  4QU2 A;  1AL2 3;  1PGW 1;  1TNF A;  1YYN A;  4CXW A;  2NP0 A;  2DCT A;  4QQH A;  3M70 A;  2XLF A;  5CNA A;  4YW7 A;  4LA3 A;  4RGG A;  4DY5 A;  1NT0 A;  4B29 A;  4ZKT B;  4Q0P A;  4XJU A;  4WM8 C;  2R04 2;  5F5I A;  4HAN A;  3ZM8 A;  3ZYR A;  2FDJ A;  1QXP A;  2J1S A;  4RN5 A;  1KQR A;  4NII A;  3VDD A;  5FMD A;  1N1V A;  3USS A;  2IXK A;  3PL0 A;  5FZK A;  4JHT A;  2PYT A;  4PLO A;  3KCC A;  4BIF A;  4PIY A;  3Q8E A;  4DEQ A;  1AX0 A;  3WVJ A;  2B8M A;  2PLV 3;  3AP9 A;  3UKT A;  4CXY A;  4AFD A;  5I0T A;  3LPF A;  2GAU A;  2YY1 A;  4DO0 A;  1QDO A;  3OGS A;  3ZYG A;  4CP0 A;  4BOW A;  4CDQ B;  3MLL A;  4MGT A;  3ZN6 B;  5LA0 A;  3GJA A;  2Y6F A;  2X29 A;  2CWM A;  3H7J A;  1ULO A;  1G8W A;  2ORX A;  5AFE A;  2K2S A;  1Z0H A;  1WLD A;  2Y38 A;  4IXL A;  1ZVF A;  4QT6 A;  1DBN A;  2UY8 A;  1RMU 1;  4KU7 A;  4OQ9 A;  1AR9 3;  4CCJ A;  5FWE A;  2YGL A;  4UW6 A;  5FZO B;  2XL9 A;  4BU2 A;  3AMP A;  5FPB A;  5FPZ A;  1WA6 X;  4YVW C;  2RR1 2;  1WMF A;  2VNR A;  4QDQ A;  3VDA A;  5LA1 A;  5FZF A;  1H1I A;  2WT2 A;  5IAT A;  4XFA A;  4GWJ A;  2Y34 A;  1W8F A;  2IXC A;  2VCA A;  1SMV A;  5CYY A;  2BNO A;  5FZO A;  3IDE A;  2EA7 A;  4AQS A;  4E4H A;  4OMC A;  2JEC A;  4Y20 B;  2RDN A;  4A3Z A;  1W39 A;  1YJL A;  3PU3 A;  1GP5 A;  4Q0Q A;  1W03 A;  3SH5 A;  3SH3 A;  4E4S A;  1W8T A;  3VD3 A;  2GC2 A;  5FOB B;  1XND A;  1A8M A;  1NCR C;  1QOT A;  3DKW A;  4HET A;  4PHZ A;  5FQ0 A;  5J7M A;  1W9T A;  5FUI A;  3ZXK A;  1VBC 3;  4KGQ A;  4DIN B;  2TEP A;  4IV1 A;  3AK0 A;  3AP4 A;  4YNI A;  4EQV A;  3ZSK A;  4AFA A;  5ACA 3;  3NNJ A;  3OYW B;  2GC0 A;  2YB7 A;  3M7A A;  5JSP A;  3E1F 1;  2FMY A;  3AJY A;  1ND2 C;  1X82 A;  2Q4S A;  2SBA A;  3DEM A;  3RVH A;  2CU5 A;  1LOC A;  2JWP A;  3FHI B;  4HOO A;  1AL2 2;  1YQC A;  3PUS A;  4NMI A;  4CA9 A;  4DXR A;  2X09 A;  4H7M A;  4C91 A;  3VKF C;  3O1R A;  1RUE 1;  1QQP 3;  5A7O A;  3ZXF A;  3O1T A;  2WN3 A;  3I8T A;  3NNF A;  5J3U A;  4CSW A;  2VBB A;  3C3V A;  3OGG A;  2OW4 A;  1KIT A;  5DPN A;  4GKX A;  1JHN A;  1ZRC A;  1GAN A;  1A8D A;  1VBB 2;  2F17 A;  4D3W A;  4LXL A;  2W1U A;  2VCB A;  5A3L A;  3IWZ A;  4Q0S A;  3QD6 A;  3Q8C A;  3VV1 A;  3QH6 A;  3HQR A;  4YW5 A;  1N1T A;  1NXD 1;  1QF3 A;  5F9T A;  4NWV A;  1AR7 1;  3HT1 A;  2GN3 A;  1CX4 A;  1UX6 A;  2QDR A;  2V72 A;  5IK7 A;  1FX5 A;  2WQ4 A;  3VD7 A;  4QXK A;  1ONA A;  3HR9 A;  4HKL A;  4QDR A;  1Z78 A;  3H7Y A;  2BVB A;  4GJY A;  4TZD A;  1YUD A;  3A21 A;  1OF3 A;  1SPP A;  5JLV A;  3AKQ A;  4K3U A;  3ZYH A;  1BMV 2;  2D6O X;  4COV A;  3RMY A;  5FXW A;  3RQ0 A;  5C4W C;  3ACH A;  3JXS A;  2UYB A;  2A7A A;  1G9B A;  2DTY A;  1O3S A;  4P9J A;  3O1S A;  1PO2 1;  5DAX A;  2RR1 3;  2A5Z A;  1AYM 2;  3CDZ B;  2WWJ A;  5JMO A;  3MIH A;  5IJR A;  4Y1Z A;  2ZAB A;  5KXD A;  3QOP A;  2XDV A;  2P2K A;  2YHJ A;  3HWJ A;  1DHK B;  4CDU C;  3M4F A;  2WA3 A;  1BXH A;  3W59 A;  4D6S A;  3BUC A;  4EYU A;  5LCW L;  3K4A A;  1L7R A;  2IC1 A;  3OGJ A;  4D94 A;  1YC6 1;  4CDX C;  3BN6 A;  3C2U A;  3VBF B;  2BER A;  4NIA A;  1V6L A;  3THC A;  5CA6 A;  3Q8B A;  3JB8 A;  3HPN A;  3ILF A;  3OEB A;  4B4R A;  1GSL A;  2ZX0 A;  1DQ1 A;  3CZU A;  3OEA A;  1ACC A;  2WNV C;  2BZD A;  4WZF A;  2AZ5 A;  3AM2 A;  3DEC A;  4XBN A;  5F3C A;  2FCV A;  4IEZ A;  4P9I A;  5FMC A;  3A4U A;  3ROU A;  4BHP A;  3NNM A;  2XKO A;  4Q8L A;  1UF2 