3SEEA

Crystal structure of a putative sugar binding protein (bt_4411) from bacteroides thetaiotaomicron vpi-5482 at 1.25 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
214
structure length
214
Chain Sequence
QNLIKNEKFATEVTNKVTNPSKATAGEWFIMNNEADGVTTIAWEQTGDAKYPNAMKIDNSGAEKNTSWYKAFLGQRITDGLEKGIYVLTFYAKAKEAGTPVSVYIKQTNEEKNDNGKLNTTFFMRRDYDADAQPNASGAQYNFKIKDADKWTKVVVYYDMGQVVNAISSKKSNPALEVSDTDDDAAILKDCYVAILGQNKGGVVEISDVTLKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical sugar binding protein
publication title Crystal structure of a Hypothetical sugar binding protein (BT_4411) from Bacteroides thetaiotaomicron VPI-5482 at 1.25 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Sugar binding protein
total genus 49
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15425 DUF4627 Domain of unknown function (DUF4627)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 3seeA00
2Y64A 4P08A 4D8MA 2QQOA 2VZTA 4KI5M 1XNTA 3I3BA 1ULOA 2YC2A 2W1QA 4DEVA 4W4ZA 2V4VA 4AG4A 3SKVA 1UY1A 4BDVB 1YQ2A 4ARYA 1JYVA 5IYYA 2C26A 3UNPA 3C7HA 3ECQA 1O8PA 1JYNA 2YB7A 1NAEA 2DCKA 3OGVA 4P5YA 3MBWA 4CU9A 3IIIA 5IFPA 4LHSA 4M4RA 1GMMA 2VZVA 2EIBA 2Y6HA 2Y6LA 2WAOA 1PMJX 2E31A 2WZEA 3WF1A 2J1SA 3HN3A 5LCWL 4OMDA 2J22A 2W92A 3A7QA 3WF3A 1EUUA 3AC0A 4ZZ5A 3K4AA 2WABA 2ZEZA 2LW8A 2JD9A 3LEKA 5HPOA 2WYSA 4IUGA 1UZ0A 1T2XA 4DUVA 2C4XA 2J1UA 3FHQA 3NRUA 2ORZA 2EICA 2W94A 2WO2A 1CIYA 1WCQA 3I2IA 3OG2A 4UI9L 1DYOA 3C8XA 3VD7A 3HOBA 4DUWA 4RYDA 2BBAA 1UY2A 3IAPA 1US3A 3VD4A 2VZPA 2QQKA 2VQUA 3THCA 3THDA 3MUZ1 3ACIA 2J1TA 4JKLA 1JZ3A 2VJXA 4W50A 3WF0A 3I2FA 3CZUA 3K4ZA 1K12A 3GM8A 4BK4A 3BGAA 4CU6A 2WDBA 2VCAA 1GOHA 2WN2A 3C7FA 1JHJA 3LPGA 4QX3A 2E26A 3CMGA 1KEXA 3F2ZA 2VMFA 4OUEA 4UOJA 1EUTA 1GQPA 5JMOA 3WNPA 1JZ7A 3A21A 3OEAA 1UXXX 4JHZA 4TXWA 3SKJE 3K4DA 3WNMA 1GNYA 2ID4A 3LQCA 2EIEA 3MV01 4GZ9A 3K77A 3WSOA 3MO4A 3LEGA 4A45A 1JZ8A 5C70A 2WO1A 1OF3A 2WZ8A 2BERA 2W1UA 4A41A 4CU7A 4MGQA 3I2JA 2QQNA 5A1AA 2W1SA 2JDAA 3A22A 5B4XA 2W87A 5JXIA 2W9XA 4ZXEA 4CUCA 3I3EA 3E1F1 1W9SA 2WO3A 4DEQA 2E33A 3I97A 4A6OA 1UYYA 3U37A 2V5DA 4M4PA 5LA2A 5C71A 2VM9A 1CX1A 3CIHA 2QQLA 1OH4A 1O8SA 3CDZB 3NNGA 3EYPA 1W8OA 2XHNA 3IAQA 3MUY1 3SEPA 1NX9A 3MV11 4DXRA 3P1IA 2RV9A 2QQIA 3CZJA 4XUNA 4OZOA 1MPXA 5JXJA 1UXZA 2BGPA 4XUPA 3VDCA 4Z2AA 3D3AA 4JX0A 4FI9A 5IFTA 1XPWA 1UY3A 1UYZA 2VR4A 4QDSA 3OBAA 2VL4A 1P8JA 2VOTA 1TVGA 2YFUA 1GOFA 3GXUA 1JZ2A 5LA1A 3I2HA 4CUAA 1JZ5A 1F4AA 3ACHA 5EJ1B 5JXGA 2V72A 3I2GA 4GWIA 4QB2A 4AAXA 4JKKA 3OEBA 3EB7A 4DUXA 5EJZB 2W47A 4A4AA 5HXMA 2VZRA 4CVUA 1O59A 1UMHA 3C7EA 3LEIA 3A23A 1CZTA 2YFZA 2QQJA 1I5PA 3GGLA 3BN6A 3DYOA 4QDQA 1K45A 4RN5A 1JI6A 1W9TA 1W9WA 1DP0A 2XONA 2R7EB 1SG3A 2VO5A 2YC4A 3OGRA 1US2A 3P6BA 4ZZ8A 4P02B 2WN3A 2ORXA 3WF2A 1L7RA 2DDUA 1IQDC 2VCBA 4W8JA 