3SEEA

Crystal structure of a putative sugar binding protein (bt_4411) from bacteroides thetaiotaomicron vpi-5482 at 1.25 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QNLIKNEKFATEVTNKVTNPSKATAGEWFIMNNEADGVTTIAWEQTGDAKYPNAMKIDNSGAEKNTSWYKAFLGQRITDGLEKGIYVLTFYAKAKEAGTPVSVYIKQTNEEKNDNGKLNTTFFMRRDYDADAQPNASGAQYNFKIKDADKWTKVVVYYDMGQVVNAISSKKSNPALEVSDTDDDAAILKDCYVAILGQNKGGVVEISDVTLKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Hypothetical sugar binding protein (BT_4411) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
molecule keywords Hypothetical sugar binding protein
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15425 DUF4627 Domain of unknown function (DUF4627)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3seeA00
2EIEA 3I2KA 2QQKA 3W5NA 2VZUA 2X10A 2EICA 3HN3A 3WEZA 4A42A 1MPXA 1O8PA 4E8DA 2DCKA 2ZEWA 4ARYA 2Y6LA 1JZ8A 3K75B 3VD5A 3K4ZA 4MGSA 3K4AA 1TG7A 1CZVA 4LPLA 3W5MA 4QDSA 2VL4A 3BGAA 4UAPA 2RV9A 2XQXA 5C7GA 4KMQA 4QX0A 1R64A 3VDAA 4ZXEA 2VZ1A 3SEEA 2Y64A 2WYSA 1W9WA 1L7RA 2WUHA 2BBAA 3HNBM 2Y6GA 1GOHA 4W4ZA 2V5DA 3P1IA 3VD3A 1UY0A 3LEKA 1GQPA 4OMCA 4CUCA 4JKMA 4UOJA 5I0DA 2XHNA 3C7EA 2VCBA 3T0BA 2WO2A 5J1XA 1O59A 3WNMA 3IAPA 4M4PA 2VMCA 4TTGA 2QQNA 3PUHA 2W94A 3AC0A 3CMGA 3I2GA 1NX9A 1OF4A 3LPFA 2X05A 5JUVA 1HN1A 3I3EA 3VD7A 1PMHX 4P5YA 1F4HA 3ECQA 3C7HA 3THCA 3VDCA 3WNKA 3MUZ1 4M4RA 1YQ2A 4DXTA 2HYXA 3HEIA 3WSOA 4QAWA 3ACGA 4DUVA 1JZ5A 2ZEZA 2VZTA 4XZUG 3WNNA 4P08A 1XC6A 4RYDA 5C71A 1J84A 2QQOA 4OZOA 5IYYA 2J1RA 3I2FA 3LEIA 3I3BA 3A7QA 4L0PA 4XUQA 2YC2A 4QDQA 2L9LA 3C8XA 5C70A 5IFTA 2E32A 3T2QA 1JZ4A 3MV11 4PT6A 3SEPA 5JXGA 1KGYA 1OH4A 1F4AA 3MBWA 2J1TA 2WO3A 1ULOA 2W47A 4KI5M 4LHSA 2PQSA 2HLEA 3VD4A 2W46A 3SKVA 1H6YA 4GWIA 4A41A 3ACHA 4PF1A 3DYPA 2JE8A 2VQTA 2JD9A 5G05L 5DN2A 1WCQA 1KEXA 4CU6A 2BERA 4DUXA 1P8JA 1EUUA 1OD3A 5JR2A 4ARXA 1JYNA 4D0QA 3MO4A 1ULPA 1PX3A 4GWJA 5CYYA 4PQQA 4P00B 1H6XA 2W1SA 4A45A 4XVHA 2YFZA 2V4VA 1W9SA 2VCAA 4DUWA 2VC9A 3LPGA 3WF4A 3OBAA 3IAQA 1J83A 2V72A 1SDDB 3LEGA 5EJ1B 2J1UA 2RJ2A 2EIBA 3FL7A 2RVAA 2VZOA 2E26A 3HJRA 2WZEA 4FI9A 1DP0A 1NUKA 2J22A 2WZ8A 2W1WA 2DCJA 2ZXQA 4KWUA 4XUTA 2WABA 1O8SA 2CDOA 3IDAA 1K12A 2CDPA 2J1EA 4DEVA 3CQOA 2VMDA 3MUY1 1XNTA 3THDA 4OYUA 3OB8A 1JZ3A 3ABZA 3OGRA 1JU4A 3WNOA 2DDUA 3CDZB 5FUIA 3P6BA 4D8MA 1JZ6A 5DPNA 3GM8A 2WAOA 2VZ3A 2W95A 2ZEYA 4W8JA 2W9XA 1GMMA 3F2ZA 2ORXA 2JDAA 4RN5A 3WNPA 4BJ0A 1W8NA 1UY3A 4CU8A 4OMDA 1LNSA 1CZSA 2XONA 2WDBA 4YPJA 1K42A 3CZUA 3WF0A 4JHZA 3J7HA 4IUGA 3EYPA 2XOMA 3LQCA 4CVUA 1JYWA 5IFPA 2QQJA 3OGVA 2LS6A 4XUOA 1UXZA 5IJRA 3GGLA 4BK4A 2VZSA 3UETA 5JMOA 2W1QA 2LW8A 3A21A 4A44A 3ETPA 5B4XA 5B4NA 1GNYA 2Y8KA 1JZ7A 1CIYA 4DEQA 2OKXA 3EB7A 1NKGA 1UMIA 1I5PA 2ID4A 3IB3A 3OEAA 4TXWA 3GXUA 2J7MA 3C7GA 4XUPA 1RYYA 2VOTA 2BGOA 4QX3A 1SHWB 1IQDC 2X09A 1DYOA 5F7UA 3T0DA 5EIYB 1UX7A 2VZVA 4DXRA 2W3JA 4GZ9A 1K3IA 3K46A 1JHJA 2YB7A 3MV01 2W92A 4JX0A 3DECA 3FN9A 3A23A 2Y6JA 5LA2A 3SKJE 1JI6A 3IIIA 4BDVB 4HG6B 3VD9A 2QQMA 3I3DA 4P02B 3WF3A 2VCCA 1W8OA 3DYMA 3GDBA 4QB2A 3ACIA 4CU7A 1T2XA 5G04L 1CX1A 4ZZ8A 4BK5A 3WQBA 3NQHA 1WKYA 2B9VA 1UYXA 4UI9L 4AAXA 1JYXA 1UZ0A 2EIDA 3FHQA 1CZTA 2VZQA 2BZDA 4MGQA 3NRUA 3NJXA 3T0AA 3T09A 1US2A 3I97A 5HXMA 2VR4A 1UWWA 2QQIA 4LKSA 3K77A 4XURA 3I2JA 1GOGA 5A1AA 2E31A 2WN2A 2WN3A 1NAEA 4QX2A 3C7OA 4CUAA 3LE0A 1K45A 1XNAA 3OEBA 2VMEA 4MOAA 1UYZA 2WQ8A 2W87A 2VTFA 1D7PM 3T2PA 4QX1A 3I2IA 4JKLA 1PMJX 3CKHA 4LQRA 4QDRA 4W50A 4A3ZA 2C4XA 2YFUA 4E8CA 4DXSA 1GUIA 4OUEA 3VDBA 2J1AA 3ZM8A 3HNYM 2WAAA 3WF1A 2VM9A 2E33A 1JYVA 5JXJA 2W5FA 3OG2A 4AG4A 1XPWA 1PX4A 2VZRA 4QPWA 2ORZA 1OF3A 3PUIA 5HPOA 3E1F1 3HOBA 5LCWL 2Y6HA 1TVGA 1UY1A 5DQ0A 4QB6A 3NNGA 3UESA 2QBXA 3U37A 2QQLA 4MADA 3ACFA 4MO3M 4ET7A 2VQUA 5JXIA 4JKKA 5JXHA 5CZKA 4CUBA 4CU9A 1JZ2A 3T2OA 4ZY9A 3WF2A 2C26A 1UXXX 1US3A 1EUTA 3FHAA 1JU3A 4ZZ5A 2J1SA 1UY4A 5EJZB 3CIHA 2WBKA 1W9TA 2VMFA 3HNMA 4QB1A 2BGPA 4Z2AA 2B4KA 1GU3A 2YG0A 2VJXA 4XUNA 1W99A 3K4DA 5LA1A 1OT5A 3BN6A 5LA0A 3WNLA 3T08A 1L7QA 2C9KA 3A22A 3JXSA 2J1VA 3DYOA 3OGSA 2R7EB 1SG3A 3C7FA 3UNPA 2JKXA 2W1UA 1W0NA 2VO5A 1UY2A 2VZPA 3NJVA 5IHRA 2KD7A 4A6OA 3HPNA 1UYYA 3I2HA 1UMHA 3D3AA 1BHGA 2YC4A 2W91A 2Z4FA 4BXSV 2ZEXA 4A4AA 5DMYA 3CZJA 1DLCA 2WO1A 2Y6KA 1GOFA
chains in the Genus database with same CATH superfamily
4E4DX 5FYYA 2ENRA 1ENXA 2R16A 4TLFA 1HB4A 1AR72 3IT8A 4RGGA 3PUSA 3USUB 4B4RA 4R52A 3W5NA 5CB7A 1ZZ7A 4RFRB 4AFMA 2RDNA 1OA2A 3WEZA 4AI9A 4M0NA 1LENA 1O8PA 1UPIA 3O7OA 1D2SA 4ARYA 2LM3A 2Y6LA 4N53B 3OUJA 2BVVA 1OA3A 1FPN2 3K4ZA 5I0RA 3N7LA 4RR3A 4MGSA 3C2UA 1NA1B 3ME2A 3POJA 4QDSA 1O6UA 4IGPA 2VL4A 4FOWA 3VDDA 1CAUA 1R64A 2CNAA 3AX4A 1H1AA 1NZCA 1S0IA 1VJ2A 2A70A 1XRUA 2VZ1A 2WFF3 1AR63 1D2QA 1HIXA 3H1WA 1KITA 4PDWA 5FYUA 1JYTA 2B8MA 2WUHA 2E53A 1V6OA 2YHJA 1DFQA 2F17A 3HNBM 1GICA 4CDQC 1YIPA 2V09A 1QJU2 2V5DA 1UY0A 4W4ZA 3ZPYA 2QQUA 3RZMA 5JIAA 2JWPA 1VRH2 2Y60A 1Y43B 1GQPA 4OMCA 3AJZA 1QNYA 1OI6A 1UAIA 2VTXA 2ZHMA 4MXWA 3RS6A 2PN5A 2ZGSA 1HRV3 1YWKA 1H2LA 3GJBA 4LKFA 5D8AA 2VCBA 4ZHNA 3T0BA 4Q4X1 1EP0A 3HT2A 3B94A 4CCNA 2FDIA 1QY4A 3ZYHA 4COUA 2KXLA 2YC0A 2CHHA 5KR7A 1OA4A 2QZ3A 1UCXA 5FKBA 2XB6C 3WDYA 2UURA 4WM8B 4NJ4A 3VBFC 3KCCA 3H8OA 1RUE3 1ND2A 4HZFA 4NOTA 4OZXA 5H9QA 5C4WA 3SCGA 5CFDC 4TTGA 2Z5WA 1QIQA 3AC0A 1NX9A 4N43B 1GWLA 3HIFA 4I09A 3ZN6B 2PAMA 5F5CA 4AQTA 1BYHA 5FZ9A 1C57A 2D6LX 1PMHX 5AFBA 3Q8CA 4AGGA 2UY9A 3H3ZA 1ND3B 2D3RA 4XAAA 2GSYA 2CAVA 3OUIA 3WSOA 4AVCA 2BPA2 4QAWA 1DG6A 1OC1A 5SV8A 4XCAA 3J9SA 4QM9A 3WP4A 3JBG1 1ZA4A 4I2OA 1LGCA 1VPHA 4QPGA 2Q4SA 5BNPB 2MEV3 2VBBA 3IDBB 5L7OB 3GZAA 1IKPA 3LSEA 1YYNA 4RL7A 2VUAA 1IG0A 4QDQA 2L9LA 1AZDA 3AKRA 4Q1RA 2RM22 5CISA 4XYXA 2QKDA 3OBTA 3LDKA 1JZ4A 3PIJA 5T50A 3KM5A 4L2NA 2RE9A 3M3CA 3O0VA 2B5HA 2B9UA 3BOWA 4LR4A 2CSGA 4XC9A 3AMMA 2W47A 1NXD1 4KI5M 5T3NA 2EXJA 5A3NA 1CX4A 3NNLA 1VBB3 3H7YA 4FPCA 4AAPA 2W46A 4XXAA 2HWF2 4I3PA 4UFIA 1XOYA 3ACHA 3NV3A 2ZACA 1HJFA 3J7LA 5J09A 2JD9A 5G05L 2WFF2 5FPVA 1I3HA 1KD7A 2EAKA 2VOKA 3KF3A 2WZR3 3VKNA 4CDQA 5L7OC 3H9AA 3F95A 1GQGA 1UF2C 4CU6A 4OHYA 1NA1C 4OFGA 1UOFA 3DXTA 4Z07A 3U14A 2BOIA 3ZKUA 3VBOC 3ZSKA 1K5JA 1XU2A 2P3KA 1NYWA 3O14A 5F32A 2OA2A 4D0QA 5F6KA 2HWB1 4P5HA 1ULPA 1PX3A 4L92A 4PQQA 1CN1A 2DUOA 4WBBA 3EXUA 4WVMA 5E6HA 2HBUA 3WX5A 2DVAA 3AVRA 4MUVA 3S30A 4XF0A 5E8AA 3TWIA 1ALYA 4UW6A 3UL2A 4A45A 4B4QA 4MGTA 4IEUA 1QJX3 4I3GA 3UJQA 4FAHA 4HETA 1REFA 2VCAA 2ZKNA 2MPFA 3LPGA 2ZX2A 5CA6A 1BQPA 4CDUB 3OBAA 5C3PA 3K2OA 4FOQA 4FSJA 4JTNA 4BH9A 1SDDB 2Q1MA 5EJ1B 3T4HB 4BQ2A 1QNWA 1CGPA 2IZWA 3ZXFA 5CFCC 2R063 1NY72 4FTBA 3HJRA 1A3KA 5FXXA 4XBNA 2VOVA 3CU7A 3TN92 1JOPA 2KR2A 4AI0A 2OPKA 3JD71 5H9SA 2UYBA 2HWE2 2GU9A 2A3WA 4Y4YA 2JDMA 5A3OA 3BOPA 4ZKTB 5J96B 5FO9B 5BNNC 4Q4Y1 1LKNA 4XFCA 2VTXJ 5H9PA 3RZHA 4WM7B 1HJGA 2HH9A 3R4SA 2XJTA 4QPGC 2A6YA 3OSDA 1O3TA 3ZIWA 4Q8LA 3ZVXA 2QVSB 4QKNA 1O4ZA 1VMFA 1LGNA 1XYNA 2VMDA 4LBNA 1D4M1 1XNTA 2Y33A 1M4WA 3IWZA 3M1HA 1OFSA 5FZ4A 3OB8A 5EWSA 2IXLA 3MW3A 4YRDA 2IC1A 2C5DA 2WA4A 3IDCB 1DQ0A 1JUIA 3ABZA 3OGRA 3J26N 1ODMA 1MQTB 4GH4A 3MLLA 5FUIA 1FYUA 3B5LB 1YJLA 3FLPA 4XQ4A 3MFCA 5DPNA 3CF6E 5FYBA 5T5OA 2CV6A 4NRQA 2VBPA 1JMUB 3LB9A 3SNMA 2NMNA 4YVSB 1KJLA 3AP6A 1GYKA 1QOTA 3EMRA 4YZ5A 3F2ZA 3VBSC 2XBO2 3WHUA 4RN5A 4YW1A 4BJ0A 4XF9A 2PQQA 3UJOA 2Y34A 1QHDA 4BPZA 1H0BA 2JIGA 3NNJA 5C4WB 1LOEA 5T52A 4JDMA 4ZS2A 4NRMA 3PU3A 1F9KA 3LZZA 4OMDA 3B69A 4N53C 1BBT2 1MVQA 3KSCA 1CD3G 2WDBA 4GMP1 4RA0A 4WVZA 1IS5A 5GALA 4TYSA 2R073 2P2KA 1IKQA 2GN7A 4KGQA 4NR1A 1UPSA 4BQWA 1DQ5A 4OHXA 4HK9A 4ZU4A 3QLQA 4X8PA 5FYVA 5DUUA 4AWDA 2R061 1U5YA 4CRQA 4HKLA 4G3YC 5KHIA 5L36A 1TEIA 4C1WA 4CCCA 1OH3A 2QQJA 5BNPC 1MZ6A 4R9AA 4QPGB 5FOBB 3MF9A 2PHXA 1RMU2 3P3PA 3PUQA 2XR4A 4CPBD 1PO23 2LS6A 2ETEA 3U07A 2JKBA 4AQ6A 5L7OA 2XVLA 1RUD3 4KWKA 4RS5A 3UETA 4N90A 2ZGPA 1DF0A 3V56A 1WCSA 3WQ7A 2OQ7A 1JZ7A 1XBFA 4IV3C 1AJKA 1FOD3 1WCDJ 2CY6A 2WL1A 3J8F3 1I5PA 3FMGA 1OVSA 1XSQA 3LDRA 1VBA2 3OEAA 4P9JA 3ZKYA 4OHVA 2YBPA 5DUXA 2Y0IA 4PF5A 5CKMA 4XUPA 4QQPA 1RYYA 4M0HA 1W8WA 2A71A 2DCTA 4BQ5A 1RUH1 1SHWB 3D0SA 4BU2A 1YO8A 2XLAA 2X09A 4ZU5A 3KF5A 5FYHA 2C1FA 2YUEA 1NLSA 4PI2A 4K6BA 3Q8BA 1VRBA 3GZEA 5EIYB 2VZVA 3SITA 3KD4A 3FUQA 4AVSA 4AYUA 1SQ4A 1UIKA 2WNVC 1X8EA 3ZFGB 3KV4A 1NG0A 2GMEA 3IPVB 3ZN5A 2YB7A 3MV01 2P3IA 2EXIA 2W92A 4YVWC 1UOBA 3DECA 3FN9A 3ZSJA 3ZMNA 4SBVA 3A23A 4QPIB 4X8NA 2Y6JA 5FLJA 5LA2A 5C3SA 4YG0A 3WP6A 4RFT0 3VBFB 1S0DA 3K3NA 1G9FA 5EFUA 3WDWA 2QQMA 3AFKA 2WC2A 2R0HA 4FPJA 2XBO3 1A8MA 4P02B 1OSGA 4FPKA 5EYXA 2VCCA 1W8OA 4LE4A 1COV2 2O14A 2W0XA 3D6EA 4ASMB 5DZFA 1E5HA 2WNUA 3POEA 1W0PA 4L8QA 3A4UA 4JVAA 3WQBA 3J7MA 4ES9A 1OQDA 3S5QA 5E88A 3OGGA 1FPN3 1IQAA 2DU1A 1CZTA 3IKWA 4U36A 2JG9C 2VG9A 4LMFA 5F3GA 2WS92 4BLIA 1OPOA 2G1MA 5LASA 4LK7A 5LRSA 2XHKA 1WW7A 5HXMA 4FOYA 3BU0A 1OPMA 4FPEA 2GALA 4I0WB 1RMU3 1R082 3BU7A 4FXGB 5KXEA 1IS3A 3FBMA 1FMD3 2NPIA 2PHLA 4Q4V2 1QQP3 2WNVA 4XILA 4OULA 3VKLA 1PK6A 3QCWA 3PVEA 1G9AA 4EE2A 5C8CA 3CLPA 3WZ1A 4NIDA 1YFUA 3C7OA 4JCKA 4CUAA 3LE0A 4QHZA 1OMIA 1RUI2 4JAAA 1W6PB 3WT3A 5T5LA 5KHJA 4PCRA 1W90A 3RNSA 3U4SA 3BKZA 1UOGA 1PO13 1FV2A 5F5IA 4OQ9A 1CPMA 5T5PA 3BTYA 2WSUA 5LK5A 1FI2A 5FZCA 2WQ8A 2W87A 1EV11 1D7PM 2VTFA 3J7NA 3E6BA 4QX1A 1G8WA 4JDNA 3KT7A 4R9CA 1ZBA3 2A6WA 1IS4A 2C4XA 2MHFA 4KG0A 4CCLA 3RZJA 4E8CA 3I49A 4Q29A 3MW4A 5FY5A 4KGGA 2J1AA 1CONA 1YQ6A 3HNYM 2WAAA 3WF1A 5IVJA 5L9BA 2JXAA 5IK4A 2P34A 5BV6A 2E33A 3E97A 3WG1A 3JD73 3ZFGC 4N43C 4XFFA 3OG2A 4H7MA 3URFA 3G6JB 2BTVC 4Q27A 2FCUA 3B9CA 3WDUA 4CDWB 4IE5A 4BMBA 3HOBA 3I59B 5I91A 4OHWA 1J3RA 1TVGA 3WUDA 3NNGA 5GZCA 5C3QA 2DVFA 1RTVA 1IS6A 3ZYFA 4H2AA 1OKQA 2K0GA 2PHUA 4AEDC 3N4MA 4YG6A 4GALA 4MO3M 4N8MA 5DXDA 4DIQA 2PHWA 2YMZA 3U4XA 3MIGA 4TWTA 3KWVA 5A33B 1DGWX 5CZKA 3WINE 4AK3A 4CU9A 1TZOA 3UGFA 1R1A2 3ZSEA 1JZ2A 3VZMA 4CTEA 1SACA 1YQ8A 2C26A 1UXXX 1ZNPA 3DPRC 1US3A 4LBJA 1D0GA 4RQPA 2J1SA 3LGRA 4E4ZA 1CAXA 3GALA 3NW4A 3CIHA 5I93A 3E6CC 2B7YA 4QKDA 1MS9A 5FP8A 2WINB 4QGNA 1UU5A 4DINB 2R062 3WP3A 4G4FA 4AVTA 4LXLA 5L9RA 5FV3A 4JDOA 2JDKA 4JGZC 1CJDA 3RVHA 5A6YA 4E4HA 3RI9A 1WLDA 4CE8A 3M2MA 1DYPA 2VJXA 4XUNA 1W99A 5FFOC 1RUNA 1OT5A 1VALA 3NMBA 3IM0A 5AVAA 1R1A1 3WNLA 5FZ0A 3GZTB 2RG4A 5IUQA 1MS1A 1YC61 3DYOA 3FHIB 3MW2A 4NVPA 3W58A 4AXOA 5K8SA 1DQ2A 1A8DA 3SCHA 3UNPA 3UKTA 1GQHA 5IW0A 1W0NA 3K48A 3AP4A 1WBLA 3MDPA 1BBT1 1UY2A 2PFWA 1D4VB 3MLJA 3DPRB 2RJLA 5FPBA 1KXGA 4A6OA 3HPNA 1UYYA 5M0TA 4NHXA 1GZ9A 3NV2A 