3SEEA

Crystal structure of a putative sugar binding protein (bt_4411) from bacteroides thetaiotaomicron vpi-5482 at 1.25 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
b'QNLIKNEKFATEVTNKVTNPSKATAGEWFIMNNEADGVTTIAWEQTGDAKYPNAMKIDNSGAEKNTSWYKAFLGQRITDGLEKGIYVLTFYAKAKEAGTPVSVYIKQTNEEKNDNGKLNTTFFMRRDYDADAQPNASGAQYNFKIKDADKWTKVVVYYDMGQVVNAISSKKSNPALEVSDTDDDAAILKDCYVAILGQNKGGVVEISDVTLKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sugar binding protein
molecule tags Sugar binding protein
source organism Bacteroides thetaiotaomicron
publication title Crystal structure of a Hypothetical sugar binding protein (BT_4411) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution
rcsb
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15425 DUF4627 Domain of unknown function (DUF4627)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3seeA00
2VZVA 1DLCA 2QBXA 2YG0A 4IUGA 2W1QA 4QX0A 2VR4A 1UY1A 2C4XA 3CIHA 2V4VA 2HLEA 2VZRA 1UX7A 5DPNA 2C26A 5A1AA 3WEZA 2WZEA 3OEAA 2W1SA 3SEPA 4CU9A 2VL4A 4XUTA 2DCJA 2WAOA 1CZVA 2W92A 2V5DA 3NNGA 5JXIA 1F4HA 1W99A 1GNYA 2WQ8A 4KI5M 2YB7A 1JZ5A 3WQBA 1JYWA 2ID4A 1UZ0A 2W1WA 3MV11 2W94A 3FHQA 2W1UA 2VQUA 2XHNA 4PT6A 4DEQA 1XC6A 3D3AA 3IAPA 5LCWL 2J1EA 2Y6GA 2HYXA 5G05L 1O8SA 3T2OA 2WBKA 2VTFA 4OYUA 1F4AA 3W5NA 3IDAA 3K4DA 5FUIA 3UNPA 1ULPA 1SDDB 2QQJA 3VD7A 1US2A 2VJXA 4MGQA 5JXGA 1SHWB 2E33A 5JR2A 3I3EA 3LEIA 2C9KA 1JI6A 1GQPA 2Y6HA 3CDZB 3DYMA 1GOHA 2Z4FA 3FL7A 2W9XA 4XVHA 4QDSA 5DN2A 2BZDA 3WNNA 3MBWA 4P08A 2VCAA 4UAPA 1L7RA 2W87A 1K3IA 2B4KA 3THCA 3LPGA 1K45A 1GUIA 2YC2A 3ETPA 4QB1A 3F2ZA 3I3DA 1TG7A 1JZ7A 3AC0A 1US3A 3ACHA 2E32A 3K4ZA 3A22A 4CU6A 1GMMA 2WYSA 2WO3A 1H6YA 3LPFA 4E8DA 2BGOA 3OB8A 4OMCA 5JXJA 5CZKA 3SEEA 2VQTA 3P6BA 1XNAA 3BN6A 2W46A 5JUVA 2VM9A 5B4XA 3WF1A 3MV01 3T0BA 4W8JA 3HEIA 2VZ1A 1OH4A 1JZ8A 2VMEA 2PQSA 1OT5A 4KMQA 3WSOA 5LA2A 2VZTA 4D8MA 5IFPA 3A21A 2J1UA 1WCQA 4ZZ5A 3IB3A 5HXMA 4D0QA 4MOAA 3OGVA 5EIYB 5IHRA 1R64A 3NJVA 2QQLA 2XQXA 2QQKA 1UY4A 4MADA 3I2HA 4W50A 1W9WA 4LKSA 3I2IA 2E31A 1W0NA 3J7HA 4QB6A 5CYYA 3WNMA 3OEBA 4XUQA 4KWUA 4L0PA 4QPWA 1W8NA 3VD3A 4DUXA 1JYXA 4E8CA 1LNSA 2ZEWA 2B9VA 2W47A 4OZOA 4PQQA 2EIBA 3VDBA 2VZUA 3GXUA 3K75B 4BK4A 3NJXA 1JZ6A 2VZOA 1ULOA 1TVGA 1UY0A 4LQRA 2EIEA 2J1VA 3PUHA 2VZ3A 3ZM8A 3C7GA 2YFZA 3HNBM 3PUIA 4AG4A 1WKYA 5J1XA 3ACIA 3HOBA 3WF2A 2WO2A 1JYNA 2QQNA 3U37A 1W9TA 2WZ8A 3WF4A 1NX9A 4ZXEA 4ARXA 4CU8A 1OD3A 3T08A 1GOFA 1D7PM 3HJRA 3HN3A 2Y8KA 3UETA 1XNTA 2WN3A 4LHSA 3GM8A 4BJ0A 4LPLA 4ZY9A 2OKXA 3LE0A 4P5YA 2VCCA 1CX1A 1KEXA 3OGSA 5JXHA 1JU4A 4XUPA 5IJRA 2BERA 1IQDC 1GOGA 1CZTA 3K4AA 4TXWA 5IYYA 3K46A 2WDBA 2XOMA 4MO3M 3T0DA 2W3JA 3FN9A 2RV9A 1J83A 1CIYA 3WNKA 3HNYM 4OUEA 4JKLA 2VMCA 3SKVA 3T2PA 2J1SA 2Y6KA 2BGPA 2KD7A 3NQHA 2QQMA 3T0AA 5EJZB 4A44A 3WNLA 1MPXA 2RJ2A 4ZZ8A 5C71A 3ACFA 3UESA 1JZ3A 4CUAA 2DDUA 3VD4A 1UYXA 1NUKA 2X05A 1DP0A 2VO5A 4XUOA 4A41A 2VC9A 3DYOA 3WNPA 3C7EA 3T2QA 3I97A 3MO4A 1UYYA 4DUWA 1YQ2A 1KGYA 2J7MA 2LW8A 4OMDA 4QAWA 1BHGA 1EUTA 2ZEXA 2LS6A 5LA0A 2WN2A 3GGLA 4PF1A 5EJ1B 4QB2A 3I3BA 4JHZA 4HG6B 2Y64A 1PMJX 3A23A 2XONA 3VD5A 1J84A 5B4NA 3EB7A 1DYOA 2YFUA 5F7UA 2VMFA 3K77A 2X10A 2CDPA 1H6XA 2J1AA 3CQOA 4DEVA 4GWIA 2V72A 3CZJA 1PX4A 4QDQA 3C7OA 4CVUA 4CUCA 1UY2A 2VZQA 4TTGA 3SKJE 3WF3A 3WF0A 2JDAA 3W5MA 3CKHA 4MGSA 1OF3A 4GZ9A 2ORXA 5IFTA 2BBAA 5HPOA 2J22A 3I2KA 4QX2A 4JKMA 4ARYA 2YC4A 2W95A 4XUNA 1K42A 1NAEA 4BK5A 4XURA 4CUBA 5DMYA 2EIDA 1JU3A 1O8PA 1P8JA 4A42A 3ECQA 3DYPA 4DUVA 3DECA 1UXZA 1JZ4A 3LQCA 2WABA 3IIIA 1W8OA 4QX3A 1RYYA 2QQIA 1CZSA 1JHJA 2VMDA 3VDAA 3IAQA 4QX1A 2W5FA 3P1IA 2J1RA 3OG2A 4P00B 4RN5A 1L7QA 1UMIA 3VD9A 2R7EB 3A7QA 1PX3A 1UMHA 2Y6LA 2VZSA 4A45A 1UXXX 4ET7A 2EICA 4GWJA 3ACGA 4BXSV 5DQ0A 1T2XA 3VDCA 3CMGA 1W9SA 2RVAA 5G04L 3CZUA 2Y6JA 4JX0A 1EUUA 4A4AA 3C7HA 4QDRA 2ORZA 3I2GA 4AAXA 3MUZ1 5C7GA 1O59A 1JZ2A 2JE8A 4BDVB 2W91A 1HN1A 4DXSA 3E1F1 4DXRA 3GDBA 2DCKA 3C7FA 4RYDA 4XZUG 4M4PA 1NKGA 3NRUA 3T09A 3I2JA 4YPJA 3FHAA 4P02B 3HNMA 1JYVA 3I2FA 1SG3A 2J1TA 2WAAA 3THDA 4DXTA 2CDOA 2ZXQA 1XPWA 3MUY1 3C8XA 1PMHX 2X09A 2JD9A 2QQOA 3HPNA 3LEGA 3WNOA 2ZEZA 5I0DA 2L9LA 2WO1A 3JXSA 2ZEYA 3OGRA 1GU3A 1UYZA 5C70A 5JMOA 3OBAA 4CU7A 4JKKA 1UWWA 3BGAA 3EYPA 4M4RA 4A3ZA 2VCBA 4Z2AA 4FI9A 1I5PA 2JKXA 3LEKA 4UI9L 4A6OA 2WUHA 3ABZA 2E26A 5LA1A 2VZPA 2VOTA 4UOJA 1UY3A 1OF4A 4W4ZA 1K12A
chains in the Genus database with same CATH superfamily
4Q4V1 2JIGA 2XLFA 3FBMA 1BVVA 5FPUA 2YG0A 4IUGA 5F5AA 4W65A 2W1QA 1QXJA 5GLUA 3U10A 4D3WA 4FAGA 3H8RA 5I91A 1HJFA 1LU2A 3S30A 2C4XA 3N9PA 1QQP2 1R1ZA 2QDRA 3M4FA 5A3OA 2WQ4A 2VZRA 3ILRA 2CGPA 3DXTA 3SITA 2GP3A 4NHMA 1NCRC 4FBFA 4Q4X1 2WZEA 5FZDA 1V6IA 2VPVA 4WM8A 5EXOA 1TME3 1IG0A 1WBFA 2CHHA 4AL9A 1QOOA 1GR3A 1H30A 5JSRA 2VL4A 4AVSA 1IGOA 4OUMA 1CZVA 3ON7A 4UFLA 4LMFA 4R9AA 3ZKYA 4D6SA 4IGOA 1YUDA 3KVBA 4NRPA 3HWJA 5CNAA 2G4IA 1H1IA 1ZBE2 1BXHA 3KF3A 4KI5M 1OQ1A 5KC6A 3ZXDA 1RUD2 1JYWA 3WDYA 3AX4A 3R0RA 3G7DA 1C8NA 4QPIA 2X5IC 4Q4Y2 4C90A 2BRTA 2HWB3 3H8OA 2RS32 4BLJA 5LA9A 4HBNA 3ZFFB 2J1EA 2WZPP 1H2NA 3MIGA 1JUIA 3NV4A 1IKQA 3J7LA 4YM2A 4IEVA 1HRV2 4AW7A 2RM23 2HYXA 3VBHA 2VE1A 1QNWA 4OQ8A 2RDSA 1WLWA 3OD4A 2AR6A 3WY6A 5FZHA 5FYTA 4P5HA 4XBLA 2O0OA 2JG9A 3NV2A 1XU1A 3N9OA 1QJEA 1QU0A 4M0HA 2WJSA 3BTYA 1S4CA 4AK3A 5FAXA 3JBG2 5FQ0A 3ST7A 3I2OA 2ZGNA 3B02A 1R081 1KQRA 3NJZA 1CVNA 1JI6A 3WG2A 3CDZB 3VBOB 3UV9A 1GOHA 1GZCA 2XJPA 5FO7B 2MEV3 2GMMA 4Z82A 2JDZA 4Q0VA 2DFBA 2QDNA 3ROUA 4COWA 2F6BA 1SFNA 3WNNA 3Q8FA 4P08A 1C4RA 1W2AX 4XDQA 3WG1A 2GDFA 4Q5OA 3MDPA 1R091 4XFGA 3DGTA 3SLIA 1EP0A 2RS11 3CHXA 1EY2A 1QJFA 1TG7A 2ZHNA 3PUAA 5C9AB 1POV3 1VBE3 1VBA2 3ZYFA 3SH4A 1CAVB 1TQ5A 2C0ZA 2DYCA 3B00A 1ND3A 3SISA 3ZFEC 3AC0A 1EPWA 1RINA 1US3A 4NIDA 4E4SA 3PUSA 4S2DA 1ULCA 2QFEA 4NO4A 1U5IA 5F3GA 1FOD1 1H6YA 2OPKA 4BA6A 1PGW2 1DGRN 3POYA 1O3SA 1LB2A 1JTZX 2RJKA 4GA9A 5FY1A 1WCSA 4K1YA 4YZ4A 1HRV3 1W04A 3M70A 3VV1A 3V56A 2UU8A 3AMPA 3JQWA 5JWPA 1OHFA 4LNVA 3IBMA 4F3JA 1OFSA 1UU6A 2BDRA 3BN6A 4X8NA 4CPBA 1W6OA 5J96B 5CVRA 4IDZA 3LFMA 2XUMA 1QQP1 4MUVA 1MZFA 4P9WA 3H7JA 1AHSA 1RHI1 4OLLA 1WMEA 1PZ9A 1CWPA 4Q0SA 2P6HA 4FFHA 5IVVA 3GNEA 3HEIA 3HQUA 5K7PA 1CGPA 3AL6A 5GZEA 1OH4A 5IK5A 4QXHA 4LUKA 3MFAA 3NWKA 2EXIA 1S0DA 1VBB1 2D43A 1JODA 2WT1A 1KD7A 2Q0AA 1V70A 4NIAA 5LA2A 2VZTA 5EJ3A 4D8MA 5IFPA 5FY5A 4Q0QA 3CBNA 3ES4A 4ISQA 2BWAA 2H6BA 4J1XA 3RMXA 3WP5A 4QPIC 4N7IA 1NE6A 3MZHA 5JMCA 1O7FA 4NPMA 1LCLA 3ZSJA 4EN7B 5JZGB 3IB3A 5BNOA 5HXMA 2HBTA 5CEHA 3O1SA 3NL1A 4P9XA 4SBVA 4JCKA 4O65A 2D40A 1WA4A 2JX9A 2CGNA 4RL7A 5IT6A 3T1MA 4XJ9A 2WKKA 1PMIA 4I02A 5F6LB 2JD4A 1UY4A 4WVWA 5DDJ1 2BBVA 2WINB 1HXS2 4LLFA 1W9WA 1RUH1 1QJU2 4LKSA 1ULGA 2JDMA 3JCIA 2ZMLA 1ZZCA 1HB4A 3MGUA 2OYZA 1RUJ2 2HWC2 1OVPA 4PIXA 4AEDA 3JD72 1RGSA 2GMEA 2BNNA 1OVSA 1RUC2 1FI2A 1EV11 1RVF3 2JIJA 5ANQA 4HK9A 4KWUA 1ALYA 4NHYA 4YVSC 1LNSA 4ASLA 2ZEWA 4PQQA 1VRH2 2EIBA 2FDJA 3VDBA 1RHI2 2DVBA 1RC6A 1H2MA 2XJVA 4BK4A 3AFGA 4XJWA 2RDNA 1H8TB 4O9EA 3LOBA 2DU0A 1ULOA 3UKNA 2YU2A 3VBFC 1OD5A 2ENRA 1GANA 3FUOA 3I59A 5FYUA 4COUA 2IXIA 3FFQA 5GZGA 1UU4A 4FQ4A 1LGCA 5FZGA 2J1VA 3OBZA 4QGMA 1IPKA 1B35A 1UYPA 2UY8A 2VZ3A 3C7GA 5SV8A 3ZSLA 5A32B 3POGA 3VBRA 4AG4A 3IZOA 4S2FA 3ACIA 4NRMA 4A2UA 3RPQA 4LBLA 1HW5A 2WO2A 1JYNA 1ONAA 3M8LA 2ZZJA 1NQJA 4AQ2A 2WZ8A 1YQ5A 1AX1A 1QXRA 4U36A 3WF4A 1NX9A 4RD7A 4ZXEA 3AKSA 1ZZ6A 5FREA 4INDA 4WVZA 1Q8VA 5KHKA 4GB32 4N43A 1YJLA 2A75A 1HLCA 4G4FA 4H7LA 4N9IA 4QXCA 2X5IA 1FPN3 1PVXA 2DUQA 3AB0A 2LM3A 3FC0A 2VVFA 3I59B 5LBCA 3UETA 3GZTB 3WCSA 3FLRA 3ZYPA 1G7YA 2WN3A 4GMP3 5FXZA 3GM8A 2B45X 4UFJA 3KS7A 4LPLA 1QJY2 3JU9A 3LE0A 4BHPA 4EWAA 3VDDB 2GZWA 5KWRA 5LBEA 4FOWA 1I6XA 4HVRA 1CX1A 4LR4A 1W9YA 1KEXA 3R4SA 3JZVA 3ZSKA 4A6SA 1JU4A 4GAZA 4MHUA 4FPKA 4WVVA 4XJ8A 1UCXA 4XUPA 2GH8A 2BERA 1WWYA 1CZTA 2XJSA 3VBHB 2J42A 1C1FA 3K46A 2XOMA 2XB6C 3N36A 4XXAA 5C9AC 3N9LA 1B35C 1S2BA 3MLJA 1AL21 4L8QA 2W3JA 4MO3M 4WM8C 2RV9A 2VW2A 3WNKA 2SLIA 2JG9B 3HNYM 2G19A 4OHVA 4ATFA 5LBFA 1URXA 4C8DA 1R1A1 4P9JA 1NY71 1FYUA 2E7QA 2VNGA 3LD8A 4AI9A 3O14A 3T4VA 3APBA 2QQVA 1SPPB 3MW4A 4X6RB 3IIAA 5CKMA 4AHZA 4Q8LA 3AVSA 3ZX7A 4AI3A 2PA7A 1RITA 1QNYA 2XH6A 3EO6A 3POFA 1YJKA 2KR2A 4UT5A 1MPXA 3RJ2X 3WNLA 4ZZ8A 5C71A 2WNUC 5DZEA 4XTMA 1ASJ2 5FV3A 3NO8A 5I8SA 3UESA 4BQYA 1Q3EA 2DDUA 2R49A 3ZYBA 5CG8A 1POV0 5LASA 3UJQA 4FTBA 2XGXA 4MGKE 4R4ZA 1DP0A 2NN8A 2VO5A 5A7NA 3AP9A 3WNPA 2VUDA 4RSUA 2R073 1YQ8A 2OUHA 2R063 4YFZA 3T2QA 1OBNA 2BYVE 5JIUA 4Z92B 3OYWA 2RS33 1TME2 2W08A 5DAQA 4DINB 4Z1VA 3POJA 5I8TA 2B46X 5FPVA 1HKDA 1I5ZA 3VL9A 1Y9GA 3HMYA 4AAPA 4AZZA 4K21A 4D94A 5L19A 4B1LA 3BU0A 1EUTA 2ZEXA 3LKJA 2LS6A 2ZPXA 4NWWA 5LA0A 2WN2A 3KCXA 5FJKA 1Q8SA 2D5HA 4QB2A 4AQSA 1YHFA 3I3BA 3J4UH 4IL7A 4HG6B 4JHZA 4QGLA 1DQ6A 1YLLA 1ZRRA 3Q8EA 4YGDA 3USUA 1PIV2 3JD73 5B4NA 4NHLA 4PI2A 4YW7A 5EQUA 1ZA7A 4OHYA 5IVCA 2FCUA 2PQQA 2Y6FA 4KL1A 4NPRA 2PXJA 4KBZA 2Q8OA 1H9PA 5DUUA 1FV2A 5E8AA 3JD71 3PL0A 4ES8A 4A3XA 2HWE1 1H6XA 1C28A 1C5IA 3KD4A 2E63A 4AI1A 2XBO2 4FAHA 1W0OA 3RSJA 2DUPA 2E53A 1LULA 2C1FA 4DEVA 5C5UA 3J8F2 4GWIA 1G9CA 3TN91 5BNPB 2PHFA 3E5XA 5LBBA 4EJRA 3H42B 4J1WA 5FYIA 2WZR3 1JW6A 5FMBA 4M3CE 1UY2A 5FZ6A 3W20A 2JJ6A 5C4WB 2BFUS 1IQAA 4CXWA 1XXNA 4YW2A 4LLOA 2JDAA 4UWDA 1K5MC 3NNLA 4DOUA 4FP3A 3LB9A 4NN0A 1K5MB 5IFTA 1HXS1 3I2KA 5BNNC 3B3QE 4EV0A 4JKMA 4ARYA 1ZBE3 5FMCA 3ZFEA 2ET7A 2DBNA 1NAEA 2H0VA 1ND3C 1N1YA 2UY9A 5KHGA 4NROA 1V6LA 2XBO1 4N90A 3UT0A 3E6BA 1V9U2 1FMD2 2D7FA 3Q8AA 4GALA 3TNQA 1COV1 5F3EA 1RUI3 1DQ5A 1MS4A 4DUVA 3I3MA 1UOFA 3LQCA 4LHLA 4DZGA 3RJRA 2WABA 1OXCA 4G9SB 4IEYA 4QX3A 5EPAA 4QKDA 2R16A 3M3QA 3AYAA 3EMRA 3AP7A 2Q8CA 5DZFA 1RUE1 1HV0A 2CAUA 3IAQA 3KV4A 1HQWA 3R4DB 4TYSA 5EV7A 2VQ0A 5FXXA 1UPIA 1SMVA 3ZYJB 1JOBA 5CFDB 1L7QA 1PVC1 2DVFA 3FE5A 1W05A 4GJZA 4UF0A 5HCFA 3UYJA 4BQ1A 3VHNA 4IE0A 4JVAA 4JGYB 2E6VA 2BV4A 5DUWA 2P37A 1UXXX 4YVWC 2BW8A 3RMYA 4AR2A 5DQ0A 3VBHC 1ZBA1 1ZZ9A 3VDCA 4CA9A 4MHRA 4NOTA 3WW4A 2Q4SA 2YDEA 1REDA 3ZN5A 2YGMA 4CDWC 3QH7A 3ZXEA 1J3QA 3HQRA 4QM8A 3WZ1A 4M00A 1DZRA 1FMD3 3I2GA 5FXWA 3RFRA 3VBOA 1SCRA 4AAXA 4IV3C 1R092 2JE8A 4MH0E 3MIFA 4KGGA 2Q30A 1FAYA 1HN1A 2EXKA 4DXRA 3GDBA 5AFEA 2HWD1 1AJKA 3CLPA 4KG0A 1COV3 1N1VA 4RA0A 3HBZA 3VBUA 4RYDA 3N9NA 1DCSA 1W2OA 4NIIA 2RS12 4XZUG 4M4PA 3S7IA 3J8F3 1NKGA 3N7JA 1DYPA 3NRUA 3SH5A 1V6KA 3NSTA 2FMYA 3BIWE 4IE6A 5LEJA 3USUB 5FCCA 2KM2A 1XQNA 2OQ7A 4YPJA 3GBFA 1O4YA 5FBZA 4P02B 4UBHA 4I2OA 4IV1A 3H3LA 4XF9A 