2X05A 1JU3A 2W5FA 2ZEXA 3JXSA 2Z4FA 2B9VA 4UAPA 1XNAA 2VZ3A 3WNLA 4XUOA 3PUIA 1H6YA 4MADA 5CYYA 4QDRA 1JZ6A 3C7OA 3I2KA 3T2OA 4PF1A 5EIYB 5JUVA 4BK5A 5LA0A 4DXTA 5J1XA 3VDAA 2VZSA 1F4HA 2E32A 1XC6A 1GOGA 3VD5A 2VZ1A 1TG7A 2J7MA 3FN9A 5F7UA 2ZXQA 3T0BA 2KD7A 2VQTA 4XUTA 4XUQA 1PX4A 4TTGA 4ET7A 3W5MA 1SHWB 5B4NA 2WQ8A 4LPLA 2X10A 1NKGA 3WEZA 3WNNA 2LS6A 1UY4A 5JR2A 3HNYM 4QX0A 2VMCA 3K75B 2WUHA 3HJRA 4GWJA 4A44A 3WF4A 4CUBA 2OKXA 1CZVA 3HNBM 1BHGA 2QBXA 3VD9A 2RJ2A 4LQRA 2EIDA 3VD3A 3OGSA 1W8NA 4XURA 3ZM8A 1SDDB 2VZQA 2VCCA 5G04L 2QQMA 2PQSA 1RYYA 1WKYA 3OB8A 4QAWA 1JZ4A 2RVAA 2Y6JA 3LE0A 4JKMA 3HNMA 3K46A 1PX3A 2XOMA 3WNKA 2BGOA 3W5NA 2J1AA 3HEIA 4OMCA 3CKHA 2BZDA 4QX1A 2ZEYA 4E8DA 3T09A 2W95A 4QX2A 2X09A 1UY0A 4A42A 2W91A 3NQHA 4XVHA 1K3IA 1K42A 2W3JA 3FHAA 3IB3A 2DCJA 2HYXA 4KMQA 3FL7A 1JYWA 4OYUA 5IJRA 4YPJA 2XQXA 5I0DA 3DECA 3NJXA 5DMYA 3UESA 2VMEA 2Y8KA 3GDBA 2J1EA 2VTFA 2HLEA 1JU4A 4MOAA 1KGYA 3T2QA 3T0DA 3J7HA 3ACFA 4QB6A 4E8CA 5IHRA 4QB1A 1UYXA 4HG6B 2VMDA 2YG0A 2CDOA 1OD3A 3T08A 2JKXA 4A3ZA 1JYXA 4BXSV 4PT6A 5FUIA 4BJ0A 3CQOA 1H6XA 3C7GA 4ARXA 5CZKA 4ZY9A 3HPNA 4QPWA 1UWWA 1NUKA 2WBKA 3ABZA 1UX7A 2L9LA 3T2PA 2J1RA 1ULPA 1R64A 2CDPA 3UETA 5G05L 3VDBA 2JE8A 1GUIA 2VZUA 1D7PM 2Y6KA 1W0NA 2C9KA 5DN2A 2W46A 1HN1A 5DPNA 4MO3M 2WAAA 1OF4A 4CU8A 3I3DA 1OT5A 3T0AA 1PMHX 3LPFA 2J1VA 5JXHA 4KWUA 1LNSA 2Y6GA 3PUHA 1UMIA 2ZEWA 3WNOA 2VC9A 3IDAA 5DQ0A 1CZSA 3ACGA 4PQQA 3SEEA 3ETPA 3DYPA 1GU3A 4DXSA 2W1WA 4P00B 1L7QA 5C7GA 3DYMA 4MGSA 3NJVA 3WQBA 4XZUG 4LKSA 1J83A 1J84A 1DLCA 4D0QA 4L0PA 2B4KA 2VZOA 1W99A
chains in the Genus database with same CATH superfamily
1YIFA 3H8UA 3NVCA 3VBSB 5APAA 2I45A 3ZXGA 5IVEA 1GICA 3UV9A 4Q2FA 3I3BA 1N3OA 2JDMA 1DGLA 1SLBA 1DZRA 2YC2A 5A80A 4AQSA 4CP2A 4S2HA 3SKVA 4NRQA 2D98A 1AYM3 2RMU2 4N90A 3I3QA 1YQ2A 4EWDA 5FP4A 2AACA 1XBFA 1BBT1 2C1FA 2PAEA 3SQOA 4YZ3A 3ZSKA 4LT5A 1MACA 1AR62 5IYYA 1QDOA 3BB6A 3WOGA 1UMZA 1B35C 1HN0A 2HWC3 4D6SA 3VKFC 4URAA 2RS12 2Z2SB 4YG6A 4CP0A 1O8PA 2VVEA 3TRSB 2CL2A 3EQEA 4AVBA 4BXFA 4D7YA 1HRI3 2JWPA 2PHUA 1H2NA 1PGW2 1EAH2 3Q8AA 4CU9A 2D40A 5KXBA 4BOWA 3LD8A 4HVOA 2D3RA 4CEWB 1YI9A 5BXXA 1UU4A 1GANA 4CDUA 3TEYA 1U5IA 2Y6HA 5A32A 3R05A 1COV1 2D93A 3OPTA 3RI8A 4GB32 5JPNB 1JW6A 5FZOA 2WZEA 3JD73 3ZYPA 2YY1A 2BPA2 1S0FA 1S0IA 3HQRA 2JG8B 3Q8EA 2J1SA 4GULA 1O3QA 2YZ4A 3HN3A 3JZVA 2H6BA 2P6CA 4NAMA 3VKMA 3WZ1A 3MYXA 1EUUA 3K4AA 1RJ8A 5JSRA 2WZR2 2VMIA 2R073 3LEKA 3O1PA 3WW3A 1QKQA 3UKTA 3POIA 4CP9B 5L7OC 2VOXA 3FHQA 4NWWA 4IETA 2ORZA 4L99A 1VP6A 2A73B 1QJFA 2ZAHA 1QIQA 5EYYA 3VBRA 2JG9A 2W94A 3O14A 2DTYA 4TLGA 2R062 2WO2A 2A6WA 1W2TA 3D82A 1WCQA 1RINA 4LXLA 4E4HA 3T1MA 3C8XA 4MUVA 3VD7A 4GMP0 4AOCA 4FQ4A 1H1MA 1VBD1 1GLHA 2ZGTA 5IW0A 1IKQA 1H1AA 1RGSA 1VBC2 2VECA 4AHZA 5BY5A 5LK5A 3PVOA 2NM1A 2JDKA 4SBVA 