C;  1UPS A;  2ADD A;  2CAV A;  2BYV E;  1HJF A;  1SLA A;  2XOM A;  3FZ3 A;  4KNC A;  5K0U B;  3A0K A;  1NLR A;  2EXJ A;  1DLC A;  4RGA A;  1U5Y A;  3AYA A;  1JUH A;  2D6L X;  2Y26 A;  3ZO0 B;  1H8T C;  4AGV A;  2D3R A;  3ZXE A;  5FMO S;  5A6Z A;  1J3P A;  4URT A;  5K4L A;  5EWS A;  2G9F A;  1XYP A;  2LAL A;  2JDP A;  2ZJC A;  3GJB A;  3KF3 A;  1NUK A;  4YGB A;  1R08 1;  2XBO 2;  1EPW A;  2MEV 3;  3ATG A;  1NAE A;  4XOG A;  5K0U A;  2QJV A;  1HN1 A;  4TLG A;  3ST7 A;  1W2U A;  2V09 A;  3GZA A;  3IB3 A;  2WNV A;  3JCI A;  3ETP A;  3ABZ A;  3QLQ A;  3V56 A;  1Y9M A;  4XTP A;  1TQ5 A;  3HAG A;  4AVS A;  4RFR B;  4P5H A;  1ZM1 A;  4UWD A;  5T50 A;  3EXU A;  5F1R A;  1UOF A;  3IAP A;  4LKD A;  2HKX A;  4JGY A;  5BNN A;  5DAB A;  4CEW C;  1C8N A;  5F32 A;  1MVQ A;  2RMU 1;  2Q8O A;  4E27 A;  5ABJ C;  4LBN A;  5HV0 A;  5FR3 A;  1EV1 1;  4AVV A;  3EB7 A;  5CB7 A;  5FLJ A;  2OVU A;  3OD0 A;  4DUW A;  4QGL A;  1RMU 3;  3M8L A;  4BB3 A;  2OUH A;  1CR7 A;  1W6O B;  2B45 X;  2CV6 A;  2D40 A;  3JD7 1;  4OI1 A;  1AXY A;  3NV2 A;  3T2Q A;  4JDO A;  4CU8 A;  2GME A;  2WA4 A;  3U14 A;  3GBG A;  5KXB A;  2MNG A;  4UFI A;  5FY4 A;  5IAX A;  5LA9 A;  4IEO A;  4XUN A;  1Q8Q A;  1R09 2;  1ZRF A;  4O61 A;  3ZYF A;  3INA A;  4C1X A;  3CJI A;  2VMH A;  5JXH A;  2YBP A;  1GU3 A;  3MGU A;  1YXW A;  2A3Y A;  2YBK A;  2FD8 A;  5DDJ 1;  3T08 A;  1YIP A;  2FDK A;  3DN7 A;  1RUD 3;  4CXX A;  1QDC A;  1MEC 1;  1TMF 3;  1RUH 2;  1VBE 1;  1UCX A;  2YFZ A;  3AMH A;  3OUI A;  4BIS A;  4OUL A;  1RIR A;  4R9C A;  1V0A A;  3IN9 A;  4IGO A;  5DAP A;  3LOB A;  3AMM A;  3K77 A;  4IV3 A;  4PJY A;  1PGS A;  4RS5 A;  3AMN A;  5FY8 A;  4IE0 A;  5LB6 A;  3U10 A;  3B5L B;  1GOH A;  1FPN 2;  2B46 X;  1OPO A;  5DAV A;  5CEH A;  1ULE A;  4AQ6 A;  2GNB A;  2HWF 3;  1H8T A;  4I30 A;  5A7S A;  1AR9 1;  2RM2 2;  4LPL A;  2WO1 A;  1NZI A;  4KBB A;  2EVX A;  3OUH A;  4HPK B;  5BV6 A;  1GP6 A;  2DU1 A;  3I2J A;  1A34 A;  3KV4 A;  4FFH A;  4V1P A;  1JOP A;  1S0J A;  5LBB A;  1J59 A;  1GYK A;  5A7W A;  2ZKN A;  2BNN A;  1UD1 A;  2P17 A;  4UFH A;  2WT0 A;  1MVE A;  3MV1 1;  4AHZ A;  1PIV 1;  4XMI A;  3ZXG A;  4CU9 A;  1S0B A;  1FNZ A;  1RUJ 2;  3AZZ A;  4TLF A;  5H9P A;  5LRR A;  3AL5 A;  2YPD A;  4Y5T A;  1YRZ A;  3WQ1 A;  2Q8E A;  5DMY A;  3O7O A;  4H7L A;  4YG0 A;  1RC6 A;  1ENX A;  1F4H A;  4D8M A;  1GNH A;  5IUQ A;  1WZX A;  4Q4Y 2;  1ND2 B;  2GC1 A;  4XUT A;  4YG3 A;  3KS7 A;  4XJZ A;  4Z8B A;  2RJL A;  3OBR A;  3IKW A;  4N43 A;  1BEV 2;  4CTE A;  4FTB A;  5GZD A;  3FFQ A;  2YYO A;  1R1A 3;  3GZU C;  4LHS A;  4OUS A;  2W92 A;  4XFH A;  4IUG A;  2WZR 1;  4DOU A;  1DDL A;  2HH9 A;  1Q5O A;  5JIU A;  5ACA 1;  1Y4W A;  3B9C A;  3EBR A;  4IGQ A;  4M4R A;  3T0B A;  3T09 A;  3KMH A;  4OQ8 A;  1Z7S 3;  3KT7 A;  1ND2 A;  2LS6 A;  1FNY A;  2DU0 A;  5C9A A;  3N9N A;  2RDS A;  3PJQ A;  3KV5 A;  3JBG 2;  1RJ7 A;  4JRL A;  1W9W A;  5KWR A;  2A70 A;  1GZ9 A;  5CIR A;  4LUL A;  1AR9 2;  4J1X A;  4LIT A;  1KD7 A;  1ND3 C;  4A7Y A;  2VUL A;  1W2O A;  1DZR A;  3BOD A;  3LAG A;  4K8F A;  2IXH A;  4Q1R A;  3RNS A;  1A78 A;  5HV4 A;  3V0B A;  1Q8P A;  3A7Q A;  3KM5 A;  3BTY A;  1N3O A;  2YU2 A;  4QX0 A;  3VBR C;  2KR2 A;  4JCK A;  4AFM A;  3AXE A;  2AH2 A;  4NID A;  2GP5 A;  4MVT A;  2VMF A;  1DQ0 A;  2UWA A;  3K75 B;  4ONU A;  1C8M 3;  1UZ0 A;  5B4X A;  3KLS A;  4HKO A;  