1O6UA 4CCOA 3B5LB 2QKDA 1JYVA 3MF6A 4XEZA 4OI2A 1AXYA 1BEV3 2EXHA 4XPVA 3POIA 3I49A 3KMHA 2P2KA 3PVEA 4NVPA 1XPWA 3C8XA 2Z79A 1GZTA 1PMHX 2X09A 4E2SA 1S1AA 5LK7B 3TEZA 1WMXA 3HPNA 3LEGA 3LDRA 4FVVA 2ZEZA 5I0DA 1TNRA 1ZNPA 3JXSA 2GNTA 3UGGA 3BI3A 3OGRA 4JRLA 5FZIA 4GKYA 5H9QA 3VKFC 3OBAA 4CU7A 5A3LA 1D2SA 3J7NA 3BGAA 3DN7A 3EYPA 1E5HA 4A3ZA 3U1XA 2CSGA 3O1VA 2HKXA 2VGDA 2A3XA 1IKPA 4YG0A 4XOGA 2VNRA 2VOWA 2WUHA 3WHTA 4TWTA 2EIGA 2ARAA 3VUOA 2DCZA 5FYMA 5LA1A 1ODNA 2E7AA 1XE7A 5FK7A 1X7NA 2AUYA 3KLSA 3GYDA 3FMGA 5KHHA 2VNVA 4COZA 1D4M3 2WT0A 1F5FA 1G9FA 3ZXFA 1OF4A 2VNOA 5FUNA 3VBFB 3HIFA 3AXDA 4W4ZA 3AP6A 4KGQA 1V6NA 2WNUA 1FXZA 3UGHA 4CE8A 3ZYRA 4CUGA 2ZGTA 3CU7A 2DTYA 3EBRA 4QX5A 3RWKX 5K9YA 1NCQB 3D8CA 2CYFA 2VR4A 4H2AA 1UY1A 2ZGRA 3CIHA 5BNOB 3RYKA 3C3VA 2V4VA 4XQWA 5IUQA 4AGGA 5IVFA 4RS5B 5DPNA 2C26A 5F8PA 2XG3A 5A1AA 3WDVA 1LHNA 5IK8A 3VDDA 1LEMA 1ZA4A 2GN7A 4JHTA 1UAIA 4BWOA 2W1SA 3SHRA 3RZLA 5IATA 1ZRIA 2WA3A 3SEPA 4CU9A 4E4ZA 4LE3A 2WAOA 3RYPA 2V5DA 3NNGA 5JXIA 4OZXA 2AREA 1W99A 1D4VB 1Q5OA 5FK8A 4XABA 3E6DA 4UFHA 4B7EA 5JSPA 4KQ7A 2R0HA 2R6QA 2JENA 2RS13 5F32A 1MS3A 2YB7A 2EA7A 4Q4W3 3S6PA 3NNJA 2EF6A 3BVCA 3ORJA 5KHIA 3MV11 1IOAA 1QDOA 1S0FA 4HANA 5JOYA 2R072 2NPIA 3FHQA 2IXKA 2QQUA 3IM0A 1MS9A 4GH4A 1GWLA 3U0ZA 2DBIA 1MZ6A 1H2KA 2W1UA 3PMSA 4N43C 4PT6A 4XMAA 3D3AA 4MGIE 5K0UA 4RR3A 1B35B 3ZOIA 1HJGA 3KCYA 3OUIA 4N53B 5L9RA 1W6OB 4HPKA 1RUOA 2WBKA 4OYUA 5FLHA 5T5OA 3AJYA 3IDAA 5FPAA 3H50A 1W6NB 3K4DA 5FUIA 3J8F1 3IDBB 3O0WA 2WIIB 3O0XA 3VKLA 3VD7A 4AFAA 3VBRC 3UNPA 2GMPA 1FPN2 2VJXA 3JB8A 4MGQA 2XHKA 5K4LA 1KDMA 1SHWB 2E33A 2QCSB 2WFF3 2C9KA 3LEIA 3AL5A 2LALA 4EQVA 2DF7A 1LENA 1Y7BA 2CWMA 1XE0A 2Z4FA 4NMIA 1O91A 2JDHA 1EV13 1AL23 4XVHA 4QDSA 4V1PA 5DN2A 3W21A 5JOXA 3H9AA 1WW6A 1CIWA 1HX6A 1OQEA 2BZDA 2PHRA 2ZKLA 1PGW1 3MBWA 3OBTA 4PDWA 4UAPA 4YVSA 3WXPA 1L7RA 3O1UA 3RRDA 4FOQA 3ZSEA 1K3IA 5CU1A 3DPRC 1C8M2 3V0AA 1GUIA 2VAUA 3T4HB 3ETPA 1E5RA 2JDPA 3BB6A 3I3DA 4AEDC 1LKNA 2PN5A 3MEPA 1SFPA 2BOIA 3H1MA 3P5BA 1AR73 2OVUA 4C0HA 1YI7A 2O8OA 3FBYA 1PZ8A 5I0TA 1W28A 3K4ZA 1DQ4A 3WP6A 3W58A 4AI8A 2WO3A 1X9TA 3LPFA 4E8DA 1QWRA 1X8MA 2MPFA 2BGOA 1SLTA 3X29B 5A6QA 4YARA 4XFHA 4H3WA 5CKQA 4OMCA 5J37A 5JXJA 2YROA 2ZCWA 2K0GA 5ACA3 1RB8G 4LBMA 3V0AB 2XPJA 3SEEA 2VQTA 1V6MA 5ABJB 3P6BA 1XNAA 2WZR2 4BOWA 4UFIA 3BKZA 2W46A 2WWSA 4Z2WA 3FX3A 3O7OA 2WQZC 4LJHA 4XCBA 3LSEA 5GLZA 3MV01 5F3IA 4W8JA 3WF1A 4RFT0 4Q8KA 4QGNA 4CPBD 4QT6A 2VZ1A 4Y1VA 1W8ZA 4DRVA 2PQSA 1OT5A 4QPGB 5IW0A 3P3PA 5DAPA 5GM0A 3H8XA 1GP6A 5GLWA 5T55A 3WSOA 4IGQA 2KA3A 1RMU1 1FX5A 3D6EA 3M3CA 1AR63 1X36A 1FOD3 3OGJA 2UWBA 4LHKA 4U2AA 1AF9A 2G9GA 1RIRA 2LROA 1WA6X 4MLOA 5L9BA 1W6MB 2YBPA 2OA2A 4XXPA 5JIAA 5FXVA 1YC61 2XLGA 3N4MA 4WM7C 2UYAA 2WLPA 4MOAA 5EIYB 4CDUC 1YYNA 1QMJA 2BNMA 1RUE3 4R8HA 4CEWA 1G9AA 3UKVA 1OA4A 3OOXA 1CPNA 2K2SA 1G9BA 2QQKA 4QD2A 4KWKA 1LOCA 4UBGA 4FPLA 2WNOA 3I2HA 4P9IA 4W50A 3ZR6A 5KHJA 5I0UA 4JGYA 3AFKA 3I2IA 5FZEA 4Y5SA 2PELA 4E27A 1ND2B 3NAPB 5H9RA 5E88A 4CCCA 1QXPA 2BOJA 4QPWA 2QZ3A 1JYXA 1Y4WA 1OSGA 1APNA 2QUOA 5CFDC 3WCRA 3AXEA 2W47A 4OZOA 3AP5A 4IXLA 1W03A 3K75B 1G86A 1W8TA 5FP4A 3OPZA 2GC0A 5E89A 3FZ3A 3RI9A 3RZMA 4IEZA 1VBD2 2BP6A 1DU3D 1C1LA 1H4GA 4LBQA 2Y0OA 1UMZA 3B01A 2WS92 2D5FA 2GC3A 3EJKA 4YM0A 4CDXB 1OFNA 3VBUB 3ZM8A 1AR93 1SFYA 3HNBM 4AVAA 1SBFA 1MEC3 1GNHA 3E97A 2P4EA 4OUSA 1C57A 3BYWA 3K51A 5F37A 2JG8A 1NOVA 4PF5A 5FP3A 3PJYA 5BV6A 5A7PA 5IK4A 1DLLA 1RUC1 5DZGA 3QH6A 3VZOA 5GZCA 1W6PB 3NVCA 3AMQA 3TRSB 1V9U1 2FD8A 4YRDA 4FSJA 2XQRA 1OD3A 1WW4A 3T08A 1GOFA 2ZHKA 4S2HA 5JZGA 1D7PM 3THTA 1CAWA 3HN3A 1SLBA 2Q8DA 1YO8A 3D0SA 3DV8A 3PDQA 4IQPA 1NLSA 1OUSA 4CEYC 4CZSA 4LHSA 4IE5A 4AI2A 1S0GA 4BJ0A 1ZRDA 3M3IA 4GB33 2PAMA 2VCCA 3WQ0A 4NPLA 2B39A 1WD4A 3ME2A 4Q27A 5IAVA 2RR11 1BBT2 2WSVA 2VBDA 3L2YA 4XETA 1GOGA 1YIFA 5IJRA 4BISA 3LDBA 1DGRA 4AI0A 1ACCA 4TXWA 1ULFA 3WQ1A 3ZYIB 4JTOA 1XSRA 4AEDB 2OX0A 1HV1A 1VMHA 4AHXA 4K40A 2A7AA 2MEV2 3KHBA 1IS3A 1MZ5A 1Z78A 4DRRA 5BY5A 2HWE2 3FN9A 1AYN1 3ILNA 1J83A 3KT1A 1CIYA 5DXDA 2PHXA 5F2SA 3V64A 4I3GA 3IMNA 1IS6A 4JKLA 3RDIA 1BCXA 2JDYA 4EN0A 4XFIA 3SKVA 1G9DA 2J1SA 4QPIB 2Y6KA 3PIGA 4AE2A 1CJPA 5A3UA 2XJQA 2A73B 4AQ6A 1WW5A 2Y60A 3GJAA 4JZRA 2RJ2A 4JDOA 3ACFA 3SH3A 4LKEA 4GMP1 3ALQA 4DS0A 1IG3A 1WGPA 4CUAA 1UZYA 1UYXA 3DKWA 4UW5A 4YG3A 2BPA2 2R062 4CP9A 2X05A 2DUOA 4AVCA 4B1MA 5FZAA 1NZIA 4CEWB 4K8FA 1BMV2 4XUOA 1QOTA 1PK6A 5LATA 5FWJA 3LIHA 2BU9A 5GZDA 1YEWA 3HQXA 3I4IA 5FZ4A 3WT3A 2DVAA 1GP4A 1F2NA 3I7DA 3SCHA 1KGYA 3ES1A 4OMDA 4FPGA 5BNOC 4B8EA 4XAAA 4AHYA 4ES9A 1H8TC 3OSDA 5BNNB 4QQLA 1XNDA 3PVBB 4PF1A 4KU8A 3LA7A 4PIYA 5JI7A 4IEUA 1RUI1 1AR81 3MW3A 2C5DA 5FIXA 3VD5A 2XVKA 1TNFA 4AVBA 2ZHMA 1FPN1 3LAGA 4FFIA 1DYOA 3VN4A 1GYKA 1R1A2 1VALA 1PO22 1H1MA 2G9ZA 4RQPA 4A7YA 1AXKA 2ZX2A 4FQZA 1VAVA 4TLGA 4XACA 2X10A 1AL22 1XU2A 4FT8A 4HPKB 4QQPA 1Q8QA 5T50A 5AC91 5A7QA 5J09A 2J1AA 3N7KA 5FY7A 5JCTA 5EWSA 3ZXGA 1PX4A 1Z7S2 2BWCA 3MFCA 3QCWA 4R9CA 4ZS3A 4QDQA 3C7OA 1W6PA 3WDTA 4OCTA 2FZ1A 4EYUA 2C24A 4TTGA 1IHMA 1H4HA 3SKJE 3U75A 2ZX0A 2BUKA 3IWZA 1BBT3 4Q1RA 1LOFA 2XLAA 3CKHA 4XHBA 5FJHA 3TN93 4N8MA 1OF3A 2PLV2 1VPHA 5C3RA 2D6PA 2J22A 5FY0A 3E5UA 1U0AA 5ANNA 5HCHA 2E9QA 3WUDA 2YC4A 2W95A 1LESA 2QJVA 4XUNA 2QVSB 1V00A 1K42A 3VBRB 1BQPA 2RS53 1HDKA 3HD8B 4XC9A 1YFXA 2EAKA 4BZ4A 4JQTA 3ELNA 2ZHLA 1LJ7A 1NA1C 4RHV2 4Y1XA 2ZTNA 3AKPA 1BK1A 4RQPC 5FYSA 3ECQA 3DYPA 3USSA 1ENRA 4XJZA 3ZDVA 1WBLA 1W8OA 3DKQA 3IIIA 1JYCA 1QIQA 4KH9A 3QOPA 4Q4X2 1CZSA 1JHJA 3OTFA 4PBOA 2VMDA 3E5QA 1GP5A 2Y38A 1O4ZA 1GZWA 3IKWA 4K1ZA 1AL0G 2W5FA 2FCTA 2ZJCA 4FPFA 4CEYB 4JV4A 5D8AB 3OG2A 4KBBA 1OPMA 1RUC3 2VXJA 4P00B 1HXS3 1KFXL 1W2NA 1W2TA 2RHPA 4LO5B 2PAKA 4LE4A 4WM8B 5AVPA 1VRH1 4N53A 4XFAA 2JG9C 4GWMA 1YIPA 4HXCA 3WDWA 4V2WA 4K9SA 3VD9A 3GHMA 1BKZA 1Z7S3 1RHI3 3MI8A 4AYUA 2Y6LA 2ADDA 4YGBA 4ET7A 2ES3A 4BXSV 4S2GA 3DEMA 2W68A 3LCPA 4DY5A 5FO8B 5C5TA 2HWF1 1LHWA 1EAH1 1T2XA 4YGCA 5BNPA 1PK6C 3SCFA 1RUH2 3CZUA 2Y6JA 4ISRA 1A34A 2IXJA 5DDJ2 1UF2C 4QPGA 5J98B 1ZRFA 3I2DA 4QDRA 2ORZA 1O3QA 3O1TA 2HWB2 5CAZA 1JZ2A 3O1PA 1MS8A 1HRI2 3RZHA 3PURA 1N3OA 4M01A 2BJSA 2DCKA 3EXUA 3C7FA 1MZEA 3NW4A 3PLQA 1FNYA 1MS1A 5C3PA 1KRIA 4FO9A 3VLBB 1UZVA 1VIWB 2NLRA 1AYM3 3CF6E 4YVSB 1ZREA 1UNBA 4UFMA 3TB0A 4F7ZA 1XE8A 3H7YA 3T3YA 3O5SA 3HNMA 1F31A 1N3PA 3I2FA 3O1MA 1SG3A 1V6JA 4J25A 5KC5A 2J1TA 1JZ4A 3THDA 3N3HA 2QQPA 2PHTA 2CDOA 4F8AA 4E9KA 3G6JB 5AVAA 3NAPA 5FZLA 1F35A 2ZGOA 2Y26A 3BIEA 4BIFA 2GSYA 2QQOA 4XF1A 3OUHA 5FOBB 1MS5A 2GN3A 2L9LA 2RS52 3I3QA 2ZABA 2ZEYA 4P14A 1XYPA 2RMU3 5C70A 2YXSA 1YFUA 2FDHA 2P17A 1PHMA 2XJRA 3UL2A 5D21A 2YPDA 2VOVA 4ONUA 4YW6A 4DMIA 3VHPA 2OZ6A 3AZYA 5BNPC 1TME1 4A6OA 3N7LA 2GNDA 5C8CB 4Q0PA 4Q4X3 4XBQA 5E16A 4AEJA 1C8M1 3ABZA 4Z07A 2EAAA 3RVHA 2V5YA 2VZPA 1AR92 4HKOA 4BXFA 2HEWF 5JPMB 1CAXA 1L3JA 2WS93 4I30A 4CRQA 3POWA 3SNMA 1ZRCA 4UOJA 1J59A 1ZBA3 4QQOA 1YXWA 3TOJA 1WMDA 2RDQA 4Q26A 2EALA 3L2HA 2JKBA 3VBSB 1K12A 3VBSC 2RS51 2VZVA 4ZONA 4Z8BA 3W59A 2D6OX 4LT5A 2MNGA 4LKFA 5IVJA 5HXVA 1W90A 4D7YA 1G6NA 2Q1MA 2VOKA 1X8EA 3HN1A 5A70A 1OA3A 2HLEA 3AZVA 3ETQA 1JH5A 3ZFEB 3S0MA 3KQRA 1R082 2ZAHA 4RS5A 5LRSA 4YVWB 3OEAA 4LBNA 3KB5A 1DQ0A 4HK8A 1ULEA 4XUTA 5GLVA 5H9SA 1RUF3 1HRI1 2DU1A 5I0RA 4BMBA 4K6BA 4LO8A 3Q9OA 2WL1A 3ZFGC 5H9PA 5T5JA 2VOXA 3H3ZA 3PMEA 4WZCA 5J36A 2P34A 1HRV1 2N7GA 4AHWA 5A3NA 4YW3A 4BQ5A 2ID4A 5F5IA 1LOFC 3M2MA 1N1SA 1N1TA 3KV6A 2ZS6B 4HMZA 1UZ0A 2XL7A 5A3TA 2HWB1 1LOBA 3A0NA 4YGEA 2JWPA 4GH4B 3K3NA 4FPEA 1V9U3 3MPBA 1WW7A 1VBE2 1Y43B 4W6WA 3MICA 2W2IA 4DEQA 1GNZA 3CJIB 5FLJA 2IVIB 3RZJA 2D6LX 4C91A 3BPSA 1UU5A 5F9TA 5FOJB 4XE9A 1O8SA 4D7SA 1U12A 2VTFA 4AOCA 3W5NA 2WNVA 2XMLA 1O5LA 1OOPA 2IXLA 3OY8B 5FRAA 4B3NA 3SC7X 4H7MA 2V73A 1ULPA 1SDDB 2QQJA 4WBBA 1DF0A 4HSJA 3U4XA 3BOPA 2DTWA 1STMA 3BODA 5JXGA 2A6YA 2B42B 4XFFA 2WFPA 1DHKB 4DB5A 5FZFA 2WNEA 1JS9A 3R6SA 2FDKA 5APAA 1GQPA 2A70A 5ERLA 4DO0A 3DYMA 1TE1B 1SLCA 2JDKA 3PU3A 1DQ2A 2WR9A 4Y20B 2X53S 3H0OA 4Y4YA 3WDXA 4AGVA 1OLRA 4CXYA 2TEPA 3NJYA 1LHUA 5A7OA 3ZMOA 3INAA 5FO9B 2VCAA 1W6MA 4KWJA 5CKNA 2O1QA 4HVOA 5D8AA 3WP3A 2W87A 2B4KA 3THCA 3LPGA 1EV12 1K45A 1POV1 1VBE1 2FHRA 2YC2A 4RHV1 1VAMA 1LR5A 4Y26A 4CCMA 4PQ9A 3GF6A 3N35A 5FY4A 2IFRA 2RM21 4Q2FA 2Q8EA 4CDQA 2B5HA 2PLV1 5F6KA 4YM3A 3RQ0A 3ZR5A 4URAA 3FJSA 3D4KA 4JC1A 1OLQA 4LKDA 1CESA 3ACHA 3AKRA 2E32A 4CU6A 1QH7A 2WYSA 3WDUA 2LRPA 5T3NA 3ZYGA 4FTEA 1LRHA 1NQDA 4PDWC 5E1RA 5L7OA 1YFWA 3AP4A 4NJ4A 1NCQC 3LA3A 2OUJA 1BEV2 4BPZA 4LBJA 3AYCA 5AC92 3AKQA 1XYOA 1QJU3 3BCWA 1X50A 2CY6A 5ABJA 4L9BA 1XNBA 2XR4A 2CWSA 1UOBA 5A1FA 3MW2A 4FPOB 4JGZA 5B4XA 3ZSMA 2XWBB 2BGCA 1I9RA 5EHDA 1QJZA 1QQP3 1W6NA 1GZ9A 1QGLA 1ND2C 3T0BA 1UN1A 2PYTA 2WC2A 3IDEA 1PO21 5C8CC 3BUCA 3S5AA 4E4HA 1JYIA 3SQOA 3DUIA 3ZFFC 4YZ1A 4HONA 5C3SA 4XILA 1A8MA 1ZYBA 2NP0A 1SPPA 3DXUA 4JGZC 5FZKA 3K3OA 5FDBA 4RHV3 1J1LA 1XNKA 2C9AA 1RMU3 3S7EA 2PHDA 2XJUA 1Z0HA 3KV5A 4E4DX 4HL0A 4YLZA 4HETA 3TAYA 4GKXA 3POSA 1UZZA 2BVVA 1DG6A 4XIOA 3TEXA 4LXLA 1W6QA 1FOD2 1H1AA 2AEYA 5IHRA 2QQWA 1NA1B 3HVDA 3NJVA 2XQXA 3VHOA 4AVTA 4BE3A 3GZUC 4CCKA 4B29A 2ZGMA 1PGL2 4MADA 1R093 4OI0A 2R042 3KT7A 4NWVA 1YWKA 1Q8OA 3OUJA 5FZMA 2E31A 3WVJA 3I54A 2UYBA 4I09A 4NRQA 1W0NA 3IDCB 2ZX3A 4YG6A 5FP9A 4ZHNA 5GJ6A 4QB6A 3VZKA 5IVEA 1DGWX 1K5JA 1W3VA 3LDKA 3OEBA 4L0PA 2PLV3 3KM5A 1LECA 1AYM2 2VVDA 5D8AC 1SBEA 5FZOB 3GBGA 3ZXKA 4AFMA 4E8CA 4Y33A 5L36A 2Y0IA 4PCRA 1J3PA 1XNCA 3NJXA 4CP0A 1LGNA 2ETEA 3ATGA 3D5OA 5EYXA 5CFDA 1VJ2A 2VBBA 4HOOA 1J3RA 3ILFA 1QOSA 2OXBA 1SZBA 1U5XA 3DF0A 4IESA 2VY0A 4QX7A 1D4M2 1OA2A 5DAWA 2ZGUA 4RGKA 3WD5A 2XL9A 3JBG1 4L2NA 1AYN2 2EIEA 4BLIA 5A7WB 5DDJ3 3HBKA 3MPPG 2YFZA 3PUIA 1KJRA 1WKYA 4EN9B 5J1XA 4W6YA 1YQCA 2GU9A 1AR62 3PTYA 2WYFA 1MQTB 3NV3A 2QQNA 2JG8B 1KS4A 1MQTC 3RGBA 4EN8B 3DCQA 2GH2A 1RUG2 3GCWA 2ZKNA 4PJYA 1ZZ8A 4CTEA 3ZPYA 2XWJB 4C1XA 3B9CA 3R05A 3VL8A 4CU8A 3ASIA 5LZ6A 1ZX5A 4MSVA 2GC2A 2VCMA 3F95A 1BVP1 2GNBA 3HJRA 4LBOA 2YZ4A 4L97A 4PBPA 5LK5A 2Y8KA 2VTXA 2V09A 3WG4A 5F5QA 4DPNA 3LFIA 3ZN6B 1NLQA 5CFCB 1AVBA 1T6BX 2R1BA 3POBA 4ZY9A 2VW1A 2OKXA 2A6ZA 1W9FA 1GQHA 4XF4A 2IC1A 1VLNA 1QF3A 3ZFFA 2GP5A 1MQTA 4TSVA 1VBC1 2VUCA 2IUWA 2YHJA 3M3EA 4QHBA 3H8UA 4C1WA 1JUHA 1LOGA 3WX5A 4I3PA 1ND2A 1VBD1 2PTMA 3AK0A 4DQAA 4MGTA 3V0BA 2LUWA 1BK0A 5CISA 3LOIA 2I07B 4FP2A 4IERA 5FY9A 4RS5C 4OUEA 5ABJC 4MXWB 2AENA 3AJZA 4UFKA 1VMJA 1OKQA 3D82A 3VZNA 4Y22B 1QH6A 1YNAA 1PIV3 2JB4A 2VD7A 5D2AA 4CCJA 1N47A 