4C0HA 4JCKA 3MUZ1 1QJY3 1UQXA 3W21A 2J1TA 1C8NA 4K21A 1PVC3 4WZFA 4COWA 1R082 3MDPA 3EO6A 2VNGA 5FZ1A 3VKNA 4PF5A 1ZM1A 3N7KA 3DUIA 2PXJA 2B8MA 1UO9A 2V4AA 3AYDA 2FZ1A 3H3UA 4LO5B 1RUNA 4MVTA 4K1ZA 1K12A 3GM8A 1BK0A 4BK4A 5FP3A 2QQUA 4FOYA 2XL7A 1N3PA 4QGLA 4E4ZA 5T5LA 3ZDVA 1VPHA 3KHBA 1AL22 4K20A 2WN2A 2ZX1A 1S55A 1XSRA 5JPMB 5KBFA 3CMGA 2WIIB 3VL9A 3D0JA 4E27A 2XLAA 1ZBE1 1KEXA 4UOJA 5JLVA 2HBUA 1ODMA 3FJSA 4O9EA 3WNPA 1S0EA 4GH4C 5L9VA 2GNDA 3ILNA 4E2GA 2XVKA 4XQDA 5J98B 4TXWA 4JAAA 4UFMA 3SKJE 3K4DA 4Y5Z0 1MS1A 1MEC2 2VW1A 4DINB 5LRSA 1UF2C 1UD1A 3K77A 4OI2A 4E4DX 1YQ5A 3MO4A 4XF4A 3LEGA 4QXCA 1F31A 4Y20A 3WSOA 4P9XA 4DPNA 1JZ8A 4Q5OA 3LCPA 4CZSA 1Z7S1 2JDHA 2BOJA 3ZYFA 3M3EA 1IZ3A 2YV8A 5FZ8A 2GC2A 5FO9B 3ILFA 1VRH2 1PO11 4AGRA 2VOWA 2QQNA 2W1SA 3D8CA 4QU1A 4RL7A 2W87A 5FPUA 1OOPA 4N8MA 3U11A 1NZCA 4LKDA 3BKZA 1ZBA1 1RMU1 1LENA 4A7YA 3I3EA 4HOOA 2VBPA 4AHWA 4AW7A 1HDKA 5FMOS 3NW4A 3E1F1 4NR1A 2E33A 1XXNA 3N35A 4P9JA 4PDWC 5DZFA 5F3EA 4A6OA 2Y0IA 1UYYA 1O3RA 3RWNA 1K5MB 4M4PA 5C71A 1QJX1 4JTOA 5CFCC 1V70A 3AKRA 3VHOA 3MHZA 1E57A 3I4IA 2WYFA 1C8M1 1O8SA 3CDZB 4LBLA 1BVVA 3EYPA 4OUSA 3U07A 1N1TA 1UZYA 3IAQA 5HXVA 3MUY1 3SEPA 5C7GA 4OQ8A 2UY9A 4NIDA 1RC6A 2AH2A 2IXKA 3OUHA 4YG3A 4FT8A 5F5IA 2RV9A 2ZCWA 2GNTA 1POV1 1G86A 1MPXA 2E51A 5DAPA 3WG1A 4AI8A 5ACA1 2VQ0A 2A6XA 2WT2A 4B1LA 4XUPA 2W08A 5C8CA 1RIRA 1RUF1 2OPWA 2K2SA 5I0TA 4WM8C 4K7JA 4MHRA 1ZA4A 1WA6X 4HKWA 3AMPA 1NCRA 4M0HA 4QDSA 2RG4A 1TEIA 1YI7A 1RTVA 1P8JA 1W28A 3VBOB 2BEOA 1F15A 1ZNPA 4A7ZA 3GXUA 2PN5A 2ARBA 1IS4A 2W52A 2YBKA 4CUAA 1H2LA 2B5HA 1Y7BA 4ORFA 2FCVA 5FZ6A 4MXVA 5JI9A 4OI4A 4N43B 1D4VB 1ND2A 1BMV2 1NE6A 4YM0A 1CJPA 4N9IA 3ZR6A 3U4XA 2B9UA 3BU7A 4XETA 1PMIA 5KHGA 3S57A 5FYCA 4QKNA 2WFF1 1X33A 4XJUA 2D6KA 2VZRA 1OQ1A 4IEQA 4CVUA 5F8PA 2ZACA 1O59A 5I8SA 3L2YA 1IS5A 3JB4C 2YFZA 1EP0A 4NPRA 1DQ1A 1RUH1 1I5PA 4Z82A 3GGLA 3DYOA 5BV6A 1W2UA 1LGCA 1X36A 2UURA 1GP6A 3K3OA 2BQPA 1JI6A 2CAUA 2VVFA 1SG3A 2R7EB 3ZR5A 2YC4A 5FOJB 4Y1VA 2OPKA 4KBZA 2ZGRA 1US2A 3PVBB 1A6CA 3P6BA 4COVA 2MEV2 4QKDA 4YSFA 2ZX0A 2V5YA 2UWBA 5LEJA 1C28A 2WN3A 4MZUA 3URFA 5FCCA 2ZAAA 1RUE2 3OBRA 1MS5A 3AP6A 4L9BA 5FY0A 1T6GC 2GH2A 4AL9A 1HQWA 1JU3A 4ATFA 2JENA 2W5FA 3WP5A 4PJYA 1SPPA 1W03A 2WR9A 3OBTA 2NP0A 1JYTA 1UOJA 1BQPA 2Z4FA 3G7DA 4JDOA 1ACCA 3LDRA 4FOWA 4YNIA 5CG9A 1S2KA 1QQP1 5DG2A 4C91A 5JIUA 1XNAA 4R9CA 1L3JA 2VZ3A 2RS31 4YWAA 5LBEA 2DCZA 2OQ7A 3KV9A 1NE4A 2X53S 1GZWA 3AZZA 3VDDB 2FMDA 4PI0A 1H6YA 4QPGB 4I01A 1U5YA 1BXHA 4QDRA 5FZ9A 3C7OA 4QPIA 3O1VA 3VBFB 4PF1A 1UOBA 1YC61 3JBG1 1AF9A 3SCGA 5LA0A 3WR0A 1PNFA 1R091 4MV2A 4CDUC 3BVCA 2R6QA 3AP9A 4KBBA 5JAXA 4W65A 3W59A 1W6MB 3AMQA 2K0GA 3VD5A 1REFA 1ZREA 1AYM2 2A3YA 1LHUA 4NROA 5T50A 3K3NA 3MLLA 2ZXQA 2FQPA 3AYAA 1LOCA 1PX4A 1Q3EA 3KWVA 4FQZA 3NV2A 3ZMNA 5IWFA 