1F5F A;  2JX9 A;  1N47 A;  1OD3 A;  2WO7 A;  3WP6 A;  1SG3 A;  4XAA A;  4JX0 A;  5FYB A;  5JOY A;  1WCS A;  3IPV B;  3KB5 A;  3PME A;  4NE9 A;  5CFD A;  2R49 A;  3ELN A;  5FFO C;  1JUI A;  4XXA A;  3I2H A;  5ANN A;  4GIQ A;  1O4Z A;  5FZG A;  1VLN A;  3SMH A;  1H2L A;  4MG2 A;  1SZB A;  1BLZ A;  2P5B A;  2VZU A;  4WM8 A;  2QQV A;  1CZS A;  3GXU A;  5F3I A;  3FUQ A;  3LF7 A;  1IGO A;  1FI2 A;  4XJA A;  2JDY A;  4FI9 A;  5C33 A;  5AC9 1;  5FZL A;  1R1Z A;  1K5J A;  4AVC A;  2JIJ A;  3SCH A;  4LOR A;  1W6Q A;  4BQ4 A;  4E8D A;  1SLC A;  4M00 A;  3MF6 A;  1VBD 3;  2B5H A;  4XF0 A;  3BYW A;  1APN A;  1NCR A;  3J7N A;  3T0D A;  1LAJ A;  4ZU4 A;  3LIG A;  4XMA A;  2R04 3;  3RSJ A;  1K5M B;  1RUI 2;  3K46 A;  4AED A;  2W08 A;  1T6B X;  2XXZ A;  4FP3 A;  3ZXJ A;  5FMB A;  3N7L A;  2VU9 A;  3ACF A;  3LCP A;  4XVH A;  2DVB A;  4HXC A;  4QU1 A;  5AVA A;  3SEE A;  2P4E A;  1M4W A;  2XVG A;  5CFD C;  3USU A;  4RS5 B;  2VZQ A;  4JVA A;  3S7E A;  4K8R B;  4K6B A;  1GWM A;  1EUU A;  5I8S A;  2ZGO A;  1Q56 A;  2SLI A;  1ASJ 1;  1NCQ A;  4QXC A;  1XBF A;  4WM7 A;  3BAL A;  3AP5 A;  3BKZ A;  1U0A A;  3WNO A;  4QKD A;  3WNX A;  3VBO B;  1ULC A;  3WV6 A;  2E53 A;  3HBZ A;  1PM7 A;  3BGA A;  3ES4 A;  2NMN A;  4CU6 A;  4YZ5 A;  2DUO A;  1H6X A;  4HSL A;  4H3W A;  1FMD 2;  2MEV 1;  2XUM A;  2MPF A;  1IKQ A;  2WFF 2;  1AYM 3;  5ABJ B;  1WGP A;  1XE0 A;  3SIT A;  1TMF 1;  1VBE 3;  4UT5 A;  1JMU B;  5FJK A;  4YRD A;  4QX5 A;  1PMH X;  1GIC A;  2P6H A;  2B39 A;  2IVI B;  4MGS A;  4QPW A;  2J42 A;  4IER A;  3UT0 A;  1U5X A;  1CGP A;  5DUV A;  3DYM A;  1W9Y A;  1LOB A;  5DQ0 A;  3APB A;  3DPR A;  4RYD A;  2Y6L A;  4JDM A;  4QQO A;  5T52 A;  3GCW A;  1FPN 3;  1HRV 3;  3TBD A;  5IFP A;  2ARA A;  1HW5 A;  1VAK A;  3AC0 A;  2BGO A;  2VR4 A;  1K45 A;  1OBN A;  3WNN A;  4Y33 A;  5HCH A;  4OI0 A;  5FY9 A;  2QZ3 A;  2D7F A;  1RHI 1;  2A3W A;  2I45 A;  4DUV A;  3B01 A;  1BMV 1;  2GNT A;  1SAC A;  4P9L A;  5I0R A;  1I6X A;  2QQM A;  2WT1 A;  3IBM A;  3VBS A;  3FWE A;  1LEN A;  3JB4 C;  5FIX A;  5CFC B;  5LEK A;  3J8F 1;  4A45 A;  1PO2 2;  2VZP A;  1JOJ A;  3OD4 A;  1CAU B;  1HXS 3;  4XIL A;  4BQW A;  1IS5 A;  2E7T A;  3FLT A;  3GNE A;  3TAY A;  3WW3 A;  4E4D X;  4CVU A;  3OJB A;  2VOX A;  3SH4 A;  2ZAC A;  4K21 A;  4TYS A;  1DYP A;  4UW5 A;  4Q8K A;  4OI4 A;  4WVM A;  3FFZ A;  4UFJ A;  2JIC A;  1SDW A;  1W6M A;  3H9A A;  3LSE A;  3NRU A;  3ZKY A;  1LOF A;  1W05 A;  3ASI A;  4IL7 A;  1OFS A;  3ZFE C;  3H0O A;  3F2Z A;  2Y64 A;  3FBM A;  3PVO A;  1D2S A;  3IPV A;  4UFM A;  2HWE 3;  5EYX A;  1HDK A;  1JW6 A;  2WII B;  3WG4 A;  4RR3 B;  1WBF A;  1VBA 3;  2HWF 1;  3L2H A;  4Y1X A;  5A3P A;  5C8C A;  2FDG A;  5C8C C;  4JGZ B;  2CHH A;  1BYH A;  2RDR A;  4CCL A;  1YFY A;  1QU0 A;  4P00 B;  2VZT A;  4P9X A;  3U0Z A;  3J7H A;  1SLB A;  2JXA A;  3RPQ A;  1LOD A;  4BLJ A;  2JG9 C;  5FY1 A;  3RI8 A;  4AGG A;  4IE4 A;  5BNO C;  2RS5 2;  3H3L A;  4GQ7 A;  5C5U A;  1H4H A;  2VM9 A;  4LBK A;  1UMI A;  4M01 A;  5JSO A;  3CJI C;  1HXS 2;  1RGS A;  2IXL A;  4EN8 B;  1HLC A;  4NHX A;  1LU2 A;  4JKM A;  1X7N A;  3HNM A;  5C9A C;  4LTA A;  2JDK A;  3B69 A;  1LHV A;  4YLZ A;  2VXJ A;  3ZFF C;  1JYN A;  5JDB A;  2Y6J A;  2HJI A;  2VOW A;  3CJX A;  5JOX A;  2EIG A;  4Q4X 2;  2EAK A;  2WNO A;  1S0E A;  2OA2 A;  4W50 A;  3KGZ A;  4QXB A;  4JKK A;  1K5M A;  5FXX