4A7KA 2BGPA 1JN2P 1HQNA 2ILMA 2KD7A 3T0AA 1KFUL 1S0IA 2G9FA 2YGLA 1NXMA 1MACA 4QWNA 2A6VA 2I2SA 5FZ8A 5FMOS 3POEA 4ORFA 3ENRA 4QPGC 3VD4A 3J9SA 5FR3A 1JYTA 2Y33A 3AYEA 1W6QB 1EPZA 1V6OA 1O5UA 1XRUA 4A41A 3IPVB 1J58A 5DAVA 4IEWA 2R30A 4CDQC 1LEDA 3TEWA 4CDQB 4YVWA 2W39A 3C7EA 4ZU4A 1SBDA 3MO4A 1UYYA 2ZZQA 3PHMA 4WM7B 1UKGA 1YQ2A 1C8M3 4M3CF 4N53C 3KF5A 4D6QA 3M1HA 2RMU2 2HYKA 1R083 1VB4A 2ZOEB 4LUMA 5IVYA 4BIOA 4EZHA 4I01A 5FZ1A 1XBFA 1JMUB 1OUXA 4B4QA 1KITA 3GGLA 1D4M1 2XXZA 3NKTA 2PFWA 4I0AA 2RDRA 4O9GA 1GWMA 1F15A 1UIJA 3THPA 5JOZA 2Y64A 1NLRA 4QX8A 1TMF3 2XONA 1J84A 2JDUA 3NAPC 5I8YA 3EB7A 1PNFA 2Z42A 1RUI2 1IPSA 2YFUA 3H1WA 4XQDA 5J3UA 4BQWA 5F7UA 1DFQA 2A3YA 2EXJA 5C8CA 3LZZA 1ENQA 3K77A 2AEZA 3WUCA 2WNVC 4NAMA 4RQPB 1QJY3 1IZ3A 2XVGA 4Q4Y3 2CDPA 5A32A 1BYHA 3ZKUA 2PHLA 1PO23 1PO12 2V72A 3CZJA 1LOEA 2GALA 1CQ9A 2R041 5K0UC 5CADA 3M3OA 1OH3A 4CVUA 3KHCA 2ATFA 3WLUA 4QMAA 1WD3A 3CJIC 4QKBA 3T1LA 3AZWA 5J7MA 1YRZA 2AGSA 2AACA 4V2VA 4Y5Z0 5HBAA 1R1A3 1VBA3 4YW5A 5FQ0B 1RUD1 3AMHA 4MGSA 4AEKA 2NMNA 4OULA 1HB2A 2ORXA 2NZ9A 1ZM1A 2X8KA 1MVQA 4QX2A 4RR3B 4CP9B 5GKAC 2OPWA 1RUG3 5DUXA 2XKPA 2BVBA 5C8WA 3FUQA 1ENXA 2Z5WA 1LTEA 2AYHA 2I74A 2VQAA 3RZKA 2VMGA 3WQ7A 4ATEA 3NMBA 5FP8A 1JU3A 1OMIA 2AZ5A 4R4XA 2OZJA 1P8JA 3C2UA 4K7JA 2NYYA 2CNAA 3BALA 1RUE2 2D3SA 1E5SA 1RTVA 2K9ZA 5C4WC 3DECA 2IFWA 1Y9MA 2C6SA 5J48A 4JRAA 4XJUA 2ZAAA 4HFSA 3WHUA 1D2QA 5FZOA 2NMOA 2UWAA 1KS5A 2WLQA 1X9PA 3VDAA 5JAXA 4IE7A 5SV5A 1X82A 1AXZA 2DCTA 1F5JA 2OQ6A 2ZGKA 4RGGA 3LIGA 1H8TA 4UW6A 2ZMKA 4RN5A 3L9JT 3V65A 1OKOA 1UX6A 1UMIA 1DQ1A 4META 2D6NA 1XYNA 2WO7A 5C4WA 1OOPC 3A7QA 1PX3A 1UKRA 4DY3A 5IVBA 1OOPB 1ZZBA 3ZVXA 4A45A 2TBVA 4E2QA 5HI0A 1NYWA 4GWJA 4XMIA 3O0VA 2KXLA 1BEV1 1LODA 2FBEA 1E57A 2RMU1 2VXRA 4FCAA 2FDFA 1C5HA 2SBAA 3CMGA 2RVAA 3J26N 2Q1FA 3AKTA 1CR7A 1S55A 4HSLA 4EWDA 2TNFA 5T5PA 2ZGQA 5C7GA 2ERFA 1UIKA 2VH9A 1Q8PA 4AQTA 2AH2A 2HJIA 2OIIA 4L11A 3VZMA 4QKFA 4IE4A 5GZFA 4DXSA 5FPXA 4Y20A 4MXVA 2HWF2 1PGL1 2WS91 4WZFA 5CFCA 2DVDA 3ZFGA 1PO13 5KBFA 4ASKA 3T09A 4B4RA 5T52A 4OI1A 1LOAA 4YW4A 1XSQA 3CJXA 3I2JA 4LBQD 4QHZA 2O8QA 1MEC1 1CAVA 1WZXA 2Z69A 2EVXA 5C9AA 1AR83 3WP4A 1TMF1 3MIDA 5EP9A 1O3TA 1AR71 2R32A 2WWUA 2Q1ZB 4K8RB 1TMF2 2A71A 2D44A 3I8TA 1ST8A 3OPWA 4YNIA 3VBUC 4DFSA 3B69A 1POQA 4KU7A 5A3WA 4BM8A 1MEC2 1G8WA 4XW3A 3HAGA 2WO1A 4IV3A 3VBOC 3HT1A 3ZYHA 1UYZA 2FMDA 4LOTA 3VGIA 4BQ2A 5F2WA 4Q29A 1A3KA 1ZZ7A 2HWD3 1OC1A 4JKKA 4LO4B 4I0BA 4CYDA 2OW4A 4WVMA 4M4RA 2VCBA 4Z2AA 4DUXA 2D3PA 4FI9A 2F17A 1VBA1 3LEKA 4XF0A 2XUEA 4UI9L 3KQ4B 2D6KA 4HN0A 1VRH3 4WV8A 1OLMA 4UW3A 2WT2A 2E26A 3IPVA 5FBJA 1SLIA 2P3JA 4Y24A 3OF1A 4QU2A 4YW1A 2CU5A 1RMU2 1LHOA 4CCDA 1MS0A 2HWF3 4ASMB 5KXEA 2HBUA 5EFUA 3OCPA 4XFCA 1AR61 1DLCA 1DZQA 5E6HA 2QBXA 1AX0A 4QX0A 4Y1ZA 5FYBA 4LK7A 2CV6A 2ZBJA 2JDNA 3GZEA 1AX2A 3H1YA 4XDOA 1UX7A 3B9IA 3MIEA 3NKGA 1QJX2 5A33B 4LIVA 1NA1A 4HLTA 4YYOA 3WEZA 1GWKA 2FDIA 4PLNA 4NIHA 1H9WA 5JPNB 3URFA 2HWD2 4N9HA 2A5ZA 1AUYA 1TEIA 2DCJA 3ACLA 4R52A 3KGLA 4YWAA 2W92A 2RS31 1F4HA 4QQ2A 4E2GA 5L73A 1GNYA 1WCKA 1W0PA 2H0BA 2WNUB 1B09A 2WQ8A 3UJOA 1VR3A 4COYA 1GKBA 3VHRA 4D7TA 4EZ4A 5CFCC 5BNNA 5ACA1 3WG3A 4CEWC 1JZ5A 3WQBA 1VE0A 4GQ7A 3ZLIA 5IWFA 3UGFA 2UURA 1ZBE1 2W1WA 3VZLA 4IEOA 4PLMA 4CEYA 2D93A 2W94A 1CAUA 1CN1A 3RWNA 5FKBA 2YU1A 1QKQA 5A33A 2XHNA 2VQUA 4DIQA 5JZGC 1RUD3 1XC6A 3IAPA 3O12A 2YBKA 4FFGA 5LCWL 1W2UA 3U07A 2PMWB 4XQ4A 2Y6GA 2FQPA 2Z2SB 3ZDSA 5ACA2 1WLCA 3T2OA 1X33A 4GJYA 3ZPOA 1GQGA 1F4AA 1S0CA 2CTVA 2TUNA 3NV1A 1H8VA 2D6MA 3NNFA 1NCRB 5FZ7A 3KVAA 1PO11 3OD0A 5FYVA 1NXD1 4EN6B 1US2A 2XVLA 1PVC2 2MEV1 2W0XA 1SQ4A 1DGLA 3Q8CA 5LY1A 2ARXA 4FPYA 5FLIA 5JR2A 1LAJA 4GULA 3IMMA 3I3EA 5A3MA 1S2EA 3VZJA 2Y34A 3UKTA 1YCIA 3WW2A 2Y6HA 2O14A 2WFF1 2CGOA 3FL7A 3LA2A 2W9XA 3B94A 1SEFA 3GJBA 1AZDA 1RUJ1 3MLLA 3JUUA 3AM2A 4LO7A 1UL9A 2XKOA 4PHZA 4ZPIA 4DXZA 3PTRB 2MHFA 2V4AA 4XJAA 4Q4W2 2VBPA 4CCLA 1ODMA 2B8MA 5HV0A 3MIHA 4A7ZA 1FV3A 2ZGPA 4QB1A 3F2ZA 3FLPA 1A8DA 4P9LA 1YI9A 3Q8BA 3T2TA 1QDCA 4BCUA 1JZ7A 2BFUL 2DV9A 1Q43A 2ZX4A 5L9VA 1W8HA 4O61A 1W8WA 3OPTA 4RGAA 3WNXA 4QPYA 2HEVF 2PHWA 2YY1A 4J6GA 1CAWB 4NUBA 3ZIWA 3A22A 1OI6A 4K20A 5JSOA 1GMMA 2JECA 1GZWB 5LB6A 2B9UA 1GV9A 4GWNA 2QZ2A 2JXAA 1ASJ3 3BOWA 1UW8A 3OB8A 3U78A 1XB9A 1EAH2 2RM22 1VBB2 3TEYA 1DZTA 3TWIA 1WCDJ 4XIKA 3CJIA 1WUVA 1PNGA 5CZKA 1NG0A 2DFCA 4XYXA 3RI8A 2DCYA 1D0HA 4NE9A 2VMHA 4FOYA 2VMIA 5C3OA 5JUVA 2VM9A 3H3UA 1IS4A 1LU1A 1PIV1 3WR0A 2XJTA 5A7WA 3U11A 3T30A 1I1EA 5FTTC 1J1TA 1RXGA 2VUAA 4NHXA 5K8SA 4D6RA 1W39A 1W8UA 2OS2A 2VMEA 5BYNA 1JZ8A 5EZWA 2R1DA 5A7SA 4KMQA 2A6XA 4D69A 1VBD3 4XDPA 4BQ4A 3LWCA 4RR3C 4P9YA 3A21A 4FPHA 2GAUA 2J1UA 4L92A 2PHUA 1WCQA 4GH4C 3J7MA 4F83A 4CCNA 3CO2A 4MGZE 4JTNA 5DABA 5A6YA 2IXCA 4ZZ5A 1NZCA 1S0EA 2ZMNA 4D0QA 1CX4A 4G3YC 3OGVA 5CB7A 1RUH3 1V0AA 5B2GB 2PAEA 1R64A 2BQPA 5T5LA 2BTVC 2QQLA 1CAUB 1GICA 4QXBA 4IEQA 2XBO3 5BPXA 4B4PA 2P3YA 4HN1A 1ASJ1 5FUPA 3TBDA 2JG8C 1Z7S1 4CSWA 5CG9A 2VW0A 4NR1A 2CL2A 5DUVA 1W06A 1YQ6A 4OVEA 5DAXA 4COVA 5FZBA 5LEKA 1QHDA 3AZXA 1JHNA 5AC93 1VBB3 3J7HA 5FYCA 4M3CA 3S5QA 3PVNA 4W6XA 5BNQA 4AFBA 3MIBA 5FWEA 1NCRA 4JAAA 3FWEA 5CYYA 3WNMA 1UPSA 1I3HA 4HKLA 5FYHA 4XUQA 3VD3A 4ZKTB 1W8NA 5A6XA 1S0JA 4Q4W1 1DIWA 5FYYA 5A80A 2RE9A 2E7TA 2B9VA 2F4LA 1OLME 3ZIXA 2VZUA 3GXUA 4Q0UA 2FDGA 4Y4RA 4QXKA 4BB3A 1JZ6A 1AR82 3KWVA 2WFF2 2VZOA 1NY72 3MF9A 3KT4A 4MVTA 1VAKA 1TVGA 1UY0A 3OGGA 2H6CA 3RZGA 5L7OC 1KXGA 1DDLA 4LQRA 1DYKA 3AYDA 1LGBA 2ARCA 3PUHA 1Y3TA 5C6CA 1RVF2 1S0BA 3VKNA 1JOJA 4YM1A 4H14A 1GBGA 4QKNA 2P3IA 3OY8A 3HOBA 3PVOA 1AR91 4BQXA 4HZFA 3WF2A 3S57A 4GXLA 2AC1A 1SCSA 1AYN3 3A4UA 5FZ9A 3DL3A 3KGZA 3U37A 1GLHA 1W9TA 5JOWA 3GBWA 4CCEA 3ITQA 4IGPA 5FMOL 1F9KA 4CDUA 4ARXA 1EYBA 1RJ7A 4XAEA 4Y1YA 5GLTA 4Y5TA 4IEXA 3ZN6A 2YV8A 3ZN4A 4LBQB 1XNTA 3IN9A 4GB31 4AFCA 5I0SA 3QACA 4LITA 1CONA 5JR7B 4P5YA 3O1OA 4UF0B 1NE4A 1Y9QA 4AF9A 3SMHA 2GC1A 1HB3A 1DGWA 4IETA 5CA6A 4SLIA 1H0BA 3OGSA 5BUVA 5JXHA 1RJ8A 1XJAA 3AZZA 1VMFA 3CL1A 4PLOA 1IQDC 1L7LA 1PM7A 3K4AA 1DBNA 3RZZA 5IYYA 1ND3B 5GALA 1O4TA 2WDBA 3AMNA 2Q5TA 4CDUB 5FMDA 3T0DA 2G1MA 2YC0A 4KNCA 4L99A 1F8VA 1QJX1 1CJDA 4MGYE 1Q56A 2P6CA 2VMCA 1JBCA 1JOPA 3BPZA 4YZ3A 5FY8A 1COV2 3VKOA 4OHWA 2RR12 4AEMA 3T2PA 2HH9A 2IZWA 2HWC1 1FMD1 4OFGA 1M4WA 3NQHA 2QQMA 5FZ3A 5HCAA 5EJZB 3QD6A 1RUF2 4A44A 2LTNA 1N3QA 1QJU1 5JLVA 3VKMA 3PUQA 2BNOA 4CDWB 1BJQA 1PZ7A 2QNKA 4GIQA 3RG0A 3ZFGB 3O1RA 1JZ3A 2NQYA 5FP7A 3W9AA 3TNPB 1UZWA 3ZMNA 1C3HA 1NUKA 1VB2A 2WNVB 3QBQA 4UXAA 3RYRA 1WCUA 4JGZB 4IW3A 4BH9A 3OBRA 2ZX1A 4JGYC 1W3XA 2VECA 2VC9A 1MVEA 2YPJA 3DYOA 2B7YA 1H2LA 2WWJA 3JBG3 4BYYA 1A78A 5TSWA 3I97A 5CBLA 2GNMA 4CDXC 5D1IA 1VP6A 4OHXA 4DUWA 2A3WA 4JDMA 4N43B 4Y3OA 5F1RA 1RUF1 5KXBA 2YBSA 2J7MA 4EE2A 2LW8A 4WM7A 2DWRA 5F5CA 1WLDA 2D97A 4QAWA 1BHGA 4UYBA 4MYEA 3VB9A 5C3QA 2ZACA 3JB4C 5CIRA 5KR7A 3KCCA 2RG4A 3WW3A 2P5BA 5FPBA 1SDWA 3N9MA 5EJ1B 3WOGA 4LK6A 1PMJX 3A23A 3U14A 4WVMB 2NM1A 4X6QB 1PK6B 3NNMA 2HWE3 3WW1A 3N7MA 4JQRA 4BU2A 2A1XA 4QM9A 5FKCA 2VMFA 3B7MA 3RNSA 4C0BA 4ZU7A 2FZ2A 2JE7A 2RR13 3PU8A 1UQXA 4TZDA 2ZA9A 4K3UA 1WLTA 5JVVA 2A6WA 4LULA 1YFYA 5JI9A 2QE3A 1BZWA 3CQOA 4UW4A 4Y22A 4PI0A 3FFZA 4TLFA 5L7OB 2VULA 3MYXA 2K46A 1VBC2 4OQ9A 4CUCA 3ZXLA 2JB8A 3DPRB 1M06G 3LGRA 4AGRA 1PM4A 2VZQA 4LA3A 4BMEA 5FPZA 1O3RA 3WINE 3WF3A 1E5IA 3WF0A 3BTZA 1NCQA 1IS5A 3BTAA 4XCAA 4XTPA 1K5MA 3W5MA 3UK9A 1QJX3 4LORA 2DURA 4GZ9A 1A6CA 4NHKA 1PVC3 2BBAA 5HPOA 3IT8A 4PIZA 3K48A 4LO6B 1RUJ3 4FXKB 1BLZA 1SACA 2ADEA 2P1BA 3P3NA 4N7UA 3GZAA 4PDWB 5F3CA 4AXOA 4Q4V3 2WA4A 5IK7A 1HIXA 4BK5A 2W52A 4LA2A 4XFBA 4XURA 4AFDA 4CUBA 1FNZA 4FXGB 1RVF1 5LW9A 1RUG1 3OYWB 4HVQA 5DMYA 3AMMA 4XZPA 2IVJA 3SXWA 2EIDA 2ZGLA 4B7KA 5KXDA 1O8PA 3DPRA 1HRI3 3MHZA 4KG8A 3E6CC 4A42A 4XF3A 4FOVA 2VU9A 2WRAA 1REFA 1AJOA 1CD3G 1UXZA 4LOSA 3LF7A 3KV9A 2YMZA 3PIJA 4EWEA 2UWCA 2VG9A 3HR9A 4FPJA 2YUEA 2ZGSA 3QLQA 4MX3A 4RFRB 2P3KA 3HT2A 3LSDA 1RYYA 1VRBA 4ITCA 2QQIA 4Q1PA 1ZVFA 3PJQA 4YZ5A 2X5IB 5C33A 2IWGB 2YYOA 4QX1A 4YFWA 1KJLA 3WV6A 4TN7A 3ZXJA 1U5ZA 2I45A 3P1IA 4OI4A 4QHOA 1GSLA 2J1RA 5FZCA 1HN0A 2DVGA 2IXHA 4URTA 1RXFA 4ZU5A 4H55A 4AWDA 2FCVA 2WZR1 5ISLA 2QTWB 1AYM1 2R7EB 5DG1A 4CDXA 2HWC3 3R4UA 2R0FA 4LEJA 1UMHA 2VZSA 1REEA 2EICA 5I93A 3ACGA 4ZXKA 1MR5A 5KXCA 4DNYA 4CP2A 3BTXA 4R9DA 4I0WB 3SCGA 5A3PA 1QJY1 1W9SA 4XBNA 5G04L 5BXXA 2VUJA 3GALA 1OQDA 4EROA 2JICA 1SLLA 1GFF2 2BEOA 4JX0A 5FYZA 1QY4A 1EUUA 1WMFA 3C7HA 3KZ4C 4Q4Y1 1QEXA 4GD4A 5HCBA 4A4AA 1FT9A 3KSCA 3MUZ1 1O59A 2R043 3RS6A 1D0GA 5HV4A 4YZ2A 1ENSA 4LBKA 1PGSA 5LY2A 4BDVB 2W91A 1BMV1 3E1F1 3GCXA 3N9QA 4IEPA 1ZBA2 2R061 2WSUA 2JE9A 4M0NA 3ZO0B 4LHNA 3U4SA 3VBFA 3M7AA 5LWBA 3GHNA 1AR72 5T54A 4LIUA 5EYYA 5F39A 4JDNA 3JQXA 4KWLA 3K2OA 4IV1C 1NT0A 3FHAA 4IV1B 5JDBA 2OT7A 3VDDC 1W8FA 3FHIB 5A6ZA 4FTSA 3CNAA 2WAAA 1EAH3 4DXTA 1HQLA 1BBT1 5AFBA 2X29A 2ZXQA 3MUY1 4M3CB 4AVVA 1CAXB 2XDVA 1IPJA 1CPMA 2F4PA 1U5YA 1T6GC 2RJLA 3AVRA 3B93A 2D3RA 2JD9A 1UOGA 3BU7A 3D0JA 4X8PA 2HEYF 3WNOA 4YSFA 2D98A 4MG2A 5LRRA 4QQHA 4Q4V2 5DG2A 3VBSA 4BQ3A 1GU3A 2ARBA 1ULDA 4IV3B 4CXXA 1SLAA 4GMP0 2R071 4R9BA 5FPLA 5JMOA 1HB1A 1OPOA 4QU1A 1XOYA 4FPCA 2JEMA 3EHKA 4CDWA 1UWWA 3PNAA 3MLKA 1RUNA 4Y1UA 3A0KA 2VTXJ 4LTAA 1I5PA 4NAOA 4OHZA 2ET1A 4CP1A 1VBC3 5K0UB 3V0BB 2JKXA 4MV2A 1JXNA 2VVEA 5FFOC 4HT1T 4MZUA 1OURA 3ZXAC 1FATA 5IAXA 4FFFA 1UD1A 2E51A 3LEMA 3OJBA 4P9GA 3TN92 5A1LA 4MXWA 4NIGA 4HKWA 1LHVA 3TYJA 2VOTA 1UOJA 3EQEA 1KDKA 3CEWA 3FLTA 2CAVA 4O7XA 5FZ0A 1RL3A 1UO9A 1TZOA 1UY3A 4ZS2A 4XHXA 5G05L 5M0TA 1S2KA
chains in the Genus database with same CATH topology