4CSWA 1OUXA 4WV8A 2YC4A 1GZCA 1UQXA 4FO9A 4R8HA 4A4AA 1QQP2 2ZAAA 1UIJA 3CZJA 5F39A 1XNDA 5C9AB 3AKPA 1AL22 2D5HA 2Y6KA 3H1MA 2XMLA 1CVNA 5DAXA 3N9OA 2GH8A 2WNUB 5BY5A 4MGZE 1O91A 4O9GA 1VAMA 3ILRA 5L9VA 2EIEA 2ZMNA 4HANA 1QDCA 1X7NA 1HV0A 4MLOA 4CUGA 1QJY2 3OPWA 4QHOA 3MICA 3WP5A 5ANNA 3I2DA 1RUJ3 4A42A 1DDLA 2RS31 4P9GA 5FZDA 4K40A 3VD5A 2E7AA 1HDKA 2BOJA 3V0BB 1X82A 4C0BA 1TG7A 2XJUA 4IEXA 4E2SA 3W5MA 1PO22 3BGAA 4FFIA 4XE9A 2EXHA 1BBT3 3LA2A 4EN6B 4GIQA 5JOXA 1SFYA 3VDAA 4ZXEA 4YZ3A 3JUUA 1RUI1 3SEEA 3ZLIA 3CO2A 2BFUL 2WYSA 5HCAA 4XQDA 1AXYA 1L7RA 2HWE1 2WIIB 3T2TA 3OY8B 1PK6B 1C8M1 1XNBA 2EAAA 2TNFA 1GOHA 1SBDA 2Y6GA 4DY5A 1PGSA 2TUNA 3VD3A 1ZYBA 3UK9A 3THTA 2QQWA 3KHCA 3M3OA 1JODA 4XJ8A 4UOJA 5I0DA 4BMEA 1PGL2 1Q43A 1E5SA 2MEV1 1H8VA 1MS4A 2VD7A 5ERLA 5FPLA 1XB9A 1Q8PA 3CJIB 1BK1A 4FVVA 5FJHA 3NO8A 1ENSA 1RUF2 3ZOIA 4DXZA 1W2OA 2FMDA 3WG4A 2B39A 2RJKA 1E5IA 1UZWA 4IESA 4UFJA 4NIIA 3WG3A 4XJ9A 3WNMA 4JGZB 5A7PA 3IAPA 3D4KA 3ZSMA 4NIGA 2AYHA 3AKQA 3ZN4A 3AP5A 1W2AX 3VBSB 3BIEA 2C0ZA 4KU7A 1PIV1 1EAH2 2LUWA 3B7MA 1TNRA 4GH4C 2X05A 4Y24A 1HN1A 1XXNA 3AMPA 3P3NA 1ZZ8A 3H8UA 3I3EA 4YVWB 3KVAA 5T54A 3VD7A 3O1VA 4LTAA 2JX9A 1GWKA 3VKFC 2LROA 2DVGA 2WQ4A 1L3JA 1C1LA 3C7HA 4IV1A 3THCA 4AEDB 3WNKA 1VBC3 1RVF2 2HYXA 3HEIA 2QQPA 3SMHA 4MXVA 1RUJ1 3I59A 2IFWA 4DUVA 3UV9A 3RYKA 1HQWA 1CAVB 3WW4A 4CEWA 2ZAHA 4QHBA 3WNNA 3VHRA 3S0MA 3DL3A 2BDRA 1J84A 2HWF1 3LOIA 4GMP0 2QQOA 1IPSA 1KDMA 1VRH3 2J1RA 3MPPG 4HN0A 4JC1A 1UD1A 5A7QA 3I2FA 3BI3A 4FP2A 3I3BA 1W6OA 3M70A 4FFHA 4XUQA 5FZAA 1K5MB 3C8XA 5KWRA 1QXPA 4BQXA 3PTRB 4MYEA 2A5ZA 3ZFFC 5F6LB 5IATA 1G9DA 4CEYA 5FIXA 5JI7A 1LODA 3MV11 2ZMKA 1W8ZA 4BB3A 5A3TA 5JXGA 4IV3B 1RUH2 4UFLA 5FK7A 4CDXC 2TBVA 1LR5A 4IEWA 4AGRA 2A73B 1HRI1 2J1TA 2WO3A 1ULOA 1MQTC 3ENRA 3MHZA 2PQSA 3ZYBA 4GD4A 3H0OA 3VZOA 2YROA 3EHKA 1ZVFA 1PIV2 4BCUA 5B2GB 2NM1A 3RFRA 1WUVA 3JBG2 3WCRA 4L11A 4B7EA 4YVSC 5AFEA 1U12A 1VBD2 1KEXA 4UFKA 1PK6C 4DUXA 1P8JA 1OD3A 1TME3 4DQAA 1H4GA 4FXKB 2GAUA 2GMMA 4NPMA 3M8LA 2CWMA 1N1SA 1RUF1 2VQAA 2ZPXA 1NA1A 1WW4A 3MO4A 2RS52 4GWJA 4GA9A 2FDJA 1DQ6A 2OT7A 5DDJ3 3TYJA 4HPKB 3ZXGA 4XVHA 2PA7A 5DAPA 3TEWA 4RD7A 2AEZA 4J1XA 2YFZA 2ZOEB 2IXHA 3MZHA 2ILMA 4WM7A 4Q4X2 4N9IA 2QE3A 2YY1A 1PM4A 1UKRA 3WF4A 5A32B 4DO0A 1V6KA 1J3QA 3IAQA 5C9AC 2V72A 2X5IB 1OURA 4AOCA 2RJ2A 4MXWB 1YFXA 3ZIXA 4Z92B 2GP5A 1EAH3 3I8TA 1AXKA 2E26A 3APBA 4JHTA 3AK0A 4F8AA 5JSRA 1DP0A 1NUKA 2H6BA 2VXJA 1F31A 1PMIA 2ZX1A 4NO4A 2YZ4A 4WVWA 2DCJA 2DV9A 2ZXQA 2B46X 1PNFA 4JV4A 3ZR6A 1O4YA 5EXOA 2WABA 5I8SA 1ULEA 4LHKA 3FWEA 5J36A 1REDA 1XQNA 5C5TA 3JU9A 2CDPA 2LTNA 4Y1VA 4DEVA 1UNBA 1ND2B 5C3OA 4LUKA 5DABA 4CPBA 3UKNA 5DUWA 1PZ7A 2EF6A 2D6MA 4OLLA 3MUY1 4YVSA 3THDA 4KNCA 1MR5A 4AZZA 3PL0A 2VECA 2Y38A 3AP7A 1ODNA 2FCVA 4D6QA 1N3PA 1ND3A 1BMV2 2ZGMA 3LEMA 4COYA 3OY8A 5FZ7A 2ARXA 2O8OA 4RSUA 3S6PA 4X6RB 1NLRA 2HEYF 4Z82A 3WNOA 1W6QA 2DDUA 3CDZB 1AJOA 3TAYA 3FLTA 4NAMA 4AE2A 2DVBA 1WMDA 4X6QB 3GBGA 4DOUA 1JZ6A 5FZFA 2H0BA 3GM8A 3EO6A 1RVF1 2BWAA 3RI8A 2H0VA 2W95A 5FYIA 1ZBA2 3ZFFB 4QQHA 4XABA 4W8JA 1DIWA 3NSTA 2ZHKA 3RZKA 4XF3A 1AHSA 1RC6A 4LBLA 4QM8A 2ORXA 5FY0A 2JDAA 3NL1A 5FXWA 3UKVA 3WNPA 2NP0A 2CU5A 3PHMA 4IEVA 4AFAA 3S7EA 3VBHC 1UY3A 2O1QA 4CU8A 1PVXA 2JDPA 5DAQA 2A3YA 2RS51 2CGPA 1CZSA 4AVAA 2XONA 3IZOA 2CGOA 4K3UA 4N7IA 1V70A 1R092 1WWYA 4AEDA 3PTYA 2OW4A 3WF0A 1UN1A 1IOAA 4IUGA 1BVVA 3ZPOA 1V6MA 3EYPA 1WMEA 2YGLA 3LQCA 4CVUA 1U5XA 1VE0A 1YQCA 1O3QA 1A34A 2CTVA 4HONA 1ND2C 2LALA 2RR11 1FOD2 1CJPA 3IMNA 2NQYA 1L7LA 2XWJB 4XUOA 3ASIA 1UOJA 1MEC1 2VZSA 2FCTA 1RUE1 2LW8A 3OPTA 4A44A 1CR7A 2OVUA 5B4XA 5B4NA 1PO21 1GNYA 2Y8KA 2RS33 4KBZA 2I2SA 1CIYA 1D4M3 1RL3A 2WT0A 3EB7A 1NKGA 2OS2A 4GKYA 4CP9A 4DEQA 4EN9B 5D8AC 4IV3A 4TXWA 3GXUA 2XL9A 4IDZA 4PI0A 3OF1A 2PXJA 4BHPA 1SZBA 1TME1 4KWLA 3C7GA 4I0AA 3H8XA 3A0KA 2Z79A 3N9PA 4MHRA 4WM8C 1W8TA 3I2OA 2BGOA 4BWOA 3ZDSA 1O3SA 2Z69A 2JDHA 1AR82 1RUC3 1N1TA 4QX3A 1IQDC 2ZGKA 2HWD3 4C8DA 1DYOA 1REEA 5FJKA 4OUSA 5A3WA 4XXPA 3VDDC 1S0BA 3BALA 3ORJA 4HOOA 5D21A 1LRHA 2XKOA 3N9MA 5ACA3 1LULA 2CWSA 1STMA 4META 3CEWA 1R083 3VZKA 5DG1A 4XJAA 3VKOA 2ZKLA 3ATGA 4LHLA 2ZGOA 3O0XA 5IVYA 4Q4V3 5HBAA 3DV8A 1SLLA 4JX0A 4Q26A 2VNRA 3ZMOA 1JN2P 2E9QA 3KLSA 3SISA 1IG3A 2R6QA 2Q8OA 1LHWA 1UZVA 3SKJE 3D0JA 3IIIA 1MS0A 4BDVB 5JDBA 3VD9A 3NVCA 4Q0VA 1YFYA 4E2QA 3RZZA 5FO8B 2RDSA 2JG8A 1ZRFA 3LOBA 2DURA 2RDRA 3DYMA 5ABJC 5A7OA 5GZGA 4KBBA 4R9DA 3M3IA 3ACIA 1YI9A 2IXCA 1W9YA 1HN0A 3KV6A 3O1OA 1PO11 4IE0A 3QACA 1QOOA 4MGIE 1PZ8A 4XW3A 1SLIA 4RGAA 4UI9L 1AR92 1X36A 3AZXA 3ZYGA 2EIDA 4EQVA 2CYFA 1XYOA 4LUMA 1VBD1 3POIA 3MF6A 1FMD2 1W6PA 3NRUA 1TQ5A 1W8FA 3POBA 3T0AA 2E51A 2P3JA 3OBRA 4W6XA 3T09A 3I97A 4DY3A 1C8M3 2DYCA 1NCQA 4UF0A 4JQRA 4JZRA 2HYKA 4JTOA 2JDNA 4LKSA 1C3HA 1GP6A 1VRH1 3RYRA 1RUI3 3PVOA 1IPJA 4PBOA 1QJU1 3RDIA 4IGOA 1LCLA 3VL8A 4YLZA 2KA3A 2Q0AA 4ISQA 4DFSA 2XVGA 2BRTA 1DGWA 2WN3A 3E5XA 2DU0A 1UU4A 2WZR2 1SCRA 3UGHA 2R30A 4UBHA 3RRDA 4I30A 4D6SA 4EV0A 4Q4W2 1FATA 1ZBE1 3POFA 1RUC1 1UX6A 4P9YA 2AR6A 3EJKA 1XNAA 2Q30A 4V2VA 2ZX3A 1AL21 5K9YA 2VMEA 3HWJA 2GC1A 1CAWA 1HB3A 2NMOA 1QQP1 1UYZA 1AYN3 4MOAA 3OOXA 1HQNA 4QGMA 1AYM3 3PDQA 4XFAA 3I2IA 4QDRA 4YM2A 5FMCA 4LQRA 1Z78A 2HWD2 4MZUA 1W9FA 4Q4W1 4DXSA 4OUEA 1EV13 2BWCA 2MNGA 1QMJA 3BPSA 4GB32 4KU8A 4XHBA 2Q8EA 3ZM8A 3VDBA 2JDYA 1AR71 3LD8A 3OD0A 4C91A 2F6BA 4LOSA 4OI2A 4MVTA 1JYVA 1VBC2 5FZ6A 4AG4A 1XPWA 2DTWA 2EXKA 2VZRA 3GCWA 2ORZA 3R4DB 4QPWA 1OF3A 4MG2A 2N7GA 2XGXA 3LIHA 4P9LA 3JBG3 5A3LA 4LBQB 4ZS3A 2R072 3S57A 1GFF2 3KMHA 5LBBA 1UY1A 4CA9A 4QB6A 2GNBA 2QBXA 2AREA 2UWCA 3B3QE 5FLHA 1ZREA 1R1A3 2QQLA 1DZQA 1LHNA 2WLQA 1Q8QA 1PGW2 1AR62 3PVNA 1AX1A 2PAEA 3E6DA 5FP3A 4Y1YA 3ZR5A 3USUA 2ZGTA 5JXIA 4JKKA 5ANQA 2XQRA 4CUBA 4Q4W3 4FT8A 3T2OA 3OYWA 4ZY9A 5KXBA 1GP5A 1T6BX 1MEC3 2VGDA 1AR93 3VBFA 2OPWA 3P5BA 4ONUA 5FY1A 2WS91 5FMOL 3SH4A 1WLTA 1EUTA 4OUMA 3FHAA 1JU3A 4ZZ5A 2YU1A 3GZUC 4K1YA 5EJZB 1KS4A 1VR3A 4IXLA 1YQ5A 1CWPA 3VDDB 2P5BA 1S0JA 2YYOA 4ZXKA 4QB1A 1ZBE3 2HWC2 2XLGA 3JB4C 2RHPA 3RPQA 2O0OA 5FZLA 3I7DA 2H6CA 4XTMA 5LRRA 4QXHA 2YBSA 5FQ0B 1XYPA 5AC93 1WA6X 2R042 5CKNA 3RWNA 1WMXA 1OOPB 2ARAA 3PMEA 1FXZA 1RHI1 3BN6A 4QU1A 4S2FA 2PHFA 1RGSA 5FZHA 1PVC1 2I07B 1TE1B 3A22A 3JXSA 4AEJA 3DF0A 1ASJ1 3HVDA 1ASJ2 4EWAA 3TEYA 2RS13 4R4ZA 1J58A 2D3SA 3DN7A 1AVBA 3LKJA 4BQYA 2JKXA 1X9TA 1RHI2 4CXWA 4QQOA 2WO7A 1GP4A 5FXVA 2D3PA 4NHKA 5LY2A 1W04A 2A6VA 2PHRA 5LZ6A 2E7QA 2KD7A 1UZYA 3V64A 5CFDA 4ATEA 1UMHA 1HRV2 5HXVA 2UU8A 1BJQA 4WM8A 4K7JA 1S2KA 1BHGA 3M3QA 2W91A 4Y1UA 4BXSV 5C8CB 4LO7A 4XBQA 3WW3A 1AUYA 1Q3EA 3QOPA 2XVKA 3MYXA 2HEVF 1HV1A 1VBE2 1B35A 3IMMA 3MI8A 4NE9A 5KHGA 1GOFA 4B8EA 4IE7A 2VPVA 1RUE2 2AGSA 2W2IA 1U5IA 2ZZJA 3FBYA 1RJ7A 2R041 1COV3 1W03A 5J48A 4A7KA 2OX0A 2QQKA 3VHNA 5LY1A 4ISRA 5AC91 2X10A 3J8F1 4IEPA 2EICA 4ES8A 1XU1A 4E8DA 5HCHA 2ZEWA 5FCCA 1JTZX 3OUHA 5C6CA 4UW5A 1DQ1A 1S0FA 3UGGA 1N3OA 4GJYA 3HQUA 2Y0OA 3IBMA 5BNPA 4KH9A 3K4AA 3DUIA 4LBOA 1CZVA 4LPLA 5FKCA 5C7GA 2XQXA 2YPDA 3M3EA 1N47A 5BNQA 4LNVA 1W6NB 4KMQA 1NY71 4HVOA 2P6HA 2D7FA 3SC7X 3SLIA 4AHZA 2Y64A 2DFCA 4HMZA 4YW4A 4R9BA 4NAOA 2RMU1 1W05A 4QPIC 2GNMA 2JECA 1ZRCA 4CDWA 1Z7S1 2BBAA 2DFBA 4HSJA 1CQ9A 3ZX7A 3G7DA 5JZGB 1RHI3 3GJAA 3LEKA 4XMIA 3AB0A 3OGJA 5FP4A 2D44A 1NE4A 4JGYB 4IEZA 4CUCA 4JKMA 1X8MA 3C7EA 1WW5A 1ACCA 1ZA7A 4ZPIA 1C28A 1H1MA 3JB8A 4B7KA 1N1VA 1SLBA 2EALA 1O59A 5CBLA 5A33A 4HBNA 4B29A 5JR2A 3VZLA 3ZYRA 1J59A 2QNKA 1SBEA 3SQOA 3VV1A 2DCYA 4M4PA 2XLFA 4XIKA 5FZGA 1F5JA 1CAVA 4CEWB 3TEZA 2VMCA 1Q56A 5FK8A 2X53S 3KCYA 4QXCA 5JPMB 4OI4A 3JQWA 2XUEA 3KGZA 4LOTA 1ULGA 4AI2A 2DBIA 1NCRB 1OKOA 1QOSA 3I2GA 4GB31 3WXPA 1B09A 1BCXA 1W6OB 4LK6A 4IGQA 1F4HA 2JG9B 1BZWA 3ECQA 2DWRA 3IN9A 1OBNA 2E63A 1RUC2 1JUHA 3MUZ1 4M4RA 4RHV2 5FZ3A 4NWVA 4DXTA 3V65A 3T3YA 1ZBE2 2HWC3 3ACGA 5A7SA 2RR13 2WZR1 2XPJA 1JZ5A 4N53A 4CDUA 3W59A 2ZEZA 1ST8A 4PJYA 4BOWA 2XJVA 2WS93 2R043 4CDWC 4XZUG 1H9PA 4P08A 2UY8A 3N7KA 4RR3B 5EHDA 2WZPP 5C71A 4RGKA 3O1MA 4ASLA 4OZOA 1VLNA 1RUH3 1RXFA 4LA2A 4NMIA 5CVRA 3LEIA 3PIGA 3A7QA 3PJYA 4L0PA 5GLZA 1YUDA 2YC2A 3HMYA 2ZGUA 1AR73 2E32A 4LORA 5A7WA 4XCBA 4LT5A 3BVCA 1HQLA 2DCZA 1MS3A 2D6KA 4AL9A 1WCKA 3SEPA 3NJYA 1H2MA 2AC1A 2ZTNA 4XBLA 1YXWA 2FHRA 5D2AA 4AW7A 3TEXA 3MBWA 3C3VA 5C9AA 1XNKA 5DZEA 5J3UA 2HLEA 3LIGA 5FY9A 3ZFEC 1VBD3 4OVEA 1H6YA 2NZ9A 3O0WA 4A41A 4AEMA 1Q8SA 1UO9A 4YZ2A 3E5QA 3W20A 4Q1PA 2VH9A 5GLTA 2ZZQA 3U0ZA 2JE8A 2VQTA 4Y5Z0 1K5MC 2VNVA 2ZJCA 4PLNA 4XF1A 5BPXA 4D69A 5DN2A 5H9RA 5A3UA 3MIHA 2GNTA 4XMAA 5K0UA 1C5HA 1OXCA 2ES3A 3ZYPA 1GR3A 3VBOA 1QJU3 4WZFA 4YWAA 1PIV3 4NUBA 1JYNA 3ZSLA 1G9CA 2FDKA 1A78A 4Y33A 4CZSA 5KXCA 4Y3OA 1JOBA 4NIHA 4EWDA 5C33A 5K7PA 1JBCA 1H6XA 1APNA 1QH6A 1AYN2 2FQPA 2OZ6A 3AP9A 4BISA 1PHMA 2PLV1 4XEZA 3I3MA 3UYJA 4CCDA 5JVVA 1S0CA 5F1RA 4HK8A 5LBFA 4TN7A 4YW3A 2VC9A 1YRZA 1U0AA 2FDHA 1KS5A 1PVC2 1SLTA 4AEKA 2A6ZA 2J1UA 5FZOB 4OHZA 1BVP1 2ZMLA 1B35B 2VOXA 1NLQA 5IK5A 2RVAA 2VZOA 4QX7A 4EN8B 4XOGA 1S0EA 4BM8A 2PMWB 2WZEA 4FI9A 4HXCA 2Q1FA 4YSFA 2J22A 5IT6A 4CCOA 2Y6FA 5IVEA 3GBWA 5EPAA 3WV6A 2HKXA 4GJZA 4QXBA 4RQPC 4XUTA 4FBFA 1O8SA 2CDOA 3IDAA 5FYTA 5C3RA 2HEWF 4A7ZA 1NZIA 1K12A 1ZZCA 1FNYA 3NWKA 4GB33 4LLFA 2NLRA 4MSVA 5FYZA 3FJSA 3PURA 2XL7A 4I0BA 2X5IC 3DXUA 3VN4A 1W6MA 3CQOA 1QU0A 3BYWA 3OCPA 3AYCA 4YVWA 1O5LA 2GZWA 5E16A 4D7YA 4RS5B 3MPBA 4OYUA 2QZ2A 3GYDA 4D6RA 1JZ3A 1AXZA 2O8QA 1VMJA 3FZ3A 1I6XA 1HXS1 1MEC2 3BTAA 3VBUC 2DF7A 4I01A 2VUDA 3OD4A 3AKTA 2V5YA 3HBZA 4K9SA 3P6BA 1AL23 1OQEA 4D8MA 1DGRA 3ES1A 2VVDA 3TN91 1I9RA 2R49A 2K46A 2PTMA 2WWJA 1JYCA 3NV4A 2VZ3A 3MIDA 4FQ4A 5GLWA 4XFBA 4DB5A 1EPZA 1H8TB 2ZEYA 1AL0G 1YCIA 4NWWA 3KT4A 1RMU1 1K5MA 4IETA 1AR61 2W9XA 4Z2WA 4QQLA 1GMMA 2WT2A 2RDQA 5J37A 2GDFA 3N9NA 4QMAA 2RM23 1QF3A 1XNCA 3ZFGA 3HQRA 3NJZA 4LO5B 3IPVA 1WLWA 1G86A 1IPKA 2PAKA 4Y26A 2HWB2 4CDXA 3WLUA 4MGKE 2PLV3 5K4LA 4XETA 3T30A 5FPUA 1RINA 3GBFA 4K21A 5IK7A 3CZUA 4ASKA 3DGTA 4NN0A 3R0RA 4QPIA 3E5UA 4W65A 4DMIA 3IDEA 2XH6A 3J7HA 5LEKA 4AF9A 3QD6A 3VHOA 1DHKB 4Y5TA 5KXDA 4TSVA 5FMDA 4KWJA 5IFPA 1VBE3 3OGVA 4RR3C 2D40A 2ADDA 3PU8A 4A6SA 4UBGA 3ON7A 1KDKA 1UXZA 3KHBA 3GGLA 4CDUC 5CAZA 4KQ7A 1UL9A 4UW3A 5T5JA 1JS9A 3CNAA 5FMBA 4HPKA 2W1QA 2OUJA 3A21A 4E27A 3ETPA 2ARBA 1BKZA 2VNGA 3LFMA 4URAA 4FFFA 3AM2A 1YLLA 3AXEA 1Y7BA 2ID4A 3NKGA 2DTYA 5JOWA 3WUCA 1MQTA 3L9JT 4GH4B 3WDXA 3BTZA 3JCIA 2JDZA 1Y4WA 2XJPA 2J7MA 2JIJA 5FREA 1RITA 5GZDA 5FUNA 1D4M2 1WLCA 1I1EA 