4DY3A 1SHWB 2R32A 4HLTA 4O9GA 4P9GA 4Z1VA 5B4NA 5FY8A 1QF3A 4PDWB 1HRI2 3AZWA 4CEYA 2X10A 5T5OA 5LB6A 2QTWB 2CSGA 3WEZA 1D0GA 1D4M3 1ULFA 2LS6A 3LKJA 3NO8A 3VBRC 5JR2A 1I3HA 2JG9C 2WWSA 2PLV2 4J6GA 3OGGA 4YW2A 4I0WB 2ARXA 5A3LA 3HJRA 5KXCA 1C5IA 1E5HA 1GWLA 4XHBA 1J3PA 1CZVA 5FZGA 2QFEA 3CF6E 1BHGA 3HNBM 4DFSA 1APNA 3I59A 2IXHA 3USSA 1AX2A 3GJBA 2RJ2A 4LQRA 2EIDA 2NMNA 5FPVA 3SITA 3RWKX 3ELNA 3V64A 5L9RA 3O1MA 2VZQA 2G1MA 2ZGMA 1OHFA 5IATA 2R072 3ZMOA 1RUI3 5C4WC 1ASJ3 3KLSA 4YZ4A 3OB8A 1QH7A 4QAWA 4Z8BA 1JZ4A 4IERA 2RVAA 4BH9A 3LE0A 5LK7B 4M01A 3KT1A 2XOMA 1A3KA 2HWE2 2BGOA 5FJHA 3WNKA 1JUHA 5IK4A 3GCWA 4GJZA 4YYOA 2QQPA 3ZXLA 1AX1A 2ZMKA 1CAWA 4B7KA 1OQEA 1REDA 3BTZA 3I54A 1XU2A 5A33B 1PIV2 5FQ0A 4XVHA 2W3JA 3FHAA 5FXVA 3IB3A 3O7OA 4Q4X1 4FTSA 4KMQA 4BQ3A 1W6NA 4ZU4A 1OQDA 2O0OA 3RZZA 1JYWA 5FBZA 4QX7A 3AMMA 2JXAA 4DS0A 1JTZX 2H6CA 4YPJA 2QZ3A 3QCWA 4Y22A 4LHLA 3T4VA 4UFJA 5J3UA 3HT2A 5FBJA 5JVVA 2X5IB 4B1MA 4CA9A 4EN7B 2VMEA 1H8TA 3GDBA 5GZEA 3DPRB 5AC93 2WNUB 2FBEA 1VE0A 3WXPA 4JC1A 1BJQA 4RGKA 2WNVB 2XLFA 3J7HA 4QPYA 4AFDA 3TB0A 1MS9A 4QB1A 2PHLA 1OOPC 1OI6A 2ZS6B 2VOVA 2EIGA 1FOD1 1EV12 3VZMA 1OD3A 2HWD2 4Y1UA 1JYXA 1RUG3 1CGPA 2XKPA 3WHUA 2DUOA 3ENRA 5FUIA 1S4CA 5JIAA 5A6YA 5LBFA 1LKNA 4XF3A 2VTXA 2V09A 3KZ4C 3THPA 4ARXA 2QZ2A 3ZDSA 4QPWA 3MF9A 5BNNB 4AEKA 3BOWA 4EN9B 1AYN1 4CDQA 1VRBA 1HIXA 3N9QA 3K2OA 4LORA 1W8WA 5SV5A 4XJ8A 5F1RA 1NUKA 4MG2A 4YZ1A 2KM2A 2RS53 1HJGA 2Y38A 3ABZA 5FZLA 1RVF2 4XW3A 2VUJA 3FBYA 4QQHA 5IVBA 2Q8DA 3T30A 2RDSA 2CDPA 5BNOA 3QD6A 3DN7A 3UETA 4JDMA 5G05L 3ZSJA 5C8CC 1EPWA 1AZDA 3KGLA 1S2EA 2HJIA 1U12A 2WA4A 4EYUA 5FOBB 3NNLA 4LE4A 1ODNA 2DYCA 1VLNA 2VG9A 1W0NA 5DN2A 4HONA 2W46A 1S0BA 1HN1A 4LBKA 1NCRC 4UF0B 2JB8A 5GJ6A 4IE7A 2OVUA 4QHOA 3WP3A 1OF4A 3AX4A 5FZOB 4K6BA 3I3DA 3WQ7A 3WHTA 5LZ6A 2P5BA 4YGBA 4YVWA 2RMU1 3TAYA 4L92A 5F2WA 3VBUB 1GKBA 1IG0A 1POQA 3FC0A 3RVHA 4HVQA 4XIKA 2R16A 3PUHA 3AB0A 1HV1A 1J3RA 2VC9A 3HMYA 1ND2C 3WW4A 1Y4WA 2RS11 3TYJA 3KQRA 5C33A 1W8ZA 2GZWA 4HANA 4JGZA 4BQYA 1PGW1 3ETPA 1EAH1 4NWVA 1VBE2 3VBRB 5A3UA 1GU3A 2ZOEB 5DABA 3CU7A 1MZ6A 3ZSLA 2XVLA 4Q4W3 3RJRA 5A1FA 4YARA 3ETQA 1LGNA 3DYMA 2QE3A 4FPJA 4FVVA 4K3UA 3WQBA 4XZUG 3LWCA 4LKSA 4LNVA 1PZ9A 3QLQA 4GB31 2RHPA 4GJYA 1OKOA 4IGQA 1UU6A 3PHMA 5DDJ1 2B46X 3NNJA 4YRDA 4LHKA 4SLIA 2Y64A 4P08A 1GZCA 3KM5A 1V9U1 1DQ2A 2Y34A 4B29A 3AVSA 3S7IA 2VZTA 4CDWA 1XNTA 4CPBA 5GZCA 2W1QA 5C4WB 1CAVB 2WZR1 3FHIB 2V4VA 4HFSA 1XNKA 4W4ZA 3KT7A 4BLJA 4BDVB 5I8TA 3BODA 1RUC1 4CDXA 5T5PA 3LOIA 4QD2A 3UNPA 2RM23 3TN93 2PFWA 3ECQA 1BEV3 1POV0 1FAYA 2WINB 1JYNA 4XTPA 1Y9GA 1AUYA 2IC1A 1W6QA 4HXCA 2DCKA 3OGVA 1U0AA 1SBEA 4L11A 4EWEA 3MBWA 4UFLA 5IFPA 1VBC1 4LHSA 2QUOA 2XKOA 3ZN4A 2P2KA 2YPJA 5HCHA 2CGPA 3PVEA 4BQWA 2Q8OA 5D21A 5BPXA 2Y6LA 4MSVA 3GHMA 5IUQA 3HVDA 1VBB1 