2VZVA 1DLCA 2QBXA 2YG0A 4IUGA 2W1QA 4QX0A 2VR4A 1UY1A 2C4XA 3CIHA 2V4VA 2HLEA 2VZRA 1UX7A 5DPNA 2C26A 5A1AA 3WEZA 2WZEA 3OEAA 2W1SA 3SEPA 4CU9A 2VL4A 4XUTA 2DCJA 2WAOA 1CZVA 2W92A 2V5DA 3NNGA 5JXIA 1F4HA 1W99A 1GNYA 2WQ8A 4KI5M 2YB7A 1JZ5A 3WQBA 1JYWA 2ID4A 1UZ0A 2W1WA 3MV11 2W94A 3FHQA 2W1UA 2VQUA 2XHNA 4PT6A 4DEQA 1XC6A 3D3AA 3IAPA 5LCWL 2J1EA 2Y6GA 2HYXA 5G05L 1O8SA 3T2OA 2WBKA 2VTFA 4OYUA 1F4AA 3W5NA 3IDAA 3K4DA 5FUIA 3UNPA 1ULPA 1SDDB 2QQJA 3VD7A 1US2A 2VJXA 4MGQA 5JXGA 1SHWB 2E33A 5JR2A 3I3EA 3LEIA 2C9KA 1JI6A 1GQPA 2Y6HA 3CDZB 3DYMA 1GOHA 2Z4FA 3FL7A 2W9XA 4XVHA 4QDSA 5DN2A 2BZDA 3WNNA 3MBWA 4P08A 2VCAA 4UAPA 1L7RA 2W87A 1K3IA 2B4KA 3THCA 3LPGA 1K45A 1GUIA 2YC2A 3ETPA 4QB1A 3F2ZA 3I3DA 1TG7A 1JZ7A 3AC0A 1US3A 3ACHA 2E32A 3K4ZA 3A22A 4CU6A 1GMMA 2WYSA 2WO3A 1H6YA 3LPFA 4E8DA 2BGOA 3OB8A 4OMCA 5JXJA 5CZKA 3SEEA 2VQTA 3P6BA 1XNAA 3BN6A 2W46A 5JUVA 2VM9A 5B4XA 3WF1A 3MV01 3T0BA 4W8JA 3HEIA 2VZ1A 1OH4A 1JZ8A 2VMEA 2PQSA 1OT5A 4KMQA 3WSOA 5LA2A 2VZTA 4D8MA 5IFPA 3A21A 2J1UA 1WCQA 4ZZ5A 3IB3A 5HXMA 4D0QA 4MOAA 3OGVA 5EIYB 5IHRA 1R64A 3NJVA 2QQLA 2XQXA 2QQKA 1UY4A 4MADA 3I2HA 4W50A 1W9WA 4LKSA 3I2IA 2E31A 1W0NA 3J7HA 4QB6A 5CYYA 3WNMA 3OEBA 4XUQA 4KWUA 4L0PA 4QPWA 1W8NA 3VD3A 4DUXA 1JYXA 4E8CA 1LNSA 2ZEWA 2B9VA 2W47A 4OZOA 4PQQA 2EIBA 3VDBA 2VZUA 3GXUA 3K75B 4BK4A 3NJXA 1JZ6A 2VZOA 1ULOA 1TVGA 1UY0A 4LQRA 2EIEA 2J1VA 3PUHA 2VZ3A 3ZM8A 3C7GA 2YFZA 3HNBM 3PUIA 4AG4A 1WKYA 5J1XA 3ACIA 3HOBA 3WF2A 2WO2A 1JYNA 2QQNA 3U37A 1W9TA 2WZ8A 3WF4A 1NX9A 4ZXEA 4ARXA 4CU8A 1OD3A 3T08A 1GOFA 1D7PM 3HJRA 3HN3A 2Y8KA 3UETA 1XNTA 2WN3A 4LHSA 3GM8A 4BJ0A 4LPLA 4ZY9A 2OKXA 3LE0A 4P5YA 2VCCA 1CX1A 1KEXA 3OGSA 5JXHA 1JU4A 4XUPA 5IJRA 2BERA 1IQDC 1GOGA 1CZTA 3K4AA 4TXWA 5IYYA 3K46A 2WDBA 2XOMA 4MO3M 3T0DA 2W3JA 3FN9A 2RV9A 1J83A 1CIYA 3WNKA 3HNYM 4OUEA 4JKLA 2VMCA 3SKVA 3T2PA 2J1SA 2Y6KA 2BGPA 2KD7A 3NQHA 2QQMA 3T0AA 5EJZB 4A44A 3WNLA 1MPXA 2RJ2A 4ZZ8A 5C71A 3ACFA 3UESA 1JZ3A 4CUAA 2DDUA 3VD4A 1UYXA 1NUKA 2X05A 1DP0A 2VO5A 4XUOA 4A41A 2VC9A 3DYOA 3WNPA 3C7EA 3T2QA 3I97A 3MO4A 1UYYA 4DUWA 1YQ2A 1KGYA 2J7MA 2LW8A 4OMDA 4QAWA 1BHGA 1EUTA 2ZEXA 2LS6A 5LA0A 2WN2A 3GGLA 4PF1A 5EJ1B 4QB2A 3I3BA 4JHZA 4HG6B 2Y64A 1PMJX 3A23A 2XONA 3VD5A 1J84A 5B4NA 3EB7A 1DYOA 2YFUA 5F7UA 2VMFA 3K77A 2X10A 2CDPA 1H6XA 2J1AA 3CQOA 4DEVA 4GWIA 2V72A 3CZJA 1PX4A 4QDQA 3C7OA 4CVUA 4CUCA 1UY2A 2VZQA 4TTGA 3SKJE 3WF3A 3WF0A 2JDAA 3W5MA 3CKHA 4MGSA 1OF3A 4GZ9A 2ORXA 5IFTA 2BBAA 5HPOA 2J22A 3I2KA 4QX2A 4JKMA 4ARYA 2YC4A 2W95A 4XUNA 1K42A 1NAEA 4BK5A 4XURA 4CUBA 5DMYA 2EIDA 1JU3A 1O8PA 1P8JA 4A42A 3ECQA 3DYPA 4DUVA 3DECA 1UXZA 1JZ4A 3LQCA 2WABA 3IIIA 1W8OA 4QX3A 1RYYA 2QQIA 1CZSA 1JHJA 2VMDA 3VDAA 3IAQA 4QX1A 2W5FA 3P1IA 2J1RA 3OG2A 4P00B 4RN5A 1L7QA 1UMIA 3VD9A 2R7EB 3A7QA 1PX3A 1UMHA 2Y6LA 2VZSA 4A45A 1UXXX 4ET7A 2EICA 4GWJA 3ACGA 4BXSV 5DQ0A 1T2XA 3VDCA 3CMGA 1W9SA 2RVAA 5G04L 3CZUA 2Y6JA 4JX0A 1EUUA 4A4AA 3C7HA 4QDRA 2ORZA 3I2GA 4AAXA 3MUZ1 5C7GA 1O59A 1JZ2A 2JE8A 4BDVB 2W91A 1HN1A 4DXSA 3E1F1 4DXRA 3GDBA 2DCKA 3C7FA 4RYDA 4XZUG 4M4PA 1NKGA 3NRUA 3T09A 3I2JA 4YPJA 3FHAA 4P02B 3HNMA 1JYVA 3I2FA 1SG3A 2J1TA 2WAAA 3THDA 4DXTA 2CDOA 2ZXQA 1XPWA 3MUY1 3C8XA 1PMHX 2X09A 2JD9A 2QQOA 3HPNA 3LEGA 3WNOA 2ZEZA 5I0DA 2L9LA 2WO1A 3JXSA 2ZEYA 3OGRA 1GU3A 1UYZA 5C70A 5JMOA 3OBAA 4CU7A 4JKKA 1UWWA 3BGAA 3EYPA 4M4RA 4A3ZA 2VCBA 4Z2AA 4FI9A 1I5PA 2JKXA 3LEKA 4UI9L 4A6OA 2WUHA 3ABZA 2E26A 5LA1A 2VZPA 2VOTA 4UOJA 1UY3A 1OF4A 4W4ZA 1K12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZV A;  1DLC A;  2QBX A;  2YG0 A;  4IUG A;  2W1Q A;  4QX0 A;  2VR4 A;  1UY1 A;  2C4X A;  3CIH A;  2V4V A;  2HLE A;  2VZR A;  1UX7 A;  5DPN A;  2C26 A;  5A1A A;  3WEZ A;  2WZE A;  3OEA A;  2W1S A;  3SEP A;  4CU9 A;  2VL4 A;  4XUT A;  2DCJ A;  2WAO A;  1CZV A;  2W92 A;  2V5D A;  3NNG A;  5JXI A;  1F4H A;  1W99 A;  1GNY A;  2WQ8 A;  4KI5 M;  2YB7 A;  1JZ5 A;  3WQB A;  1JYW A;  2ID4 A;  1UZ0 A;  2W1W A;  3MV1 1;  2W94 A;  3FHQ A;  2W1U A;  2VQU A;  2XHN A;  4PT6 A;  4DEQ A;  1XC6 A;  3D3A A;  3IAP A;  5LCW L;  2J1E A;  2Y6G A;  2HYX A;  5G05 L;  1O8S A;  3T2O A;  2WBK A;  2VTF A;  4OYU A;  1F4A A;  3W5N A;  3IDA A;  3K4D A;  5FUI A;  3UNP A;  1ULP A;  1SDD B;  2QQJ A;  3VD7 A;  1US2 A;  2VJX A;  4MGQ A;  5JXG A;  1SHW B;  2E33 A;  5JR2 A;  3I3E A;  3LEI A;  2C9K A;  1JI6 A;  1GQP A;  2Y6H A;  3CDZ B;  3DYM A;  1GOH A;  2Z4F A;  3FL7 A;  2W9X A;  4XVH A;  4QDS A;  5DN2 A;  2BZD A;  3WNN A;  3MBW A;  4P08 A;  2VCA A;  4UAP A;  1L7R A;  2W87 A;  1K3I A;  2B4K A;  3THC A;  3LPG A;  1K45 A;  1GUI A;  2YC2 A;  3ETP A;  4QB1 A;  3F2Z A;  3I3D A;  1TG7 A;  1JZ7 A;  3AC0 A;  1US3 A;  3ACH A;  2E32 A;  3K4Z A;  3A22 A;  4CU6 A;  1GMM A;  2WYS A;  2WO3 A;  1H6Y A;  3LPF A;  4E8D A;  2BGO A;  3OB8 A;  4OMC A;  5JXJ A;  5CZK A;  3SEE A;  2VQT A;  3P6B A;  1XNA A;  3BN6 A;  2W46 A;  5JUV A;  2VM9 A;  5B4X A;  3WF1 A;  3MV0 1;  3T0B A;  4W8J A;  3HEI A;  2VZ1 A;  1OH4 A;  1JZ8 A;  2VME A;  2PQS A;  1OT5 A;  4KMQ A;  3WSO A;  5LA2 A;  2VZT A;  4D8M A;  5IFP A;  3A21 A;  2J1U A;  1WCQ A;  4ZZ5 A;  3IB3 A;  5HXM A;  4D0Q A;  4MOA A;  3OGV A;  5EIY B;  5IHR A;  1R64 A;  3NJV A;  2QQL A;  2XQX A;  2QQK A;  1UY4 A;  4MAD A;  3I2H A;  4W50 A;  1W9W A;  4LKS A;  3I2I A;  2E31 A;  1W0N A;  3J7H A;  4QB6 A;  5CYY A;  3WNM A;  3OEB A;  4XUQ A;  4KWU A;  4L0P A;  4QPW A;  1W8N A;  3VD3 A;  4DUX A;  1JYX A;  4E8C A;  1LNS A;  2ZEW A;  2B9V A;  2W47 A;  4OZO A;  4PQQ A;  2EIB A;  3VDB A;  2VZU A;  3GXU A;  3K75 B;  4BK4 A;  3NJX A;  1JZ6 A;  2VZO A;  1ULO A;  1TVG A;  1UY0 A;  4LQR A;  2EIE A;  2J1V A;  3PUH A;  2VZ3 A;  3ZM8 A;  3C7G A;  2YFZ A;  3HNB M;  3PUI A;  4AG4 A;  1WKY A;  5J1X A;  3ACI A;  3HOB A;  3WF2 A;  2WO2 A;  1JYN A;  2QQN A;  3U37 A;  1W9T A;  2WZ8 A;  3WF4 A;  1NX9 A;  4ZXE A;  4ARX A;  4CU8 A;  1OD3 A;  3T08 A;  1GOF A;  1D7P M;  3HJR A;  3HN3 A;  2Y8K A;  3UET A;  1XNT A;  2WN3 A;  4LHS A;  3GM8 A;  4BJ0 A;  4LPL A;  4ZY9 A;  2OKX A;  3LE0 A;  4P5Y A;  2VCC A;  1CX1 A;  1KEX A;  3OGS A;  5JXH A;  1JU4 A;  4XUP A;  5IJR A;  2BER A;  1IQD C;  1GOG A;  1CZT A;  3K4A A;  4TXW A;  5IYY A;  3K46 A;  2WDB A;  2XOM A;  4MO3 M;  3T0D A;  2W3J A;  3FN9 A;  2RV9 A;  1J83 A;  1CIY A;  3WNK A;  3HNY M;  4OUE A;  4JKL A;  2VMC A;  3SKV A;  3T2P A;  2J1S A;  2Y6K A;  2BGP A;  2KD7 A;  3NQH A;  2QQM A;  3T0A A;  5EJZ B;  4A44 A;  3WNL A;  1MPX A;  2RJ2 A;  4ZZ8 A;  5C71 A;  3ACF A;  3UES A;  1JZ3 A;  4CUA A;  2DDU A;  3VD4 A;  1UYX A;  1NUK A;  2X05 A;  1DP0 A;  2VO5 A;  4XUO A;  4A41 A;  2VC9 A;  3DYO A;  3WNP A;  3C7E A;  3T2Q A;  3I97 A;  3MO4 A;  1UYY A;  4DUW A;  1YQ2 A;  1KGY A;  2J7M A;  2LW8 A;  4OMD A;  4QAW A;  1BHG A;  1EUT A;  2ZEX A;  2LS6 A;  5LA0 A;  2WN2 A;  3GGL A;  4PF1 A;  5EJ1 B;  4QB2 A;  3I3B A;  4JHZ A;  4HG6 B;  2Y64 A;  1PMJ X;  3A23 A;  2XON A;  3VD5 A;  1J84 A;  5B4N A;  3EB7 A;  1DYO A;  2YFU A;  5F7U A;  2VMF A;  3K77 A;  2X10 A;  2CDP A;  1H6X A;  2J1A A;  3CQO A;  4DEV A;  4GWI A;  2V72 A;  3CZJ A;  1PX4 A;  4QDQ A;  3C7O A;  4CVU A;  4CUC A;  1UY2 A;  2VZQ A;  4TTG A;  3SKJ E;  3WF3 A;  3WF0 A;  2JDA A;  3W5M A;  3CKH A;  4MGS A;  1OF3 A;  4GZ9 A;  2ORX A;  5IFT A;  2BBA A;  5HPO A;  2J22 A;  3I2K A;  4QX2 A;  4JKM A;  4ARY A;  2YC4 A;  2W95 A;  4XUN A;  1K42 A;  1NAE A;  4BK5 A;  4XUR A;  4CUB A;  5DMY A;  2EID A;  1JU3 A;  1O8P A;  1P8J A;  4A42 A;  3ECQ A;  3DYP A;  4DUV A;  3DEC A;  1UXZ A;  1JZ4 A;  3LQC A;  2WAB A;  3III A;  1W8O A;  4QX3 A;  1RYY A;  2QQI A;  1CZS A;  1JHJ A;  2VMD A;  3VDA A;  3IAQ A;  4QX1 A;  2W5F A;  3P1I A;  2J1R A;  3OG2 A;  4P00 B;  4RN5 A;  1L7Q A;  1UMI A;  3VD9 A;  2R7E B;  3A7Q A;  1PX3 A;  1UMH A;  2Y6L A;  2VZS A;  4A45 A;  1UXX X;  4ET7 A;  2EIC A;  4GWJ A;  3ACG A;  4BXS V;  5DQ0 A;  1T2X A;  3VDC A;  3CMG A;  1W9S A;  2RVA A;  5G04 L;  3CZU A;  2Y6J A;  4JX0 A;  1EUU A;  4A4A A;  3C7H A;  4QDR A;  2ORZ A;  3I2G A;  4AAX A;  3MUZ 1;  5C7G A;  1O59 A;  1JZ2 A;  2JE8 A;  4BDV B;  2W91 A;  1HN1 A;  4DXS A;  3E1F 1;  4DXR A;  3GDB A;  2DCK A;  3C7F A;  4RYD A;  4XZU G;  4M4P A;  1NKG A;  3NRU A;  3T09 A;  3I2J A;  4YPJ A;  3FHA A;  4P02 B;  3HNM A;  1JYV A;  3I2F A;  1SG3 A;  2J1T A;  2WAA A;  3THD A;  4DXT A;  2CDO A;  2ZXQ A;  1XPW A;  3MUY 1;  3C8X A;  1PMH X;  2X09 A;  2JD9 A;  2QQO A;  3HPN A;  3LEG A;  3WNO A;  2ZEZ A;  5I0D A;  2L9L A;  2WO1 A;  3JXS A;  2ZEY A;  3OGR A;  1GU3 A;  1UYZ A;  5C70 A;  5JMO A;  3OBA A;  4CU7 A;  4JKK A;  1UWW A;  3BGA A;  3EYP A;  4M4R A;  4A3Z A;  2VCB A;  4Z2A A;  4FI9 A;  1I5P A;  2JKX A;  3LEK A;  4UI9 L;  4A6O A;  2WUH A;  3ABZ A;  2E26 A;  5LA1 A;  2VZP A;  2VOT A;  4UOJ A;  1UY3 A;  1OF4 A;  4W4Z A;  1K12 A; 
#chains in the Genus database with same CATH topology
 4Q4V 1;  2JIG A;  2XLF A;  3FBM A;  1BVV A;  5FPU A;  2YG0 A;  4IUG A;  5F5A A;  4W65 A;  2W1Q A;  1QXJ A;  5GLU A;  3U10 A;  4D3W A;  4FAG A;  3H8R A;  5I91 A;  1HJF A;  1LU2 A;  3S30 A;  2C4X A;  3N9P A;  1QQP 2;  1R1Z A;  2QDR A;  3M4F A;  5A3O A;  2WQ4 A;  2VZR A;  3ILR A;  2CGP A;  3DXT A;  3SIT A;  2GP3 A;  4NHM A;  1NCR C;  4FBF A;  4Q4X 1;  2WZE A;  5FZD A;  1V6I A;  2VPV A;  4WM8 A;  5EXO A;  1TME 3;  1IG0 A;  1WBF A;  2CHH A;  4AL9 A;  1QOO A;  1GR3 A;  1H30 A;  5JSR A;  2VL4 A;  4AVS A;  1IGO A;  4OUM A;  1CZV A;  3ON7 A;  4UFL A;  4LMF A;  4R9A A;  3ZKY A;  4D6S A;  4IGO A;  1YUD A;  3KVB A;  4NRP A;  3HWJ A;  5CNA A;  2G4I A;  1H1I A;  1ZBE 2;  1BXH A;  3KF3 A;  4KI5 M;  1OQ1 A;  5KC6 A;  3ZXD A;  1RUD 2;  1JYW A;  3WDY A;  3AX4 A;  3R0R A;  3G7D A;  1C8N A;  4QPI A;  2X5I C;  4Q4Y 2;  4C90 A;  2BRT A;  2HWB 3;  3H8O A;  2RS3 2;  4BLJ A;  5LA9 A;  4HBN A;  3ZFF B;  2J1E A;  2WZP P;  1H2N A;  3MIG A;  1JUI A;  3NV4 A;  1IKQ A;  3J7L A;  4YM2 A;  4IEV A;  1HRV 2;  4AW7 A;  2RM2 3;  2HYX A;  3VBH A;  2VE1 A;  1QNW A;  4OQ8 A;  2RDS A;  1WLW A;  3OD4 A;  2AR6 A;  3WY6 A;  5FZH A;  5FYT A;  4P5H A;  4XBL A;  2O0O A;  2JG9 A;  3NV2 A;  1XU1 A;  3N9O A;  1QJE A;  1QU0 A;  4M0H A;  2WJS A;  3BTY A;  1S4C A;  4AK3 A;  5FAX A;  3JBG 2;  5FQ0 A;  3ST7 A;  3I2O A;  2ZGN A;  3B02 A;  1R08 1;  1KQR A;  3NJZ A;  1CVN A;  1JI6 A;  3WG2 A;  3CDZ B;  3VBO B;  3UV9 A;  1GOH A;  1GZC A;  2XJP A;  5FO7 B;  2MEV 3;  2GMM A;  4Z82 A;  2JDZ A;  4Q0V A;  2DFB A;  2QDN A;  3ROU A;  4COW A;  2F6B A;  1SFN A;  3WNN A;  3Q8F A;  4P08 A;  1C4R A;  1W2A X;  4XDQ A;  3WG1 A;  2GDF A;  4Q5O A;  3MDP A;  1R09 1;  4XFG A;  3DGT A;  3SLI A;  1EP0 A;  2RS1 1;  3CHX A;  1EY2 A;  1QJF A;  1TG7 A;  2ZHN A;  3PUA A;  5C9A B;  1POV 3;  1VBE 3;  1VBA 2;  3ZYF A;  3SH4 A;  1CAV B;  1TQ5 A;  2C0Z A;  2DYC A;  3B00 A;  1ND3 A;  3SIS A;  3ZFE C;  3AC0 A;  1EPW A;  1RIN A;  1US3 A;  4NID A;  4E4S A;  3PUS A;  4S2D A;  1ULC A;  2QFE A;  4NO4 A;  1U5I A;  5F3G A;  1FOD 1;  1H6Y A;  2OPK A;  4BA6 A;  1PGW 2;  1DGR N;  3POY A;  1O3S A;  1LB2 A;  1JTZ X;  2RJK A;  4GA9 A;  5FY1 A;  1WCS A;  4K1Y A;  4YZ4 A;  1HRV 3;  1W04 A;  3M70 A;  3VV1 A;  3V56 A;  2UU8 A;  3AMP A;  3JQW A;  5JWP A;  1OHF A;  4LNV A;  3IBM A;  4F3J A;  1OFS A;  1UU6 A;  2BDR A;  3BN6 A;  4X8N A;  4CPB A;  1W6O A;  5J96 B;  5CVR A;  4IDZ A;  3LFM A;  2XUM A;  1QQP 1;  4MUV A;  1MZF A;  4P9W A;  3H7J A;  1AHS A;  1RHI 1;  