4C90A 3NNMA 5FWJA 4HSLA 1QJZA 5BNOC 3LF7A 4YW7A 3POWA 4R4XA 2ZBJA 3AYAA 3BODA 1V6JA 3VBUA 2JG8B 4D7TA 1UX7A 2A1XA 2BV4A 4E2GA 1OFNA 4DPNA 4GZ9A 5K0UB 2P4EA 2IVJA 4SLIA 1K3IA 3K46A 4K1ZA 1V9U1 1XJAA 4L97A 4AFCA 3JD72 4MV2A 4V1PA 1QGLA 1X9PA 3LAGA 5FAXA 5GZEA 4YFZA 5JZGC 1NE6A 4XDQA 1RUD1 3WOGA 3PLQA 3FE5A 3KQ4B 4NROA 4O65A 3AL6A 4IEQA 1POV3 1JI6A 1DGLA 2BW8A 4M3CA 4HG6B 1H2NA 1RJ8A 2EVXA 5SV5A 2AEYA 5JLVA 5EQUA 1Y3TA 3ETQA 3I3DA 5FY4A 4Z8BA 3R6SA 3H7JA 4QKBA 2GNDA 3WF3A 5FTTC 1NCQB 1ULCA 3GHNA 1SLCA 2UWBA 1T2XA 4BZ4A 1MS8A 5G04L 4EROA 1CX1A 4BK5A 4FQZA 2ZGRA 5F8PA 1LJ7A 3LA7A 3NQHA 5BUVA 1WKYA 1AR81 1UYXA 2B9VA 1CIWA 4IEOA 4WVVA 5F5QA 5FO7B 4AAXA 5IK8A 1JYXA 2J42A 2JB4A 1UZ0A 3BPZA 4FFGA 4P9WA 2YXSA 4M01A 1H30A 2BZDA 2Q8DA 1H1IA 5F9TA 1O5UA 3I54A 1HRI2 5FPZA 2JENA 1XE8A 4MX3A 3WDVA 2OYZA 5F3EA 2YU2A 5A1FA 4MHUA 1SLAA 5F2WA 4FTSA 1IGOA 1NT0A 3DEMA 3VB9A 2QQIA 4OI0A 2HBTA 1CAWB 3K77A 2K2SA 5A70A 1FPN1 5FPXA 1W2TA 5FY8A 5FOJB 5DAWA 1Y9QA 2I45A 2VW2A 2E31A 5ABJB 3WY6A 5CG9A 3D5OA 3FC0A 3HQXA 5AVPA 3WQ0A 2RR12 4QX2A 4EWEA 1K45A 1W06A 2BU9A 3FX3A 3ELNA 2IUWA 4BE3A 3L2YA 5JIUA 2EA7A 3I4IA 3I3QA 1LEMA 3RZGA 3HN1A 4YGDA 1M06G 1H8TA 4YFWA 1LESA 2KM2A 2BJSA 1W28A 1VIWB 1GNZA 2WJSA 3V0AB 3T2PA 3WNXA 1TNFA 1MZEA 4JKLA 2P1BA 3CKHA 3LDBA 1WCUA 3U10A 3PJQA 4W6YA 4XZPA 1GUIA 1AYN1 3RQ0A 3N9QA 3RZLA 3PNAA 3M7AA 3RJRA 3U11A 1LEDA 5LK7B 3NAPC 4B1MA 5A6ZA 3N7JA 3N35A 2C9AA 3HD8B 5BNOB 2ADEA 3DPRA 5FYMA 1DYKA 1WZXA 2JJ6A 1C8M2 2W5FA 2WRAA 1C1FA 3W9AA 4CCMA 1DZTA 1R091 4TLGA 1DCSA 3OTFA 3OYWB 3U75A 4PLMA 4DZGA 1S2BA 4CEWC 1NOVA 1OLRA 2Y6HA 4LBQD 2Q5TA 2VNOA 1ASJ3 2MEV2 5DQ0A 1PGL1 1KQRA 2JDUA 4ORFA 1J3PA 3ES4A 1PVC3 1QEXA 4HL0A 4LBMA 5F2SA 3U37A 2D6OX 5LWBA 4COZA 2RMU3 4IV1C 4MADA 3SH3A 2D6PA 3ACFA 4FPGA 4YW6A 4ET7A 3POYA 2OZJA 4AFDA 2VULA 3MEPA 5TSWA 5A3PA 1BMV1 4O61A 1GANA 4JQTA 4FCAA 1BK0A 4XFIA 2A7AA 2YDEA 3MIEA 4QT6A 5D1IA 1ULDA 3HBKA 4OQ8A 1Q8OA 2Q8CA 4XDOA 1H4HA 4XJUA 4AHYA 3VBRA 1V6IA 5HCFA 2I74A 3THPA 2VVFA 2WNEA 3U1XA 2XJQA 3TNPB 4GKXA 2RS32 3EQEA 4GWNA 5IWFA 1UY4A 4Q5OA 5JXJA 1UU6A 4EZHA 1JOJA 1ZRRA 4DRRA 2WBKA 5ACA1 2FD8A 3ZN6A 1O4TA 2JG8C 5FZ8A 3ZXAC 2G9GA 3ZXJA 5C8CC 1GZWA 1JHNA 2BGPA 4DNYA 2VUJA 4AI1A 2V73A 5CFCA 1RXGA 2GP3A 1QJY1 1OLME 5GLUA 4H55A 4XIOA 4AVBA 5KC5A 1W8HA 1OHFA 2D97A 3K4DA 1UKGA 3AVSA 4Q0SA 4QKFA 3VBUB 4GMP3 3T08A 1JYIA 1ENQA 4YG3A 2FDFA 1UYPA 1WD4A 4NHMA 3KS7A 2Q1ZB 2J1VA 3ILNA 4LKEA 5F37A 2A75A 2R7EB 5CIRA 1SG3A 4TZDA 2D5FA 1W8UA 3DKWA 1HLCA 2R1DA 3LCPA 3TB0A 3ITQA 4Y20A 5J7MA 1FAYA 2W1UA 4UF0B 1Z0HA 3CJIA 4XACA 4HVRA 3NJVA 1KFXL 2VZPA 1W3VA 2ZGQA 5FYCA 3R05A 3WD5A 1ZRDA 2GC0A 1Z7S2 4KL1A 2XKPA 2BP6A 3D3AA 4M3CB 1YNAA 2HJIA 1OLQA 1I5ZA 2W68A 2JE7A 4LULA 4HKOA 2ZEXA 4Y22A 1UW8A 3O5SA 2A6XA 3MIBA 4FPLA 1NCQC 3T1LA 3GNEA 2HWB3 5FZ1A 5E89A 1CPNA 1KJRA 2ZABA 1TMF3 1S1AA 3I2KA 1B35C 3QBQA 4LKDA 4JRLA 4N9HA 4XTPA 1SCSA 5DZGA 1HXS2 2VZUA 2ET1A 1F35A 4FOVA 3HN3A 2QFEA 4G9SB 1MPXA 5JZGA 2B42B 1MZFA 2DCKA 2IFRA 5JOYA 1JZ8A 2QJVA 3K75B 1JW6A 2VXRA 2SLIA 4JGYA 4UWDA 1EPWA 2VW0A 4M3CE 1WD3A 3PUAA 4O9EA 4IE4A 4UAPA 2RV9A 4A2UA 3WVJA 1POV1 3KT1A 3ALQA 1RIRA 4QX0A 3CJIC 4XHXA 4GQ7A 3ZYIB 3GHMA 1LU1A 1ZZBA 2CGNA 4K8FA 4Q4X3 3RSJA 5A3MA 1AYM1 2PELA 1W9WA 4CEYB 3H3LA 1HRV1 5FZEA 4NHYA 5FR3A 2E7TA 2XJSA 1JH5A 3J8F2 4IQPA 5FZIA 1RUOA 3SHRA 4H3WA 4BA6A 3AYDA 2BNOA 1VMHA 3P1IA 3K3OA 1G7YA 2VAUA 4CCJA 2FZ2A 3O1UA 3ZXKA 4Q8KA 4HKWA 4ATFA 2XHNA 5FP7A 1Z7S3 5JSPA 4IE6A 2JG9A 2WSVA 2WO2A 1YIFA 3KV9A 5J1XA 3VZJA 2R32A 4PDWB 1FV3A 2AUYA 1LGBA 4AVVA 5I0SA 3LA3A 5GZFA 5GLVA 5FZBA 4XFGA 1RUG1 3RMYA 5CNAA 4Y1XA 4P14A 5HV0A 1FX5A 2VY0A 2PLV2 2JICA 2VOWA 3VGIA 2QQNA 3PUHA 2W94A 2BNMA 3CMGA 1EV12 1OF4A 3LPFA 4YM1A 3RYPA 5JUVA 3H50A 1RUJ2 3AZYA 3AMHA 4XF4A 2G4IA 3L2HA 4P5YA 2P37A 4ZONA 4EJRA 1QDOA 3VDCA 4Q4V1 5E1RA 3MFAA 3OBZA 5A7WB 4P9XA 1YQ2A 2C6SA 3O12A 5FQ0A 1AX0A 5C5UA 1R081 4GWMA 4Q2FA 4CP0A 1OOPA 5A32A 2NN8A 1EAH1 3LSDA 4D94A 1YFWA 2DBNA 2HWC1 2X5IA 4YZ1A 1TMF1 2VZTA 1LHVA 2ZX4A 3M4FA 4YM0A 1XC6A 5I8TA 2ET7A 4LE3A 4RYDA 3V0BA 1DBNA 3INAA 4QX5A 3RMXA 4PIYA 4N43A 5LB6A 4HT1T 5IYYA 4M3CF 1WW6A 1KRIA 2WQZC 1V6NA 3BUCA 4IL7A 3TRSB 2VQ0A 1QJX2 3O1RA 2EIGA 4QWNA 5C70A 5CFDB 5IFTA 2WR9A 1SDWA 1VAKA 3OPZA 1SMVA 2RS11 3T2QA 5JPNB 5DDJ1 3VBRB 1KFUL 4LBKA 4PT6A 5CKQA 1S2EA 1WMFA 3ZFEB 5DAVA 1LOFA 1KGYA 2D93A 1PNGA 1PZ9A 3VBOB 1LOCA 1OH4A 1F4AA 1VB4A 2WWSA 3N3HA 2ERFA 1PM7A 2GH2A 1C5IA 4FPYA 4LHSA 1HB2A 5JSOA 3VD4A 1GZWB 2K9ZA 1FNZA 3SKVA 4GWIA 3T4VA 1OD5A 5IVVA 3HT1A 4PF1A 3DYPA 4QU2A 5CFCB 5CG8A 2HWD1 2XDVA 4RHV1 4DRVA 3CL1A 2C24A 3ROUA 1WCQA 3X29B 5HV4A 4LO8A 4EYUA 1VAVA 1QJY3 1VBB2 2W08A 2BERA 4HN1A 4LJHA 1SEFA 1COV1 1EUUA 5EZWA 5CEHA 1HRI3 5IVBA 2FDGA 3WR0A 1V6LA 1NQJA 1SFNA 2WFPA 3BCWA 3DCQA 4NHLA 3RG0A 2WFF1 3UT0A 2AH2A 4ARXA 4PDWC 5K0UC 5FWEA 4UW4A 2ZA9A 3EBRA 2VMGA 1QXRA 5CYYA 3USSA 4P00B 5L19A 2JE9A 2W1SA 3OJBA 1HB1A 3AZVA 4MH0E 3VBHB 5APAA 4IV1B 3CBNA 1UZZA 4E4SA 2VU9A 4LIVA 5JI9A 1W2UA 2V4VA 4FPHA 4L99A 1W9SA 4XJZA 2PYTA 2XG3A 5FP9A 2QUOA 5T55A 4NIAA 1MS5A 4DUWA 1UMZA 3AJYA 4D7SA 5J98B 4LIUA 4YW2A 4V2WA 3WCSA 1J83A 3AYEA 1J1TA 4ITCA 3FUOA 1W6MB 3LEGA 3VUOA 1W2NA 2Y26A 1AR83 2EIBA 3FL7A 1H8TC 4IEYA 5A6XA 3A0NA 1FMD1 2WKKA 5I0UA 2WZ8A 3HR9A 5BNNA 2W1WA 4AHWA 1BEV3 1GWMA 1Q8VA 2A3XA 4B3NA 3KB5A 5F3CA 5FZMA 1FT9A 4KWUA 4XPVA 4XJWA 2ZHNA 4YYOA 4S2DA 5LATA 2CAUA 2IVIB 3J4UH 4AQ2A 2J1EA 1R093 2VMIA 3H1YA 5L73A 2RMU2 4FTEA 2RS12 3VHPA 4BQ3A 1LTEA 1QJFA 2F4LA 1NCRA 3CJXA 1OOPC 4CCEA 5C8WA 1RUG3 2QCSB 1G9BA 2W52A 2ZHLA 2PHTA 4O7XA 3VZNA 1RB8G 1QKQA 2VCMA 3VL9A 4QGLA 1URXA 5AC92 3LWCA 4IW3A 2JB8A 1C8NA 5FMOS 1JU4A 5KHHA 4YZ4A 5JCTA 1RVF3 1HW5A 1AX2A 1EY2A 1F5FA 1PO12 4UFHA 1VBE1 2Z2SB 4Z1VA 5C4WC 4INDA 4QPYA 4CDXB 4BIOA 4GULA 2WAOA 1LOGA 3Q8AA 5A6QA 1S4CA 2QDNA 2GMPA 1BXHA 1VP6A 2ATFA 3WQ1A 2G9ZA 4NPRA 4YNIA 2VVEA 2BBVA 2DVDA 3PMSA 4N7UA 5KHKA 4B1LA 4FP3A 5FZKA 5KC6A 4CXYA 1V9U3 3WW1A 4OCTA 3O1SA 1W8NA 3VKMA 4AHXA 3WG2A 4UYBA 1BEV2 3KV5A 3Q9OA 3POGA 1CESA 1SPPA 5A80A 1LNSA 1Y9GA 3AMQA 1POQA 2TEPA 2G9FA 3N7MA 4DS0A 5GKAC 3RWKX 4YPJA 1K42A 3BB6A 5I0TA 1DZRA 5LA9A 3AMNA 3D8CA 3O1TA 2CL2A 1DGRN 1BEV1 2VMHA 3B02A 4JHZA 3H42B 2YGMA 2XOMA 4H14A 3AZZA 1XSRA 2BVBA 4A7YA 1IHMA 1F8VA 3TNQA 1JYWA 5LEJA 3NAPB 2FBEA 1A6CA 5FY7A 1FOD1 3AXDA 1S55A 4XAEA 2ZGNA 5IJRA 1SBFA 2AACA 1GZTA 1QJEA 3AL5A 4BK4A 4CP2A 5JMOA 4AI3A 4F3JA 2BEOA 4YGBA 2XJRA 1XE0A 4Q0UA 4YW5A 2FZ1A 1Q5OA 5DDJ2 1ONAA 4CXXA 3NKTA 4JRAA 4OI1A 2OKXA 4COVA 3RJ2X 3ZXDA 1UMIA 1U5ZA 3KVBA 3ZFEA 2SBAA 5F3IA 3IB3A 2X29A 1W6QB 1E5RA 2X8KA 1ZX5A 1GNHA 5EYYA 4M00A 1H9WA 2XXZA 5FZOA 2AZ5A 3DKQA 1Y9MA 1YI7A 1VB2A 1LOFC 3RGBA 4BIFA 2VOTA 1WGPA 4LLOA 4PQ9A 4LA3A 3AZWA 4GAZA 2BGCA 2R071 2QTWB 1TMF2 2WNUC 5F5AA 4Y5SA 1ZM1A 1BLZA 4LEJA 3ZFFA 2BFUS 1YEWA 5DUVA 3KGLA 4P9IA 2GC2A 5A7NA 1O7FA 5F7UA 4J6GA 2BQPA 3T0DA 2BYVE 2YBKA 2V4AA 4DXRA 1PGW1 2W3JA 4Y4RA 4BYYA 2D6NA 1ND3C 5CU1A 3FFZA 1JHJA 3B01A 4MGYE 4C1XA 1YJKA 1G6NA 1POV0 1VBC1 1J1LA 3U78A 1ENRA 4XDPA 4A3XA 3ILFA 3VBHA 1MVEA 2G19A 4Y1ZA 3TBDA 2QQVA 1RUG2 2WT1A 2WYFA 4B4PA 3MLKA 4YGEA 4K8RB 2NYYA 4S2HA 5EJ3A 4EN0A 3S7IA 1W0OA 4RQPB 1CAXB 1QWRA 3GDBA 5I8YA 2R1BA 4QB2A 1N3QA 3SCFA 4F7ZA 4CU7A 4I02A 1VBA3 1H2KA 1HXS3 2GN3A 4HLTA 3Q8FA 4AI8A 4ZZ8A 2BUKA 2B45X 1OUSA 1W39A 2PHDA 5JWPA 1R1ZA 2QDRA 1V0AA 5BNNB 1T6GC 2BNNA 2XUMA 3BIWE 4QD2A 1LB2A 3W21A 5JR7B 5ABJA 4LBQA 3SH5A 1ULFA 3ACLA 3FHQA 3MIFA 4NPLA 1E57A 2VZQA 2JEMA 4E9KA 1VBB1 4MGQA 5FRAA 4PBPA 4CP9B 1AF9A 1DLLA 4LO6B 3LFIA 5EV7A 3T1MA 5DG2A 4D3WA 2E6VA 3NJXA 5JAXA 1US2A 2IXIA 4H7LA 5KBFA 4AGVA 3JZVA 2VR4A 1CAUB 1UWWA 5CADA 5FXZA 1V00A 4XURA 4U2AA 3BTXA 3I2JA 3V0AA 2HWF3 3GF6A 2RM21 3KQRA 1NXMA 1GOGA 5LBEA 4AQSA 3MGUA 3FFQA 5FPAA 5HCBA 4YARA 5HI0A 5A1AA 1QXJA 2FMYA 4XFHA 1OVPA 4HVQA 2WN2A 5FUPA 2IWGB 2IXJA 1NAEA 2P3YA 5JMCA 1C4RA 2UYAA 4W6WA 2GC3A 1VBA1 1GLHA 3KCXA 4QQ2A 5EP9A 4CP1A 4QXKA 5GJ6A 4YM3A 3ZXEA 4Q0QA 5BYNA 5BNOA 5FDBA 1QJX1 1X50A 4JGYC 2P17A 1ZZ6A 4KG8A 4URTA 5D8AB 5FLIA 3ZDVA 3HAGA 3TN93 2VUCA 3OEBA 5IVFA 1WBFA 2W39A 2HWE3 5FBZA 2WWUA 1N1YA 3H8RA 1AR91 5LW9A 1PMJX 3ZYJB 4W50A 4A3ZA 2YFUA 2IXKA 2WNVB 2P6CA 3ZO0B 3B9IA 2D43A 3VLBB 4WM7C 2OIIA 5FYSA 3ZXLA 2VE1A 4FPOB 1QH7A 3TOJA 2VM9A 4LO4B 2D98A 5ISLA 4K20A 1SPPB 2WNOA 4RS5C 3O1PA 3IIAA 4BQ1A 1X33A 2LRPA 4BXFA 4C0HA 5LBCA 1PX4A 1IZ3A 1DU3D 3VBRC 1GKBA 5JOZA 2ZX0A 3PUIA 4Q4Y3 4BQ4A 2WLPA 5HPOA 1OQ1A 3E1F1 3D82A 4IERA 1S0GA 5LCWL 4PIXA 3S5AA 3AFGA 2OQ6A 2Z42A 1F15A 3UESA 3N9LA 3PVBB 3NAPA 4WZCA 1TME2 4F83A 1ZRIA 3QH6A 3WHTA 4ZU7A 3QH7A 1O3RA 2XBO1 2ZS6B 4EZ4A 3K51A 1OLMA 4FPFA 2VQUA 5ACA2 1LHUA 1XE7A 1NCRC 1W3XA 4J25A 1NQDA 4LITA 4PHZA 5JXHA 4PLOA 2ZCWA 1LECA 1GBGA 4JGZA 4YGCA 3WDTA 3WF2A 1SFPA 2YPJA 1WA4A 5FBJA 1EYBA 4AR2A 3VBSA 1JXNA 4CEYC 3WW2A 1GSLA 1YHFA 1MACA 3H3UA 4PIZA 2YV8A 3SXWA 1LHOA 4Y20B 1AYM2 1W9TA 4GXLA 5IAXA 4L9BA 1W6NA 2VMFA 3HNMA 4RHV3 5IAVA 1LU2A 3R4UA 4CCKA 4Z2AA 5GM0A 2B4KA 1ZZ9A 4LHNA 1GU3A 2F4PA 2JD4A 1LAJA 2ARCA 2ZGLA 4AFBA 3FLRA 1GV9A 2YG0A 2WA3A 1DQ4A 4J1WA 3ST7A 4FAGA 5LA1A 3JQXA 4CDQB 5IVCA 4Y22B 5LA0A 1L7QA 3NNFA 2C9KA 1F2NA 4HFSA 2RS53 1LOAA 1MZ5A 3OGSA 4EN7B 2OXBA 2OUHA 2UWAA 2VBDA 4Q4Y2 4UFMA 3C7FA 2VW1A 4UXAA 1HX6A 2VO5A 1HKDA 1RUD2 4WVMB 4NRPA 3B93A 3KZ4C 5IHRA 3POSA 2DUQA 3I2HA 4UT5A 3CHXA 2AENA 1V9U2 3N36A 4COWA 3GCXA 2R0FA 2Z4FA 4S2GA 5BXXA 5DMYA 4BLJA 3Q8EA 1D0HA 2DUPA 1DLCA 4Q0PA 2WO1A 2XWBB 3NV1A 3AKSA 5A1LA 4QX8A 1ZBA1 4CYDA 1LOBA 1RUF3 3B00A 4XQWA
chains in the Genus database with same CATH topology