2WAOA 4WVMA 4XDOA 5T55A 1PMJX 5FY5A 1F2NA 3WF1A 4QPIC 1DQ0A 4I3GA 2E7AA 1DQ4A 2ZKLA 4NAOA 4RGAA 3UJOA 2DCYA 3AJYA 4Y20B 5IVFA 2J22A 1G9AA 3NWKA 1OD5A 2W92A 4R9BA 2Z5WA 3MLKA 3AYEA 3WF3A 1LOFA 3AC0A 3T08A 2ZEZA 1D2QA 5EFUA 2XJPA 3CL1A 4MGYE 1AL21 4CXWA 1ULDA 1ENRA 2P3IA 2D6OX 1GWMA 2WYSA 4FFFA 1UZ0A 1T2XA 1QJU3 3VBHA 2C4XA 1KFXL 3FMGA 4CXYA 3NRUA 5DZEA 3NAPA 5CB7A 4PBPA 4XAAA 1CIYA 2OA2A 3WDUA 2HEWF 5C5UA 4AAPA 1PGSA 1DYOA 4DUWA 1MEC1 4RYDA 4CEYC 1DF0A 3IAPA 4JTNA 5DAQA 3WVJA 3VD4A 2VZPA 2MPFA 3NJZA 2QQKA 5GLUA 1ONAA 3THDA 1ZVFA 1HJFA 2JE7A 3AKSA 2VNRA 3NV3A 3QBQA 3NSTA 4JKLA 1JZ3A 5CKQA 4XC9A 1J59A 1LEDA 4W50A 1OPOA 2WFPA 3WQ0A 1VRH1 2WS92 3MIEA 4RGGA 4BIFA 4NHKA 4GA9A 4HPKB 3PURA 4KWLA 4KL1A 4IV3B 3BGAA 3SXWA 5K9YA 2XL9A 3DGTA 3RYRA 4NVPA 1U5XA 1ZA7A 1N1VA 2GMEA 2VCAA 5C8CB 3OYWB 3C7FA 1JHJA 2VBDA 3H9AA 4ZKTB 2E26A 1ENSA 4Z92B 3WW2A 3IPVB 2VMFA 3K51A 1V6IA 3M3OA 3U4SA 1IPSA 2E7TA 3N36A 4Q4V1 2JICA 4M3CB 5FDBA 5JMOA 1BBT3 1ZX5A 2YXSA 1D4M2 1LHWA 4DNYA 3OEAA 1ULGA 3TOJA 3ZIWA 2ZX4A 3L9JT 3DXUA 3KCXA 4FOVA 4UFIA 2QNKA 5ANQA 3WNMA 2PQQA 1WMEA 5A7NA 1FX5A 2KA3A 2EXIA 2ZGLA 1WWYA 4ZU5A 2EIEA 5L73A 3VZJA 2ATFA 2ARCA 4A45A 2OUHA 5C70A 4R4ZA 3ZKUA 4XFFA 2NYYA 2WO1A 1NLSA 3LDBA 3CJXA 2ZA9A 3NL1A 3W9AA 5BUVA 5JOZA 2WZ8A 1HX6A 4UW5A 3SH3A 5GKAC 1ND3A 1DBNA 1LOGA 1S0JA 1MQTB 1RUI2 3KD4A 4K8FA 4QKBA 4A7KA 4LOTA 5CVRA 2W39A 3PMSA 2X8KA 2P4EA 4NE9A 5BNPA 5JXIA 1H9WA 4ZXEA 4B4PA 4XFGA 2GDFA 1H8TC 2I2SA 3WDWA 1RUD1 1WW7A 2VY0A 4Y4YA 2DVAA 2UU8A 1WLWA 3I97A 3Q8FA 2IXIA 4LBOA 4Q1RA 4YVSA 4F3JA 5E1RA 4JDNA 1TMF2 3ZN6A 3U37A 3O1RA 5IVYA 5FK7A 1QEXA 2KR2A 2V5DA 5LA2A 2PHTA 2F4LA 3O1UA 3LAGA 4AVCA 1W06A 4BQ1A 4AK3A 4O65A 3BPZA 3OD0A 4WM7B 2D6LX 4QXKA 5DUVA 1VBD3 3MLJA 3POSA 2D6NA 3WDTA 2XHNA 2ZTNA 4COYA 1J1LA 4XOGA 3MV11 1G7YA 4N53A 4QMAA 5K4LA 2VVDA 3P1IA 1OC1A 2LM3A 2X29A 1HB4A 2BGPA 4HSJA 4FPHA 4CDQC 1PHMA 3VDCA 1A8MA 4JX0A 3RI9A 2VNOA 4IEUA 3M4FA 3AZVA 1DZQA 1C1FA 3VZLA 4LUMA 5CFDA 2RJLA 4MXWB 5JMCA 3WY6A 5FXXA 1OPMA 4W6YA 1UYZA 2A3WA 2VR4A 3MF6A 5FY4A 3FUQA 5BNOC 2WO7A 4RR3A 2VMGA 4XPVA 4NPLA 5A1LA 4BQ5A 1CIWA 3WDXA 4IE0A 1HB3A 4QX5A 1ZBE3 1RUG2 2RE9A 2YHJA 4M3CF 4XMAA 5A7WB 3VZKA 5LA1A 1JZ5A 1JOPA 3GJAA 3O5SA 1F4AA 5FZCA 4CSWA 3V0BA 2JKBA 2TEPA 4MLOA 5F6LB 1AHSA 4MYEA 2V72A 5A7OA 4BIOA 3SC7X 4RD7A 1RJ7A 1DYKA 3HQXA 3I2GA 2AENA 3QH7A 4GWIA 4QB2A 4ZPIA 4BZ4A 4JKKA 2WA3A 2LALA 1DCSA 3EB7A 4YVWC 3PUQA 2H0VA 2VMHA 5E8AA 2E53A 5EJZB 2RS52 4YGEA 1FMD1 4A4AA 3A4UA 1X8EA 3V0AB 2C9AA 2JIGA 3KVAA 2G9FA 3U0ZA 3T1LA 1DHKB 1YFUA 3ES1A 4MH0E 4UFKA 1UMHA 1Z7S3 4L8QA 4IEVA 2QQJA 4AFCA 3AP4A 1O5UA 1PO13 4FO9A 4JGZC 2EAAA 3BN6A 2WZPP 1K45A 2YGLA 4JGYB 4PBOA 1CR7A 3ZXFA 3BU0A 3N9OA 5FK8A 4ZU7A 4XCBA 4X6RB 1W9TA 1ZBA3 1DP0A 3N7JA 2F4PA 4AGVA 1RMU3 2DU1A 3OGRA 4AVSA 4XJZA 3PIGA 4AQTA 3B5LB 