A;  3KGL A;  2P34 A;  1JYV A;  1AR8 2;  4OVE A;  3L2Y A;  2ARB A;  2LM3 A;  3P3P A;  3MF9 A;  1DGR N;  5JZG B;  1A3K A;  1UXX X;  3U4X A;  5M0T A;  2V4A A;  2A3X A;  4B7E A;  2B9U A;  3S5A A;  1ZBA 2;  1DG6 A;  2YG0 A;  1VRB A;  1PHM A;  4A6O A;  4B8E A;  2CSG A;  1VRH 1;  3NJV A;  1ZRD A;  2B7Y A;  4MXV A;  4IE7 A;  3CF6 E;  3P5B A;  4FOV A;  1W2T A;  4QAW A;  2A6Z A;  5IFT A;  3VBO A;  2XQR A;  1Y9G A;  4XFF A;  4MV2 A;  3RJ2 X;  5JOZ A;  3DV8 A;  5FPX A;  1L7L A;  3OOX A;  2HWC 2;  3KD4 A;  4YZ2 A;  1ZRE A;  2FDI A;  1DCS A;  5CZK A;  2WFF 3;  1F15 A;  2J1T A;  4YGE A;  4RHV 2;  4XFI A;  3OG2 A;  1CAW B;  4N7U A;  1NQJ A;  1MQT B;  2EXK A;  1UKR A;  3CIH A;  4QKB A;  4QHO A;  2PHX A;  3A0N A;  5F6K A;  4D7S A;  1O7F A;  1WUV A;  2KXL A;  3X29 B;  4IDZ A;  1NY7 2;  3RZK A;  1CQ9 A;  1SPP B;  3J7M A;  4ZPI A;  2BGC A;  1IQD C;  1O6U A;  5JI7 A;  1T2X A;  1UN1 A;  3FLP A;  1QJZ A;  3PVE A;  1UU5 A;  4FPK A;  4GB3 3;  3R4D B;  4M3C A;  3POB A;  4B1L A;  5CBL A;  5FYC A;  2QQK A;  3MDP A;  5HCA A;  3JQX A;  5HBA A;  4JTO A;  3T4V A;  2ZEW A;  2D5H A;  4ITC A;  4QXH A;  5J37 A;  4Q4W 3;  3T3Y A;  3CNA A;  2NQY A;  4ZZ8 A;  2A6X A;  1XE8 A;  2J1U A;  4ES9 A;  1HB3 A;  2XJQ A;  2PLV 1;  1LGB A;  3PHM A;  4PF5 A;  4KG8 A;  4XDQ A;  2HWD 2;  1K5M C;  3KCX A;  1SDD B;  5FY7 A;  3T2P A;  4QB1 A;  3MZH A;  1RXG A;  3ZFG B;  4YPJ A;  2JDZ A;  3VBS B;  3TN9 1;  2BUK A;  2WZE A;  4JTN A;  3POW A;  3VHP A;  1TME 1;  2WBK A;  2XML A;  3FN9 A;  1LRH A;  3I4I A;  3ZFE A;  3AVS A;  1C4R A;  1UL9 A;  3LZZ A;  3M1H A;  4PIX A;  2HWB 3;  3S6P A;  3H8X A;  2PLV 2;  3WNK A;  1O5U A;  5FLH A;  1DYO A;  4RQP A;  2VZO A;  3AYD A;  4CCD A;  5A1L A;  4AE2 A;  5J1X A;  1MS0 A;  4WVM B;  4DFS A;  2WO3 A;  4Q4V 1;  4UF0 B;  3VGI A;  3WNP A;  1SLL A;  2JG9 A;  3ZN5 A;  2R7E B;  2Y6G A;  3VBO C;  1M06 G;  2FBE A;  2B4K A;  4GWM A;  4QB6 A;  3CU7 A;  2OZ6 A;  3B7M A;  4ATE A;  1K42 A;  1VJ2 A;  4IW3 A;  4D6Q A;  2W0X A;  3M3O A;  4YM1 A;  4COW A;  4JGZ A;  1W6O A;  2RS3 3;  3AYE A;  4NRQ A;  3SEP A;  5J36 A;  1LEC A;  3NAP A;  5IWF A;  1PZ9 A;  3IDB B;  1LOF C;  1UWW A;  3LEK A;  2VW0 A;  4YM2 A;  4OFG A;  1QJX 1;  2X5I C;  2YFU A;  2PAM A;  1IQA A;  2VMD A;  1RED A;  1UOG A;  5EJ3 A;  4LOS A;  5F2W A;  4AHW A;  4XFB A;  5I0D A;  1W2A X;  5DG2 A;  5C71 A;  3QCW A;  1QY4 A;  1D0G A;  2CGO A;  2PN5 A;  3UJQ A;  3ZXD A;  4OMD A;  4MUV A;  2VZ1 A;  1H0B A;  1OLM A;  2VEC A;  4FPL A;  1JHJ A;  2J1A A;  5I0S A;  3N4M A;  1RUJ 3;  2H6B A;  4EJR A;  2CL2 A;  1UU6 A;  2E7Q A;  4MX3 A;  1HIX A;  3BOP A;  4HVR A;  1BEV 1;  2BOI A;  5T55 A;  3VKN A;  1R1A 2;  1WCU A;  5L36 A;  3PVB B;  4GAZ A;  3UKV A;  3WT3 A;  5FZ3 A;  1OFN A;  3ACI A;  1IG0 A;  5AVP A;  1G9D A;  2D98 A;  5JUV A;  1YJK A;  3THD A;  4Q4Y 3;  3HVD A;  2RS3 2;  4L2N A;  5HXM A;  4HG6 B;  4JAA A;  3LDK A;  3R4S A;  1Y43 B;  5FZC A;  2H0V A;  3HJR A;  3VBR A;  4CEY C;  3POG A;  1FV3 A;  4YVS B;  3LKJ A;  2A6W A;  5C3O A;  5LWB A;  5A7W B;  2QQU A;  1SBF A;  3AX4 A;  1CZT A;  3C7O A;  1EY2 A;  1AR7 3;  3MYX A;  4K40 A;  3RYR A;  3P6B A;  5BYN A;  4NPM A;  2IXI A;  2QQI A;  3UYJ A;  1PVC 2;  5FKB A;  1VAL A;  3OY8 B;  2WO2 A;  3O0W A;  2ZHL A;  3CLP A;  2TUN A;  4QKN A;  4DXS A;  5IVF A;  1GNZ A;  1S0I A;  3J8F 2;  1NA1 C;  1RUC 2;  2PHL A;  4FCA A;  4KBZ A;  4NHK A;  1BK1 A;  