2EIEA 3I2KA 2QQKA 3W5NA 2VZUA 2X10A 2EICA 3HN3A 3WEZA 4A42A 1MPXA 1O8PA 4E8DA 2DCKA 2ZEWA 4ARYA 2Y6LA 1JZ8A 3K75B 3VD5A 3K4ZA 4MGSA 3K4AA 1TG7A 1CZVA 4LPLA 3W5MA 4QDSA 2VL4A 3BGAA 4UAPA 2RV9A 2XQXA 5C7GA 4KMQA 4QX0A 1R64A 3VDAA 4ZXEA 2VZ1A 3SEEA 2Y64A 2WYSA 1W9WA 1L7RA 2WUHA 2BBAA 3HNBM 2Y6GA 1GOHA 4W4ZA 2V5DA 3P1IA 3VD3A 1UY0A 3LEKA 1GQPA 4OMCA 4CUCA 4JKMA 4UOJA 5I0DA 2XHNA 3C7EA 2VCBA 3T0BA 2WO2A 5J1XA 1O59A 3WNMA 3IAPA 4M4PA 2VMCA 4TTGA 2QQNA 3PUHA 2W94A 3AC0A 3CMGA 3I2GA 1NX9A 1OF4A 3LPFA 2X05A 5JUVA 1HN1A 3I3EA 3VD7A 1PMHX 4P5YA 1F4HA 3ECQA 3C7HA 3THCA 3VDCA 3WNKA 3MUZ1 4M4RA 1YQ2A 4DXTA 2HYXA 3HEIA 3WSOA 4QAWA 3ACGA 4DUVA 1JZ5A 2ZEZA 2VZTA 4XZUG 3WNNA 4P08A 1XC6A 4RYDA 5C71A 1J84A 2QQOA 4OZOA 5IYYA 2J1RA 3I2FA 3LEIA 3I3BA 3A7QA 4L0PA 4XUQA 2YC2A 4QDQA 2L9LA 3C8XA 5C70A 5IFTA 2E32A 3T2QA 1JZ4A 3MV11 4PT6A 3SEPA 5JXGA 1KGYA 1OH4A 1F4AA 3MBWA 2J1TA 2WO3A 1ULOA 2W47A 4KI5M 4LHSA 2PQSA 2HLEA 3VD4A 2W46A 3SKVA 1H6YA 4GWIA 4A41A 3ACHA 4PF1A 3DYPA 2JE8A 2VQTA 2JD9A 5G05L 5DN2A 1WCQA 1KEXA 4CU6A 2BERA 4DUXA 1P8JA 1EUUA 1OD3A 5JR2A 4ARXA 1JYNA 4D0QA 3MO4A 1ULPA 1PX3A 4GWJA 5CYYA 4PQQA 4P00B 1H6XA 2W1SA 4A45A 4XVHA 2YFZA 2V4VA 1W9SA 2VCAA 4DUWA 2VC9A 3LPGA 3WF4A 3OBAA 3IAQA 1J83A 2V72A 1SDDB 3LEGA 5EJ1B 2J1UA 2RJ2A 2EIBA 3FL7A 2RVAA 2VZOA 2E26A 3HJRA 2WZEA 4FI9A 1DP0A 1NUKA 2J22A 2WZ8A 2W1WA 2DCJA 2ZXQA 4KWUA 4XUTA 2WABA 1O8SA 2CDOA 3IDAA 1K12A 2CDPA 2J1EA 4DEVA 3CQOA 2VMDA 3MUY1 1XNTA 3THDA 4OYUA 3OB8A 1JZ3A 3ABZA 3OGRA 1JU4A 3WNOA 2DDUA 3CDZB 5FUIA 3P6BA 4D8MA 1JZ6A 5DPNA 3GM8A 2WAOA 2VZ3A 2W95A 2ZEYA 4W8JA 2W9XA 1GMMA 3F2ZA 2ORXA 2JDAA 4RN5A 3WNPA 4BJ0A 1W8NA 1UY3A 4CU8A 4OMDA 1LNSA 1CZSA 2XONA 2WDBA 4YPJA 1K42A 3CZUA 3WF0A 4JHZA 3J7HA 4IUGA 3EYPA 2XOMA 3LQCA 4CVUA 1JYWA 5IFPA 2QQJA 3OGVA 2LS6A 4XUOA 1UXZA 5IJRA 3GGLA 4BK4A 2VZSA 3UETA 5JMOA 2W1QA 2LW8A 3A21A 4A44A 3ETPA 5B4XA 5B4NA 1GNYA 2Y8KA 1JZ7A 1CIYA 4DEQA 2OKXA 3EB7A 1NKGA 1UMIA 1I5PA 2ID4A 3IB3A 3OEAA 4TXWA 3GXUA 2J7MA 3C7GA 4XUPA 1RYYA 2VOTA 2BGOA 4QX3A 1SHWB 1IQDC 2X09A 1DYOA 5F7UA 3T0DA 5EIYB 1UX7A 2VZVA 4DXRA 2W3JA 4GZ9A 1K3IA 3K46A 1JHJA 2YB7A 3MV01 2W92A 4JX0A 3DECA 3FN9A 3A23A 2Y6JA 5LA2A 3SKJE 1JI6A 3IIIA 4BDVB 4HG6B 3VD9A 2QQMA 3I3DA 4P02B 3WF3A 2VCCA 1W8OA 3DYMA 3GDBA 4QB2A 3ACIA 4CU7A 1T2XA 5G04L 1CX1A 4ZZ8A 4BK5A 3WQBA 3NQHA 1WKYA 2B9VA 1UYXA 4UI9L 4AAXA 1JYXA 1UZ0A 2EIDA 3FHQA 1CZTA 2VZQA 2BZDA 4MGQA 3NRUA 3NJXA 3T0AA 3T09A 1US2A 3I97A 5HXMA 2VR4A 1UWWA 2QQIA 4LKSA 3K77A 4XURA 3I2JA 1GOGA 5A1AA 2E31A 2WN2A 2WN3A 1NAEA 4QX2A 3C7OA 4CUAA 3LE0A 1K45A 1XNAA 3OEBA 2VMEA 4MOAA 1UYZA 2WQ8A 2W87A 2VTFA 1D7PM 3T2PA 4QX1A 3I2IA 4JKLA 1PMJX 3CKHA 4LQRA 4QDRA 4W50A 4A3ZA 2C4XA 2YFUA 4E8CA 4DXSA 1GUIA 4OUEA 3VDBA 2J1AA 3ZM8A 3HNYM 2WAAA 3WF1A 2VM9A 2E33A 1JYVA 5JXJA 2W5FA 3OG2A 4AG4A 1XPWA 1PX4A 2VZRA 4QPWA 2ORZA 1OF3A 3PUIA 5HPOA 3E1F1 3HOBA 5LCWL 2Y6HA 1TVGA 1UY1A 5DQ0A 4QB6A 3NNGA 3UESA 2QBXA 3U37A 2QQLA 4MADA 3ACFA 4MO3M 4ET7A 2VQUA 5JXIA 4JKKA 5JXHA 5CZKA 4CUBA 4CU9A 1JZ2A 3T2OA 4ZY9A 3WF2A 2C26A 1UXXX 1US3A 1EUTA 3FHAA 1JU3A 4ZZ5A 2J1SA 1UY4A 5EJZB 3CIHA 2WBKA 1W9TA 2VMFA 3HNMA 4QB1A 2BGPA 4Z2AA 2B4KA 1GU3A 2YG0A 2VJXA 4XUNA 1W99A 3K4DA 5LA1A 1OT5A 3BN6A 5LA0A 3WNLA 3T08A 1L7QA 2C9KA 3A22A 3JXSA 2J1VA 3DYOA 3OGSA 2R7EB 1SG3A 3C7FA 3UNPA 2JKXA 2W1UA 1W0NA 2VO5A 1UY2A 2VZPA 3NJVA 5IHRA 2KD7A 4A6OA 3HPNA 1UYYA 3I2HA 1UMHA 3D3AA 1BHGA 2YC4A 2W91A 2Z4FA 4BXSV 2ZEXA 4A4AA 5DMYA 3CZJA 1DLCA 2WO1A 2Y6KA 1GOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIE A;  3I2K A;  2QQK A;  3W5N A;  2VZU A;  2X10 A;  2EIC A;  3HN3 A;  3WEZ A;  4A42 A;  1MPX A;  1O8P A;  4E8D A;  2DCK A;  2ZEW A;  4ARY A;  2Y6L A;  1JZ8 A;  3K75 B;  3VD5 A;  3K4Z A;  4MGS A;  3K4A A;  1TG7 A;  1CZV A;  4LPL A;  3W5M A;  4QDS A;  2VL4 A;  3BGA A;  4UAP A;  2RV9 A;  2XQX A;  5C7G A;  4KMQ A;  4QX0 A;  1R64 A;  3VDA A;  4ZXE A;  2VZ1 A;  3SEE A;  2Y64 A;  2WYS A;  1W9W A;  1L7R A;  2WUH A;  2BBA A;  3HNB M;  2Y6G A;  1GOH A;  4W4Z A;  2V5D A;  3P1I A;  3VD3 A;  1UY0 A;  3LEK A;  1GQP A;  4OMC A;  4CUC A;  4JKM A;  4UOJ A;  5I0D A;  2XHN A;  3C7E A;  2VCB A;  3T0B A;  2WO2 A;  5J1X A;  1O59 A;  3WNM A;  3IAP A;  4M4P A;  2VMC A;  4TTG A;  2QQN A;  3PUH A;  2W94 A;  3AC0 A;  3CMG A;  3I2G A;  1NX9 A;  1OF4 A;  3LPF A;  2X05 A;  5JUV A;  1HN1 A;  3I3E A;  3VD7 A;  1PMH X;  4P5Y A;  1F4H A;  3ECQ A;  3C7H A;  3THC A;  3VDC A;  3WNK A;  3MUZ 1;  4M4R A;  1YQ2 A;  4DXT A;  2HYX A;  3HEI A;  3WSO A;  4QAW A;  3ACG A;  4DUV A;  1JZ5 A;  2ZEZ A;  2VZT A;  4XZU G;  3WNN A;  4P08 A;  1XC6 A;  4RYD A;  5C71 A;  1J84 A;  2QQO A;  4OZO A;  5IYY A;  2J1R A;  3I2F A;  3LEI A;  3I3B A;  3A7Q A;  4L0P A;  4XUQ A;  2YC2 A;  4QDQ A;  2L9L A;  3C8X A;  5C70 A;  5IFT A;  2E32 A;  3T2Q A;  1JZ4 A;  3MV1 1;  4PT6 A;  3SEP A;  5JXG A;  1KGY A;  1OH4 A;  1F4A A;  3MBW A;  2J1T A;  2WO3 A;  1ULO A;  2W47 A;  4KI5 M;  4LHS A;  2PQS A;  2HLE A;  3VD4 A;  2W46 A;  3SKV A;  1H6Y A;  4GWI A;  4A41 A;  3ACH A;  4PF1 A;  3DYP A;  2JE8 A;  2VQT A;  2JD9 A;  5G05 L;  5DN2 A;  1WCQ A;  1KEX A;  4CU6 A;  2BER A;  4DUX A;  1P8J A;  1EUU A;  1OD3 A;  5JR2 A;  4ARX A;  1JYN A;  4D0Q A;  3MO4 A;  1ULP A;  1PX3 A;  4GWJ A;  5CYY A;  4PQQ A;  4P00 B;  1H6X A;  2W1S A;  4A45 A;  4XVH A;  2YFZ A;  2V4V A;  1W9S A;  2VCA A;  4DUW A;  2VC9 A;  3LPG A;  3WF4 A;  3OBA A;  3IAQ A;  1J83 A;  2V72 A;  1SDD B;  3LEG A;  5EJ1 B;  2J1U A;  2RJ2 A;  2EIB A;  3FL7 A;  2RVA A;  2VZO A;  2E26 A;  3HJR A;  2WZE A;  4FI9 A;  1DP0 A;  1NUK A;  2J22 A;  2WZ8 A;  2W1W A;  2DCJ A;  2ZXQ A;  4KWU A;  4XUT A;  2WAB A;  1O8S A;  2CDO A;  3IDA A;  1K12 A;  2CDP A;  2J1E A;  4DEV A;  3CQO A;  2VMD A;  3MUY 1;  1XNT A;  3THD A;  4OYU A;  3OB8 A;  1JZ3 A;  3ABZ A;  3OGR A;  1JU4 A;  3WNO A;  2DDU A;  3CDZ B;  5FUI A;  3P6B A;  4D8M A;  1JZ6 A;  5DPN A;  3GM8 A;  2WAO A;  2VZ3 A;  2W95 A;  2ZEY A;  4W8J A;  2W9X A;  1GMM A;  3F2Z A;  2ORX A;  2JDA A;  4RN5 A;  3WNP A;  4BJ0 A;  1W8N A;  1UY3 A;  4CU8 A;  4OMD A;  1LNS A;  1CZS A;  2XON A;  2WDB A;  4YPJ A;  1K42 A;  3CZU A;  3WF0 A;  4JHZ A;  3J7H A;  4IUG A;  3EYP A;  2XOM A;  3LQC A;  4CVU A;  1JYW A;  5IFP A;  2QQJ A;  3OGV A;  2LS6 A;  4XUO A;  1UXZ A;  5IJR A;  3GGL A;  4BK4 A;  2VZS A;  3UET A;  5JMO A;  2W1Q A;  2LW8 A;  3A21 A;  4A44 A;  3ETP A;  5B4X A;  5B4N A;  1GNY A;  2Y8K A;  1JZ7 A;  1CIY A;  4DEQ A;  2OKX A;  3EB7 A;  1NKG A;  1UMI A;  1I5P A;  2ID4 A;  3IB3 A;  3OEA A;  4TXW A;  3GXU A;  2J7M A;  3C7G A;  4XUP A;  1RYY A;  2VOT A;  2BGO A;  4QX3 A;  1SHW B;  1IQD C;  2X09 A;  1DYO A;  5F7U A;  3T0D A;  5EIY B;  1UX7 A;  2VZV A;  4DXR A;  2W3J A;  4GZ9 A;  1K3I A;  3K46 A;  1JHJ A;  2YB7 A;  3MV0 1;  2W92 A;  4JX0 A;  3DEC A;  3FN9 A;  3A23 A;  2Y6J A;  5LA2 A;  3SKJ E;  1JI6 A;  3III A;  4BDV B;  4HG6 B;  3VD9 A;  2QQM A;  3I3D A;  4P02 B;  3WF3 A;  2VCC A;  1W8O A;  3DYM A;  3GDB A;  4QB2 A;  3ACI A;  4CU7 A;  1T2X A;  5G04 L;  1CX1 A;  4ZZ8 A;  4BK5 A;  3WQB A;  3NQH A;  1WKY A;  2B9V A;  1UYX A;  4UI9 L;  4AAX A;  1JYX A;  1UZ0 A;  2EID A;  3FHQ A;  1CZT A;  2VZQ A;  2BZD A;  4MGQ A;  3NRU A;  3NJX A;  3T0A A;  3T09 A;  1US2 A;  3I97 A;  5HXM A;  2VR4 A;  1UWW A;  2QQI A;  4LKS A;  3K77 A;  4XUR A;  3I2J A;  1GOG A;  5A1A A;  2E31 A;  2WN2 A;  2WN3 A;  1NAE A;  4QX2 A;  3C7O A;  4CUA A;  3LE0 A;  1K45 A;  1XNA A;  3OEB A;  2VME A;  4MOA A;  1UYZ A;  2WQ8 A;  2W87 A;  2VTF A;  1D7P M;  3T2P A;  4QX1 A;  3I2I A;  4JKL A;  1PMJ X;  3CKH A;  4LQR A;  4QDR A;  4W50 A;  4A3Z A;  2C4X A;  2YFU A;  4E8C A;  4DXS A;  1GUI A;  4OUE A;  3VDB A;  2J1A A;  3ZM8 A;  3HNY M;  2WAA A;  3WF1 A;  2VM9 A;  2E33 A;  1JYV A;  5JXJ A;  2W5F A;  3OG2 A;  4AG4 A;  1XPW A;  1PX4 A;  2VZR A;  4QPW A;  2ORZ A;  1OF3 A;  3PUI A;  5HPO A;  3E1F 1;  3HOB A;  5LCW L;  2Y6H A;  1TVG A;  1UY1 A;  5DQ0 A;  4QB6 A;  3NNG A;  3UES A;  2QBX A;  3U37 A;  2QQL A;  4MAD A;  3ACF A;  4MO3 M;  4ET7 A;  2VQU A;  5JXI A;  4JKK A;  5JXH A;  5CZK A;  4CUB A;  4CU9 A;  1JZ2 A;  3T2O A;  4ZY9 A;  3WF2 A;  2C26 A;  1UXX X;  1US3 A;  1EUT A;  3FHA A;  1JU3 A;  4ZZ5 A;  2J1S A;  1UY4 A;  5EJZ B;  3CIH A;  2WBK A;  1W9T A;  2VMF A;  3HNM A;  4QB1 A;  2BGP A;  4Z2A A;  2B4K A;  1GU3 A;  2YG0 A;  2VJX A;  4XUN A;  1W99 A;  3K4D A;  5LA1 A;  1OT5 A;  3BN6 A;  5LA0 A;  3WNL A;  3T08 A;  1L7Q A;  2C9K A;  3A22 A;  3JXS A;  2J1V A;  3DYO A;  3OGS A;  2R7E B;  1SG3 A;  3C7F A;  3UNP A;  2JKX A;  2W1U A;  1W0N A;  2VO5 A;  1UY2 A;  2VZP A;  3NJV A;  5IHR A;  2KD7 A;  4A6O A;  3HPN A;  1UYY A;  3I2H A;  1UMH A;  3D3A A;  1BHG A;  2YC4 A;  2W91 A;  2Z4F A;  4BXS V;  2ZEX A;  4A4A A;  5DMY A;  3CZJ A;  1DLC A;  2WO1 A;  2Y6K A;  1GOF A; 
#chains in the Genus database with same CATH topology
 4E4D X;  5FYY A;  2ENR A;  1ENX A;  2R16 A;  4TLF A;  1HB4 A;  1AR7 2;  3IT8 A;  4RGG A;  3PUS A;  3USU B;  4B4R A;  4R52 A;  3W5N A;  5CB7 A;  1ZZ7 A;  4RFR B;  4AFM A;  2RDN A;  1OA2 A;  3WEZ A;  4AI9 A;  4M0N A;  1LEN A;  1O8P A;  1UPI A;  3O7O A;  1D2S A;  4ARY A;  2LM3 A;  2Y6L A;  4N53 B;  3OUJ A;  2BVV A;  1OA3 A;  1FPN 2;  3K4Z A;  5I0R A;  3N7L A;  4RR3 A;  4MGS A;  3C2U A;  1NA1 B;  3ME2 A;  3POJ A;  4QDS A;  1O6U A;  4IGP A;  2VL4 A;  4FOW A;  3VDD A;  1CAU A;  1R64 A;  2CNA A;  3AX4 A;  1H1A A;  1NZC A;  1S0I A;  1VJ2 A;  2A70 A;  1XRU A;  2VZ1 A;  2WFF 3;  1AR6 3;  1D2Q A;  1HIX A;  3H1W A;  1KIT A;  4PDW A;  5FYU A;  1JYT A;  2B8M A;  2WUH A;  2E53 A;  1V6O A;  2YHJ A;  1DFQ A;  2F17 A;  3HNB M;  1GIC A;  4CDQ C;  1YIP A;  2V09 A;  1QJU 2;  2V5D A;  1UY0 A;  4W4Z A;  3ZPY A;  2QQU A;  3RZM A;  5JIA A;  2JWP A;  1VRH 2;  2Y60 A;  1Y43 B;  1GQP A;  4OMC A;  3AJZ A;  1QNY A;  1OI6 A;  1UAI A;  2VTX A;  2ZHM A;  4MXW A;  3RS6 A;  2PN5 A;  2ZGS A;  1HRV 3;  1YWK A;  1H2L A;  3GJB A;  4LKF A;  5D8A A;  2VCB A;  4ZHN A;  3T0B A;  4Q4X 1;  1EP0 A;  3HT2 A;  3B94 A;  4CCN A;  2FDI A;  1QY4 A;  3ZYH A;  4COU A;  2KXL A;  2YC0 A;  2CHH A;  5KR7 A;  1OA4 A;  2QZ3 A;  1UCX A;  5FKB A;  2XB6 C;  3WDY A;  2UUR A;  4WM8 B;  4NJ4 A;  3VBF C;  3KCC A;  3H8O A;  1RUE 3;  1ND2 A;  4HZF A;  4NOT A;  4OZX A;  5H9Q A;  5C4W A;  3SCG A;  5CFD C;  4TTG A;  2Z5W A;  1QIQ A;  3AC0 A;  1NX9 A;  4N43 B;  1GWL A;  3HIF A;  4I09 A;  3ZN6 B;  2PAM A;  5F5C A;  4AQT A;  1BYH A;  5FZ9 A;  1C57 A;  2D6L X;  1PMH X;  5AFB A;  3Q8C A;  4AGG A;  2UY9 A;  3H3Z A;  1ND3 B;  2D3R A;  4XAA A;  2GSY A;  2CAV A;  3OUI A;  3WSO A;  4AVC A;  2BPA 2;  4QAW A;  1DG6 A;  1OC1 A;  5SV8 A;  4XCA A;  3J9S A;  4QM9 A;  3WP4 A;  3JBG 1;  1ZA4 A;  4I2O A;  1LGC A;  1VPH A;  4QPG A;  2Q4S A;  5BNP B;  2MEV 3;  2VBB A;  3IDB B;  5L7O B;  3GZA A;  1IKP A;  3LSE A;  1YYN A;  4RL7 A;  2VUA A;  1IG0 A;  4QDQ A;  2L9L A;  1AZD A;  3AKR A;  4Q1R A;  2RM2 2;  5CIS A;  4XYX A;  2QKD A;  3OBT A;  3LDK A;  1JZ4 A;  3PIJ A;  5T50 A;  3KM5 A;  4L2N A;  2RE9 A;  3M3C A;  3O0V A;  2B5H A;  2B9U A;  3BOW A;  4LR4 A;  2CSG A;  4XC9 A;  3AMM A;  2W47 A;  1NXD 1;  4KI5 M;  5T3N A;  2EXJ A;  5A3N A;  1CX4 A;  3NNL A;  1VBB 3;  3H7Y A;  4FPC A;  4AAP A;  2W46 A;  4XXA A;  2HWF 2;  4I3P A;  4UFI A;  1XOY A;  3ACH A;  3NV3 A;  2ZAC A;  1HJF A;  3J7L A;  5J09 A;  2JD9 A;  5G05 L;  2WFF 2;  5FPV A;  1I3H A;  1KD7 A;  2EAK A;  2VOK A;  3KF3 A;  2WZR 3;  3VKN A;  4CDQ A;  