4OLL A;  1WME A;  1PZ9 A;  1CWP A;  4Q0S A;  2P6H A;  4FFH A;  5IVV A;  3GNE A;  3HEI A;  3HQU A;  5K7P A;  1CGP A;  3AL6 A;  5GZE A;  1OH4 A;  5IK5 A;  4QXH A;  4LUK A;  3MFA A;  3NWK A;  2EXI A;  1S0D A;  1VBB 1;  2D43 A;  1JOD A;  2WT1 A;  1KD7 A;  2Q0A A;  1V70 A;  4NIA A;  5LA2 A;  2VZT A;  5EJ3 A;  4D8M A;  5IFP A;  5FY5 A;  4Q0Q A;  3CBN A;  3ES4 A;  4ISQ A;  2BWA A;  2H6B A;  4J1X A;  3RMX A;  3WP5 A;  4QPI C;  4N7I A;  1NE6 A;  3MZH A;  5JMC A;  1O7F A;  4NPM A;  1LCL A;  3ZSJ A;  4EN7 B;  5JZG B;  3IB3 A;  5BNO A;  5HXM A;  2HBT A;  5CEH A;  3O1S A;  3NL1 A;  4P9X A;  4SBV A;  4JCK A;  4O65 A;  2D40 A;  1WA4 A;  2JX9 A;  2CGN A;  4RL7 A;  5IT6 A;  3T1M A;  4XJ9 A;  2WKK A;  1PMI A;  4I02 A;  5F6L B;  2JD4 A;  1UY4 A;  4WVW A;  5DDJ 1;  2BBV A;  2WIN B;  1HXS 2;  4LLF A;  1W9W A;  1RUH 1;  1QJU 2;  4LKS A;  1ULG A;  2JDM A;  3JCI A;  2ZML A;  1ZZC A;  1HB4 A;  3MGU A;  2OYZ A;  1RUJ 2;  2HWC 2;  1OVP A;  4PIX A;  4AED A;  3JD7 2;  1RGS A;  2GME A;  2BNN A;  1OVS A;  1RUC 2;  1FI2 A;  1EV1 1;  1RVF 3;  2JIJ A;  5ANQ A;  4HK9 A;  4KWU A;  1ALY A;  4NHY A;  4YVS C;  1LNS A;  4ASL A;  2ZEW A;  4PQQ A;  1VRH 2;  2EIB A;  2FDJ A;  3VDB A;  1RHI 2;  2DVB A;  1RC6 A;  1H2M A;  2XJV A;  4BK4 A;  3AFG A;  4XJW A;  2RDN A;  1H8T B;  4O9E A;  3LOB A;  2DU0 A;  1ULO A;  3UKN A;  2YU2 A;  3VBF C;  1OD5 A;  2ENR A;  1GAN A;  3FUO A;  3I59 A;  5FYU A;  4COU A;  2IXI A;  3FFQ A;  5GZG A;  1UU4 A;  4FQ4 A;  1LGC A;  5FZG A;  2J1V A;  3OBZ A;  4QGM A;  1IPK A;  1B35 A;  1UYP A;  2UY8 A;  2VZ3 A;  3C7G A;  5SV8 A;  3ZSL A;  5A32 B;  3POG A;  3VBR A;  4AG4 A;  3IZO A;  4S2F A;  3ACI A;  4NRM A;  4A2U A;  3RPQ A;  4LBL A;  1HW5 A;  2WO2 A;  1JYN A;  1ONA A;  3M8L A;  2ZZJ A;  1NQJ A;  4AQ2 A;  2WZ8 A;  1YQ5 A;  1AX1 A;  1QXR A;  4U36 A;  3WF4 A;  1NX9 A;  4RD7 A;  4ZXE A;  3AKS A;  1ZZ6 A;  5FRE A;  4IND A;  4WVZ A;  1Q8V A;  5KHK A;  4GB3 2;  4N43 A;  1YJL A;  2A75 A;  1HLC A;  4G4F A;  4H7L A;  4N9I A;  4QXC A;  2X5I A;  1FPN 3;  1PVX A;  2DUQ A;  3AB0 A;  2LM3 A;  3FC0 A;  2VVF A;  3I59 B;  5LBC A;  3UET A;  3GZT B;  3WCS A;  3FLR A;  3ZYP A;  1G7Y A;  2WN3 A;  4GMP 3;  5FXZ A;  3GM8 A;  2B45 X;  4UFJ A;  3KS7 A;  4LPL A;  1QJY 2;  3JU9 A;  3LE0 A;  4BHP A;  4EWA A;  3VDD B;  2GZW A;  5KWR A;  5LBE A;  4FOW A;  1I6X A;  4HVR A;  1CX1 A;  4LR4 A;  1W9Y A;  1KEX A;  3R4S A;  3JZV A;  3ZSK A;  4A6S A;  1JU4 A;  4GAZ A;  4MHU A;  4FPK A;  4WVV A;  4XJ8 A;  1UCX A;  4XUP A;  2GH8 A;  2BER A;  1WWY A;  1CZT A;  2XJS A;  3VBH B;  2J42 A;  1C1F A;  3K46 A;  2XOM A;  2XB6 C;  3N36 A;  4XXA A;  5C9A C;  3N9L A;  1B35 C;  1S2B A;  3MLJ A;  1AL2 1;  4L8Q A;  2W3J A;  4MO3 M;  4WM8 C;  2RV9 A;  2VW2 A;  3WNK A;  2SLI A;  2JG9 B;  3HNY M;  2G19 A;  4OHV A;  4ATF A;  5LBF A;  1URX A;  4C8D A;  1R1A 1;  4P9J A;  1NY7 1;  1FYU A;  2E7Q A;  2VNG A;  3LD8 A;  4AI9 A;  3O14 A;  3T4V A;  3APB A;  2QQV A;  1SPP B;  3MW4 A;  4X6R B;  3IIA A;  5CKM A;  4AHZ A;  4Q8L A;  3AVS A;  3ZX7 A;  4AI3 A;  2PA7 A;  1RIT A;  1QNY A;  2XH6 A;  3EO6 A;  3POF A;  1YJK A;  2KR2 A;  4UT5 A;  1MPX A;  3RJ2 X;  3WNL A;  4ZZ8 A;  5C71 A;  2WNU C;  5DZE A;  4XTM A;  1ASJ 2;  5FV3 A;  3NO8 A;  5I8S A;  3UES A;  4BQY A;  1Q3E A;  2DDU A;  2R49 A;  3ZYB A;  5CG8 A;  1POV 0;  5LAS A;  3UJQ A;  4FTB A;  2XGX A;  4MGK E;  4R4Z A;  1DP0 A;  2NN8 A;  2VO5 A;  5A7N A;  3AP9 A;  3WNP A;  2VUD A;  4RSU A;  2R07 3;  1YQ8 A;  2OUH A;  2R06 3;  4YFZ A;  3T2Q A;  1OBN A;  2BYV E;  5JIU A;  4Z92 B;  3OYW A;  2RS3 3;  1TME 2;  2W08 A;  5DAQ A;  4DIN B;  4Z1V A;  3POJ A;  5I8T A;  2B46 X;  5FPV A;  1HKD A;  1I5Z A;  3VL9 A;  1Y9G A;  3HMY A;  4AAP A;  4AZZ A;  4K21 A;  4D94 A;  5L19 A;  4B1L A;  3BU0 A;  1EUT A;  2ZEX A;  3LKJ A;  2LS6 A;  2ZPX A;  4NWW A;  5LA0 A;  2WN2 A;  3KCX A;  5FJK A;  1Q8S A;  2D5H A;  4QB2 A;  4AQS A;  1YHF A;  3I3B A;  3J4U H;  4IL7 A;  4HG6 B;  4JHZ A;  4QGL A;  1DQ6 A;  1YLL A;  1ZRR A;  3Q8E A;  4YGD A;  3USU A;  1PIV 2;  3JD7 3;  5B4N A;  4NHL A;  4PI2 A;  4YW7 A;  5EQU A;  1ZA7 A;  4OHY A;  5IVC A;  2FCU A;  2PQQ A;  2Y6F A;  4KL1 A;  4NPR A;  2PXJ A;  4KBZ A;  2Q8O A;  1H9P A;  5DUU A;  1FV2 A;  5E8A A;  3JD7 1;  3PL0 A;  4ES8 A;  4A3X A;  2HWE 1;  1H6X A;  1C28 A;  1C5I A;  3KD4 A;  2E63 A;  4AI1 A;  2XBO 2;  4FAH A;  1W0O A;  3RSJ A;  2DUP A;  2E53 A;  1LUL A;  2C1F A;  4DEV A;  5C5U A;  3J8F 2;  4GWI A;  1G9C A;  3TN9 1;  5BNP B;  2PHF A;  3E5X A;  5LBB A;  4EJR A;  3H42 B;  4J1W A;  5FYI A;  2WZR 3;  1JW6 A;  5FMB A;  4M3C E;  1UY2 A;  5FZ6 A;  3W20 A;  2JJ6 A;  5C4W B;  2BFU S;  1IQA A;  4CXW A;  1XXN A;  4YW2 A;  4LLO A;  2JDA A;  4UWD A;  1K5M C;  3NNL A;  4DOU A;  4FP3 A;  3LB9 A;  4NN0 A;  1K5M B;  5IFT A;  1HXS 1;  3I2K A;  5BNN C;  3B3Q E;  4EV0 A;  4JKM A;  4ARY A;  1ZBE 3;  5FMC A;  3ZFE A;  2ET7 A;  2DBN A;  1NAE A;  2H0V A;  1ND3 C;  1N1Y A;  2UY9 A;  5KHG A;  4NRO A;  1V6L A;  2XBO 1;  4N90 A;  3UT0 A;  3E6B A;  1V9U 2;  1FMD 2;  2D7F A;  3Q8A A;  4GAL A;  3TNQ A;  1COV 1;  5F3E A;  1RUI 3;  1DQ5 A;  1MS4 A;  4DUV A;  3I3M A;  1UOF A;  3LQC A;  4LHL A;  4DZG A;  3RJR A;  2WAB A;  1OXC A;  4G9S B;  4IEY A;  4QX3 A;  5EPA A;  4QKD A;  2R16 A;  3M3Q A;  3AYA A;  3EMR A;  3AP7 A;  2Q8C A;  5DZF A;  1RUE 1;  1HV0 A;  2CAU A;  3IAQ A;  3KV4 A;  1HQW A;  3R4D B;  4TYS A;  5EV7 A;  2VQ0 A;  5FXX A;  1UPI A;  1SMV A;  3ZYJ B;  1JOB A;  5CFD B;  1L7Q A;  1PVC 1;  2DVF A;  3FE5 A;  1W05 A;  4GJZ A;  4UF0 A;  5HCF A;  3UYJ A;  4BQ1 A;  3VHN A;  4IE0 A;  4JVA A;  4JGY B;  2E6V A;  2BV4 A;  5DUW A;  2P37 A;  1UXX X;  4YVW C;  2BW8 A;  3RMY A;  4AR2 A;  5DQ0 A;  3VBH C;  1ZBA 1;  1ZZ9 A;  3VDC A;  4CA9 A;  4MHR A;  4NOT A;  3WW4 A;  2Q4S A;  2YDE A;  1RED A;  3ZN5 A;  2YGM A;  4CDW C;  3QH7 A;  3ZXE A;  1J3Q A;  3HQR A;  4QM8 A;  3WZ1 A;  4M00 A;  1DZR A;  1FMD 3;  3I2G A;  5FXW A;  3RFR A;  3VBO A;  1SCR A;  4AAX A;  4IV3 C;  1R09 2;  2JE8 A;  4MH0 E;  3MIF A;  4KGG A;  2Q30 A;  1FAY A;  1HN1 A;  2EXK A;  4DXR A;  3GDB A;  5AFE A;  2HWD 1;  1AJK A;  3CLP A;  4KG0 A;  1COV 3;  1N1V A;  4RA0 A;  3HBZ A;  3VBU A;  4RYD A;  3N9N A;  1DCS A;  1W2O A;  4NII A;  2RS1 2;  4XZU G;  4M4P A;  3S7I A;  3J8F 3;  1NKG A;  3N7J A;  1DYP A;  3NRU A;  3SH5 A;  1V6K A;  3NST A;  2FMY A;  3BIW E;  4IE6 A;  5LEJ A;  3USU B;  5FCC A;  2KM2 A;  1XQN A;  2OQ7 A;  4YPJ A;  3GBF A;  1O4Y A;  5FBZ A;  4P02 B;  4UBH A;  4I2O A;  4IV1 A;  3H3L A;  4XF9 A;  1O6U A;  4CCO A;  3B5L B;  2QKD A;  1JYV A;  3MF6 A;  4XEZ A;  4OI2 A;  1AXY A;  1BEV 3;  2EXH A;  4XPV A;  3POI A;  3I49 A;  3KMH A;  2P2K A;  3PVE A;  4NVP A;  1XPW A;  3C8X A;  2Z79 A;  1GZT A;  1PMH X;  2X09 A;  4E2S A;  1S1A A;  5LK7 B;  3TEZ A;  1WMX A;  3HPN A;  3LEG A;  3LDR A;  4FVV A;  2ZEZ A;  5I0D A;  1TNR A;  1ZNP A;  3JXS A;  2GNT A;  3UGG A;  3BI3 A;  3OGR A;  4JRL A;  5FZI A;  4GKY A;  5H9Q A;  3VKF C;  3OBA A;  4CU7 A;  5A3L A;  1D2S A;  3J7N A;  3BGA A;  3DN7 A;  3EYP A;  1E5H A;  4A3Z A;  3U1X A;  2CSG A;  3O1V A;  2HKX A;  2VGD A;  2A3X A;  1IKP A;  4YG0 A;  4XOG A;  2VNR A;  2VOW A;  2WUH A;  3WHT A;  4TWT A;  2EIG A;  2ARA A;  3VUO A;  2DCZ A;  5FYM A;  5LA1 A;  1ODN A;  2E7A A;  1XE7 A;  5FK7 A;  1X7N A;  2AUY A;  3KLS A;  3GYD A;  3FMG A;  5KHH A;  2VNV A;  4COZ A;  1D4M 3;  2WT0 A;  1F5F A;  1G9F A;  3ZXF A;  1OF4 A;  2VNO A;  5FUN A;  3VBF B;  3HIF A;  3AXD A;  4W4Z A;  3AP6 A;  4KGQ A;  1V6N A;  2WNU A;  1FXZ A;  3UGH A;  4CE8 A;  3ZYR A;  4CUG A;  2ZGT A;  3CU7 A;  2DTY A;  3EBR A;  4QX5 A;  3RWK X;  5K9Y A;  1NCQ B;  3D8C A;  2CYF A;  2VR4 A;  4H2A A;  1UY1 A;  2ZGR A;  3CIH A;  5BNO B;  3RYK A;  3C3V A;  2V4V A;  4XQW A;  5IUQ A;  4AGG A;  5IVF A;  4RS5 B;  5DPN A;  2C26 A;  5F8P A;  2XG3 A;  5A1A A;  3WDV A;  1LHN A;  5IK8 A;  3VDD A;  1LEM A;  1ZA4 A;  2GN7 A;  4JHT A;  1UAI A;  4BWO A;  2W1S A;  3SHR A;  3RZL A;  5IAT A;  1ZRI A;  2WA3 A;  3SEP A;  4CU9 A;  4E4Z A;  4LE3 A;  2WAO A;  3RYP A;  2V5D A;  3NNG A;  5JXI A;  4OZX A;  2ARE A;  1W99 A;  1D4V B;  1Q5O A;  5FK8 A;  4XAB A;  3E6D A;  4UFH A;  4B7E A;  5JSP A;  4KQ7 A;  2R0H A;  2R6Q A;  2JEN A;  2RS1 3;  5F32 A;  1MS3 A;  2YB7 A;  2EA7 A;  4Q4W 3;  3S6P A;  3NNJ A;  2EF6 A;  3BVC A;  3ORJ A;  5KHI A;  3MV1 1;  1IOA A;  1QDO A;  1S0F A;  4HAN A;  5JOY A;  2R07 2;  2NPI A;  3FHQ A;  2IXK A;  2QQU A;  3IM0 A;  1MS9 A;  4GH4 A;  1GWL A;  3U0Z A;  2DBI A;  1MZ6 A;  1H2K A;  2W1U A;  3PMS A;  4N43 C;  4PT6 A;  4XMA A;  3D3A A;  4MGI E;  5K0U A;  4RR3 A;  1B35 B;  3ZOI A;  1HJG A;  3KCY A;  3OUI A;  4N53 B;  5L9R A;  1W6O B;  4HPK A;  1RUO A;  2WBK A;  4OYU A;  5FLH A;  5T5O A;  3AJY A;  3IDA A;  5FPA A;  3H50 A;  1W6N B;  3K4D A;  5FUI A;  3J8F 1;  3IDB B;  3O0W A;  2WII B;  3O0X A;  3VKL A;  3VD7 A;  4AFA A;  3VBR C;  3UNP A;  2GMP A;  1FPN 2;  2VJX A;  3JB8 A;  4MGQ A;  2XHK A;  5K4L A;  1KDM A;  1SHW B;  2E33 A;  2QCS B;  2WFF 3;  2C9K A;  3LEI A;  3AL5 A;  2LAL A;  4EQV A;  2DF7 A;  1LEN A;  1Y7B A;  2CWM A;  1XE0 A;  2Z4F A;  4NMI A;  1O91 A;  2JDH A;  1EV1 3;  1AL2 3;  4XVH A;  4QDS A;  4V1P A;  5DN2 A;  3W21 A;  5JOX A;  3H9A A;  1WW6 A;  1CIW A;  1HX6 A;  1OQE A;  2BZD A;  2PHR A;  2ZKL A;  1PGW 1;  3MBW A;  3OBT A;  4PDW A;  4UAP A;  4YVS A;  3WXP A;  1L7R A;  3O1U A;  3RRD A;  4FOQ A;  3ZSE A;  1K3I A;  5CU1 A;  3DPR C;  1C8M 2;  3V0A A;  1GUI A;  2VAU A;  3T4H B;  3ETP A;  1E5R A;  2JDP A;  3BB6 A;  3I3D A;  4AED C;  1LKN A;  2PN5 A;  3MEP A;  1SFP A;  2BOI A;  3H1M A;  3P5B A;  1AR7 3;  2OVU A;  4C0H A;  1YI7 A;  2O8O A;  3FBY A;  1PZ8 A;  5I0T A;  1W28 A;  3K4Z A;  1DQ4 A;  3WP6 A;  3W58 A;  4AI8 A;  2WO3 A;  1X9T A;  3LPF A;  4E8D A;  1QWR A;  1X8M A;  2MPF A;  2BGO A;  1SLT A;  3X29 B;  5A6Q A;  4YAR A;  4XFH A;  4H3W A;  5CKQ A;  4OMC A;  5J37 A;  5JXJ A;  2YRO A;  2ZCW A;  2K0G A;  5ACA 3;  1RB8 G;  4LBM A;  3V0A B;  2XPJ A;  3SEE A;  2VQT A;  1V6M A;  5ABJ B;  3P6B A;  1XNA A;  2WZR 2;  4BOW A;  4UFI A;  3BKZ A;  2W46 A;  2WWS A;  4Z2W A;  3FX3 A;  3O7O A;  2WQZ C;  4LJH A;  4XCB A;  3LSE A;  5GLZ A;  3MV0 1;  5F3I A;  4W8J A;  3WF1 A;  4RFT 0;  4Q8K A;  4QGN A;  4CPB D;  4QT6 A;  2VZ1 A;  4Y1V A;  1W8Z A;  4DRV A;  2PQS A;  1OT5 A;  4QPG B;  5IW0 A;  3P3P A;  5DAP A;  5GM0 A;  3H8X A;  1GP6 A;  5GLW A;  5T55 A;  3WSO A;  4IGQ A;  2KA3 A;  1RMU 1;  1FX5 A;  3D6E A;  3M3C A;  1AR6 3;  1X36 A;  1FOD 3;  