1H8T B;  3NO8 A;  4U2A A;  3MLK A;  2GSY A;  1MZE A;  4PDW C;  3W9A A;  2VC9 A;  3ZDV A;  3DUI A;  5L7O C;  2P6C A;  4N43 B;  1N1Y A;  1WWY A;  2MHF A;  4XQW A;  3AP7 A;  5FYV A;  1OA2 A;  3T2O A;  3SQO A;  4Y4R A;  4WV8 A;  3N35 A;  1YNA A;  1MS9 A;  3FJS A;  1VRH 3;  3LEM A;  5LBC A;  4LKS A;  2ZAH A;  3RZH A;  1TZO A;  1OC1 A;  5C9A B;  4G4F A;  1EYB A;  1AX1 A;  1FOD 1;  5CKQ A;  3RDI A;  4QB2 A;  3E6D A;  4A42 A;  3Q8F A;  1MAC A;  5F39 A;  2G4I A;  4XTM A;  3H1Y A;  2ZHK A;  3VL9 A;  3H8R A;  4LBQ D;  1LKN A;  4W8J A;  2ATF A;  5KC6 A;  3B00 A;  4UW4 A;  3ZFG A;  2DUP A;  3WF0 A;  3JD7 2;  1PX3 A;  3J8F 3;  4XFG A;  1WME A;  3LFI A;  5EV7 A;  5F3E A;  3VDC A;  3VZJ A;  4I0B A;  1AYN 1;  3W20 A;  2W2I A;  1UAI A;  1CIY A;  3I59 A;  4YVW A;  3FMG A;  2BTV C;  2VOV A;  5GLZ A;  3IIA A;  4AQT A;  5I93 A;  1JYW A;  3O1P A;  2LTN A;  3QH7 A;  4R9B A;  1OXC A;  3WG1 A;  4LUK A;  2NYY A;  3B3Q E;  2A71 A;  4LBM A;  4Y24 A;  1AL0 G;  2VBP A;  4AG4 A;  1VPH A;  1ZZC A;  4FFG A;  5EYY A;  4MXW B;  1FAY A;  2IFR A;  3CO2 A;  2D6K A;  4XPV A;  4JZR A;  4IGP A;  4W65 A;  4I3G A;  2E6V A;  2VQU A;  3ZSM A;  4FPG A;  2QVS B;  2XBO 1;  3MIF A;  2A1X A;  3OSD A;  5FMO L;  4N9H A;  3I2D A;  3WDY A;  4KMQ A;  3HMY A;  1GWL A;  4X6Q B;  1QQP 1;  1IOA A;  2GP3 A;  4HFS A;  3HNY M;  1TEI A;  3I3D A;  3WHU A;  4LO5 B;  1ULP A;  2WFF 1;  1B35 C;  1AJO A;  1HJG A;  1OOP B;  2O14 A;  1UMH A;  2MEV 2;  3FL7 A;  4UYB A;  1LOE A;  4CCO A;  2HWB 1;  1YIF A;  1PVC 3;  2VXR A;  2XKP A;  3DKQ A;  4GMP 1;  3U11 A;  5F7U A;  5L7O A;  3O1V A;  4I0W B;  3E6C C;  1RUN A;  1EV1 3;  2DVA A;  1UMZ A;  2YMZ A;  4UI9 L;  4XF1 A;  1RJ8 A;  2BNM A;  3RGB A;  1QKQ A;  2W47 A;  1CAX A;  2PEL A;  4XHX A;  1UZW A;  2Z42 A;  3J7L A;  2E9Q A;  3A23 A;  3RYP A;  3LOI A;  3NJX A;  4Y22 B;  2JEM A;  4B4Q A;  3FHQ A;  2PQQ A;  4QWN A;  5FYH A;  1EAH 1;  4XDO A;  2GNM A;  1JOB A;  4EWA A;  3I54 A;  5JOW A;  2LRO A;  3NWK A;  3KF5 A;  4HK8 A;  2DCJ A;  4U36 A;  5ERL A;  3ZFG C;  3K4Z A;  4FQZ A;  3MIE A;  4K1Z A;  4AFC A;  1X8M A;  2ZMK A;  1O3Q A;  2L9L A;  1FT9 A;  3IMM A;  3LA2 A;  2QE3 A;  2RJK A;  4NOT A;  3SXW A;  2ZKL A;  3ZKU A;  3PTR B;  1SHW B;  4YFW A;  1FMD 3;  3AZW A;  4MGY E;  4PLM A;  1ZZ7 A;  1Q3E A;  3LQC A;  1OMI A;  2ENR A;  4BQ2 A;  1XYO A;  2V4V A;  1ENR A;  3K3N A;  2W1W A;  3VZO A;  1ULF A;  4AI1 A;  4LKF A;  1TME 3;  3UGF A;  4DZG A;  1REF A;  1HB2 A;  2DCZ A;  4ZXK A;  4DPN A;  4XXP A;  4DMI A;  5LA2 A;  3IMN A;  3D5O A;  3DPR C;  4HVO A;  1KXG A;  3I3B A;  5DXD A;  3USU B;  3ZYJ B;  4E4Z A;  4BQ5 A;  5SV8 A;  3ZDS A;  1RUC 1;  1UYX A;  1Y3T A;  1IS4 A;  1DGW A;  1GZC A;  1W8O A;  2O8O A;  3R4U A;  1DZT A;  4LHL A;  3UKN A;  4BE3 A;  1KFX L;  1XSQ A;  3H3Z A;  4CP2 A;  4J1W A;  4TSV A;  3P3N A;  4AGR A;  1CJD A;  1H8V A;  3T0A A;  5JXG A;  2H6C A;  4ES8 A;  2VZR A;  3HN1 A;  5FZD A;  1JBC A;  4LO7 A;  2WQZ C;  1DZQ A;  1PGL 1;  2OUJ A;  2VME A;  2FCT A;  3D3A A;  1TE1 B;  3TB0 A;  1CD3 G;  3I49 A;  1KEX A;  5FO7 B;  2R16 A;  4YZ4 A;  4DNY A;  2R1D A;  2FQP A;  2XLA A;  1MZF A;  2Z2S B;  3EQE A;  4ERO A;  4CU7 A;  2CY6 A;  5JCT A;  1PMI A;  4H55 A;  4OCT A;  4AI2 A;  5FZ6 A;  4CDX B;  3ZMN A;  2VZ3 A;  2W5F A;  5FY0 A;  5HPO A;  4DB5 A;  1BVV A;  4FSJ A;  2ADE A;  1W6P B;  2VO5 A;  1W99 A;  2C24 A;  3EJK A;  4P14 A;  2FDF A;  