5L7O C;  3H9A A;  3F95 A;  1GQG A;  1UF2 C;  4CU6 A;  4OHY A;  1NA1 C;  4OFG A;  1UOF A;  3DXT A;  4Z07 A;  3U14 A;  2BOI A;  3ZKU A;  3VBO C;  3ZSK A;  1K5J A;  1XU2 A;  2P3K A;  1NYW A;  3O14 A;  5F32 A;  2OA2 A;  4D0Q A;  5F6K A;  2HWB 1;  4P5H A;  1ULP A;  1PX3 A;  4L92 A;  4PQQ A;  1CN1 A;  2DUO A;  4WBB A;  3EXU A;  4WVM A;  5E6H A;  2HBU A;  3WX5 A;  2DVA A;  3AVR A;  4MUV A;  3S30 A;  4XF0 A;  5E8A A;  3TWI A;  1ALY A;  4UW6 A;  3UL2 A;  4A45 A;  4B4Q A;  4MGT A;  4IEU A;  1QJX 3;  4I3G A;  3UJQ A;  4FAH A;  4HET A;  1REF A;  2VCA A;  2ZKN A;  2MPF A;  3LPG A;  2ZX2 A;  5CA6 A;  1BQP A;  4CDU B;  3OBA A;  5C3P A;  3K2O A;  4FOQ A;  4FSJ A;  4JTN A;  4BH9 A;  1SDD B;  2Q1M A;  5EJ1 B;  3T4H B;  4BQ2 A;  1QNW A;  1CGP A;  2IZW A;  3ZXF A;  5CFC C;  2R06 3;  1NY7 2;  4FTB A;  3HJR A;  1A3K A;  5FXX A;  4XBN A;  2VOV A;  3CU7 A;  3TN9 2;  1JOP A;  2KR2 A;  4AI0 A;  2OPK A;  3JD7 1;  5H9S A;  2UYB A;  2HWE 2;  2GU9 A;  2A3W A;  4Y4Y A;  2JDM A;  5A3O A;  3BOP A;  4ZKT B;  5J96 B;  5FO9 B;  5BNN C;  4Q4Y 1;  1LKN A;  4XFC A;  2VTX J;  5H9P A;  3RZH A;  4WM7 B;  1HJG A;  2HH9 A;  3R4S A;  2XJT A;  4QPG C;  2A6Y A;  3OSD A;  1O3T A;  3ZIW A;  4Q8L A;  3ZVX A;  2QVS B;  4QKN A;  1O4Z A;  1VMF A;  1LGN A;  1XYN A;  2VMD A;  4LBN A;  1D4M 1;  1XNT A;  2Y33 A;  1M4W A;  3IWZ A;  3M1H A;  1OFS A;  5FZ4 A;  3OB8 A;  5EWS A;  2IXL A;  3MW3 A;  4YRD A;  2IC1 A;  2C5D A;  2WA4 A;  3IDC B;  1DQ0 A;  1JUI A;  3ABZ A;  3OGR A;  3J26 N;  1ODM A;  1MQT B;  4GH4 A;  3MLL A;  5FUI A;  1FYU A;  3B5L B;  1YJL A;  3FLP A;  4XQ4 A;  3MFC A;  5DPN A;  3CF6 E;  5FYB A;  5T5O A;  2CV6 A;  4NRQ A;  2VBP A;  1JMU B;  3LB9 A;  3SNM A;  2NMN A;  4YVS B;  1KJL A;  3AP6 A;  1GYK A;  1QOT A;  3EMR A;  4YZ5 A;  3F2Z A;  3VBS C;  2XBO 2;  3WHU A;  4RN5 A;  4YW1 A;  4BJ0 A;  4XF9 A;  2PQQ A;  3UJO A;  2Y34 A;  1QHD A;  4BPZ A;  1H0B A;  2JIG A;  3NNJ A;  5C4W B;  1LOE A;  5T52 A;  4JDM A;  4ZS2 A;  4NRM A;  3PU3 A;  1F9K A;  3LZZ A;  4OMD A;  3B69 A;  4N53 C;  1BBT 2;  1MVQ A;  3KSC A;  1CD3 G;  2WDB A;  4GMP 1;  4RA0 A;  4WVZ A;  1IS5 A;  5GAL A;  4TYS A;  2R07 3;  2P2K A;  1IKQ A;  2GN7 A;  4KGQ A;  4NR1 A;  1UPS A;  4BQW A;  1DQ5 A;  4OHX A;  4HK9 A;  4ZU4 A;  3QLQ A;  4X8P A;  5FYV A;  5DUU A;  4AWD A;  2R06 1;  1U5Y A;  4CRQ A;  4HKL A;  4G3Y C;  5KHI A;  5L36 A;  1TEI A;  4C1W A;  4CCC A;  1OH3 A;  2QQJ A;  5BNP C;  1MZ6 A;  4R9A A;  4QPG B;  5FOB B;  3MF9 A;  2PHX A;  1RMU 2;  3P3P A;  3PUQ A;  2XR4 A;  4CPB D;  1PO2 3;  2LS6 A;  2ETE A;  3U07 A;  2JKB A;  4AQ6 A;  5L7O A;  2XVL A;  1RUD 3;  4KWK A;  4RS5 A;  3UET A;  4N90 A;  2ZGP A;  1DF0 A;  3V56 A;  1WCS A;  3WQ7 A;  2OQ7 A;  1JZ7 A;  1XBF A;  4IV3 C;  1AJK A;  1FOD 3;  1WCD J;  2CY6 A;  2WL1 A;  3J8F 3;  1I5P A;  3FMG A;  1OVS A;  1XSQ A;  3LDR A;  1VBA 2;  3OEA A;  4P9J A;  3ZKY A;  4OHV A;  2YBP A;  5DUX A;  2Y0I A;  4PF5 A;  5CKM A;  4XUP A;  4QQP A;  1RYY A;  4M0H A;  1W8W A;  2A71 A;  2DCT A;  4BQ5 A;  1RUH 1;  1SHW B;  3D0S A;  4BU2 A;  1YO8 A;  2XLA A;  2X09 A;  4ZU5 A;  3KF5 A;  5FYH A;  2C1F A;  2YUE A;  1NLS A;  4PI2 A;  4K6B A;  3Q8B A;  1VRB A;  3GZE A;  5EIY B;  2VZV A;  3SIT A;  3KD4 A;  3FUQ A;  4AVS A;  4AYU A;  1SQ4 A;  1UIK A;  2WNV C;  1X8E A;  3ZFG B;  3KV4 A;  1NG0 A;  2GME A;  3IPV B;  3ZN5 A;  2YB7 A;  3MV0 1;  2P3I A;  2EXI A;  2W92 A;  4YVW C;  1UOB A;  3DEC A;  3FN9 A;  3ZSJ A;  3ZMN A;  4SBV A;  3A23 A;  4QPI B;  4X8N A;  2Y6J A;  5FLJ A;  5LA2 A;  5C3S A;  4YG0 A;  3WP6 A;  4RFT 0;  3VBF B;  1S0D A;  3K3N A;  1G9F A;  5EFU A;  3WDW A;  2QQM A;  3AFK A;  2WC2 A;  2R0H A;  4FPJ A;  2XBO 3;  1A8M A;  4P02 B;  1OSG A;  4FPK A;  5EYX A;  2VCC A;  1W8O A;  4LE4 A;  1COV 2;  2O14 A;  2W0X A;  3D6E A;  4ASM B;  5DZF A;  1E5H A;  2WNU A;  3POE A;  1W0P A;  4L8Q A;  3A4U A;  4JVA A;  3WQB A;  3J7M A;  4ES9 A;  1OQD A;  3S5Q A;  5E88 A;  3OGG A;  1FPN 3;  1IQA A;  2DU1 A;  1CZT A;  3IKW A;  4U36 A;  2JG9 C;  2VG9 A;  4LMF A;  5F3G A;  2WS9 2;  4BLI A;  1OPO A;  2G1M A;  5LAS A;  4LK7 A;  5LRS A;  2XHK A;  1WW7 A;  5HXM A;  4FOY A;  3BU0 A;  1OPM A;  4FPE A;  2GAL A;  4I0W B;  1RMU 3;  1R08 2;  3BU7 A;  4FXG B;  5KXE A;  1IS3 A;  3FBM A;  1FMD 3;  2NPI A;  2PHL A;  4Q4V 2;  1QQP 3;  2WNV A;  4XIL A;  4OUL A;  3VKL A;  1PK6 A;  3QCW A;  3PVE A;  1G9A A;  4EE2 A;  5C8C A;  3CLP A;  3WZ1 A;  4NID A;  1YFU A;  3C7O A;  4JCK A;  4CUA A;  3LE0 A;  4QHZ A;  1OMI A;  1RUI 2;  4JAA A;  1W6P B;  3WT3 A;  5T5L A;  5KHJ A;  4PCR A;  1W90 A;  3RNS A;  3U4S A;  3BKZ A;  1UOG A;  1PO1 3;  1FV2 A;  5F5I A;  4OQ9 A;  1CPM A;  5T5P A;  3BTY A;  2WSU A;  5LK5 A;  1FI2 A;  5FZC A;  2WQ8 A;  2W87 A;  1EV1 1;  1D7P M;  2VTF A;  3J7N A;  3E6B A;  4QX1 A;  1G8W A;  4JDN A;  3KT7 A;  4R9C A;  1ZBA 3;  2A6W A;  1IS4 A;  2C4X A;  2MHF A;  4KG0 A;  4CCL A;  3RZJ A;  4E8C A;  3I49 A;  4Q29 A;  3MW4 A;  5FY5 A;  4KGG A;  2J1A A;  1CON A;  1YQ6 A;  3HNY M;  2WAA A;  3WF1 A;  5IVJ A;  5L9B A;  2JXA A;  5IK4 A;  2P34 A;  5BV6 A;  2E33 A;  3E97 A;  3WG1 A;  3JD7 3;  3ZFG C;  4N43 C;  4XFF A;  3OG2 A;  4H7M A;  3URF A;  3G6J B;  2BTV C;  4Q27 A;  2FCU A;  3B9C A;  3WDU A;  4CDW B;  4IE5 A;  4BMB A;  3HOB A;  3I59 B;  5I91 A;  4OHW A;  1J3R A;  1TVG A;  3WUD A;  3NNG A;  5GZC A;  5C3Q A;  2DVF A;  1RTV A;  1IS6 A;  3ZYF A;  4H2A A;  1OKQ A;  2K0G A;  2PHU A;  4AED C;  3N4M A;  4YG6 A;  4GAL A;  4MO3 M;  4N8M A;  5DXD A;  4DIQ A;  2PHW A;  2YMZ A;  3U4X A;  3MIG A;  4TWT A;  3KWV A;  5A33 B;  1DGW X;  5CZK A;  3WIN E;  4AK3 A;  4CU9 A;  1TZO A;  3UGF A;  1R1A 2;  3ZSE A;  1JZ2 A;  3VZM A;  4CTE A;  1SAC A;  1YQ8 A;  2C26 A;  1UXX X;  1ZNP A;  3DPR C;  1US3 A;  4LBJ A;  1D0G A;  4RQP A;  2J1S A;  3LGR A;  4E4Z A;  1CAX A;  3GAL A;  3NW4 A;  3CIH A;  5I93 A;  3E6C C;  2B7Y A;  4QKD A;  1MS9 A;  5FP8 A;  2WIN B;  4QGN A;  1UU5 A;  4DIN B;  2R06 2;  3WP3 A;  4G4F A;  4AVT A;  4LXL A;  5L9R A;  5FV3 A;  4JDO A;  2JDK A;  4JGZ C;  1CJD A;  3RVH A;  5A6Y A;  4E4H A;  3RI9 A;  1WLD A;  4CE8 A;  3M2M A;  1DYP A;  2VJX A;  4XUN A;  1W99 A;  5FFO C;  1RUN A;  1OT5 A;  1VAL A;  3NMB A;  3IM0 A;  5AVA A;  1R1A 1;  3WNL A;  5FZ0 A;  3GZT B;  2RG4 A;  5IUQ A;  1MS1 A;  1YC6 1;  3DYO A;  3FHI B;  3MW2 A;  4NVP A;  3W58 A;  4AXO A;  5K8S A;  1DQ2 A;  1A8D A;  3SCH A;  3UNP A;  3UKT A;  1GQH A;  5IW0 A;  1W0N A;  3K48 A;  3AP4 A;  1WBL A;  3MDP A;  1BBT 1;  1UY2 A;  2PFW A;  1D4V B;  3MLJ A;  3DPR B;  2RJL A;  5FPB A;  1KXG A;  4A6O A;  3HPN A;  1UYY A;  5M0T A;  4NHX A;  1GZ9 A;  3NV2 A;  4CSW A;  1OUX A;  4WV8 A;  2YC4 A;  1GZC A;  1UQX A;  4FO9 A;  4R8H A;  4A4A A;  1QQP 2;  2ZAA A;  1UIJ A;  3CZJ A;  5F39 A;  1XND A;  5C9A B;  3AKP A;  1AL2 2;  2D5H A;  2Y6K A;  3H1M A;  2XML A;  1CVN A;  5DAX A;  3N9O A;  2GH8 A;  2WNU B;  5BY5 A;  4MGZ E;  1O91 A;  4O9G A;  1VAM A;  3ILR A;  5L9V A;  2EIE A;  2ZMN A;  4HAN A;  1QDC A;  1X7N A;  1HV0 A;  4MLO A;  4CUG A;  1QJY 2;  3OPW A;  4QHO A;  3MIC A;  3WP5 A;  5ANN A;  3I2D A;  1RUJ 3;  4A42 A;  1DDL A;  2RS3 1;  4P9G A;  5FZD A;  4K40 A;  3VD5 A;  2E7A A;  1HDK A;  2BOJ A;  3V0B B;  1X82 A;  4C0B A;  1TG7 A;  2XJU A;  4IEX A;  4E2S A;  3W5M A;  1PO2 2;  3BGA A;  4FFI A;  4XE9 A;  2EXH A;  1BBT 3;  3LA2 A;  4EN6 B;  4GIQ A;  5JOX A;  1SFY A;  3VDA A;  4ZXE A;  4YZ3 A;  3JUU A;  1RUI 1;  3SEE A;  3ZLI A;  3CO2 A;  2BFU L;  2WYS A;  5HCA A;  4XQD A;  1AXY A;  1L7R A;  2HWE 1;  2WII B;  3T2T A;  3OY8 B;  1PK6 B;  1C8M 1;  1XNB A;  2EAA A;  2TNF A;  1GOH A;  1SBD A;  2Y6G A;  4DY5 A;  1PGS A;  2TUN A;  3VD3 A;  1ZYB A;  3UK9 A;  3THT A;  2QQW A;  3KHC A;  3M3O A;  1JOD A;  4XJ8 A;  4UOJ A;  5I0D A;  4BME A;  1PGL 2;  1Q43 A;  1E5S A;  2MEV 1;  1H8V A;  1MS4 A;  2VD7 A;  5ERL A;  5FPL A;  1XB9 A;  1Q8P A;  3CJI B;  1BK1 A;  4FVV A;  5FJH A;  3NO8 A;  1ENS A;  1RUF 2;  3ZOI A;  4DXZ A;  1W2O A;  2FMD A;  3WG4 A;  2B39 A;  2RJK A;  1E5I A;  1UZW A;  4IES A;  4UFJ A;  4NII A;  3WG3 A;  4XJ9 A;  3WNM A;  4JGZ B;  5A7P A;  3IAP A;  3D4K A;  3ZSM A;  4NIG A;  2AYH A;  3AKQ A;  3ZN4 A;  3AP5 A;  1W2A X;  3VBS B;  3BIE A;  2C0Z A;  4KU7 A;  1PIV 1;  1EAH 2;  2LUW A;  3B7M A;  1TNR A;  4GH4 C;  2X05 A;  4Y24 A;  1HN1 A;  1XXN A;  3AMP A;  3P3N A;  1ZZ8 A;  3H8U A;  3I3E A;  4YVW B;  3KVA A;  5T54 A;  3VD7 A;  3O1V A;  4LTA A;  2JX9 A;  1GWK A;  3VKF C;  2LRO A;  2DVG A;  2WQ4 A;  1L3J A;  1C1L A;  3C7H A;  4IV1 A;  3THC A;  4AED B;  3WNK A;  1VBC 3;  1RVF 2;  2HYX A;  3HEI A;  2QQP A;  3SMH A;  4MXV A;  1RUJ 1;  3I59 A;  2IFW A;  4DUV A;  3UV9 A;  3RYK A;  1HQW A;  1CAV B;  3WW4 A;  4CEW A;  2ZAH A;  4QHB A;  3WNN A;  3VHR A;  3S0M A;  3DL3 A;  2BDR A;  1J84 A;  2HWF 1;  3LOI A;  4GMP 0;  2QQO A;  1IPS A;  1KDM A;  1VRH 3;  2J1R A;  3MPP G;  4HN0 A;  4JC1 A;  1UD1 A;  5A7Q A;  3I2F A;  3BI3 A;  4FP2 A;  3I3B A;  1W6O A;  3M70 A;  4FFH A;  4XUQ A;  5FZA A;  1K5M B;  3C8X A;  5KWR A;  1QXP A;  4BQX A;  3PTR B;  4MYE A;  2A5Z A;  3ZFF C;  5F6L B;  5IAT A;  1G9D A;  4CEY A;  5FIX A;  5JI7 A;  1LOD A;  3MV1 1;  2ZMK A;  1W8Z A;  4BB3 A;  5A3T A;  5JXG A;  4IV3 B;  1RUH 2;  4UFL A;  5FK7 A;  4CDX C;  2TBV A;  1LR5 A;  4IEW A;  4AGR A;  2A73 B;  1HRI 1;  2J1T A;  2WO3 A;  1ULO A;  1MQT C;  3ENR A;  3MHZ A;  2PQS A;  3ZYB A;  4GD4 A;  3H0O A;  3VZO A;  2YRO A;  3EHK A;  1ZVF A;  1PIV 2;  4BCU A;  5B2G B;  2NM1 A;  3RFR A;  1WUV A;  3JBG 2;  3WCR A;  4L11 A;  4B7E A;  4YVS C;  5AFE A;  1U12 A;  1VBD 2;  1KEX A;  4UFK A;  1PK6 C;  4DUX A;  1P8J A;  1OD3 A;  1TME 3;  4DQA A;  1H4G A;  4FXK B;  2GAU A;  2GMM A;  4NPM A;  3M8L A;  2CWM A;  1N1S A;  1RUF 1;  2VQA A;  2ZPX A;  1NA1 A;  1WW4 A;  3MO4 A;  2RS5 2;  4GWJ A;  4GA9 A;  2FDJ A;  1DQ6 A;  2OT7 A;  5DDJ 3;  3TYJ A;  4HPK B;  3ZXG A;  4XVH A;  2PA7 A;  5DAP A;  3TEW A;  4RD7 A;  2AEZ A;  4J1X A;  2YFZ A;  2ZOE B;  2IXH A;  3MZH A;  2ILM A;  4WM7 A;  4Q4X 2;  4N9I A;  2QE3 A;  2YY1 A;  1PM4 A;  1UKR A;  3WF4 A;  5A32 B;  4DO0 A;  1V6K A;  1J3Q A;  3IAQ A;  5C9A C;  2V72 A;  2X5I B;  1OUR A;  4AOC A;  2RJ2 A;  4MXW B;  1YFX A;  3ZIX A;  4Z92 B;  2GP5 A;  1EAH 3;  3I8T A;  1AXK A;  2E26 A;  3APB A;  4JHT A;  3AK0 A;  4F8A A;  5JSR A;  1DP0 A;  1NUK A;  2H6B A;  2VXJ A;  1F31 A;  1PMI A;  2ZX1 A;  4NO4 A;  2YZ4 A;  4WVW A;  2DCJ A;  2DV9 A;  2ZXQ A;  2B46 X;  1PNF A;  4JV4 A;  3ZR6 A;  1O4Y A;  5EXO A;  2WAB A;  