3OD4A 4YFWA 1GYKA 3D6EA 3W20A 4XBNA 2XH6A 2PELA 1Z78A 2ORXA 3PJYA 3MW4A 2EALA 1GFF2 1FPN2 4LLFA 1NCQB 3LFMA 2ZGQA 4Y33A 4OHZA 3WF2A 4FTBA 1AR82 1HRV2 1QJX3 2VCBA 4BQXA 5ABJA 5D8AA 4CDWC 1NXMA 4H3WA 3I3MA 2QKDA 1C8M3 4MGTA 1HXS2 1D0HA 4HBNA 1DGWA 4QM8A 1GNZA 2BFUS 2B9VA 4PQ9A 4JRAA 3ST7A 4CDXC 2R1DA 1DLLA 1STMA 3VUOA 2OYZA 4FOQA 4LOSA 4Q4W2 3TBDA 4ATEA 2PLV1 1POV3 4LEJA 5ACA3 5KWRA 5C9AB 1AR91 1LTEA 2H0BA 2XJTA 3E6DA 1CAXB 4IEYA 2BW8A 1WW6A 1RUF3 3I2KA 4LITA 5EIYB 2BDRA 3KVBA 4P9YA 4XYXA 4AXOA 3D4KA 5EHDA 4WBBA 4WVWA 3RMXA 5LA9A 1W6OA 3KF3A 2QQVA 4QGNA 2BBVA 2Q8CA 4BM8A 2ZGOA 4CCMA 3ZPOA 2P6HA 2JD4A 1WW4A 1XC6A 4LBQA 2VZ1A 5H9PA 4OQ9A 1T6BX 2K46A 3WT3A 3A0KA 2HWE1 2RR12 1VIWB 1V6OA 2VQTA 2Y6FA 4HN1A 5EP9A 1LOFC 1LOAA 4Y24A 3TN92 1NQDA 2VGDA 2JDPA 4GIQA 1M06G 4RQPC 3JUUA 2IFRA 1QNYA 2XBO1 4FPGA 3I2OA 1PK6A 1NKGA 3USUA 4AEDA 2BOIA 3VBHC 2CTVA 4AI9A 3GZTB 2OZ6A 2WFF3 1UY4A 4RS5A 3NAPC 3T4HB 3J8F1 3DCQA 4QX0A 1ZZ8A 2VW0A 5HBAA 1LULA 4BYYA 1XE0A 5FRAA 1MS4A 2ZABA 1N3QA 3AKPA 4WVVA 3WF4A 2OKXA 4J1WA 1BYHA 4RHV2 1RUH3 2GC0A 3ZPYA 1B35B 2PTMA 4ASMB 3FLRA 2VAUA 3ZFEA 1AR73 2QBXA 4V2WA 2WSUA 2AEYA 4TSVA 1W39A 2NQYA 3OGSA 1QOTA 1W8NA 3LA2A 3GBFA 2EVXA 1C57A 3BALA 5FYVA 3ZYRA 1PGL2 1XNCA 1W8FA 2WNOA 1J1TA 1Q8PA 1TME2 2Y6JA 4KG8A 2ET7A 3VKLA 4YZ2A 1WW5A 3AZXA 3HNMA 4EJRA 1KJLA 1PX3A 2OXBA 3HEIA 3CKHA 4JZRA 1YQ8A 2FDJA 4PIXA 2WC2A 4QX1A 1EV11 3T09A 2HWD1 1S0CA 1W8TA 4QX2A 2X09A 2YU1A 4JV4A 3H8XA 4EZ4A 1UY0A 1WGPA 3PMEA 4A42A 5A7PA 1ZZ6A 5GLVA 5CG8A 3NQHA 1K42A 3DXTA 2YDEA 4LR4A 3GBGA 5F37A 2A75A 1Q8OA 4CCCA 1QQP3 2BUKA 1DYPA 5K0UA 3H1YA 1RUJ1 2RS33 2ZZQA 1PO21 5L7OB 4NHYA 2ILMA 2ADDA 2XPJA 1VBA2 2JB4A 4G3YC 5IJRA 4DZGA 1BVP1 4CCNA 4UXAA 4Q4Y1 1UW8A 1W04A 1UPIA 4CTEA 2DVFA 5DZGA 1Q5OA 3VHPA 1GSLA 1RVF1 1SLAA 3JBG3 3N4MA 4YGCA 1ENXA 1R093 1W2OA 4LUKA 3BI3A 4PI2A 4Q27A 1SFYA 2VTFA 4UYBA 5EXOA 4AF9A 1ND3C 2XUMA 1NQJA 5FO8B 4IQPA 1R1A1 1RHI3 1AR71 3NMBA 3FLPA 4XE9A 3ACFA 5L36A 3OGJA 4E8CA 2C0ZA 2A5ZA 3WCSA 3IDEA 4OULA 3N9NA 3B00A 3FBMA 1ZRCA 3ZXDA 3RRDA 2CDOA 2ZJCA 3CJIA 2Z69A 4AYUA 2TBVA 4A3ZA 4XBLA 2VNVA 3SISA 4QU2A 3ZFGA 3MIGA 3I8TA 4GAZA 3O1OA 5F3GA 3GZEA 4YVSC 2XJVA 2D3PA 2CHHA 2DFCA 2XG3A 2ZX3A 4EN0A 4PCRA 5JOXA 1W90A 3POFA 1O3SA 3HPNA 4CCJA 1S0GA 1XE8A 3H7YA 5T52A 3VBSA 2AC1A 5H9RA 3HR9A 3FX3A 1COV2 5A3TA 4GH4B 3LOBA 1K5JA 2XR4A 2B42B 4NPMA 1UZZA 1XSQA 1YQ6A 1H8VA 4LK7A 1VBE1 3HAGA 4N53C 4YM1A 1UIJA 4TZDA 2J1RA 1SLIA 4FP2A 5DAVA 5GZGA 2YYOA 2O8QA 2R30A 3PTYA 4RFT0 2BTVC 4YM2A 3IDCB 3VDBA 2QDRA 1GUIA 2Y26A 3PVNA 4M0NA 3TEWA 5FZIA 1F5JA 2Y6KA 4COUA 4UW6A 5L19A 5FZFA 5CFDC 3GBWA 3I49A 1UZVA 2B39A 1TE1B 3OOXA 4RR3C 2P3YA 5KHKA 1CVNA 4C0BA 2YPDA 1MS0A 1RHI1 4I3PA 4XIOA 4COZA 3VL8A 5A6QA 3EJKA 4XAEA 1RL3A 3T0AA 2ADEA 2JDYA 4D3WA 1X8MA 3BCWA 1Y3TA 3D0SA 4KWUA 5EYXA 2ES3A 