3OGJ A;  2UWB A;  4LHK A;  4U2A A;  1AF9 A;  2G9G A;  1RIR A;  2LRO A;  1WA6 X;  4MLO A;  5L9B A;  1W6M B;  2YBP A;  2OA2 A;  4XXP A;  5JIA A;  5FXV A;  1YC6 1;  2XLG A;  3N4M A;  4WM7 C;  2UYA A;  2WLP A;  4MOA A;  5EIY B;  4CDU C;  1YYN A;  1QMJ A;  2BNM A;  1RUE 3;  4R8H A;  4CEW A;  1G9A A;  3UKV A;  1OA4 A;  3OOX A;  1CPN A;  2K2S A;  1G9B A;  2QQK A;  4QD2 A;  4KWK A;  1LOC A;  4UBG A;  4FPL A;  2WNO A;  3I2H A;  4P9I A;  4W50 A;  3ZR6 A;  5KHJ A;  5I0U A;  4JGY A;  3AFK A;  3I2I A;  5FZE A;  4Y5S A;  2PEL A;  4E27 A;  1ND2 B;  3NAP B;  5H9R A;  5E88 A;  4CCC A;  1QXP A;  2BOJ A;  4QPW A;  2QZ3 A;  1JYX A;  1Y4W A;  1OSG A;  1APN A;  2QUO A;  5CFD C;  3WCR A;  3AXE A;  2W47 A;  4OZO A;  3AP5 A;  4IXL A;  1W03 A;  3K75 B;  1G86 A;  1W8T A;  5FP4 A;  3OPZ A;  2GC0 A;  5E89 A;  3FZ3 A;  3RI9 A;  3RZM A;  4IEZ A;  1VBD 2;  2BP6 A;  1DU3 D;  1C1L A;  1H4G A;  4LBQ A;  2Y0O A;  1UMZ A;  3B01 A;  2WS9 2;  2D5F A;  2GC3 A;  3EJK A;  4YM0 A;  4CDX B;  1OFN A;  3VBU B;  3ZM8 A;  1AR9 3;  1SFY A;  3HNB M;  4AVA A;  1SBF A;  1MEC 3;  1GNH A;  3E97 A;  2P4E A;  4OUS A;  1C57 A;  3BYW A;  3K51 A;  5F37 A;  2JG8 A;  1NOV A;  4PF5 A;  5FP3 A;  3PJY A;  5BV6 A;  5A7P A;  5IK4 A;  1DLL A;  1RUC 1;  5DZG A;  3QH6 A;  3VZO A;  5GZC A;  1W6P B;  3NVC A;  3AMQ A;  3TRS B;  1V9U 1;  2FD8 A;  4YRD A;  4FSJ A;  2XQR A;  1OD3 A;  1WW4 A;  3T08 A;  1GOF A;  2ZHK A;  4S2H A;  5JZG A;  1D7P M;  3THT A;  1CAW A;  3HN3 A;  1SLB A;  2Q8D A;  1YO8 A;  3D0S A;  3DV8 A;  3PDQ A;  4IQP A;  1NLS A;  1OUS A;  4CEY C;  4CZS A;  4LHS A;  4IE5 A;  4AI2 A;  1S0G A;  4BJ0 A;  1ZRD A;  3M3I A;  4GB3 3;  2PAM A;  2VCC A;  3WQ0 A;  4NPL A;  2B39 A;  1WD4 A;  3ME2 A;  4Q27 A;  5IAV A;  2RR1 1;  1BBT 2;  2WSV A;  2VBD A;  3L2Y A;  4XET A;  1GOG A;  1YIF A;  5IJR A;  4BIS A;  3LDB A;  1DGR A;  4AI0 A;  1ACC A;  4TXW A;  1ULF A;  3WQ1 A;  3ZYI B;  4JTO A;  1XSR A;  4AED B;  2OX0 A;  1HV1 A;  1VMH A;  4AHX A;  4K40 A;  2A7A A;  2MEV 2;  3KHB A;  1IS3 A;  1MZ5 A;  1Z78 A;  4DRR A;  5BY5 A;  2HWE 2;  3FN9 A;  1AYN 1;  3ILN A;  1J83 A;  3KT1 A;  1CIY A;  5DXD A;  2PHX A;  5F2S A;  3V64 A;  4I3G A;  3IMN A;  1IS6 A;  4JKL A;  3RDI A;  1BCX A;  2JDY A;  4EN0 A;  4XFI A;  3SKV A;  1G9D A;  2J1S A;  4QPI B;  2Y6K A;  3PIG A;  4AE2 A;  1CJP A;  5A3U A;  2XJQ A;  2A73 B;  4AQ6 A;  1WW5 A;  2Y60 A;  3GJA A;  4JZR A;  2RJ2 A;  4JDO A;  3ACF A;  3SH3 A;  4LKE A;  4GMP 1;  3ALQ A;  4DS0 A;  1IG3 A;  1WGP A;  4CUA A;  1UZY A;  1UYX A;  3DKW A;  4UW5 A;  4YG3 A;  2BPA 2;  2R06 2;  4CP9 A;  2X05 A;  2DUO A;  4AVC A;  4B1M A;  5FZA A;  1NZI A;  4CEW B;  4K8F A;  1BMV 2;  4XUO A;  1QOT A;  1PK6 A;  5LAT A;  5FWJ A;  3LIH A;  2BU9 A;  5GZD A;  1YEW A;  3HQX A;  3I4I A;  5FZ4 A;  3WT3 A;  2DVA A;  1GP4 A;  1F2N A;  3I7D A;  3SCH A;  1KGY A;  3ES1 A;  4OMD A;  4FPG A;  5BNO C;  4B8E A;  4XAA A;  4AHY A;  4ES9 A;  1H8T C;  3OSD A;  5BNN B;  4QQL A;  1XND A;  3PVB B;  4PF1 A;  4KU8 A;  3LA7 A;  4PIY A;  5JI7 A;  4IEU A;  1RUI 1;  1AR8 1;  3MW3 A;  2C5D A;  5FIX A;  3VD5 A;  2XVK A;  1TNF A;  4AVB A;  2ZHM A;  1FPN 1;  3LAG A;  4FFI A;  1DYO A;  3VN4 A;  1GYK A;  1R1A 2;  1VAL A;  1PO2 2;  1H1M A;  2G9Z A;  4RQP A;  4A7Y A;  1AXK A;  2ZX2 A;  4FQZ A;  1VAV A;  4TLG A;  4XAC A;  2X10 A;  1AL2 2;  1XU2 A;  4FT8 A;  4HPK B;  4QQP A;  1Q8Q A;  5T50 A;  5AC9 1;  5A7Q A;  5J09 A;  2J1A A;  3N7K A;  5FY7 A;  5JCT A;  5EWS A;  3ZXG A;  1PX4 A;  1Z7S 2;  2BWC A;  3MFC A;  3QCW A;  4R9C A;  4ZS3 A;  4QDQ A;  3C7O A;  1W6P A;  3WDT A;  4OCT A;  2FZ1 A;  4EYU A;  2C24 A;  4TTG A;  1IHM A;  1H4H A;  3SKJ E;  3U75 A;  2ZX0 A;  2BUK A;  3IWZ A;  1BBT 3;  4Q1R A;  1LOF A;  2XLA A;  3CKH A;  4XHB A;  5FJH A;  3TN9 3;  4N8M A;  1OF3 A;  2PLV 2;  1VPH A;  5C3R A;  2D6P A;  2J22 A;  5FY0 A;  3E5U A;  1U0A A;  5ANN A;  5HCH A;  2E9Q A;  3WUD A;  2YC4 A;  2W95 A;  1LES A;  2QJV A;  4XUN A;  2QVS B;  1V00 A;  1K42 A;  3VBR B;  1BQP A;  2RS5 3;  1HDK A;  3HD8 B;  4XC9 A;  1YFX A;  2EAK A;  4BZ4 A;  4JQT A;  3ELN A;  2ZHL A;  1LJ7 A;  1NA1 C;  4RHV 2;  4Y1X A;  2ZTN A;  3AKP A;  1BK1 A;  4RQP C;  5FYS A;  3ECQ A;  3DYP A;  3USS A;  1ENR A;  4XJZ A;  3ZDV A;  1WBL A;  1W8O A;  3DKQ A;  3III A;  1JYC A;  1QIQ A;  4KH9 A;  3QOP A;  4Q4X 2;  1CZS A;  1JHJ A;  3OTF A;  4PBO A;  2VMD A;  3E5Q A;  1GP5 A;  2Y38 A;  1O4Z A;  1GZW A;  3IKW A;  4K1Z A;  1AL0 G;  2W5F A;  2FCT A;  2ZJC A;  4FPF A;  4CEY B;  4JV4 A;  5D8A B;  3OG2 A;  4KBB A;  1OPM A;  1RUC 3;  2VXJ A;  4P00 B;  1HXS 3;  1KFX L;  1W2N A;  1W2T A;  2RHP A;  4LO5 B;  2PAK A;  4LE4 A;  4WM8 B;  5AVP A;  1VRH 1;  4N53 A;  4XFA A;  2JG9 C;  4GWM A;  1YIP A;  4HXC A;  3WDW A;  4V2W A;  4K9S A;  3VD9 A;  3GHM A;  1BKZ A;  1Z7S 3;  1RHI 3;  3MI8 A;  4AYU A;  2Y6L A;  2ADD A;  4YGB A;  4ET7 A;  2ES3 A;  4BXS V;  4S2G A;  3DEM A;  2W68 A;  3LCP A;  4DY5 A;  5FO8 B;  5C5T A;  2HWF 1;  1LHW A;  1EAH 1;  1T2X A;  4YGC A;  5BNP A;  1PK6 C;  3SCF A;  1RUH 2;  3CZU A;  2Y6J A;  4ISR A;  1A34 A;  2IXJ A;  5DDJ 2;  1UF2 C;  4QPG A;  5J98 B;  1ZRF A;  3I2D A;  4QDR A;  2ORZ A;  1O3Q A;  3O1T A;  2HWB 2;  5CAZ A;  1JZ2 A;  3O1P A;  1MS8 A;  1HRI 2;  3RZH A;  3PUR A;  1N3O A;  4M01 A;  2BJS A;  2DCK A;  3EXU A;  3C7F A;  1MZE A;  3NW4 A;  3PLQ A;  1FNY A;  1MS1 A;  5C3P A;  1KRI A;  4FO9 A;  3VLB B;  1UZV A;  1VIW B;  2NLR A;  1AYM 3;  3CF6 E;  4YVS B;  1ZRE A;  1UNB A;  4UFM A;  3TB0 A;  4F7Z A;  1XE8 A;  3H7Y A;  3T3Y A;  3O5S A;  3HNM A;  1F31 A;  1N3P A;  3I2F A;  3O1M A;  1SG3 A;  1V6J A;  4J25 A;  5KC5 A;  2J1T A;  1JZ4 A;  3THD A;  3N3H A;  2QQP A;  2PHT A;  2CDO A;  4F8A A;  4E9K A;  3G6J B;  5AVA A;  3NAP A;  5FZL A;  1F35 A;  2ZGO A;  2Y26 A;  3BIE A;  4BIF A;  2GSY A;  2QQO A;  4XF1 A;  3OUH A;  5FOB B;  1MS5 A;  2GN3 A;  2L9L A;  2RS5 2;  3I3Q A;  2ZAB A;  2ZEY A;  4P14 A;  1XYP A;  2RMU 3;  5C70 A;  2YXS A;  1YFU A;  2FDH A;  2P17 A;  1PHM A;  2XJR A;  3UL2 A;  5D21 A;  2YPD A;  2VOV A;  4ONU A;  4YW6 A;  4DMI A;  3VHP A;  2OZ6 A;  3AZY A;  5BNP C;  1TME 1;  4A6O A;  3N7L A;  2GND A;  5C8C B;  4Q0P A;  4Q4X 3;  4XBQ A;  5E16 A;  4AEJ A;  1C8M 1;  3ABZ A;  4Z07 A;  2EAA A;  3RVH A;  2V5Y A;  2VZP A;  1AR9 2;  4HKO A;  4BXF A;  2HEW F;  5JPM B;  1CAX A;  1L3J A;  2WS9 3;  4I30 A;  4CRQ A;  3POW A;  3SNM A;  1ZRC A;  4UOJ A;  1J59 A;  1ZBA 3;  4QQO A;  1YXW A;  3TOJ A;  1WMD A;  2RDQ A;  4Q26 A;  2EAL A;  3L2H A;  2JKB A;  3VBS B;  1K12 A;  3VBS C;  2RS5 1;  2VZV A;  4ZON A;  4Z8B A;  3W59 A;  2D6O X;  4LT5 A;  2MNG A;  4LKF A;  5IVJ A;  5HXV A;  1W90 A;  4D7Y A;  1G6N A;  2Q1M A;  2VOK A;  1X8E A;  3HN1 A;  5A70 A;  1OA3 A;  2HLE A;  3AZV A;  3ETQ A;  1JH5 A;  3ZFE B;  3S0M A;  3KQR A;  1R08 2;  2ZAH A;  4RS5 A;  5LRS A;  4YVW B;  3OEA A;  4LBN A;  3KB5 A;  1DQ0 A;  4HK8 A;  1ULE A;  4XUT A;  5GLV A;  5H9S A;  1RUF 3;  1HRI 1;  2DU1 A;  5I0R A;  4BMB A;  4K6B A;  4LO8 A;  3Q9O A;  2WL1 A;  3ZFG C;  5H9P A;  5T5J A;  2VOX A;  3H3Z A;  3PME A;  4WZC A;  5J36 A;  2P34 A;  1HRV 1;  2N7G A;  4AHW A;  5A3N A;  4YW3 A;  4BQ5 A;  2ID4 A;  5F5I A;  1LOF C;  3M2M A;  1N1S A;  1N1T A;  3KV6 A;  2ZS6 B;  4HMZ A;  1UZ0 A;  2XL7 A;  5A3T A;  2HWB 1;  1LOB A;  3A0N A;  4YGE A;  2JWP A;  4GH4 B;  3K3N A;  4FPE A;  1V9U 3;  3MPB A;  1WW7 A;  1VBE 2;  1Y43 B;  4W6W A;  3MIC A;  2W2I A;  4DEQ A;  1GNZ A;  3CJI B;  5FLJ A;  2IVI B;  3RZJ A;  2D6L X;  4C91 A;  3BPS A;  1UU5 A;  5F9T A;  5FOJ B;  4XE9 A;  1O8S A;  4D7S A;  1U12 A;  2VTF A;  4AOC A;  3W5N A;  2WNV A;  2XML A;  1O5L A;  1OOP A;  2IXL A;  3OY8 B;  5FRA A;  4B3N A;  3SC7 X;  4H7M A;  2V73 A;  1ULP A;  1SDD B;  2QQJ A;  4WBB A;  1DF0 A;  4HSJ A;  3U4X A;  3BOP A;  2DTW A;  1STM A;  3BOD A;  5JXG A;  2A6Y A;  2B42 B;  4XFF A;  2WFP A;  1DHK B;  4DB5 A;  5FZF A;  2WNE A;  1JS9 A;  3R6S A;  2FDK A;  5APA A;  1GQP A;  2A70 A;  5ERL A;  4DO0 A;  3DYM A;  1TE1 B;  1SLC A;  2JDK A;  3PU3 A;  1DQ2 A;  2WR9 A;  4Y20 B;  2X53 S;  3H0O A;  4Y4Y A;  3WDX A;  4AGV A;  1OLR A;  4CXY A;  2TEP A;  3NJY A;  1LHU A;  5A7O A;  3ZMO A;  3INA A;  5FO9 B;  2VCA A;  1W6M A;  4KWJ A;  5CKN A;  2O1Q A;  4HVO A;  5D8A A;  3WP3 A;  2W87 A;  2B4K A;  3THC A;  3LPG A;  1EV1 2;  1K45 A;  1POV 1;  1VBE 1;  2FHR A;  2YC2 A;  4RHV 1;  1VAM A;  1LR5 A;  4Y26 A;  4CCM A;  4PQ9 A;  3GF6 A;  3N35 A;  5FY4 A;  2IFR A;  2RM2 1;  4Q2F A;  2Q8E A;  4CDQ A;  2B5H A;  2PLV 1;  5F6K A;  4YM3 A;  3RQ0 A;  3ZR5 A;  4URA A;  3FJS A;  3D4K A;  4JC1 A;  1OLQ A;  4LKD A;  1CES A;  3ACH A;  3AKR A;  2E32 A;  4CU6 A;  1QH7 A;  2WYS A;  3WDU A;  2LRP A;  5T3N A;  3ZYG A;  4FTE A;  1LRH A;  1NQD A;  4PDW C;  5E1R A;  5L7O A;  1YFW A;  3AP4 A;  4NJ4 A;  1NCQ C;  3LA3 A;  2OUJ A;  1BEV 2;  4BPZ A;  4LBJ A;  3AYC A;  5AC9 2;  3AKQ A;  1XYO A;  1QJU 3;  3BCW A;  1X50 A;  2CY6 A;  5ABJ A;  4L9B A;  1XNB A;  2XR4 A;  2CWS A;  1UOB A;  5A1F A;  3MW2 A;  4FPO B;  4JGZ A;  5B4X A;  3ZSM A;  2XWB B;  2BGC A;  1I9R A;  5EHD A;  1QJZ A;  1QQP 3;  1W6N A;  1GZ9 A;  1QGL A;  1ND2 C;  3T0B A;  1UN1 A;  2PYT A;  2WC2 A;  3IDE A;  1PO2 1;  5C8C C;  3BUC A;  3S5A A;  4E4H A;  1JYI A;  3SQO A;  3DUI A;  3ZFF C;  4YZ1 A;  4HON A;  5C3S A;  4XIL A;  1A8M A;  1ZYB A;  2NP0 A;  1SPP A;  3DXU A;  4JGZ C;  5FZK A;  3K3O A;  5FDB A;  4RHV 3;  1J1L A;  1XNK A;  2C9A A;  1RMU 3;  3S7E A;  2PHD A;  2XJU A;  1Z0H A;  3KV5 A;  4E4D X;  4HL0 A;  4YLZ A;  4HET A;  3TAY A;  4GKX A;  3POS A;  1UZZ A;  2BVV A;  1DG6 A;  4XIO A;  3TEX A;  4LXL A;  1W6Q A;  1FOD 2;  1H1A A;  2AEY A;  5IHR A;  2QQW A;  1NA1 B;  3HVD A;  3NJV A;  2XQX A;  3VHO A;  4AVT A;  4BE3 A;  3GZU C;  4CCK A;  4B29 A;  2ZGM A;  1PGL 2;  4MAD A;  1R09 3;  4OI0 A;  2R04 2;  3KT7 A;  4NWV A;  1YWK A;  1Q8O A;  3OUJ A;  5FZM A;  2E31 A;  3WVJ A;  3I54 A;  2UYB A;  4I09 A;  4NRQ A;  1W0N A;  3IDC B;  2ZX3 A;  4YG6 A;  5FP9 A;  4ZHN A;  5GJ6 A;  4QB6 A;  3VZK A;  5IVE A;  1DGW X;  1K5J A;  1W3V A;  3LDK A;  3OEB A;  4L0P A;  2PLV 3;  3KM5 A;  1LEC A;  1AYM 2;  2VVD A;  5D8A C;  1SBE A;  5FZO B;  3GBG A;  3ZXK A;  4AFM A;  4E8C A;  4Y33 A;  5L36 A;  2Y0I A;  4PCR A;  1J3P A;  1XNC A;  3NJX A;  4CP0 A;  1LGN A;  2ETE A;  3ATG A;  3D5O A;  5EYX A;  5CFD A;  1VJ2 A;  2VBB A;  4HOO A;  1J3R A;  3ILF A;  1QOS A;  2OXB A;  1SZB A;  1U5X A;  3DF0 A;  4IES A;  2VY0 A;  4QX7 A;  1D4M 2;  1OA2 A;  5DAW A;  2ZGU A;  4RGK A;  3WD5 