5I8S A;  1ULE A;  4LHK A;  3FWE A;  5J36 A;  1RED A;  1XQN A;  5C5T A;  3JU9 A;  2CDP A;  2LTN A;  4Y1V A;  4DEV A;  1UNB A;  1ND2 B;  5C3O A;  4LUK A;  5DAB A;  4CPB A;  3UKN A;  5DUW A;  1PZ7 A;  2EF6 A;  2D6M A;  4OLL A;  3MUY 1;  4YVS A;  3THD A;  4KNC A;  1MR5 A;  4AZZ A;  3PL0 A;  2VEC A;  2Y38 A;  3AP7 A;  1ODN A;  2FCV A;  4D6Q A;  1N3P A;  1ND3 A;  1BMV 2;  2ZGM A;  3LEM A;  4COY A;  3OY8 A;  5FZ7 A;  2ARX A;  2O8O A;  4RSU A;  3S6P A;  4X6R B;  1NLR A;  2HEY F;  4Z82 A;  3WNO A;  1W6Q A;  2DDU A;  3CDZ B;  1AJO A;  3TAY A;  3FLT A;  4NAM A;  4AE2 A;  2DVB A;  1WMD A;  4X6Q B;  3GBG A;  4DOU A;  1JZ6 A;  5FZF A;  2H0B A;  3GM8 A;  3EO6 A;  1RVF 1;  2BWA A;  3RI8 A;  2H0V A;  2W95 A;  5FYI A;  1ZBA 2;  3ZFF B;  4QQH A;  4XAB A;  4W8J A;  1DIW A;  3NST A;  2ZHK A;  3RZK A;  4XF3 A;  1AHS A;  1RC6 A;  4LBL A;  4QM8 A;  2ORX A;  5FY0 A;  2JDA A;  3NL1 A;  5FXW A;  3UKV A;  3WNP A;  2NP0 A;  2CU5 A;  3PHM A;  4IEV A;  4AFA A;  3S7E A;  3VBH C;  1UY3 A;  2O1Q A;  4CU8 A;  1PVX A;  2JDP A;  5DAQ A;  2A3Y A;  2RS5 1;  2CGP A;  1CZS A;  4AVA A;  2XON A;  3IZO A;  2CGO A;  4K3U A;  4N7I A;  1V70 A;  1R09 2;  1WWY A;  4AED A;  3PTY A;  2OW4 A;  3WF0 A;  1UN1 A;  1IOA A;  4IUG A;  1BVV A;  3ZPO A;  1V6M A;  3EYP A;  1WME A;  2YGL A;  3LQC A;  4CVU A;  1U5X A;  1VE0 A;  1YQC A;  1O3Q A;  1A34 A;  2CTV A;  4HON A;  1ND2 C;  2LAL A;  2RR1 1;  1FOD 2;  1CJP A;  3IMN A;  2NQY A;  1L7L A;  2XWJ B;  4XUO A;  3ASI A;  1UOJ A;  1MEC 1;  2VZS A;  2FCT A;  1RUE 1;  2LW8 A;  3OPT A;  4A44 A;  1CR7 A;  2OVU A;  5B4X A;  5B4N A;  1PO2 1;  1GNY A;  2Y8K A;  2RS3 3;  4KBZ A;  2I2S A;  1CIY A;  1D4M 3;  1RL3 A;  2WT0 A;  3EB7 A;  1NKG A;  2OS2 A;  4GKY A;  4CP9 A;  4DEQ A;  4EN9 B;  5D8A C;  4IV3 A;  4TXW A;  3GXU A;  2XL9 A;  4IDZ A;  4PI0 A;  3OF1 A;  2PXJ A;  4BHP A;  1SZB A;  1TME 1;  4KWL A;  3C7G A;  4I0A A;  3H8X A;  3A0K A;  2Z79 A;  3N9P A;  4MHR A;  4WM8 C;  1W8T A;  3I2O A;  2BGO A;  4BWO A;  3ZDS A;  1O3S A;  2Z69 A;  2JDH A;  1AR8 2;  1RUC 3;  1N1T A;  4QX3 A;  1IQD C;  2ZGK A;  2HWD 3;  4C8D A;  1DYO A;  1REE A;  5FJK A;  4OUS A;  5A3W A;  4XXP A;  3VDD C;  1S0B A;  3BAL A;  3ORJ A;  4HOO A;  5D21 A;  1LRH A;  2XKO A;  3N9M A;  5ACA 3;  1LUL A;  2CWS A;  1STM A;  4MET A;  3CEW A;  1R08 3;  3VZK A;  5DG1 A;  4XJA A;  3VKO A;  2ZKL A;  3ATG A;  4LHL A;  2ZGO A;  3O0X A;  5IVY A;  4Q4V 3;  5HBA A;  3DV8 A;  1SLL A;  4JX0 A;  4Q26 A;  2VNR A;  3ZMO A;  1JN2 P;  2E9Q A;  3KLS A;  3SIS A;  1IG3 A;  2R6Q A;  2Q8O A;  1LHW A;  1UZV A;  3SKJ E;  3D0J A;  3III A;  1MS0 A;  4BDV B;  5JDB A;  3VD9 A;  3NVC A;  4Q0V A;  1YFY A;  4E2Q A;  3RZZ A;  5FO8 B;  2RDS A;  2JG8 A;  1ZRF A;  3LOB A;  2DUR A;  2RDR A;  3DYM A;  5ABJ C;  5A7O A;  5GZG A;  4KBB A;  4R9D A;  3M3I A;  3ACI A;  1YI9 A;  2IXC A;  1W9Y A;  1HN0 A;  3KV6 A;  3O1O A;  1PO1 1;  4IE0 A;  3QAC A;  1QOO A;  4MGI E;  1PZ8 A;  4XW3 A;  1SLI A;  4RGA A;  4UI9 L;  1AR9 2;  1X36 A;  3AZX A;  3ZYG A;  2EID A;  4EQV A;  2CYF A;  1XYO A;  4LUM A;  1VBD 1;  3POI A;  3MF6 A;  1FMD 2;  1W6P A;  3NRU A;  1TQ5 A;  1W8F A;  3POB A;  3T0A A;  2E51 A;  2P3J A;  3OBR A;  4W6X A;  3T09 A;  3I97 A;  4DY3 A;  1C8M 3;  2DYC A;  1NCQ A;  4UF0 A;  4JQR A;  4JZR A;  2HYK A;  4JTO A;  2JDN A;  4LKS A;  1C3H A;  1GP6 A;  1VRH 1;  3RYR A;  1RUI 3;  3PVO A;  1IPJ A;  4PBO A;  1QJU 1;  3RDI A;  4IGO A;  1LCL A;  3VL8 A;  4YLZ A;  2KA3 A;  2Q0A A;  4ISQ A;  4DFS A;  2XVG A;  2BRT A;  1DGW A;  2WN3 A;  3E5X A;  2DU0 A;  1UU4 A;  2WZR 2;  1SCR A;  3UGH A;  2R30 A;  4UBH A;  3RRD A;  4I30 A;  4D6S A;  4EV0 A;  4Q4W 2;  1FAT A;  1ZBE 1;  3POF A;  1RUC 1;  1UX6 A;  4P9Y A;  2AR6 A;  3EJK A;  1XNA A;  2Q30 A;  4V2V A;  2ZX3 A;  1AL2 1;  5K9Y A;  2VME A;  3HWJ A;  2GC1 A;  1CAW A;  1HB3 A;  2NMO A;  1QQP 1;  1UYZ A;  1AYN 3;  4MOA A;  3OOX A;  1HQN A;  4QGM A;  1AYM 3;  3PDQ A;  4XFA A;  3I2I A;  4QDR A;  4YM2 A;  5FMC A;  4LQR A;  1Z78 A;  2HWD 2;  4MZU A;  1W9F A;  4Q4W 1;  4DXS A;  4OUE A;  1EV1 3;  2BWC A;  2MNG A;  1QMJ A;  3BPS A;  4GB3 2;  4KU8 A;  4XHB A;  2Q8E A;  3ZM8 A;  3VDB A;  2JDY A;  1AR7 1;  3LD8 A;  3OD0 A;  4C91 A;  2F6B A;  4LOS A;  4OI2 A;  4MVT A;  1JYV A;  1VBC 2;  5FZ6 A;  4AG4 A;  1XPW A;  2DTW A;  2EXK A;  2VZR A;  3GCW A;  2ORZ A;  3R4D B;  4QPW A;  1OF3 A;  4MG2 A;  2N7G A;  2XGX A;  3LIH A;  4P9L A;  3JBG 3;  5A3L A;  4LBQ B;  4ZS3 A;  2R07 2;  3S57 A;  1GFF 2;  3KMH A;  5LBB A;  1UY1 A;  4CA9 A;  4QB6 A;  2GNB A;  2QBX A;  2ARE A;  2UWC A;  3B3Q E;  5FLH A;  1ZRE A;  1R1A 3;  2QQL A;  1DZQ A;  1LHN A;  2WLQ A;  1Q8Q A;  1PGW 2;  1AR6 2;  3PVN A;  1AX1 A;  2PAE A;  3E6D A;  5FP3 A;  4Y1Y A;  3ZR5 A;  3USU A;  2ZGT A;  5JXI A;  4JKK A;  5ANQ A;  2XQR A;  4CUB A;  4Q4W 3;  4FT8 A;  3T2O A;  3OYW A;  4ZY9 A;  5KXB A;  1GP5 A;  1T6B X;  1MEC 3;  2VGD A;  1AR9 3;  3VBF A;  2OPW A;  3P5B A;  4ONU A;  5FY1 A;  2WS9 1;  5FMO L;  3SH4 A;  1WLT A;  1EUT A;  4OUM A;  3FHA A;  1JU3 A;  4ZZ5 A;  2YU1 A;  3GZU C;  4K1Y A;  5EJZ B;  1KS4 A;  1VR3 A;  4IXL A;  1YQ5 A;  1CWP A;  3VDD B;  2P5B A;  1S0J A;  2YYO A;  4ZXK A;  4QB1 A;  1ZBE 3;  2HWC 2;  2XLG A;  3JB4 C;  2RHP A;  3RPQ A;  2O0O A;  5FZL A;  3I7D A;  2H6C A;  4XTM A;  5LRR A;  4QXH A;  2YBS A;  5FQ0 B;  1XYP A;  5AC9 3;  1WA6 X;  2R04 2;  5CKN A;  3RWN A;  1WMX A;  1OOP B;  2ARA A;  3PME A;  1FXZ A;  1RHI 1;  3BN6 A;  4QU1 A;  4S2F A;  2PHF A;  1RGS A;  5FZH A;  1PVC 1;  2I07 B;  1TE1 B;  3A22 A;  3JXS A;  4AEJ A;  3DF0 A;  1ASJ 1;  3HVD A;  1ASJ 2;  4EWA A;  3TEY A;  2RS1 3;  4R4Z A;  1J58 A;  2D3S A;  3DN7 A;  1AVB A;  3LKJ A;  4BQY A;  2JKX A;  1X9T A;  1RHI 2;  4CXW A;  4QQO A;  2WO7 A;  1GP4 A;  5FXV A;  2D3P A;  4NHK A;  5LY2 A;  1W04 A;  2A6V A;  2PHR A;  5LZ6 A;  2E7Q A;  2KD7 A;  1UZY A;  3V64 A;  5CFD A;  4ATE A;  1UMH A;  1HRV 2;  5HXV A;  2UU8 A;  1BJQ A;  4WM8 A;  4K7J A;  1S2K A;  1BHG A;  3M3Q A;  2W91 A;  4Y1U A;  4BXS V;  5C8C B;  4LO7 A;  4XBQ A;  3WW3 A;  1AUY A;  1Q3E A;  3QOP A;  2XVK A;  3MYX A;  2HEV F;  1HV1 A;  1VBE 2;  1B35 A;  3IMM A;  3MI8 A;  4NE9 A;  5KHG A;  1GOF A;  4B8E A;  4IE7 A;  2VPV A;  1RUE 2;  2AGS A;  2W2I A;  1U5I A;  2ZZJ A;  3FBY A;  1RJ7 A;  2R04 1;  1COV 3;  1W03 A;  5J48 A;  4A7K A;  2OX0 A;  2QQK A;  3VHN A;  5LY1 A;  4ISR A;  5AC9 1;  2X10 A;  3J8F 1;  4IEP A;  2EIC A;  4ES8 A;  1XU1 A;  4E8D A;  5HCH A;  2ZEW A;  5FCC A;  1JTZ X;  3OUH A;  5C6C A;  4UW5 A;  1DQ1 A;  1S0F A;  3UGG A;  1N3O A;  4GJY A;  3HQU A;  2Y0O A;  3IBM A;  5BNP A;  4KH9 A;  3K4A A;  3DUI A;  4LBO A;  1CZV A;  4LPL A;  5FKC A;  5C7G A;  2XQX A;  2YPD A;  3M3E A;  1N47 A;  5BNQ A;  4LNV A;  1W6N B;  4KMQ A;  1NY7 1;  4HVO A;  2P6H A;  2D7F A;  3SC7 X;  3SLI A;  4AHZ A;  2Y64 A;  2DFC A;  4HMZ A;  4YW4 A;  4R9B A;  4NAO A;  2RMU 1;  1W05 A;  4QPI C;  2GNM A;  2JEC A;  1ZRC A;  4CDW A;  1Z7S 1;  2BBA A;  2DFB A;  4HSJ A;  1CQ9 A;  3ZX7 A;  3G7D A;  5JZG B;  1RHI 3;  3GJA A;  3LEK A;  4XMI A;  3AB0 A;  3OGJ A;  5FP4 A;  2D44 A;  1NE4 A;  4JGY B;  4IEZ A;  4CUC A;  4JKM A;  1X8M A;  3C7E A;  1WW5 A;  1ACC A;  1ZA7 A;  4ZPI A;  1C28 A;  1H1M A;  3JB8 A;  4B7K A;  1N1V A;  1SLB A;  2EAL A;  1O59 A;  5CBL A;  5A33 A;  4HBN A;  4B29 A;  5JR2 A;  3VZL A;  3ZYR A;  1J59 A;  2QNK A;  1SBE A;  3SQO A;  3VV1 A;  2DCY A;  4M4P A;  2XLF A;  4XIK A;  5FZG A;  1F5J A;  1CAV A;  4CEW B;  3TEZ A;  2VMC A;  1Q56 A;  5FK8 A;  2X53 S;  3KCY A;  4QXC A;  5JPM B;  4OI4 A;  3JQW A;  2XUE A;  3KGZ A;  4LOT A;  1ULG A;  4AI2 A;  2DBI A;  1NCR B;  1OKO A;  1QOS A;  3I2G A;  4GB3 1;  3WXP A;  1B09 A;  1BCX A;  1W6O B;  4LK6 A;  4IGQ A;  1F4H A;  2JG9 B;  1BZW A;  3ECQ A;  2DWR A;  3IN9 A;  1OBN A;  2E63 A;  1RUC 2;  1JUH A;  3MUZ 1;  4M4R A;  4RHV 2;  5FZ3 A;  4NWV A;  4DXT A;  3V65 A;  3T3Y A;  1ZBE 2;  2HWC 3;  3ACG A;  5A7S A;  2RR1 3;  2WZR 1;  2XPJ A;  1JZ5 A;  4N53 A;  4CDU A;  3W59 A;  2ZEZ A;  1ST8 A;  4PJY A;  4BOW A;  2XJV A;  2WS9 3;  2R04 3;  4CDW C;  4XZU G;  1H9P A;  4P08 A;  2UY8 A;  3N7K A;  4RR3 B;  5EHD A;  2WZP P;  5C71 A;  4RGK A;  3O1M A;  4ASL A;  4OZO A;  1VLN A;  1RUH 3;  1RXF A;  4LA2 A;  4NMI A;  5CVR A;  3LEI A;  3PIG A;  3A7Q A;  3PJY A;  4L0P A;  5GLZ A;  1YUD A;  2YC2 A;  3HMY A;  2ZGU A;  1AR7 3;  2E32 A;  4LOR A;  5A7W A;  4XCB A;  4LT5 A;  3BVC A;  1HQL A;  2DCZ A;  1MS3 A;  2D6K A;  4AL9 A;  1WCK A;  3SEP A;  3NJY A;  1H2M A;  2AC1 A;  2ZTN A;  4XBL A;  1YXW A;  2FHR A;  5D2A A;  4AW7 A;  3TEX A;  3MBW A;  3C3V A;  5C9A A;  1XNK A;  5DZE A;  5J3U A;  2HLE A;  3LIG A;  5FY9 A;  3ZFE C;  1VBD 3;  4OVE A;  1H6Y A;  2NZ9 A;  3O0W A;  4A41 A;  4AEM A;  1Q8S A;  1UO9 A;  4YZ2 A;  3E5Q A;  3W20 A;  4Q1P A;  2VH9 A;  5GLT A;  2ZZQ A;  3U0Z A;  2JE8 A;  2VQT A;  4Y5Z 0;  1K5M C;  2VNV A;  2ZJC A;  4PLN A;  4XF1 A;  5BPX A;  4D69 A;  5DN2 A;  5H9R A;  5A3U A;  3MIH A;  2GNT A;  4XMA A;  5K0U A;  1C5H A;  1OXC A;  2ES3 A;  3ZYP A;  1GR3 A;  3VBO A;  1QJU 3;  4WZF A;  4YWA A;  1PIV 3;  4NUB A;  1JYN A;  3ZSL A;  1G9C A;  2FDK A;  1A78 A;  4Y33 A;  4CZS A;  5KXC A;  4Y3O A;  1JOB A;  4NIH A;  4EWD A;  5C33 A;  5K7P A;  1JBC A;  1H6X A;  1APN A;  1QH6 A;  1AYN 2;  2FQP A;  2OZ6 A;  3AP9 A;  4BIS A;  1PHM A;  2PLV 1;  4XEZ A;  3I3M A;  3UYJ A;  4CCD A;  5JVV A;  1S0C A;  5F1R A;  4HK8 A;  5LBF A;  4TN7 A;  4YW3 A;  2VC9 A;  1YRZ A;  1U0A A;  2FDH A;  1KS5 A;  1PVC 2;  1SLT A;  4AEK A;  2A6Z A;  2J1U A;  5FZO B;  4OHZ A;  1BVP 1;  2ZML A;  1B35 B;  2VOX A;  1NLQ A;  5IK5 A;  2RVA A;  2VZO A;  4QX7 A;  4EN8 B;  4XOG A;  1S0E A;  4BM8 A;  2PMW B;  2WZE A;  4FI9 A;  4HXC A;  2Q1F A;  4YSF A;  2J22 A;  5IT6 A;  4CCO A;  2Y6F A;  5IVE A;  3GBW A;  5EPA A;  3WV6 A;  2HKX A;  4GJZ A;  4QXB A;  4RQP C;  4XUT A;  4FBF A;  1O8S A;  2CDO A;  3IDA A;  5FYT A;  5C3R A;  2HEW F;  4A7Z A;  1NZI A;  1K12 A;  1ZZC A;  1FNY A;  3NWK A;  4GB3 3;  4LLF A;  2NLR A;  4MSV A;  5FYZ A;  3FJS A;  3PUR A;  2XL7 A;  4I0B A;  2X5I C;  3DXU A;  3VN4 A;  1W6M A;  3CQO A;  1QU0 A;  3BYW A;  3OCP A;  3AYC A;  4YVW A;  1O5L A;  2GZW A;  5E16 A;  4D7Y A;  4RS5 B;  3MPB A;  4OYU A;  2QZ2 A;  3GYD A;  4D6R A;  1JZ3 A;  1AXZ A;  2O8Q A;  1VMJ A;  3FZ3 A;  1I6X A;  1HXS 1;  1MEC 2;  3BTA A;  3VBU C;  2DF7 A;  4I01 A;  2VUD A;  3OD4 A;  3AKT A;  2V5Y A;  3HBZ A;  4K9S A;  3P6B A;  1AL2 3;  1OQE A;  4D8M A;  1DGR A;  3ES1 A;  2VVD