1R1A 1;  1BZW A;  1UIK A;  2DCY A;  2R30 A;  5J09 A;  1YQ2 A;  4I0A A;  5FZB A;  2WRA A;  3MUZ 1;  2Q1M A;  1YFU A;  5FZ4 A;  3MLJ A;  3OF1 A;  3GGL A;  2OYZ A;  3WDW A;  2G9G A;  3R0R A;  3HBK A;  2X05 A;  3WLU A;  2ZGU A;  1OUR A;  1B09 A;  1W6P A;  2DF7 A;  5LBF A;  2R0H A;  4CDQ A;  5DZF A;  5IVY A;  3SCG A;  5K0U C;  5BNP C;  3POF A;  4LBL A;  3RMX A;  5FPU A;  4XDP A;  4YAR A;  3POE A;  5IK8 A;  1NLQ A;  2GND A;  4XFC A;  3FE5 A;  3BPS A;  1JH5 A;  4O9E A;  3WX5 A;  4FOQ A;  2VTX J;  2GC3 A;  4F83 A;  1CVN A;  3F95 A;  1NCQ C;  4IEX A;  2OQ6 A;  4RL7 A;  4JRA A;  3ALQ A;  3POS A;  2PHU A;  3N9Q A;  4CEW A;  4NAM A;  1WD3 A;  3NAP C;  2W1S A;  5E1R A;  5CFD B;  4BDV B;  2HEW F;  4RS5 C;  5D8A C;  2PHF A;  2WNU B;  1MS4 A;  2BGP A;  2VY0 A;  4FPJ A;  5FAX A;  3ZR5 A;  2D93 A;  4AI9 A;  1DFQ A;  2RS1 1;  2NPI A;  1VBE 2;  1X33 A;  2W1Q A;  3H50 A;  2VAU A;  2WDB A;  5DDJ 3;  3ACL A;  2E33 A;  3POY A;  4GKY A;  4NAO A;  1IS3 A;  4LE4 A;  3VKM A;  4IES A;  5IK5 A;  1YEW A;  2VUA A;  2TBV A;  4HSJ A;  1LU1 A;  5CKN A;  2BPA 2;  2A6V A;  4AAP A;  1POQ A;  3BI3 A;  2ZML A;  1D7P M;  1FOD 2;  2DVF A;  3PIG A;  4Z92 B;  1Y7B A;  4LK6 A;  4A3X A;  2WKK A;  2JDN A;  4OI2 A;  1DU3 D;  1REE A;  4HZF A;  5A6Y A;  5IVC A;  3V0A B;  1PNF A;  3AVR A;  1G9C A;  4Q27 A;  2VVD A;  3WCR A;  5FK7 A;  3QAC A;  1IPJ A;  4Y1Y A;  5EHD A;  4ASM B;  4UAP A;  1S0C A;  4AED B;  2AAC A;  5FYS A;  1HV1 A;  3AKR A;  2HEY F;  4WM7 C;  2RV9 A;  2EAL A;  4CP9 A;  3WG2 A;  2VNV A;  3WW1 A;  1GWK A;  1MEC 2;  4LE3 A;  4Q2F A;  1CZV A;  5F8P A;  4NIG A;  2JG8 C;  3S7I A;  1N3P A;  3JU9 A;  1KDK A;  1QOO A;  4S2H A;  3ZXL A;  4HN1 A;  1PGW 2;  1PVC 1;  1W6Q B;  4E2S A;  1UO9 A;  1O3T A;  4QGN A;  1JZ2 A;  2RE9 A;  3KSC A;  3KQ4 B;  3WDX A;  5I0U A;  1RUF 1;  1PNG A;  2VQT A;  5A7N A;  4YW6 A;  3S0M A;  1MZ5 A;  2F4L A;  3W5N A;  4HVQ A;  2ZX2 A;  5E6H A;  4YW2 A;  2ZEX A;  4JDN A;  5E16 A;  1QJU 2;  2XWJ B;  2WS9 1;  4XJ8 A;  2WQ8 A;  5A3T A;  2XHN A;  1XJA A;  1F2N A;  4LK7 A;  4M3C B;  3WNM A;  3K3O A;  2B42 B;  3W58 A;  1GUI A;  4LMF A;  1UU4 A;  5J96 B;  2ZXQ A;  4E2Q A;  1WA4 A;  1VB4 A;  1B35 B;  2VBD A;  1OOP C;  3WIN E;  5A7P A;  3VBU C;  1GZT A;  5KHJ A;  1FMD 1;  4EN7 B;  2ERF A;  1D4V B;  2W68 A;  4Q26 A;  1VRH 2;  2OX0 A;  1DLL A;  2J1R A;  2AUY A;  2XJU A;  2ARX A;  2XL7 A;  1JOD A;  2C6S A;  4G3Y C;  3WOG A;  4GWI A;  3PUQ A;  1H2N A;  2QBX A;  1OVP A;  3E5Q A;  4NJ4 A;  1ZRI A;  5ISL A;  4AI0 A;  4CDW B;  1J84 A;  4ZHN A;  3G6J B;  1AR8 1;  2WR9 A;  2ZGR A;  1QJU 3;  5KR7 A;  4A44 A;  3ORJ A;  5FUP A;  4AHY A;  3KT1 A;  1DQ5 A;  5A33 A;  4P9Y A;  4RHV 1;  4J6G A;  3MPP G;  3WXP A;  4CYD A;  4AK3 A;  1OH3 A;  2G9Z A;  1KDM A;  2PA7 A;  2PMW B;  1S2B A;  1RHI 3;  2WIN B;  1SLT A;  4LEJ A;  2VZV A;  3VD5 A;  5F6L B;  3ZVX A;  5C6C A;  1H9P A;  4B3N A;  2VCM A;  1ND3 B;  4XE9 A;  1OD5 A;  4XIO A;  3BTA A;  4YM3 A;  5DZE A;  3RFR A;  3WF3 A;  4WVV A;  5A32 B;  3LDR A;  1Y9Q A;  1GQP A;  1WW6 A;  1W0P A;  1E5R A;  4NN0 A;  4RQP C;  4W6X A;  3N9O A;  2C4X A;  2YU1 A;  5FZM A;  3O0X A;  4XQD A;  3RS6 A;  1RUO A;  2VNG A;  4CPB D;  1NE6 A;  3D0S A;  3KVB A;  1NE4 A;  3VLB B;  2RS5 3;  4PT6 A;  1D0H A;  3DCQ A;  4OHW A;  4RR3 A;  4LJH A;  2JD4 A;  3OBZ A;  4NHM A;  5DAW A;  5GLU A;  3WQB A;  2CAU A;  2VUJ A;  3TEW A;  3TN9 