A;  2XL9 A;  3JBG 1;  4L2N A;  1AYN 2;  2EIE A;  4BLI A;  5A7W B;  5DDJ 3;  3HBK A;  3MPP G;  2YFZ A;  3PUI A;  1KJR A;  1WKY A;  4EN9 B;  5J1X A;  4W6Y A;  1YQC A;  2GU9 A;  1AR6 2;  3PTY A;  2WYF A;  1MQT B;  3NV3 A;  2QQN A;  2JG8 B;  1KS4 A;  1MQT C;  3RGB A;  4EN8 B;  3DCQ A;  2GH2 A;  1RUG 2;  3GCW A;  2ZKN A;  4PJY A;  1ZZ8 A;  4CTE A;  3ZPY A;  2XWJ B;  4C1X A;  3B9C A;  3R05 A;  3VL8 A;  4CU8 A;  3ASI A;  5LZ6 A;  1ZX5 A;  4MSV A;  2GC2 A;  2VCM A;  3F95 A;  1BVP 1;  2GNB A;  3HJR A;  4LBO A;  2YZ4 A;  4L97 A;  4PBP A;  5LK5 A;  2Y8K A;  2VTX A;  2V09 A;  3WG4 A;  5F5Q A;  4DPN A;  3LFI A;  3ZN6 B;  1NLQ A;  5CFC B;  1AVB A;  1T6B X;  2R1B A;  3POB A;  4ZY9 A;  2VW1 A;  2OKX A;  2A6Z A;  1W9F A;  1GQH A;  4XF4 A;  2IC1 A;  1VLN A;  1QF3 A;  3ZFF A;  2GP5 A;  1MQT A;  4TSV A;  1VBC 1;  2VUC A;  2IUW A;  2YHJ A;  3M3E A;  4QHB A;  3H8U A;  4C1W A;  1JUH A;  1LOG A;  3WX5 A;  4I3P A;  1ND2 A;  1VBD 1;  2PTM A;  3AK0 A;  4DQA A;  4MGT A;  3V0B A;  2LUW A;  1BK0 A;  5CIS A;  3LOI A;  2I07 B;  4FP2 A;  4IER A;  5FY9 A;  4RS5 C;  4OUE A;  5ABJ C;  4MXW B;  2AEN A;  3AJZ A;  4UFK A;  1VMJ A;  1OKQ A;  3D82 A;  3VZN A;  4Y22 B;  1QH6 A;  1YNA A;  1PIV 3;  2JB4 A;  2VD7 A;  5D2A A;  4CCJ A;  1N47 A;  4A7K A;  2BGP A;  1JN2 P;  1HQN A;  2ILM A;  2KD7 A;  3T0A A;  1KFU L;  1S0I A;  2G9F A;  2YGL A;  1NXM A;  1MAC A;  4QWN A;  2A6V A;  2I2S A;  5FZ8 A;  5FMO S;  3POE A;  4ORF A;  3ENR A;  4QPG C;  3VD4 A;  3J9S A;  5FR3 A;  1JYT A;  2Y33 A;  3AYE A;  1W6Q B;  1EPZ A;  1V6O A;  1O5U A;  1XRU A;  4A41 A;  3IPV B;  1J58 A;  5DAV A;  4IEW A;  2R30 A;  4CDQ C;  1LED A;  3TEW A;  4CDQ B;  4YVW A;  2W39 A;  3C7E A;  4ZU4 A;  1SBD A;  3MO4 A;  1UYY A;  2ZZQ A;  3PHM A;  4WM7 B;  1UKG A;  1YQ2 A;  1C8M 3;  4M3C F;  4N53 C;  3KF5 A;  4D6Q A;  3M1H A;  2RMU 2;  2HYK A;  1R08 3;  1VB4 A;  2ZOE B;  4LUM A;  5IVY A;  4BIO A;  4EZH A;  4I01 A;  5FZ1 A;  1XBF A;  1JMU B;  1OUX A;  4B4Q A;  1KIT A;  3GGL A;  1D4M 1;  2XXZ A;  3NKT A;  2PFW A;  4I0A A;  2RDR A;  4O9G A;  1GWM A;  1F15 A;  1UIJ A;  3THP A;  5JOZ A;  2Y64 A;  1NLR A;  4QX8 A;  1TMF 3;  2XON A;  1J84 A;  2JDU A;  3NAP C;  5I8Y A;  3EB7 A;  1PNF A;  2Z42 A;  1RUI 2;  1IPS A;  2YFU A;  3H1W A;  4XQD A;  5J3U A;  4BQW A;  5F7U A;  1DFQ A;  2A3Y A;  2EXJ A;  5C8C A;  3LZZ A;  1ENQ A;  3K77 A;  2AEZ A;  3WUC A;  2WNV C;  4NAM A;  4RQP B;  1QJY 3;  1IZ3 A;  2XVG A;  4Q4Y 3;  2CDP A;  5A32 A;  1BYH A;  3ZKU A;  2PHL A;  1PO2 3;  1PO1 2;  2V72 A;  3CZJ A;  1LOE A;  2GAL A;  1CQ9 A;  2R04 1;  5K0U C;  5CAD A;  3M3O A;  1OH3 A;  4CVU A;  3KHC A;  2ATF A;  3WLU A;  4QMA A;  1WD3 A;  3CJI C;  4QKB A;  3T1L A;  3AZW A;  5J7M A;  1YRZ A;  2AGS A;  2AAC A;  4V2V A;  4Y5Z 0;  5HBA A;  1R1A 3;  1VBA 3;  4YW5 A;  5FQ0 B;  1RUD 1;  3AMH A;  4MGS A;  4AEK A;  2NMN A;  4OUL A;  1HB2 A;  2ORX A;  2NZ9 A;  1ZM1 A;  2X8K A;  1MVQ A;  4QX2 A;  4RR3 B;  4CP9 B;  5GKA C;  2OPW A;  1RUG 3;  5DUX A;  2XKP A;  2BVB A;  5C8W A;  3FUQ A;  1ENX A;  2Z5W A;  1LTE A;  2AYH A;  2I74 A;  2VQA A;  3RZK A;  2VMG A;  3WQ7 A;  4ATE A;  3NMB A;  5FP8 A;  1JU3 A;  1OMI A;  2AZ5 A;  4R4X A;  2OZJ A;  1P8J A;  3C2U A;  4K7J A;  2NYY A;  2CNA A;  3BAL A;  1RUE 2;  2D3S A;  1E5S A;  1RTV A;  2K9Z A;  5C4W C;  3DEC A;  2IFW A;  1Y9M A;  2C6S A;  5J48 A;  4JRA A;  4XJU A;  2ZAA A;  4HFS A;  3WHU A;  1D2Q A;  5FZO A;  2NMO A;  2UWA A;  1KS5 A;  2WLQ A;  1X9P A;  3VDA A;  5JAX A;  4IE7 A;  5SV5 A;  1X82 A;  1AXZ A;  2DCT A;  1F5J A;  2OQ6 A;  2ZGK A;  4RGG A;  3LIG A;  1H8T A;  4UW6 A;  2ZMK A;  4RN5 A;  3L9J T;  3V65 A;  1OKO A;  1UX6 A;  1UMI A;  1DQ1 A;  4MET A;  2D6N A;  1XYN A;  2WO7 A;  5C4W A;  1OOP C;  3A7Q A;  1PX3 A;  1UKR A;  4DY3 A;  5IVB A;  1OOP B;  1ZZB A;  3ZVX A;  4A45 A;  2TBV A;  4E2Q A;  5HI0 A;  1NYW A;  4GWJ A;  4XMI A;  3O0V A;  2KXL A;  1BEV 1;  1LOD A;  2FBE A;  1E57 A;  2RMU 1;  2VXR A;  4FCA A;  2FDF A;  1C5H A;  2SBA A;  3CMG A;  2RVA A;  3J26 N;  2Q1F A;  3AKT A;  1CR7 A;  1S55 A;  4HSL A;  4EWD A;  2TNF A;  5T5P A;  2ZGQ A;  5C7G A;  2ERF A;  1UIK A;  2VH9 A;  1Q8P A;  4AQT A;  2AH2 A;  2HJI A;  2OII A;  4L11 A;  3VZM A;  4QKF A;  4IE4 A;  5GZF A;  4DXS A;  5FPX A;  4Y20 A;  4MXV A;  2HWF 2;  1PGL 1;  2WS9 1;  4WZF A;  5CFC A;  2DVD A;  3ZFG A;  1PO1 3;  5KBF A;  4ASK A;  3T09 A;  4B4R A;  5T52 A;  4OI1 A;  1LOA A;  4YW4 A;  1XSQ A;  3CJX A;  3I2J A;  4LBQ D;  4QHZ A;  2O8Q A;  1MEC 1;  1CAV A;  1WZX A;  2Z69 A;  2EVX A;  5C9A A;  1AR8 3;  3WP4 A;  1TMF 1;  3MID A;  5EP9 A;  1O3T A;  1AR7 1;  2R32 A;  2WWU A;  2Q1Z B;  4K8R B;  1TMF 2;  2A71 A;  2D44 A;  3I8T A;  1ST8 A;  3OPW A;  4YNI A;  3VBU C;  4DFS A;  3B69 A;  1POQ A;  4KU7 A;  5A3W A;  4BM8 A;  1MEC 2;  1G8W A;  4XW3 A;  3HAG A;  2WO1 A;  4IV3 A;  3VBO C;  3HT1 A;  3ZYH A;  1UYZ A;  2FMD A;  4LOT A;  3VGI A;  4BQ2 A;  5F2W A;  4Q29 A;  1A3K A;  1ZZ7 A;  2HWD 3;  1OC1 A;  4JKK A;  4LO4 B;  4I0B A;  4CYD A;  2OW4 A;  4WVM A;  4M4R A;  2VCB A;  4Z2A A;  4DUX A;  2D3P A;  4FI9 A;  2F17 A;  1VBA 1;  3LEK A;  4XF0 A;  2XUE A;  4UI9 L;  3KQ4 B;  2D6K A;  4HN0 A;  1VRH 3;  4WV8 A;  1OLM A;  4UW3 A;  2WT2 A;  2E26 A;  3IPV A;  5FBJ A;  1SLI A;  2P3J A;  4Y24 A;  3OF1 A;  4QU2 A;  4YW1 A;  2CU5 A;  1RMU 2;  1LHO A;  4CCD A;  1MS0 A;  2HWF 3;  4ASM B;  5KXE A;  2HBU A;  5EFU A;  3OCP A;  4XFC A;  1AR6 1;  1DLC A;  1DZQ A;  5E6H A;  2QBX A;  1AX0 A;  4QX0 A;  4Y1Z A;  5FYB A;  4LK7 A;  2CV6 A;  2ZBJ A;  2JDN A;  3GZE A;  1AX2 A;  3H1Y A;  4XDO A;  1UX7 A;  3B9I A;  3MIE A;  3NKG A;  1QJX 2;  5A33 B;  4LIV A;  1NA1 A;  4HLT A;  4YYO A;  3WEZ A;  1GWK A;  2FDI A;  4PLN A;  4NIH A;  1H9W A;  5JPN B;  3URF A;  2HWD 2;  4N9H A;  2A5Z A;  1AUY A;  1TEI A;  2DCJ A;  3ACL A;  4R52 A;  3KGL A;  4YWA A;  2W92 A;  2RS3 1;  1F4H A;  4QQ2 A;  4E2G A;  5L73 A;  1GNY A;  1WCK A;  1W0P A;  2H0B A;  2WNU B;  1B09 A;  2WQ8 A;  3UJO A;  1VR3 A;  4COY A;  1GKB A;  3VHR A;  4D7T A;  4EZ4 A;  5CFC C;  5BNN A;  5ACA 1;  3WG3 A;  4CEW C;  1JZ5 A;  3WQB A;  1VE0 A;  4GQ7 A;  3ZLI A;  5IWF A;  3UGF A;  2UUR A;  1ZBE 1;  2W1W A;  3VZL A;  4IEO A;  4PLM A;  4CEY A;  2D93 A;  2W94 A;  1CAU A;  1CN1 A;  3RWN A;  5FKB A;  2YU1 A;  1QKQ A;  5A33 A;  2XHN A;  2VQU A;  4DIQ A;  5JZG C;  1RUD 3;  1XC6 A;  3IAP A;  3O12 A;  2YBK A;  4FFG A;  5LCW L;  1W2U A;  3U07 A;  2PMW B;  4XQ4 A;  2Y6G A;  2FQP A;  2Z2S B;  3ZDS A;  5ACA 2;  1WLC A;  3T2O A;  1X33 A;  4GJY A;  3ZPO A;  1GQG A;  1F4A A;  1S0C A;  2CTV A;  2TUN A;  3NV1 A;  1H8V A;  2D6M A;  3NNF A;  1NCR B;  5FZ7 A;  3KVA A;  1PO1 1;  3OD0 A;  5FYV A;  1NXD 1;  4EN6 B;  1US2 A;  2XVL A;  1PVC 2;  2MEV 1;  2W0X A;  1SQ4 A;  1DGL A;  3Q8C A;  5LY1 A;  2ARX A;  4FPY A;  5FLI A;  5JR2 A;  1LAJ A;  4GUL A;  3IMM A;  3I3E A;  5A3M A;  1S2E A;  3VZJ A;  2Y34 A;  3UKT A;  1YCI A;  3WW2 A;  2Y6H A;  2O14 A;  2WFF 1;  2CGO A;  3FL7 A;  3LA2 A;  2W9X A;  3B94 A;  1SEF A;  3GJB A;  1AZD A;  1RUJ 1;  3MLL A;  3JUU A;  3AM2 A;  4LO7 A;  1UL9 A;  2XKO A;  4PHZ A;  4ZPI A;  4DXZ A;  3PTR B;  2MHF A;  2V4A A;  4XJA A;  4Q4W 2;  2VBP A;  4CCL A;  1ODM A;  2B8M A;  5HV0 A;  3MIH A;  4A7Z A;  1FV3 A;  2ZGP A;  4QB1 A;  3F2Z A;  3FLP A;  1A8D A;  4P9L A;  1YI9 A;  3Q8B A;  3T2T A;  1QDC A;  4BCU A;  1JZ7 A;  2BFU L;  2DV9 A;  1Q43 A;  2ZX4 A;  5L9V A;  1W8H A;  4O61 A;  1W8W A;  3OPT A;  4RGA A;  3WNX A;  4QPY A;  2HEV F;  2PHW A;  2YY1 A;  4J6G A;  1CAW B;  4NUB A;  3ZIW A;  3A22 A;  1OI6 A;  4K20 A;  5JSO A;  1GMM A;  2JEC A;  1GZW B;  5LB6 A;  2B9U A;  1GV9 A;  4GWN A;  2QZ2 A;  2JXA A;  1ASJ 3;  3BOW A;  1UW8 A;  3OB8 A;  3U78 A;  1XB9 A;  1EAH 2;  2RM2 2;  1VBB 2;  3TEY A;  1DZT A;  3TWI A;  1WCD J;  4XIK A;  3CJI A;  1WUV A;  1PNG A;  5CZK A;  1NG0 A;  2DFC A;  4XYX A;  3RI8 A;  2DCY A;  1D0H A;  4NE9 A;  2VMH A;  4FOY A;  2VMI A;  5C3O A;  5JUV A;  2VM9 A;  3H3U A;  1IS4 A;  1LU1 A;  1PIV 1;  3WR0 A;  2XJT A;  5A7W A;  3U11 A;  3T30 A;  1I1E A;  5FTT C;  1J1T A;  1RXG A;  2VUA A;  4NHX A;  5K8S A;  4D6R A;  1W39 A;  1W8U A;  2OS2 A;  2VME A;  5BYN A;  1JZ8 A;  5EZW A;  2R1D A;  5A7S A;  4KMQ A;  2A6X A;  4D69 A;  1VBD 3;  4XDP A;  4BQ4 A;  3LWC A;  4RR3 C;  4P9Y A;  3A21 A;  4FPH A;  2GAU A;  2J1U A;  4L92 A;  2PHU A;  1WCQ A;  4GH4 C;  3J7M A;  4F83 A;  4CCN A;  3CO2 A;  4MGZ E;  4JTN A;  5DAB A;  5A6Y A;  2IXC A;  4ZZ5 A;  1NZC A;  1S0E A;  2ZMN A;  4D0Q A;  1CX4 A;  4G3Y C;  3OGV A;  5CB7 A;  1RUH 3;  1V0A A;  5B2G B;  2PAE A;  1R64 A;  2BQP A;  5T5L A;  2BTV C;  2QQL A;  1CAU B;  1GIC A;  4QXB A;  4IEQ A;  2XBO 3;  5BPX A;  4B4P A;  2P3Y A;  4HN1 A;  1ASJ 1;  5FUP A;  3TBD A;  2JG8 C;  1Z7S 1;  4CSW A;  5CG9 A;  2VW0 A;  4NR1 A;  2CL2 A;  5DUV A;  1W06 A;  1YQ6 A;  4OVE A;  5DAX A;  4COV A;  5FZB A;  5LEK A;  1QHD A;  3AZX A;  1JHN A;  5AC9 3;  1VBB 3;  3J7H A;  5FYC A;  4M3C A;  3S5Q A;  3PVN A;  4W6X A;  5BNQ A;  4AFB A;  3MIB A;  5FWE A;  1NCR A;  4JAA A;  3FWE A;  5CYY A;  3WNM A;  1UPS A;  1I3H A;  4HKL A;  5FYH A;  4XUQ A;  3VD3 A;  4ZKT B;  1W8N A;  5A6X A;  1S0J A;  4Q4W 1;  1DIW A;  5FYY A;  5A80 A;  2RE9 A;  2E7T A;  2B9V A;  2F4L A;  1OLM E;  3ZIX A;  2VZU A;  3GXU A;  4Q0U A;  2FDG A;  4Y4R A;  4QXK A;  4BB3 A;  1JZ6 A;  1AR8 2;  3KWV A;  2WFF 2;  2VZO A;  1NY7 2;  3MF9 A;  3KT4 A;  4MVT A;  1VAK A;  1TVG A;  1UY0 A;  3OGG A;  2H6C A;  3RZG A;  5L7O C;  1KXG A;  1DDL A;  4LQR A;  1DYK A;  3AYD A;  1LGB A;  2ARC A;  3PUH A;  1Y3T A;  5C6C A;  1RVF 2;  1S0B A;  3VKN A;  1JOJ A;  4YM1 A;  4H14 A;  1GBG A;  4QKN A;  2P3I A;  3OY8 A;  3HOB A;  3PVO A;  1AR9 1;  4BQX A;  4HZF A;  3WF2 A;  3S57 A;  4GXL A;  2AC1 A;  1SCS A;  1AYN 3;  3A4U A;  5FZ9 A;  3DL3 A;  3KGZ A;  3U37 A;  1GLH A;  1W9T A;  5JOW A;  3GBW A;  4CCE A;  3ITQ A;  4IGP A;  5FMO L;  1F9K A;  4CDU A;  4ARX A;  1EYB A;  1RJ7 A;  4XAE A;  4Y1Y A;  5GLT A;  4Y5T A;  4IEX A;  3ZN6 A;  2YV8 A;  3ZN4 A;  4LBQ B;  1XNT A;  3IN9 A;  4GB3 1;  4AFC A;  5I0S A;  3QAC A;  4LIT A;  1CON A;  5JR7 B;  4P5Y A;  3O1O A;  4UF0 B;  1NE4 A;  1Y9Q A;  4AF9 A;  3SMH A;  2GC1 A;  1HB3 A;  1DGW A;  4IET A;  5CA6 A;  4SLI A;  1H0B A;  3OGS A;  5BUV A;  5JXH A;  1RJ8 A;  1XJA A;  3AZZ A;  1VMF A;  3CL1 A;  4PLO A;  1IQD C;  1L7L A;  1PM7 A;  3K4A A;  1DBN A;  3RZZ A;  5IYY A;  1ND3 B;  5GAL A;  1O4T A;  2WDB A;  3AMN A;  2Q5T A;  4CDU B;  5FMD A;  3T0D A;  2G1M A;  