A;  3TN9 1;  1I9R A;  2R49 A;  2K46 A;  2PTM A;  2WWJ A;  1JYC A;  3NV4 A;  2VZ3 A;  3MID A;  4FQ4 A;  5GLW A;  4XFB A;  4DB5 A;  1EPZ A;  1H8T B;  2ZEY A;  1AL0 G;  1YCI A;  4NWW A;  3KT4 A;  1RMU 1;  1K5M A;  4IET A;  1AR6 1;  2W9X A;  4Z2W A;  4QQL A;  1GMM A;  2WT2 A;  2RDQ A;  5J37 A;  2GDF A;  3N9N A;  4QMA A;  2RM2 3;  1QF3 A;  1XNC A;  3ZFG A;  3HQR A;  3NJZ A;  4LO5 B;  3IPV A;  1WLW A;  1G86 A;  1IPK A;  2PAK A;  4Y26 A;  2HWB 2;  4CDX A;  3WLU A;  4MGK E;  2PLV 3;  5K4L A;  4XET A;  3T30 A;  5FPU A;  1RIN A;  3GBF A;  4K21 A;  5IK7 A;  3CZU A;  4ASK A;  3DGT A;  4NN0 A;  3R0R A;  4QPI A;  3E5U A;  4W65 A;  4DMI A;  3IDE A;  2XH6 A;  3J7H A;  5LEK A;  4AF9 A;  3QD6 A;  3VHO A;  1DHK B;  4Y5T A;  5KXD A;  4TSV A;  5FMD A;  4KWJ A;  5IFP A;  1VBE 3;  3OGV A;  4RR3 C;  2D40 A;  2ADD A;  3PU8 A;  4A6S A;  4UBG A;  3ON7 A;  1KDK A;  1UXZ A;  3KHB A;  3GGL A;  4CDU C;  5CAZ A;  4KQ7 A;  1UL9 A;  4UW3 A;  5T5J A;  1JS9 A;  3CNA A;  5FMB A;  4HPK A;  2W1Q A;  2OUJ A;  3A21 A;  4E27 A;  3ETP A;  2ARB A;  1BKZ A;  2VNG A;  3LFM A;  4URA A;  4FFF A;  3AM2 A;  1YLL A;  3AXE A;  1Y7B A;  2ID4 A;  3NKG A;  2DTY A;  5JOW A;  3WUC A;  1MQT A;  3L9J T;  4GH4 B;  3WDX A;  3BTZ A;  3JCI A;  2JDZ A;  1Y4W A;  2XJP A;  2J7M A;  2JIJ A;  5FRE A;  1RIT A;  5GZD A;  5FUN A;  1D4M 2;  1WLC A;  1I1E A;  4C90 A;  3NNM A;  5FWJ A;  4HSL A;  1QJZ A;  5BNO C;  3LF7 A;  4YW7 A;  3POW A;  4R4X A;  2ZBJ A;  3AYA A;  3BOD A;  1V6J A;  3VBU A;  2JG8 B;  4D7T A;  1UX7 A;  2A1X A;  2BV4 A;  4E2G A;  1OFN A;  4DPN A;  4GZ9 A;  5K0U B;  2P4E A;  2IVJ A;  4SLI A;  1K3I A;  3K46 A;  4K1Z A;  1V9U 1;  1XJA A;  4L97 A;  4AFC A;  3JD7 2;  4MV2 A;  4V1P A;  1QGL A;  1X9P A;  3LAG A;  5FAX A;  5GZE A;  4YFZ A;  5JZG C;  1NE6 A;  4XDQ A;  1RUD 1;  3WOG A;  3PLQ A;  3FE5 A;  3KQ4 B;  4NRO A;  4O65 A;  3AL6 A;  4IEQ A;  1POV 3;  1JI6 A;  1DGL A;  2BW8 A;  4M3C A;  4HG6 B;  1H2N A;  1RJ8 A;  2EVX A;  5SV5 A;  2AEY A;  5JLV A;  5EQU A;  1Y3T A;  3ETQ A;  3I3D A;  5FY4 A;  4Z8B A;  3R6S A;  3H7J A;  4QKB A;  2GND A;  3WF3 A;  5FTT C;  1NCQ B;  1ULC A;  3GHN A;  1SLC A;  2UWB A;  1T2X A;  4BZ4 A;  1MS8 A;  5G04 L;  4ERO A;  1CX1 A;  4BK5 A;  4FQZ A;  2ZGR A;  5F8P A;  1LJ7 A;  3LA7 A;  3NQH A;  5BUV A;  1WKY A;  1AR8 1;  1UYX A;  2B9V A;  1CIW A;  4IEO A;  4WVV A;  5F5Q A;  5FO7 B;  4AAX A;  5IK8 A;  1JYX A;  2J42 A;  2JB4 A;  1UZ0 A;  3BPZ A;  4FFG A;  4P9W A;  2YXS A;  4M01 A;  1H30 A;  2BZD A;  2Q8D A;  1H1I A;  5F9T A;  1O5U A;  3I54 A;  1HRI 2;  5FPZ A;  2JEN A;  1XE8 A;  4MX3 A;  3WDV A;  2OYZ A;  5F3E A;  2YU2 A;  5A1F A;  4MHU A;  1SLA A;  5F2W A;  4FTS A;  1IGO A;  1NT0 A;  3DEM A;  3VB9 A;  2QQI A;  4OI0 A;  2HBT A;  1CAW B;  3K77 A;  2K2S A;  5A70 A;  1FPN 1;  5FPX A;  1W2T A;  5FY8 A;  5FOJ B;  5DAW A;  1Y9Q A;  2I45 A;  2VW2 A;  2E31 A;  5ABJ B;  3WY6 A;  5CG9 A;  3D5O A;  3FC0 A;  3HQX A;  5AVP A;  3WQ0 A;  2RR1 2;  4QX2 A;  4EWE A;  1K45 A;  1W06 A;  2BU9 A;  3FX3 A;  3ELN A;  2IUW A;  4BE3 A;  3L2Y A;  5JIU A;  2EA7 A;  3I4I A;  3I3Q A;  1LEM A;  3RZG A;  3HN1 A;  4YGD A;  1M06 G;  1H8T A;  4YFW A;  1LES A;  2KM2 A;  2BJS A;  1W28 A;  1VIW B;  1GNZ A;  2WJS A;  3V0A B;  3T2P A;  3WNX A;  1TNF A;  1MZE A;  4JKL A;  2P1B A;  3CKH A;  3LDB A;  1WCU A;  3U10 A;  3PJQ A;  4W6Y A;  4XZP A;  1GUI A;  1AYN 1;  3RQ0 A;  3N9Q A;  3RZL A;  3PNA A;  3M7A A;  3RJR A;  3U11 A;  1LED A;  5LK7 B;  3NAP C;  4B1M A;  5A6Z A;  3N7J A;  3N35 A;  2C9A A;  3HD8 B;  5BNO B;  2ADE A;  3DPR A;  5FYM A;  1DYK A;  1WZX A;  2JJ6 A;  1C8M 2;  2W5F A;  2WRA A;  1C1F A;  3W9A A;  4CCM A;  1DZT A;  1R09 1;  4TLG A;  1DCS A;  3OTF A;  3OYW B;  3U75 A;  4PLM A;  4DZG A;  1S2B A;  4CEW C;  1NOV A;  1OLR A;  2Y6H A;  4LBQ D;  2Q5T A;  2VNO A;  1ASJ 3;  2MEV 2;  5DQ0 A;  1PGL 1;  1KQR A;  2JDU A;  4ORF A;  1J3P A;  3ES4 A;  1PVC 3;  1QEX A;  4HL0 A;  4LBM A;  5F2S A;  3U37 A;  2D6O X;  5LWB A;  4COZ A;  2RMU 3;  4IV1 C;  4MAD A;  3SH3 A;  2D6P A;  3ACF A;  4FPG A;  4YW6 A;  4ET7 A;  3POY A;  2OZJ A;  4AFD A;  2VUL A;  3MEP A;  5TSW A;  5A3P A;  1BMV 1;  4O61 A;  1GAN A;  4JQT A;  4FCA A;  1BK0 A;  4XFI A;  2A7A A;  2YDE A;  3MIE A;  4QT6 A;  5D1I A;  1ULD A;  3HBK A;  4OQ8 A;  1Q8O A;  2Q8C A;  4XDO A;  1H4H A;  4XJU A;  4AHY A;  3VBR A;  1V6I A;  5HCF A;  2I74 A;  3THP A;  2VVF A;  2WNE A;  3U1X A;  2XJQ A;  3TNP B;  4GKX A;  2RS3 2;  3EQE A;  4GWN A;  5IWF A;  1UY4 A;  4Q5O A;  5JXJ A;  1UU6 A;  4EZH A;  1JOJ A;  1ZRR A;  4DRR A;  2WBK A;  5ACA 1;  2FD8 A;  3ZN6 A;  1O4T A;  2JG8 C;  5FZ8 A;  3ZXA C;  2G9G A;  3ZXJ A;  5C8C C;  1GZW A;  1JHN A;  2BGP A;  4DNY A;  2VUJ A;  4AI1 A;  2V73 A;  5CFC A;  1RXG A;  2GP3 A;  1QJY 1;  1OLM E;  5GLU A;  4H55 A;  4XIO A;  4AVB A;  5KC5 A;  1W8H A;  1OHF A;  2D97 A;  3K4D A;  1UKG A;  3AVS A;  4Q0S A;  4QKF A;  3VBU B;  4GMP 3;  3T08 A;  1JYI A;  1ENQ A;  4YG3 A;  2FDF A;  1UYP A;  1WD4 A;  4NHM A;  3KS7 A;  2Q1Z B;  2J1V A;  3ILN A;  4LKE A;  5F37 A;  2A75 A;  2R7E B;  5CIR A;  1SG3 A;  4TZD A;  2D5F A;  1W8U A;  3DKW A;  1HLC A;  2R1D A;  3LCP A;  3TB0 A;  3ITQ A;  4Y20 A;  5J7M A;  1FAY A;  2W1U A;  4UF0 B;  1Z0H A;  3CJI A;  4XAC A;  4HVR A;  3NJV A;  1KFX L;  2VZP A;  1W3V A;  2ZGQ A;  5FYC A;  3R05 A;  3WD5 A;  1ZRD A;  2GC0 A;  1Z7S 2;  4KL1 A;  2XKP A;  2BP6 A;  3D3A A;  4M3C B;  1YNA A;  2HJI A;  1OLQ A;  1I5Z A;  2W68 A;  2JE7 A;  4LUL A;  4HKO A;  2ZEX A;  4Y22 A;  1UW8 A;  3O5S A;  2A6X A;  3MIB A;  4FPL A;  1NCQ C;  3T1L A;  3GNE A;  2HWB 3;  5FZ1 A;  5E89 A;  1CPN A;  1KJR A;  2ZAB A;  1TMF 3;  1S1A A;  3I2K A;  1B35 C;  3QBQ A;  4LKD A;  4JRL A;  4N9H A;  4XTP A;  1SCS A;  5DZG A;  1HXS 2;  2VZU A;  2ET1 A;  1F35 A;  4FOV A;  3HN3 A;  2QFE A;  4G9S B;  1MPX A;  5JZG A;  2B42 B;  1MZF A;  2DCK A;  2IFR A;  5JOY A;  1JZ8 A;  2QJV A;  3K75 B;  1JW6 A;  2VXR A;  2SLI A;  4JGY A;  4UWD A;  1EPW A;  2VW0 A;  4M3C E;  1WD3 A;  3PUA A;  4O9E A;  4IE4 A;  4UAP A;  2RV9 A;  4A2U A;  3WVJ A;  1POV 1;  3KT1 A;  3ALQ A;  1RIR A;  4QX0 A;  3CJI C;  4XHX A;  4GQ7 A;  3ZYI B;  3GHM A;  1LU1 A;  1ZZB A;  2CGN A;  4K8F A;  4Q4X 3;  3RSJ A;  5A3M A;  1AYM 1;  2PEL A;  1W9W A;  4CEY B;  3H3L A;  1HRV 1;  5FZE A;  4NHY A;  5FR3 A;  2E7T A;  2XJS A;  1JH5 A;  3J8F 2;  4IQP A;  5FZI A;  1RUO A;  3SHR A;  4H3W A;  4BA6 A;  3AYD A;  2BNO A;  1VMH A;  3P1I A;  3K3O A;  1G7Y A;  2VAU A;  4CCJ A;  2FZ2 A;  3O1U A;  3ZXK A;  4Q8K A;  4HKW A;  4ATF A;  2XHN A;  5FP7 A;  1Z7S 3;  5JSP A;  4IE6 A;  2JG9 A;  2WSV A;  2WO2 A;  1YIF A;  3KV9 A;  5J1X A;  3VZJ A;  2R32 A;  4PDW B;  1FV3 A;  2AUY A;  1LGB A;  4AVV A;  5I0S A;  3LA3 A;  5GZF A;  5GLV A;  5FZB A;  4XFG A;  1RUG 1;  3RMY A;  5CNA A;  4Y1X A;  4P14 A;  5HV0 A;  1FX5 A;  2VY0 A;  2PLV 2;  2JIC A;  2VOW A;  3VGI A;  2QQN A;  3PUH A;  2W94 A;  2BNM A;  3CMG A;  1EV1 2;  1OF4 A;  3LPF A;  4YM1 A;  3RYP A;  5JUV A;  3H50 A;  1RUJ 2;  3AZY A;  3AMH A;  4XF4 A;  2G4I A;  3L2H A;  4P5Y A;  2P37 A;  4ZON A;  4EJR A;  1QDO A;  3VDC A;  4Q4V 1;  5E1R A;  3MFA A;  3OBZ A;  5A7W B;  4P9X A;  1YQ2 A;  2C6S A;  3O12 A;  5FQ0 A;  1AX0 A;  5C5U A;  1R08 1;  4GWM A;  4Q2F A;  4CP0 A;  1OOP A;  5A32 A;  2NN8 A;  1EAH 1;  3LSD A;  4D94 A;  1YFW A;  2DBN A;  2HWC 1;  2X5I A;  4YZ1 A;  1TMF 1;  2VZT A;  1LHV A;  2ZX4 A;  3M4F A;  4YM0 A;  1XC6 A;  5I8T A;  2ET7 A;  4LE3 A;  4RYD A;  3V0B A;  1DBN A;  3INA A;  4QX5 A;  3RMX A;  4PIY A;  4N43 A;  5LB6 A;  4HT1 T;  5IYY A;  4M3C F;  1WW6 A;  1KRI A;  2WQZ C;  1V6N A;  3BUC A;  4IL7 A;  3TRS B;  2VQ0 A;  1QJX 2;  3O1R A;  2EIG A;  4QWN A;  5C70 A;  5CFD B;  5IFT A;  2WR9 A;  1SDW A;  1VAK A;  3OPZ A;  1SMV A;  2RS1 1;  3T2Q A;  5JPN B;  5DDJ 1;  3VBR B;  1KFU L;  4LBK A;  4PT6 A;  5CKQ A;  1S2E A;  1WMF A;  3ZFE B;  5DAV A;  1LOF A;  1KGY A;  2D93 A;  1PNG A;  1PZ9 A;  3VBO B;  1LOC A;  1OH4 A;  1F4A A;  1VB4 A;  2WWS A;  3N3H A;  2ERF A;  1PM7 A;  2GH2 A;  1C5I A;  4FPY A;  4LHS A;  1HB2 A;  5JSO A;  3VD4 A;  1GZW B;  2K9Z A;  1FNZ A;  3SKV A;  4GWI A;  3T4V A;  1OD5 A;  5IVV A;  3HT1 A;  4PF1 A;  3DYP A;  4QU2 A;  5CFC B;  5CG8 A;  2HWD 1;  2XDV A;  4RHV 1;  4DRV A;  3CL1 A;  2C24 A;  3ROU A;  1WCQ A;  3X29 B;  5HV4 A;  4LO8 A;  4EYU A;  1VAV A;  1QJY 3;  1VBB 2;  2W08 A;  2BER A;  4HN1 A;  4LJH A;  1SEF A;  1COV 1;  1EUU A;  5EZW A;  5CEH A;  1HRI 3;  5IVB A;  2FDG A;  3WR0 A;  1V6L A;  1NQJ A;  1SFN A;  2WFP A;  3BCW A;  3DCQ A;  4NHL A;  3RG0 A;  2WFF 1;  3UT0 A;  2AH2 A;  4ARX A;  4PDW C;  5K0U C;  5FWE A;  4UW4 A;  2ZA9 A;  3EBR A;  2VMG A;  1QXR A;  5CYY A;  3USS A;  4P00 B;  5L19 A;  2JE9 A;  2W1S A;  3OJB A;  1HB1 A;  3AZV A;  4MH0 E;  3VBH B;  5APA A;  4IV1 B;  3CBN A;  1UZZ A;  4E4S A;  2VU9 A;  4LIV A;  5JI9 A;  1W2U A;  2V4V A;  4FPH A;  4L99 A;  1W9S A;  4XJZ A;  2PYT A;  2XG3 A;  5FP9 A;  2QUO A;  5T55 A;  4NIA A;  1MS5 A;  4DUW A;  1UMZ A;  3AJY A;  4D7S A;  5J98 B;  4LIU A;  4YW2 A;  4V2W A;  3WCS A;  1J83 A;  3AYE A;  1J1T A;  4ITC A;  3FUO A;  1W6M B;  3LEG A;  3VUO A;  1W2N A;  2Y26 A;  1AR8 3;  2EIB A;  3FL7 A;  1H8T C;  4IEY A;  5A6X A;  3A0N A;  1FMD 1;  2WKK A;  5I0U A;  2WZ8 A;  3HR9 A;  5BNN A;  2W1W A;  4AHW A;  1BEV 3;  1GWM A;  1Q8V A;  2A3X A;  4B3N A;  3KB5 A;  5F3C A;  5FZM A;  1FT9 A;  4KWU A;  4XPV A;  4XJW A;  2ZHN A;  4YYO A;  4S2D A;  5LAT A;  2CAU A;  2IVI B;  3J4U H;  4AQ2 A;  2J1E A;  1R09 3;  2VMI A;  3H1Y A;  5L73 A;  2RMU 2;  4FTE A;  2RS1 2;  3VHP A;  4BQ3 A;  1LTE A;  1QJF A;  2F4L A;  1NCR A;  3CJX A;  1OOP C;  4CCE A;  5C8W A;  1RUG 3;  2QCS B;  1G9B A;  2W52 A;  2ZHL A;  2PHT A;  4O7X A;  3VZN A;  1RB8 G;  1QKQ A;  2VCM A;  3VL9 A;  4QGL A;  1URX A;  5AC9 2;  3LWC A;  4IW3 A;  2JB8 A;  1C8N A;  5FMO S;  1JU4 A;  5KHH A;  4YZ4 A;  5JCT A;  1RVF 3;  1HW5 A;  1AX2 A;  1EY2 A;  1F5F A;  1PO1 2;  4UFH A;  1VBE 1;  2Z2S B;  4Z1V A;  5C4W C;  4IND A;  4QPY A;  4CDX B;  4BIO A;  4GUL A;  2WAO A;  1LOG A;  3Q8A A;  5A6Q A;  1S4C A;  2QDN A;  2GMP A;  1BXH A;  1VP6 A;  2ATF A;  3WQ1 A;  2G9Z A;  4NPR A;  4YNI A;  2VVE A;  2BBV A;  2DVD A;  3PMS A;  4N7U A;  5KHK A;  4B1L A;  4FP3 A;  5FZK A;  5KC6 A;  4CXY A;  1V9U 3;  3WW1 A;  4OCT A;  3O1S A;  1W8N A;  3VKM A;  4AHX A;  3WG2 A;  4UYB A;  1BEV 2;  3KV5 A;  3Q9O A;  3POG A;  1CES A;  1SPP A;  5A80 A;  1LNS A;  1Y9G A;  3AMQ A;  1POQ A;  2TEP