2;  4UF0 A;  4AOC A;  5D2A A;  3VHR A;  1YWK A;  3OTF A;  1HRI 1;  5FZH A;  4XYX A;  3OPZ A;  3J9S A;  4I2O A;  5L9B A;  5FDB A;  2KA3 A;  5FKC A;  3TYJ A;  2X5I A;  3N9L A;  3AZY A;  4FPY A;  2A73 B;  3ECQ A;  2WUH A;  2YZ4 A;  1UY2 A;  4IV1 B;  1VIW B;  2QQN A;  1RVF 1;  4X6R B;  5FZ9 A;  1ZYB A;  2BFU L;  1O5L A;  1AL2 1;  2LW8 A;  4IND A;  2D3P A;  3N7K A;  4MSV A;  1HQW A;  2Y60 A;  3BIW E;  3W5M A;  1COV 1;  1S1A A;  1CIW A;  1LR5 A;  2W39 A;  4GH4 C;  5GZF A;  5KXE A;  1H1A A;  2JE9 A;  1D2Q A;  1GP4 A;  2ZHM A;  4E2G A;  1ASJ 3;  4QHB A;  2WYF A;  4QQL A;  1DF0 A;  2V5Y A;  2AEY A;  4CCM A;  4H14 A;  4KL1 A;  2XJS A;  3NV1 A;  5C8W A;  2WAB A;  1A6C A;  4D7T A;  2W94 A;  5GLT A;  3LFM A;  4DQA A;  3RWK X;  1QJY 1;  1HRI 2;  5GJ6 A;  2DCK A;  4Q4X 1;  3EMR A;  2DTW A;  1WKY A;  3Q8A A;  4DEV A;  5A1F A;  3MUY 1;  1LOA A;  1E5S A;  1XNA A;  5BNP B;  4QM9 A;  4UW3 A;  3U75 A;  4AXO A;  3C7E A;  4LOT A;  5FCC A;  2NM1 A;  5EIY B;  1CAV B;  2R06 2;  4MZU A;  2G1M A;  3WSO A;  2WZR 2;  3PIJ A;  3TOJ A;  1F35 A;  2JDH A;  2VCC A;  1ZNP A;  1GZW A;  3T30 A;  1MS8 A;  1RUC 3;  1QJE A;  1QJX 3;  4LIU A;  3EYP A;  1C5I A;  1OQ1 A;  1GMM A;  2Q1Z B;  4SLI A;  1YQ5 A;  3MV0 1;  1RXF A;  3N7M A;  4ZXE A;  2P3Y A;  3G7D A;  3NV4 A;  3B94 A;  1XNK A;  2PQS A;  2WWU A;  2GH2 A;  2ZGS A;  4SBV A;  3ZSE A;  4BME A;  2XJR A;  2I07 B;  4AFB A;  5JZG A;  3BIE A;  1LOG A;  3CEW A;  5FZE A;  4NVP A;  3LEG A; 
#chains in the Genus database with same CATH homology
 5JR2 A;  3SEP A;  3ACH A;  2XQX A;  3JXS A;  5DN2 A;  1UWW A;  3LEK A;  2YFU A;  2C26 A;  1O8P A;  3NQH A;  3CDZ B;  2VMD A;  2VMC A;  5JMO A;  5IJR A;  5I0D A;  2JE8 A;  5C71 A;  3P1I A;  2J1E A;  4OMD A;  2VZ1 A;  5LCW L;  3K4A A;  1JHJ A;  1L7R A;  2J1A A;  2E26 A;  3VD9 A;  4P08 A;  3BN6 A;  3WEZ A;  1JU3 A;  1NX9 A;  2QQL A;  2BER A;  3THC A;  2VJX A;  3HPN A;  3C7F A;  3OEB A;  2Y6K A;  5G05 L;  3ACI A;  3CZU A;  3OEA A;  3I2K A;  2BZD A;  5JUV A;  3THD A;  4W4Z A;  3DEC A;  5HXM A;  4HG6 B;  2J7M A;  4ET7 A;  3HJR A;  2XOM A;  3OBA A;  1UY1 A;  1DLC A;  1CX1 A;  2XON A;  3VD4 A;  3C7O A;  1CZT A;  3P6B A;  2W87 A;  2QQI A;  1NUK A;  4QX1 A;  1NAE A;  2WO2 A;  1HN1 A;  4DXS A;  1K3I A;  1EUT A;  3IB3 A;  1LNS A;  3ETP A;  2X10 A;  3ABZ A;  2W91 A;  2J22 A;  2VC9 A;  5JXI A;  3IAP A;  3T2O A;  2J1V A;  2BBA A;  5C7G A;  4MGQ A;  4OUE A;  3EB7 A;  4DUW A;  3C8X A;  1DP0 A;  1US3 A;  4LKS A;  1J83 A;  4ZZ5 A;  5C70 A;  3CKH A;  1US2 A;  2YC2 A;  3HOB A;  4QB2 A;  4A42 A;  3T2Q A;  4CU8 A;  1GOF A;  2EIC A;  1I5P A;  4XUN A;  3K4D A;  4W8J A;  3WF2 A;  2EIE A;  5JXH A;  3WF0 A;  1GU3 A;  1JZ3 A;  1PX3 A;  3IAQ A;  3T08 A;  1CIY A;  4TXW A;  4XUP A;  4CUA A;  2WYS A;  2YFZ A;  2E31 A;  4P5Y A;  1JYW A;  3FHA A;  3SKJ E;  5IHR A;  1K12 A;  3K77 A;  4AG4 A;  2ZEY A;  2ZEZ A;  1GOH A;  2Z4F A;  2W46 A;  3PUI A;  1KGY A;  2VQU A;  4LPL A;  3IDA A;  2WO1 A;  3DYP A;  2ID4 A;  3I2J A;  3PUH A;  2HYX A;  2W95 A;  4KMQ A;  4E8C A;  2E32 A;  3HNY M;  3I3D A;  1ULP A;  3MV1 1;  4DXT A;  4CU9 A;  3FL7 A;  1UMH A;  3T0D A;  3OB8 A;  3CMG A;  5F7U A;  1JZ7 A;  3A22 A;  4UI9 L;  3HEI A;  5DMY A;  2W47 A;  3CZJ A;  4OZO A;  1F4H A;  4D8M A;  1RYY A;  4KI5 M;  4LQR A;  3A23 A;  4XUT A;  3NJX A;  3FHQ A;  3WNL A;  4A41 A;  4LHS A;  2W92 A;  4AAX A;  2WAO A;  4IUG A;  