3KT4A 4YM3A 2HEYF 2JG8A 2HWC2 4GXLA 4NHXA 4Q4X3 3VZNA 1KJRA 1H2MA 3AYCA 4RQPB 4ASLA 4R9AA 1QXRA 5GZFA 5C3SA 1F5FA 2R0HA 2ZKNA 5CFCB 3J7MA 3E97A 1LOBA 3DYPA 3NAPB 2DV9A 3I2DA 4XXPA 4DXSA 1YIPA 1OA3A 4CP9A 3AFKA 4LIUA 5HI0A 4Y1YA 4C1XA 2DBIA 5IK7A 1CAUB 1JUIA 3BYWA 5J09A 1OLQA 1QJZA 5LY2A 4LO4B 1QH6A 1DIWA 3JD72 3KF5A 1J84A 3MW3A 5C3OA 2B4KA 5FLHA 3LFIA 3OY8A 3J7LA 1W99A 1O4ZA 1MR5A 1YFYA 1SLTA 3EHKA 1UCXA 1KDKA 2BNMA 1FOD3 1UKRA 2AR6A 2EAKA 2EXKA 2QQOA 1TNRA 2WWUA 4KI5M 5GLZA 2PHRA 4D7SA 1NA1A 1LHVA 4KGGA 4WM8B 3RZGA 1WLCA 2WQ4A 4XJAA 4FXKB 5T54A 4FPFA 5F9TA 1RUOA 4TLFA 3AZYA 5HCBA 5LEKA 2MNGA 4ARYA 4I0BA 4YW3A 5FWJA 3ZYIB 2C26A 1O4TA 2ZGNA 3P3PA 3C7HA 2R041 2E63A 5ABJC 5D8AC 4BPZA 1AYN3 4BQ4A 5EQUA 1Z7S2 2YB7A 2HWF1 3MI8A 4K8RB 3VB9A 1V6KA 1CJDA 2W2IA 1N47A 5A3WA 1PO12 4K9SA 3MFAA 5FYHA 1OSGA 1Y9MA 2JX9A 5F32A 5LW9A 4XXAA 1GMMA 1QJY2 3AP5A 5C5TA 2VZVA 1PVC2 1E5SA 2EIBA 2MHFA 4AHYA 2A71A 2HWB1 3WQ1A 2RDRA 1RMU2 1H4HA 2WNEA 5FZEA 1BKZA 1CX4A 2J42A 4E2SA 1Q8VA 1LGBA 4AQ6A 2BRTA 3R0RA 5LCWL 2WS91 4AI1A 3D5OA 4OMDA 1A8DA 1OFSA 5FY9A 3A7QA 3E5QA 2ZGPA 3SMHA 1W6PB 4ZZ5A 1ND3B 3CEWA 3FFQA 3ZXEA 2VBBA 2BU9A 4IUGA 4QHZA 4DUVA 2P17A 3MIHA 3RSJA 2RMU3 2UYBA 3AM2A 3SCFA 2J1UA 2XHKA 2C24A 4UBHA 4ISQA 2PA7A 2EICA 1ZZ7A 5A6XA 1YUDA 3C3VA 4AGGA 1HW5A 3DF0A 3I2IA 4UI9L 5B2GB 2RS13 1W05A 5ACA2 3AK0A 2ZMLA 1UX6A 3AJZA 3MIDA 5F39A 3HOBA 2BJSA 4GMP1 4LLOA 2IVJA 5C6CA 3JCIA 2VU9A 1PK6C 1UY2A 1EAH3 1HLCA 1US3A 3B01A 3POYA 3QACA 3TWIA 3ZSMA 4AEDC 2DVBA 2VQUA 4RS5C 4XFBA 4ES8A 5KXEA 3ACIA 3C2UA 3AKQA 1H2KA 4B3NA 1FV3A 4AE2A 4EV0A 5FMBA 4JRLA 1K5MA 2ARAA 2ZGKA 3P5BA 4LBNA 2GP3A 5EWSA 4CCLA 4HETA 3H50A 5H9QA 1TNFA 4GB33 3MPPG 5CAZA 2ENRA 3SNMA 3I2FA 4P14A 5FUNA 5DDJ3 5J96B 3K4ZA 2TNFA 4H7LA 3ZFEC 1KFUL 1JODA 3LSDA 1V9U3 4HN0A 3KHCA 1IGOA 4GWNA 5FY7A 4CU6A 4D94A 3U1XA 5IT6A 5JDBA 1WCSA 1GOHA 3BPSA 5JZGA 2WZR3 2GU9A 4UW4A 4NMIA 4AQ2A 1VMJA 4OUEA 5CFDB 2QCSB 4CDUB 1EUTA 1RUC3 1TMF1 5A32B 4META 3W58A 4Y1ZA 2WFF2 1XU1A 3INAA 5HCAA 3ZXJA 3NV1A 5IK5A 4MHUA 5ERLA 5I0UA 2HYKA 2B45X 4JHZA 4W6XA 2NZ9A 2YBPA 4QWNA 1CWPA 2FDFA 1GNYA 3O0XA 1C1LA 1QMJA 1SQ4A 2PHDA 3P3NA 1UU5A 3LQCA 1J58A 1PM7A 1VBC3 3MV01 3VBOA 1AR61 2FD8A 2ZGUA 5K0UC 5E6HA 4GKXA 5FZ3A 5DXDA 1C5HA 1JBCA 1VB2A 1VBB3 3JB8A 3PIJA 4KWKA 4XABA 3VHNA 3WP4A 1GNHA 4N43A 4A41A 4CU7A 2VQAA 4ZHNA 2XJQA 2JG9B 2JE9A 3I2JA 5FXZA 3M3QA 1NT0A 2JDAA 1CONA 1JMUB 3A22A 5B4XA 5FYTA 1EPZA 3N7LA 4I0AA 1ZRDA 1REEA 1VB4A 2A3XA 4B8EA 1AL23 3F95A 5BNQA 1XYPA 1JHNA 1W9SA 3E5XA 4DEQA 3ZN5A 4FPEA 4IE4A 4IV1A 5D1IA 4XQ4A 5FZ4A 4KH9A 3ROUA 2OW4A 4F7ZA 4UW3A 1QQP2 2VM9A 5FPLA 1I9RA 1CX1A 5FMOL 3CJIC 1FYUA 1UYPA 3CIHA 2QQLA 1OH4A 4AR2A 3PUSA 5I93A 3ZX7A 4D69A 3ZFGC 1MEC3 2CU5A 3B3QE 4MX3A 2A7AA 1NX9A 4IXLA 4DXRA 5F3IA 1OLRA 2R061 1PNGA 1EYBA 4XEZA 1ZRIA 3POJA 3JBG2 