A;  2G9F A;  3N7M A;  4DS0 A;  5GKA C;  3RWK X;  4YPJ A;  1K42 A;  3BB6 A;  5I0T A;  1DZR A;  5LA9 A;  3AMN A;  3D8C A;  3O1T A;  2CL2 A;  1DGR N;  1BEV 1;  2VMH A;  3B02 A;  4JHZ A;  3H42 B;  2YGM A;  2XOM A;  4H14 A;  3AZZ A;  1XSR A;  2BVB A;  4A7Y A;  1IHM A;  1F8V A;  3TNQ A;  1JYW A;  5LEJ A;  3NAP B;  2FBE A;  1A6C A;  5FY7 A;  1FOD 1;  3AXD A;  1S55 A;  4XAE A;  2ZGN A;  5IJR A;  1SBF A;  2AAC A;  1GZT A;  1QJE A;  3AL5 A;  4BK4 A;  4CP2 A;  5JMO A;  4AI3 A;  4F3J A;  2BEO A;  4YGB A;  2XJR A;  1XE0 A;  4Q0U A;  4YW5 A;  2FZ1 A;  1Q5O A;  5DDJ 2;  1ONA A;  4CXX A;  3NKT A;  4JRA A;  4OI1 A;  2OKX A;  4COV A;  3RJ2 X;  3ZXD A;  1UMI A;  1U5Z A;  3KVB A;  3ZFE A;  2SBA A;  5F3I A;  3IB3 A;  2X29 A;  1W6Q B;  1E5R A;  2X8K A;  1ZX5 A;  1GNH A;  5EYY A;  4M00 A;  1H9W A;  2XXZ A;  5FZO A;  2AZ5 A;  3DKQ A;  1Y9M A;  1YI7 A;  1VB2 A;  1LOF C;  3RGB A;  4BIF A;  2VOT A;  1WGP A;  4LLO A;  4PQ9 A;  4LA3 A;  3AZW A;  4GAZ A;  2BGC A;  2R07 1;  2QTW B;  1TMF 2;  2WNU C;  5F5A A;  4Y5S A;  1ZM1 A;  1BLZ A;  4LEJ A;  3ZFF A;  2BFU S;  1YEW A;  5DUV A;  3KGL A;  4P9I A;  2GC2 A;  5A7N A;  1O7F A;  5F7U A;  4J6G A;  2BQP A;  3T0D A;  2BYV E;  2YBK A;  2V4A A;  4DXR A;  1PGW 1;  2W3J A;  4Y4R A;  4BYY A;  2D6N A;  1ND3 C;  5CU1 A;  3FFZ A;  1JHJ A;  3B01 A;  4MGY E;  4C1X A;  1YJK A;  1G6N A;  1POV 0;  1VBC 1;  1J1L A;  3U78 A;  1ENR A;  4XDP A;  4A3X A;  3ILF A;  3VBH A;  1MVE A;  2G19 A;  4Y1Z A;  3TBD A;  2QQV A;  1RUG 2;  2WT1 A;  2WYF A;  4B4P A;  3MLK A;  4YGE A;  4K8R B;  2NYY A;  4S2H A;  5EJ3 A;  4EN0 A;  3S7I A;  1W0O A;  4RQP B;  1CAX B;  1QWR A;  3GDB A;  5I8Y A;  2R1B A;  4QB2 A;  1N3Q A;  3SCF A;  4F7Z A;  4CU7 A;  4I02 A;  1VBA 3;  1H2K A;  1HXS 3;  2GN3 A;  4HLT A;  3Q8F A;  4AI8 A;  4ZZ8 A;  2BUK A;  2B45 X;  1OUS A;  1W39 A;  2PHD A;  5JWP A;  1R1Z A;  2QDR A;  1V0A A;  5BNN B;  1T6G C;  2BNN A;  2XUM A;  3BIW E;  4QD2 A;  1LB2 A;  3W21 A;  5JR7 B;  5ABJ A;  4LBQ A;  3SH5 A;  1ULF A;  3ACL A;  3FHQ A;  3MIF A;  4NPL A;  1E57 A;  2VZQ A;  2JEM A;  4E9K A;  1VBB 1;  4MGQ A;  5FRA A;  4PBP A;  4CP9 B;  1AF9 A;  1DLL A;  4LO6 B;  3LFI A;  5EV7 A;  3T1M A;  5DG2 A;  4D3W A;  2E6V A;  3NJX A;  5JAX A;  1US2 A;  2IXI A;  4H7L A;  5KBF A;  4AGV A;  3JZV A;  2VR4 A;  1CAU B;  1UWW A;  5CAD A;  5FXZ A;  1V00 A;  4XUR A;  4U2A A;  3BTX A;  3I2J A;  3V0A A;  2HWF 3;  3GF6 A;  2RM2 1;  3KQR A;  1NXM A;  1GOG A;  5LBE A;  4AQS A;  3MGU A;  3FFQ A;  5FPA A;  5HCB A;  4YAR A;  5HI0 A;  5A1A A;  1QXJ A;  2FMY A;  4XFH A;  1OVP A;  4HVQ A;  2WN2 A;  5FUP A;  2IWG B;  2IXJ A;  1NAE A;  2P3Y A;  5JMC A;  1C4R A;  2UYA A;  4W6W A;  2GC3 A;  1VBA 1;  1GLH A;  3KCX A;  4QQ2 A;  5EP9 A;  4CP1 A;  4QXK A;  5GJ6 A;  4YM3 A;  3ZXE A;  4Q0Q A;  5BYN A;  5BNO A;  5FDB A;  1QJX 1;  1X50 A;  4JGY C;  2P17 A;  1ZZ6 A;  4KG8 A;  4URT A;  5D8A B;  5FLI A;  3ZDV A;  3HAG A;  3TN9 3;  2VUC A;  3OEB A;  5IVF A;  1WBF A;  2W39 A;  2HWE 3;  5FBZ A;  2WWU A;  1N1Y A;  3H8R A;  1AR9 1;  5LW9 A;  1PMJ X;  3ZYJ B;  4W50 A;  4A3Z A;  2YFU A;  2IXK A;  2WNV B;  2P6C A;  3ZO0 B;  3B9I A;  2D43 A;  3VLB B;  4WM7 C;  2OII A;  5FYS A;  3ZXL A;  2VE1 A;  4FPO B;  1QH7 A;  3TOJ A;  2VM9 A;  4LO4 B;  2D98 A;  5ISL A;  4K20 A;  1SPP B;  2WNO A;  4RS5 C;  3O1P A;  3IIA A;  4BQ1 A;  1X33 A;  2LRP A;  4BXF A;  4C0H A;  5LBC A;  1PX4 A;  1IZ3 A;  1DU3 D;  3VBR C;  1GKB A;  5JOZ A;  2ZX0 A;  3PUI A;  4Q4Y 3;  4BQ4 A;  2WLP A;  5HPO A;  1OQ1 A;  3E1F 1;  3D82 A;  4IER A;  1S0G A;  5LCW L;  4PIX A;  3S5A A;  3AFG A;  2OQ6 A;  2Z42 A;  1F15 A;  3UES A;  3N9L A;  3PVB B;  3NAP A;  4WZC A;  1TME 2;  4F83 A;  1ZRI A;  3QH6 A;  3WHT A;  4ZU7 A;  3QH7 A;  1O3R A;  2XBO 1;  2ZS6 B;  4EZ4 A;  3K51 A;  1OLM A;  4FPF A;  2VQU A;  5ACA 2;  1LHU A;  1XE7 A;  1NCR C;  1W3X A;  4J25 A;  1NQD A;  4LIT A;  4PHZ A;  5JXH A;  4PLO A;  2ZCW A;  1LEC A;  1GBG A;  4JGZ A;  4YGC A;  3WDT A;  3WF2 A;  1SFP A;  2YPJ A;  1WA4 A;  5FBJ A;  1EYB A;  4AR2 A;  3VBS A;  1JXN A;  4CEY C;  3WW2 A;  1GSL A;  1YHF A;  1MAC A;  3H3U A;  4PIZ A;  2YV8 A;  3SXW A;  1LHO A;  4Y20 B;  1AYM 2;  1W9T A;  4GXL A;  5IAX A;  4L9B A;  1W6N A;  2VMF A;  3HNM A;  4RHV 3;  5IAV A;  1LU2 A;  3R4U A;  4CCK A;  4Z2A A;  5GM0 A;  2B4K A;  1ZZ9 A;  4LHN A;  1GU3 A;  2F4P A;  2JD4 A;  1LAJ A;  2ARC A;  2ZGL A;  4AFB A;  3FLR A;  1GV9 A;  2YG0 A;  2WA3 A;  1DQ4 A;  4J1W A;  3ST7 A;  4FAG A;  5LA1 A;  3JQX A;  4CDQ B;  5IVC A;  4Y22 B;  5LA0 A;  1L7Q A;  3NNF A;  2C9K A;  1F2N A;  4HFS A;  2RS5 3;  1LOA A;  1MZ5 A;  3OGS A;  4EN7 B;  2OXB A;  2OUH A;  2UWA A;  2VBD A;  4Q4Y 2;  4UFM A;  3C7F A;  2VW1 A;  4UXA A;  1HX6 A;  2VO5 A;  1HKD A;  1RUD 2;  4WVM B;  4NRP A;  3B93 A;  3KZ4 C;  5IHR A;  3POS A;  2DUQ A;  3I2H A;  4UT5 A;  3CHX A;  2AEN A;  1V9U 2;  3N36 A;  4COW A;  3GCX A;  2R0F A;  2Z4F A;  4S2G A;  5BXX A;  5DMY A;  4BLJ A;  3Q8E A;  1D0H A;  2DUP A;  1DLC A;  4Q0P A;  2WO1 A;  2XWB B;  3NV1 A;  3AKS A;  5A1L A;  4QX8 A;  1ZBA 1;  4CYD A;  1LOB A;  1RUF 3;  3B00 A;  4XQW A; 
#chains in the Genus database with same CATH homology
 2EIE A;  3I2K A;  2QQK A;  3W5N A;  2VZU A;  2X10 A;  2EIC A;  3HN3 A;  3WEZ A;  4A42 A;  1MPX A;  1O8P A;  4E8D A;  2DCK A;  2ZEW A;  4ARY A;  2Y6L A;  1JZ8 A;  3K75 B;  3VD5 A;  3K4Z A;  4MGS A;  3K4A A;  1TG7 A;  1CZV A;  4LPL A;  3W5M A;  4QDS A;  2VL4 A;  3BGA A;  4UAP A;  2RV9 A;  2XQX A;  5C7G A;  4KMQ A;  4QX0 A;  1R64 A;  3VDA A;  4ZXE A;  2VZ1 A;  3SEE A;  2Y64 A;  2WYS A;  1W9W A;  1L7R A;  2WUH A;  2BBA A;  3HNB M;  2Y6G A;  1GOH A;  4W4Z A;  2V5D A;  3P1I A;  3VD3 A;  1UY0 A;  3LEK A;  1GQP A;  4OMC A;  4CUC A;  4JKM A;  4UOJ A;  5I0D A;  2XHN A;  3C7E A;  2VCB A;  3T0B A;  2WO2 A;  5J1X A;  1O59 A;  3WNM A;  3IAP A;  4M4P A;  2VMC A;  4TTG A;  2QQN A;  3PUH A;  2W94 A;  3AC0 A;  3CMG A;  3I2G A;  1NX9 A;  1OF4 A;  3LPF A;  2X05 A;  5JUV A;  1HN1 A;  3I3E A;  3VD7 A;  1PMH X;  4P5Y A;  1F4H A;  3ECQ A;  3C7H A;  3THC A;  3VDC A;  3WNK A;  3MUZ 1;  4M4R A;  1YQ2 A;  4DXT A;  2HYX A;  3HEI A;  3WSO A;  4QAW A;  3ACG A;  4DUV A;  1JZ5 A;  2ZEZ A;  2VZT A;  4XZU G;  3WNN A;  4P08 A;  1XC6 A;  4RYD A;  5C71 A;  1J84 A;  2QQO A;  4OZO A;  5IYY A;  2J1R A;  3I2F A;  3LEI A;  3I3B A;  3A7Q A;  4L0P A;  4XUQ A;  2YC2 A;  4QDQ A;  2L9L A;  3C8X A;  5C70 A;  5IFT A;  2E32 A;  3T2Q A;  1JZ4 A;  3MV1 1;  4PT6 A;  3SEP A;  5JXG A;  1KGY A;  1OH4 A;  1F4A A;  3MBW A;  2J1T A;  2WO3 A;  1ULO A;  2W47 A;  4KI5 M;  4LHS A;  2PQS A;  2HLE A;  3VD4 A;  2W46 A;  3SKV A;  1H6Y A;  4GWI A;  4A41 A;  3ACH A;  4PF1 A;  3DYP A;  2JE8 A;  2VQT A;  2JD9 A;  5G05 L;  5DN2 A;  1WCQ A;  1KEX A;  4CU6 A;  2BER A;  4DUX A;  1P8J A;  1EUU A;  1OD3 A;  5JR2 A;  4ARX A;  1JYN A;  4D0Q A;  3MO4 A;  1ULP A;  1PX3 A;  4GWJ A;  5CYY A;  4PQQ A;  4P00 B;  1H6X A;  2W1S A;  4A45 A;  4XVH A;  2YFZ A;  2V4V A;  1W9S A;  2VCA A;  4DUW A;  2VC9 A;  3LPG A;  3WF4 A;  3OBA A;  3IAQ A;  1J83 A;  2V72 A;  1SDD B;  3LEG A;  5EJ1 B;  2J1U A;  2RJ2 A;  2EIB A;  3FL7 A;  2RVA A;  2VZO A;  2E26 A;  3HJR A;  2WZE A;  4FI9 A;  1DP0 A;  1NUK A;  2J22 A;  2WZ8 A;  2W1W A;  2DCJ A;  2ZXQ A;  4KWU A;  4XUT A;  2WAB A;  1O8S A;  2CDO A;  3IDA A;  1K12 A;  2CDP A;  2J1E A;  4DEV A;  3CQO A;  2VMD A;  3MUY 1;  1XNT A;  3THD A;  4OYU A;  3OB8 A;  1JZ3 A;  3ABZ A;  3OGR A;  1JU4 A;  3WNO A;  2DDU A;  3CDZ B;  5FUI A;  3P6B A;  4D8M A;  1JZ6 A;  5DPN A;  3GM8 A;  2WAO A;  2VZ3 A;  2W95 A;  2ZEY A;  4W8J A;  2W9X A;  1GMM A;  3F2Z A;  2ORX A;  2JDA A;  4RN5 A;  3WNP A;  4BJ0 A;  1W8N A;  1UY3 A;  4CU8 A;  4OMD A;  1LNS A;  1CZS A;  2XON A;  2WDB A;  4YPJ A;  1K42 A;  3CZU A;  3WF0 A;  4JHZ A;  3J7H A;  4IUG A;  3EYP A;  2XOM A;  3LQC A;  4CVU A;  1JYW A;  5IFP A;  2QQJ A;  3OGV A;  2LS6 A;  4XUO A;  1UXZ A;  5IJR A;  3GGL A;  4BK4 A;  2VZS A;  3UET A;  5JMO A;  2W1Q A;  2LW8 A;  3A21 A;  4A44 A;  3ETP A;  5B4X A;  5B4N A;  1GNY A;  2Y8K A;  1JZ7 A;  1CIY A;  4DEQ A;  2OKX A;  3EB7 A;  1NKG A;  1UMI A;  1I5P A;  2ID4 A;  3IB3 A;  3OEA A;  4TXW A;  3GXU A;  2J7M A;  3C7G A;  4XUP A;  1RYY A;  2VOT A;  2BGO A;  4QX3 A;  1SHW B;  1IQD C;  2X09 A;  1DYO A;  5F7U A;  3T0D A;  5EIY B;  1UX7 A;  2VZV A;  4DXR A;  2W3J A;  4GZ9 A;  1K3I A;  3K46 A;  1JHJ A;  2YB7 A;  3MV0 1;  2W92 A;  4JX0 A;  3DEC A;  3FN9 A;  3A23 A;  2Y6J A;  5LA2 A;  3SKJ E;  1JI6 A;  3III A;  4BDV B;  4HG6 B;  3VD9 A;  2QQM A;  3I3D A;  4P02 B;  3WF3 A;  2VCC A;  1W8O A;  3DYM A;  3GDB A;  4QB2 A;  3ACI A;  4CU7 A;  1T2X A;  5G04 L;  1CX1 A;  4ZZ8 A;  4BK5 A;  3WQB A;  3NQH A;  1WKY A;  2B9V A;  1UYX A;  4UI9 L;  4AAX A;  1JYX A;  1UZ0 A;  2EID A;  3FHQ A;  1CZT A;  2VZQ A;  2BZD A;  4MGQ A;  3NRU A;  3NJX A;  3T0A A;  3T09 A;  1US2 A;  3I97 A;  5HXM A;  2VR4 A;  1UWW A;  2QQI A;  4LKS A;  3K77 A;  4XUR A;  3I2J A;  1GOG A;  5A1A A;  2E31 A;  2WN2 A;  2WN3 A;  1NAE A;  4QX2 A;  3C7O A;  4CUA A;  3LE0 A;  1K45 A;  1XNA A;  3OEB A;  2VME A;  4MOA A;  1UYZ A;  2WQ8 A;  2W87 A;  2VTF A;  1D7P M;  3T2P A;  4QX1 A;  3I2I A;  4JKL A;  1PMJ X;  3CKH A;  4LQR A;  4QDR A;  4W50 A;  4A3Z A;  2C4X A;  2YFU A;  4E8C A;  4DXS A;  1GUI A;  4OUE A;  3VDB A;  2J1A A;  3ZM8 A;  3HNY M;  2WAA A;  3WF1 A;  2VM9 A;  2E33 A;  1JYV A;  5JXJ A;  2W5F A;  3OG2 A;  4AG4 A;  1XPW A;  1PX4 A;  2VZR A;  4QPW A;  2ORZ A;  1OF3 A;  3PUI A;  5HPO A;  3E1F 1;  3HOB A;  5LCW L;  2Y6H A;  1TVG A;  1UY1 A;  5DQ0 A;  4QB6 A;  3NNG A;  3UES A;  2QBX A;  3U37 A;  2QQL A;  4MAD A;  3ACF A;  4MO3 M;  4ET7 A;  2VQU A;  5JXI A;  4JKK A;  5JXH A;  5CZK A;  4CUB A;  4CU9 A;  1JZ2 A;  3T2O A;  4ZY9 A;  3WF2 A;  2C26 A;  1UXX X;  1US3 A;  1EUT A;  3FHA A;  1JU3 A;  4ZZ5 A;  2J1S A;  1UY4 A;  5EJZ B;  3CIH A;  2WBK A;  1W9T A;  2VMF A;  3HNM A;  4QB1 A;  2BGP A;  4Z2A A;  2B4K A;  1GU3 A;  2YG0 A;  2VJX A;  4XUN A;  1W99 A;  3K4D A;  5LA1 A;  1OT5 A;  3BN6 A;  5LA0 A;  3WNL A;  3T08 A;  1L7Q A;  2C9K A;  3A22 A;  3JXS A;  2J1V A;  3DYO A;  3OGS A;  2R7E B;  1SG3 A;  3C7F A;  3UNP A;  2JKX A;  2W1U A;  1W0N A;  2VO5 A;  1UY2 A;  2VZP A;  3NJV A;  5IHR A;  2KD7 A;  4A6O A;  3HPN A;  1UYY A;  3I2H A;  1UMH A;  3D3A A;  1BHG A;  2YC4 A;  2W91 A;  2Z4F A;  4BXS V;  2ZEX A;  4A4A A;  5DMY A;  3CZJ A;  1DLC A;  2WO1 A;  2Y6K A;  1GOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...