2YC0 A;  4KNC A;  4L99 A;  1F8V A;  1QJX 1;  1CJD A;  4MGY E;  1Q56 A;  2P6C A;  2VMC A;  1JBC A;  1JOP A;  3BPZ A;  4YZ3 A;  5FY8 A;  1COV 2;  3VKO A;  4OHW A;  2RR1 2;  4AEM A;  3T2P A;  2HH9 A;  2IZW A;  2HWC 1;  1FMD 1;  4OFG A;  1M4W A;  3NQH A;  2QQM A;  5FZ3 A;  5HCA A;  5EJZ B;  3QD6 A;  1RUF 2;  4A44 A;  2LTN A;  1N3Q A;  1QJU 1;  5JLV A;  3VKM A;  3PUQ A;  2BNO A;  4CDW B;  1BJQ A;  1PZ7 A;  2QNK A;  4GIQ A;  3RG0 A;  3ZFG B;  3O1R A;  1JZ3 A;  2NQY A;  5FP7 A;  3W9A A;  3TNP B;  1UZW A;  3ZMN A;  1C3H A;  1NUK A;  1VB2 A;  2WNV B;  3QBQ A;  4UXA A;  3RYR A;  1WCU A;  4JGZ B;  4IW3 A;  4BH9 A;  3OBR A;  2ZX1 A;  4JGY C;  1W3X A;  2VEC A;  2VC9 A;  1MVE A;  2YPJ A;  3DYO A;  2B7Y A;  1H2L A;  2WWJ A;  3JBG 3;  4BYY A;  1A78 A;  5TSW A;  3I97 A;  5CBL A;  2GNM A;  4CDX C;  5D1I A;  1VP6 A;  4OHX A;  4DUW A;  2A3W A;  4JDM A;  4N43 B;  4Y3O A;  5F1R A;  1RUF 1;  5KXB A;  2YBS A;  2J7M A;  4EE2 A;  2LW8 A;  4WM7 A;  2DWR A;  5F5C A;  1WLD A;  2D97 A;  4QAW A;  1BHG A;  4UYB A;  4MYE A;  3VB9 A;  5C3Q A;  2ZAC A;  3JB4 C;  5CIR A;  5KR7 A;  3KCC A;  2RG4 A;  3WW3 A;  2P5B A;  5FPB A;  1SDW A;  3N9M A;  5EJ1 B;  3WOG A;  4LK6 A;  1PMJ X;  3A23 A;  3U14 A;  4WVM B;  2NM1 A;  4X6Q B;  1PK6 B;  3NNM A;  2HWE 3;  3WW1 A;  3N7M A;  4JQR A;  4BU2 A;  2A1X A;  4QM9 A;  5FKC A;  2VMF A;  3B7M A;  3RNS A;  4C0B A;  4ZU7 A;  2FZ2 A;  2JE7 A;  2RR1 3;  3PU8 A;  1UQX A;  4TZD A;  2ZA9 A;  4K3U A;  1WLT A;  5JVV A;  2A6W A;  4LUL A;  1YFY A;  5JI9 A;  2QE3 A;  1BZW A;  3CQO A;  4UW4 A;  4Y22 A;  4PI0 A;  3FFZ A;  4TLF A;  5L7O B;  2VUL A;  3MYX A;  2K46 A;  1VBC 2;  4OQ9 A;  4CUC A;  3ZXL A;  2JB8 A;  3DPR B;  1M06 G;  3LGR A;  4AGR A;  1PM4 A;  2VZQ A;  4LA3 A;  4BME A;  5FPZ A;  1O3R A;  3WIN E;  3WF3 A;  1E5I A;  3WF0 A;  3BTZ A;  1NCQ A;  1IS5 A;  3BTA A;  4XCA A;  4XTP A;  1K5M A;  3W5M A;  3UK9 A;  1QJX 3;  4LOR A;  2DUR A;  4GZ9 A;  1A6C A;  4NHK A;  1PVC 3;  2BBA A;  5HPO A;  3IT8 A;  4PIZ A;  3K48 A;  4LO6 B;  1RUJ 3;  4FXK B;  1BLZ A;  1SAC A;  2ADE A;  2P1B A;  3P3N A;  4N7U A;  3GZA A;  4PDW B;  5F3C A;  4AXO A;  4Q4V 3;  2WA4 A;  5IK7 A;  1HIX A;  4BK5 A;  2W52 A;  4LA2 A;  4XFB A;  4XUR A;  4AFD A;  4CUB A;  1FNZ A;  4FXG B;  1RVF 1;  5LW9 A;  1RUG 1;  3OYW B;  4HVQ A;  5DMY A;  3AMM A;  4XZP A;  2IVJ A;  3SXW A;  2EID A;  2ZGL A;  4B7K A;  5KXD A;  1O8P A;  3DPR A;  1HRI 3;  3MHZ A;  4KG8 A;  3E6C C;  4A42 A;  4XF3 A;  4FOV A;  2VU9 A;  2WRA A;  1REF A;  1AJO A;  1CD3 G;  1UXZ A;  4LOS A;  3LF7 A;  3KV9 A;  2YMZ A;  3PIJ A;  4EWE A;  2UWC A;  2VG9 A;  3HR9 A;  4FPJ A;  2YUE A;  2ZGS A;  3QLQ A;  4MX3 A;  4RFR B;  2P3K A;  3HT2 A;  3LSD A;  1RYY A;  1VRB A;  4ITC A;  2QQI A;  4Q1P A;  1ZVF A;  3PJQ A;  4YZ5 A;  2X5I B;  5C33 A;  2IWG B;  2YYO A;  4QX1 A;  4YFW A;  1KJL A;  3WV6 A;  4TN7 A;  3ZXJ A;  1U5Z A;  2I45 A;  3P1I A;  4OI4 A;  4QHO A;  1GSL A;  2J1R A;  5FZC A;  1HN0 A;  2DVG A;  2IXH A;  4URT A;  1RXF A;  4ZU5 A;  4H55 A;  4AWD A;  2FCV A;  2WZR 1;  5ISL A;  2QTW B;  1AYM 1;  2R7E B;  5DG1 A;  4CDX A;  2HWC 3;  3R4U A;  2R0F A;  4LEJ A;  1UMH A;  2VZS A;  1REE A;  2EIC A;  5I93 A;  3ACG A;  4ZXK A;  1MR5 A;  5KXC A;  4DNY A;  4CP2 A;  3BTX A;  4R9D A;  4I0W B;  3SCG A;  5A3P A;  1QJY 1;  1W9S A;  4XBN A;  5G04 L;  5BXX A;  2VUJ A;  3GAL A;  1OQD A;  4ERO A;  2JIC A;  1SLL A;  1GFF 2;  2BEO A;  4JX0 A;  5FYZ A;  1QY4 A;  1EUU A;  1WMF A;  3C7H A;  3KZ4 C;  4Q4Y 1;  1QEX A;  4GD4 A;  5HCB A;  4A4A A;  1FT9 A;  3KSC A;  3MUZ 1;  1O59 A;  2R04 3;  3RS6 A;  1D0G A;  5HV4 A;  4YZ2 A;  1ENS A;  4LBK A;  1PGS A;  5LY2 A;  4BDV B;  2W91 A;  1BMV 1;  3E1F 1;  3GCX A;  3N9Q A;  4IEP A;  1ZBA 2;  2R06 1;  2WSU A;  2JE9 A;  4M0N A;  3ZO0 B;  4LHN A;  3U4S A;  3VBF A;  3M7A A;  5LWB A;  3GHN A;  1AR7 2;  5T54 A;  4LIU A;  5EYY A;  5F39 A;  4JDN A;  3JQX A;  4KWL A;  3K2O A;  4IV1 C;  1NT0 A;  3FHA A;  4IV1 B;  5JDB A;  2OT7 A;  3VDD C;  1W8F A;  3FHI B;  5A6Z A;  4FTS A;  3CNA A;  2WAA A;  1EAH 3;  4DXT A;  1HQL A;  1BBT 1;  5AFB A;  2X29 A;  2ZXQ A;  3MUY 1;  4M3C B;  4AVV A;  1CAX B;  2XDV A;  1IPJ A;  1CPM A;  2F4P A;  1U5Y A;  1T6G C;  2RJL A;  3AVR A;  3B93 A;  2D3R A;  2JD9 A;  1UOG A;  3BU7 A;  3D0J A;  4X8P A;  2HEY F;  3WNO A;  4YSF A;  2D98 A;  4MG2 A;  5LRR A;  4QQH A;  4Q4V 2;  5DG2 A;  3VBS A;  4BQ3 A;  1GU3 A;  2ARB A;  1ULD A;  4IV3 B;  4CXX A;  1SLA A;  4GMP 0;  2R07 1;  4R9B A;  5FPL A;  5JMO A;  1HB1 A;  1OPO A;  4QU1 A;  1XOY A;  4FPC A;  2JEM A;  3EHK A;  4CDW A;  1UWW A;  3PNA A;  3MLK A;  1RUN A;  4Y1U A;  3A0K A;  2VTX J;  4LTA A;  1I5P A;  4NAO A;  4OHZ A;  2ET1 A;  4CP1 A;  1VBC 3;  5K0U B;  3V0B B;  2JKX A;  4MV2 A;  1JXN A;  2VVE A;  5FFO C;  4HT1 T;  4MZU A;  1OUR A;  3ZXA C;  1FAT A;  5IAX A;  4FFF A;  1UD1 A;  2E51 A;  3LEM A;  3OJB A;  4P9G A;  3TN9 2;  5A1L A;  4MXW A;  4NIG A;  4HKW A;  1LHV A;  3TYJ A;  2VOT A;  1UOJ A;  3EQE A;  1KDK A;  3CEW A;  3FLT A;  2CAV A;  4O7X A;  5FZ0 A;  1RL3 A;  1UO9 A;  1TZO A;  1UY3 A;  4ZS2 A;  4XHX A;  5G05 L;  5M0T A;  1S2K A; 
#chains in the Genus database with same CATH homology
 2VZV A;  1DLC A;  2QBX A;  2YG0 A;  4IUG A;  2W1Q A;  4QX0 A;  2VR4 A;  1UY1 A;  2C4X A;  3CIH A;  2V4V A;  2HLE A;  2VZR A;  1UX7 A;  5DPN A;  2C26 A;  5A1A A;  3WEZ A;  2WZE A;  3OEA A;  2W1S A;  3SEP A;  4CU9 A;  2VL4 A;  4XUT A;  2DCJ A;  2WAO A;  1CZV A;  2W92 A;  2V5D A;  3NNG A;  5JXI A;  1F4H A;  1W99 A;  1GNY A;  2WQ8 A;  4KI5 M;  2YB7 A;  1JZ5 A;  3WQB A;  1JYW A;  2ID4 A;  1UZ0 A;  2W1W A;  3MV1 1;  2W94 A;  3FHQ A;  2W1U A;  2VQU A;  2XHN A;  4PT6 A;  4DEQ A;  1XC6 A;  3D3A A;  3IAP A;  5LCW L;  2J1E A;  2Y6G A;  2HYX A;  5G05 L;  1O8S A;  3T2O A;  2WBK A;  2VTF A;  4OYU A;  1F4A A;  3W5N A;  3IDA A;  3K4D A;  5FUI A;  3UNP A;  1ULP A;  1SDD B;  2QQJ A;  3VD7 A;  1US2 A;  2VJX A;  4MGQ A;  5JXG A;  1SHW B;  2E33 A;  5JR2 A;  3I3E A;  3LEI A;  2C9K A;  1JI6 A;  1GQP A;  2Y6H A;  3CDZ B;  3DYM A;  1GOH A;  2Z4F A;  3FL7 A;  2W9X A;  4XVH A;  4QDS A;  5DN2 A;  2BZD A;  3WNN A;  3MBW A;  4P08 A;  2VCA A;  4UAP A;  1L7R A;  2W87 A;  1K3I A;  2B4K A;  3THC A;  3LPG A;  1K45 A;  1GUI A;  2YC2 A;  3ETP A;  4QB1 A;  3F2Z A;  3I3D A;  1TG7 A;  1JZ7 A;  3AC0 A;  1US3 A;  3ACH A;  2E32 A;  3K4Z A;  3A22 A;  4CU6 A;  1GMM A;  2WYS A;  2WO3 A;  1H6Y A;  3LPF A;  4E8D A;  2BGO A;  3OB8 A;  4OMC A;  5JXJ A;  5CZK A;  3SEE A;  2VQT A;  3P6B A;  1XNA A;  3BN6 A;  2W46 A;  5JUV A;  2VM9 A;  5B4X A;  3WF1 A;  3MV0 1;  3T0B A;  4W8J A;  3HEI A;  2VZ1 A;  1OH4 A;  1JZ8 A;  2VME A;  2PQS A;  1OT5 A;  4KMQ A;  3WSO A;  5LA2 A;  2VZT A;  4D8M A;  5IFP A;  3A21 A;  2J1U A;  1WCQ A;  4ZZ5 A;  3IB3 A;  5HXM A;  4D0Q A;  4MOA A;  3OGV A;  5EIY B;  5IHR A;  1R64 A;  3NJV A;  2QQL A;  2XQX A;  2QQK A;  1UY4 A;  4MAD A;  3I2H A;  4W50 A;  1W9W A;  4LKS A;  3I2I A;  2E31 A;  1W0N A;  3J7H A;  4QB6 A;  5CYY A;  3WNM A;  3OEB A;  4XUQ A;  4KWU A;  4L0P A;  4QPW A;  1W8N A;  3VD3 A;  4DUX A;  1JYX A;  4E8C A;  1LNS A;  2ZEW A;  2B9V A;  2W47 A;  4OZO A;  4PQQ A;  2EIB A;  3VDB A;  2VZU A;  3GXU A;  3K75 B;  4BK4 A;  3NJX A;  1JZ6 A;  2VZO A;  1ULO A;  1TVG A;  1UY0 A;  4LQR A;  2EIE A;  2J1V A;  3PUH A;  2VZ3 A;  3ZM8 A;  3C7G A;  2YFZ A;  3HNB M;  3PUI A;  4AG4 A;  1WKY A;  5J1X A;  3ACI A;  3HOB A;  3WF2 A;  2WO2 A;  1JYN A;  2QQN A;  3U37 A;  1W9T A;  2WZ8 A;  3WF4 A;  1NX9 A;  4ZXE A;  4ARX A;  4CU8 A;  1OD3 A;  3T08 A;  1GOF A;  1D7P M;  3HJR A;  3HN3 A;  2Y8K A;  3UET A;  1XNT A;  2WN3 A;  4LHS A;  3GM8 A;  4BJ0 A;  4LPL A;  4ZY9 A;  2OKX A;  3LE0 A;  4P5Y A;  2VCC A;  1CX1 A;  1KEX A;  3OGS A;  5JXH A;  1JU4 A;  4XUP A;  5IJR A;  2BER A;  1IQD C;  1GOG A;  1CZT A;  3K4A A;  4TXW A;  5IYY A;  3K46 A;  2WDB A;  2XOM A;  4MO3 M;  3T0D A;  2W3J A;  3FN9 A;  2RV9 A;  1J83 A;  1CIY A;  3WNK A;  3HNY M;  4OUE A;  4JKL A;  2VMC A;  3SKV A;  3T2P A;  2J1S A;  2Y6K A;  2BGP A;  2KD7 A;  3NQH A;  2QQM A;  3T0A A;  5EJZ B;  4A44 A;  3WNL A;  1MPX A;  2RJ2 A;  4ZZ8 A;  5C71 A;  3ACF A;  3UES A;  1JZ3 A;  4CUA A;  2DDU A;  3VD4 A;  1UYX A;  1NUK A;  2X05 A;  1DP0 A;  2VO5 A;  4XUO A;  4A41 A;  2VC9 A;  3DYO A;  3WNP A;  3C7E A;  3T2Q A;  3I97 A;  3MO4 A;  1UYY A;  4DUW A;  1YQ2 A;  1KGY A;  2J7M A;  2LW8 A;  4OMD A;  4QAW A;  1BHG A;  1EUT A;  2ZEX A;  2LS6 A;  5LA0 A;  2WN2 A;  3GGL A;  4PF1 A;  5EJ1 B;  4QB2 A;  3I3B A;  4JHZ A;  4HG6 B;  2Y64 A;  1PMJ X;  3A23 A;  2XON A;  3VD5 A;  1J84 A;  5B4N A;  3EB7 A;  1DYO A;  2YFU A;  5F7U A;  2VMF A;  3K77 A;  2X10 A;  2CDP A;  1H6X A;  2J1A A;  3CQO A;  4DEV A;  4GWI A;  2V72 A;  3CZJ A;  1PX4 A;  4QDQ A;  3C7O A;  4CVU A;  4CUC A;  1UY2 A;  2VZQ A;  4TTG A;  3SKJ E;  3WF3 A;  3WF0 A;  2JDA A;  3W5M A;  3CKH A;  4MGS A;  1OF3 A;  4GZ9 A;  2ORX A;  5IFT A;  2BBA A;  5HPO A;  2J22 A;  3I2K A;  4QX2 A;  4JKM A;  4ARY A;  2YC4 A;  2W95 A;  4XUN A;  1K42 A;  1NAE A;  4BK5 A;  4XUR A;  4CUB A;  5DMY A;  2EID A;  1JU3 A;  1O8P A;  1P8J A;  4A42 A;  3ECQ A;  3DYP A;  4DUV A;  3DEC A;  1UXZ A;  1JZ4 A;  3LQC A;  2WAB A;  3III A;  1W8O A;  4QX3 A;  1RYY A;  2QQI A;  1CZS A;  1JHJ A;  2VMD A;  3VDA A;  3IAQ A;  4QX1 A;  2W5F A;  3P1I A;  2J1R A;  3OG2 A;  4P00 B;  4RN5 A;  1L7Q A;  1UMI A;  3VD9 A;  2R7E B;  3A7Q A;  1PX3 A;  1UMH A;  2Y6L A;  2VZS A;  4A45 A;  1UXX X;  4ET7 A;  2EIC A;  4GWJ A;  3ACG A;  4BXS V;  5DQ0 A;  1T2X A;  3VDC A;  3CMG A;  1W9S A;  2RVA A;  5G04 L;  3CZU A;  2Y6J A;  4JX0 A;  1EUU A;  4A4A A;  3C7H A;  4QDR A;  2ORZ A;  3I2G A;  4AAX A;  3MUZ 1;  5C7G A;  1O59 A;  1JZ2 A;  2JE8 A;  4BDV B;  2W91 A;  1HN1 A;  4DXS A;  3E1F 1;  4DXR A;  3GDB A;  2DCK A;  3C7F A;  4RYD A;  4XZU G;  4M4P A;  1NKG A;  3NRU A;  3T09 A;  3I2J A;  4YPJ A;  3FHA A;  4P02 B;  3HNM A;  1JYV A;  3I2F A;  1SG3 A;  2J1T A;  2WAA A;  3THD A;  4DXT A;  2CDO A;  2ZXQ A;  1XPW A;  3MUY 1;  3C8X A;  1PMH X;  2X09 A;  2JD9 A;  2QQO A;  3HPN A;  3LEG A;  3WNO A;  2ZEZ A;  5I0D A;  2L9L A;  2WO1 A;  3JXS A;  2ZEY A;  3OGR A;  1GU3 A;  1UYZ A;  5C70 A;  5JMO A;  3OBA A;  4CU7 A;  4JKK A;  1UWW A;  3BGA A;  3EYP A;  4M4R A;  4A3Z A;  2VCB A;  4Z2A A;  4FI9 A;  1I5P A;  2JKX A;  3LEK A;  4UI9 L;  4A6O A;  2WUH A;  3ABZ A;  2E26 A;  5LA1 A;  2VZP A;  2VOT A;  4UOJ A;  1UY3 A;  1OF4 A;  4W4Z A;  1K12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...