4BJ0 A;  1OH4 A;  4KWU A;  2DCJ A;  3WF1 A;  3K4Z A;  4M4R A;  3T0B A;  3T09 A;  2L9L A;  2LS6 A;  1SHW B;  1O59 A;  2V5D A;  1W0N A;  1W9W A;  3VDB A;  1O8S A;  3LQC A;  3GM8 A;  2V4V A;  2JKX A;  2W1W A;  5A1A A;  1JZ4 A;  2VZS A;  2HLE A;  4CUB A;  3C7G A;  5LA2 A;  1UXZ A;  3A7Q A;  4BK4 A;  3I3B A;  4QX0 A;  1UYX A;  2VMF A;  3K75 B;  4XUO A;  4ZY9 A;  5B4X A;  1UZ0 A;  1W8O A;  3MO4 A;  1OD3 A;  2WN2 A;  1SG3 A;  5JXG A;  4JX0 A;  3T0A A;  4TTG A;  2VZR A;  1JYX A;  3HNB M;  3I2H A;  2VME A;  3D3A A;  4MAD A;  3GDB A;  2Y8K A;  4ARX A;  1KEX A;  4JKL A;  3NNG A;  4P02 B;  2VZU A;  2WAA A;  1XNT A;  1CZS A;  3GXU A;  1UY3 A;  3SKV A;  4CU7 A;  3UNP A;  4FI9 A;  2VZ3 A;  2W5F A;  5HPO A;  4BXS V;  4E8D A;  2VO5 A;  1W99 A;  2ORZ A;  3WF4 A;  1YQ2 A;  3MUZ 1;  4MOA A;  2YC4 A;  1W8N A;  3GGL A;  5EJ1 B;  3K46 A;  2X05 A;  1JZ8 A;  1F4A A;  2C9K A;  4XUR A;  5B4N A;  4PQQ A;  2VTF A;  5JXJ A;  3ACF A;  4XVH A;  3SEE A;  3MBW A;  2VZQ A;  1XPW A;  5IYY A;  1EUU A;  2VOT A;  1OF4 A;  3I97 A;  1PX4 A;  3U37 A;  3WNO A;  2QQO A;  2W1S A;  4PF1 A;  3I2I A;  2RVA A;  4BDV B;  1JZ6 A;  2BGP A;  3BGA A;  3LEI A;  3DYO A;  4CU6 A;  1H6X A;  2W9X A;  3UET A;  2W1Q A;  1BHG A;  4OYU A;  2WDB A;  2E33 A;  2JD9 A;  1PMH X;  1D7P M;  4MGS A;  3OGR A;  4QPW A;  3DYM A;  5DQ0 A;  4RYD A;  2RJ2 A;  2Y6L A;  4UAP A;  5IFP A;  1PMJ X;  1OT5 A;  3AC0 A;  2BGO A;  2RV9 A;  2VR4 A;  1K45 A;  3WNN A;  1XC6 A;  1UYY A;  2WZ8 A;  4DUV A;  1CZV A;  1H6Y A;  1L7Q A;  1NKG A;  2EIB A;  2QQM A;  2OKX A;  5EJZ B;  4BK5 A;  1JI6 A;  3CQO A;  4QDS A;  1JZ2 A;  4A45 A;  2VZP A;  4A4A A;  3I2F A;  2VQT A;  3I3E A;  1UY4 A;  4CVU A;  1UY0 A;  3W5N A;  4M4P A;  2ZEX A;  2Y6H A;  1UYZ A;  2B9V A;  2WQ8 A;  2XHN A;  3NRU A;  1UX7 A;  1GNY A;  3WNM A;  2EID A;  4L0P A;  2DDU A;  3F2Z A;  2Y64 A;  1R64 A;  1GUI A;  4CUC A;  2ZXQ A;  1TG7 A;  1JZ5 A;  4P00 B;  2VZT A;  4XUQ A;  3J7H A;  2VL4 A;  4DUX A;  1MPX A;  1JU4 A;  2J1R A;  4GWI A;  5G04 L;  4ARY A;  2VM9 A;  2QBX A;  1UMI A;  3ZM8 A;  3ACG A;  1J84 A;  2J1S A;  4JKM A;  4RN5 A;  3HNM A;  1JYN A;  2CDP A;  4A44 A;  2Y6J A;  4XZU G;  3OGV A;  3HN3 A;  4DEQ A;  4W50 A;  4JKK A;  3LPF A;  3OGS A;  3UES A;  2KD7 A;  1JYV A;  5LA0 A;  2CDO A;  2VZV A;  3VD5 A;  1UXX X;  1ULO A;  2ORX A;  2YG0 A;  3WF3 A;  4A6O A;  1GQP A;  4QX3 A;  3NJV A;  2C4X A;  4QAW A;  5IFT A;  4GZ9 A;  4QDQ A;  4PT6 A;  3VDA A;  5LA1 A;  4D0Q A;  3WQB A;  5CZK A;  4GWJ A;  2J1T A;  2VCA A;  1TVG A;  5CYY A;  3OG2 A;  3CIH A;  2W3J A;  4OMC A;  3ECQ A;  4MO3 M;  2WUH A;  1UY2 A;  2QQN A;  4A3Z A;  4QX2 A;  1IQD C;  1T2X A;  3VD3 A;  2QQJ A;  2LW8 A;  3I2G A;  1W9T A;  5FUI A;  3W5M A;  3C7H A;  2QQK A;  2ZEW A;  2YB7 A;  4ZZ8 A;  4UOJ A;  3E1F 1;  2J1U A;  2WAB A;  2W94 A;  4DXR A;  3LE0 A;  4JHZ A;  2X09 A;  3T2P A;  1SDD B;  4QB1 A;  2DCK A;  2WN3 A;  4YPJ A;  1WKY A;  2WZE A;  4DEV A;  3MUY 1;  1XNA A;  5DPN A;  2WBK A;  3FN9 A;  4Z2A A;  3C7E A;  1GOG A;  2W1U A;  2VCB A;  5EIY B;  3WNK A;  3WSO A;  1DYO A;  2VCC A;  2VZO A;  5J1X A;  2JDA A;  3VDC A;  1W9S A;  3EYP A;  2WO3 A;  3WNP A;  1GMM A;  2V72 A;  3MV0 1;  2R7E B;  4ZXE A;  3VD7 A;  2Y6G A;  3LPG A;  2B4K A;  2PQS A;  4QDR A;  4QB6 A;  1WCQ A;  3A21 A;  1K42 A;  1OF3 A;  3III A;  1P8J A;  3LEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...