4FPYA 3H3ZA 5FPBA 4X8PA 4XUNA 5CA6A 5JXJA 3VKOA 3VBSC 1Y9QA 3O1TA 1NXD1 4NO4A 4Z2AA 4FI9A 3JQWA 4NOTA 3ZO0B 5IFTA 1VRH3 4V1PA 3WCRA 3MICA 1XPWA 4J1XA 5A3MA 1ZRFA 4XDQA 5LY1A 2QDNA 4LO8A 1R081 5DUUA 2A1XA 4N7IA 4V2VA 3H8OA 3LIHA 4L2NA 2LRPA 2XGXA 3VDDA 1GOFA 2BWAA 4QPGA 1JZ2A 2O8OA 4FSJA 2CYFA 1E5RA 1QHDA 3I2HA 4Q4V3 4B4QA 1FPN1 3CLPA 3J9SA 3VBFA 1W6OB 1HRV1 4ZONA 5M0TA 3B9CA 5EJ1B 1XYNA 2VOKA 4HK8A 5FFOC 2Q4SA 3WDYA 5JXGA 3M70A 5AFBA 1DGRA 5L9BA 3MZHA 1QGLA 1OFNA 2VW2A 1OOPB 2A6ZA 4IGOA 2D43A 2XDVA 3SHRA 1KDMA 2FDIA 1W6MA 3PU8A 2W68A 2WWJA 1AX0A 2AYHA 3CNAA 1IHMA 4K1YA 2JG8C 1ALYA 5IAVA 5D2AA 4M00A 4XTMA 3C7EA 3LEIA 3B69A 3A23A 1PK6B 1CZTA 4LE3A 3V56A 2ZHLA 5CU1A 4TWTA 4LK6A 4IE6A 1GP4A 2VUDA 2WRAA 5EJ3A 2DURA 3H1MA 3ALQA 1S1AA 3HWJA 1GWKA 1MZEA 2K9ZA 1W9WA 4Q0UA 2XONA 1UPSA 1W2NA 4C1WA 1W8HA 1M4WA 5LASA 1V6MA 1X50A 1PVXA 4Q8LA 2AZ5A 2IXCA 1RUD3 4LKFA 1QOOA 1A34A 5FZ7A 4XF9A 3LB9A 1QXJA 4CCDA 4KG0A 4A6SA 4FPOB 3AXEA 3AFGA 1YJLA 1SBFA 1L7RA 2DDUA 4LO6B 2A6YA 1IQDC 2RR11 1PZ8A 4BHPA 5KHJA 2WLQA 2WT0A 3B9IA 1NA1C 3MGUA 4CRQA 1YFWA 2ZEXA 1LEMA 3JXSA 3LF7A 3DL3A 1NCRB 2F6BA 1WA4A 4UAPA 1ENQA 4MGIE 3NKGA 2Y60A 1QOSA 4IDZA 4OUMA 4Z07A 3B02A 3WNLA 3ZYHA 3NNMA 1X9PA 1XNBA 1FATA 4H2AA 4XUOA 3HBZA 1HB1A 3RQ0A 3I7DA 3NKTA 1BZWA 4MADA 1H0BA 4Y4RA 5JSOA 4UFHA 2HEVF 1VAVA 4RHV1 4TYSA 2HBTA 3T2OA 4F8AA 1ND2B 1NG0A 5A33A 2YGMA 1XB9A 4Q1PA 5FREA 5FZMA 5JUVA 4YGDA 4OI0A 5J1XA 4PLOA 4DIQA 1FOD2 3VDAA 4Q8KA 2VZSA 2R49A 1JOBA 1F4HA 4XFIA 3TEXA 4AFAA 2OQ6A 5J36A 1ASJ2 5CBLA 2E32A 1GOGA 2O14A 3CO2A 5C3PA 1TME1 2J7MA 4FPKA 3FN9A 3FLTA 2E9QA 3KV6A 4F83A 4XUQA 4TN7A 4XF1A 5GZDA 4TTGA 2FZ2A 3SCHA 3W5MA 3E5UA 3O1SA 4Q29A 1LU1A 1WCUA 2WQ8A 4LPLA 4BQ2A 2X5IA 1I1EA 3PUAA 3ITQA 5FY1A 4XFAA 3X29B 1CD3G 4HKOA 5FPXA 3WNNA 3DPRA 2WNUA 4BMEA 2VUAA 1QJEA 5A3NA 1FMD3 2WNVA 2FCUA 4NRPA 4HSLA 2VMCA 1BMV1 1GBGA 3GCXA 1GQHA 4GWJA 5KXDA 4CUBA 1L7LA 3ZSEA 1ZZBA 5J7MA 3LZZA 4ONUA 1NLRA 3ZXKA 3MFCA 1G9DA 2EXJA 5LWBA 3VD9A 1SPPB 2V73A 3THTA 2GMMA 2Z79A 4XURA 1SDDB 3MPBA 1K5MC 1KXGA 1UIKA 5E16A 5AC92 3LA3A 2QQMA 5BNNA 3IZOA 4RFRB 5FZHA 1U5ZA 2GAUA 2VTXJ 4JKMA 1AL0G 1ZRRA 3LEMA 4DXZA 2ZZJA 5DUXA 2DF7A 1GZWB 3WUCA 1NY72 3Q9OA 4HVRA 3U75A 4BU2A 2J1AA 3W5NA 1YXWA 2BZDA 4FPLA 1W0PA 4QPIB 4E8DA 3R4DB 2D5HA 3HIFA 2MEV1 5JZGC 2DUPA 3PJQA 4C90A 1W9FA 3CBNA 3ZIXA 3GALA 1OH3A 2GN7A 5T5JA 2DU0A 2LROA 1RUE1 1UNBA 1XOYA 3ZYBA 3QOPA 4ISRA 5CADA 3RNSA 2DCTA 2IWGB 5F2SA 4LULA 4A3XA 4DOUA 2UY8A 3WUDA 2Q1ZB 2PLV3 3FL7A 1CN1A 5FZKA 4PLNA 1AR93 4FFHA 4UF0A 3UKNA 1VMHA 1V0AA 2NPIA 2XJRA 2VULA 4LA2A 2Z42A 5LATA 5FP7A 3KB5A 4INDA 5DDJ2 2BVVA 4AI2A 3VBOC 1N1SA 5JOWA 1YYNA 2D97A 3NJXA 4QQOA 1V9U2 3VBUA 1QXPA 5DMYA 3UESA 1O6UA 4CEYB 4O61A 3PNAA 1TQ5A 1VALA 2GSYA 2J1EA 4Q26A 4XBQA 4RA0A 3ILRA 1JU4A 2I74A 4N43C 1GQGA 4Z2WA 1KGYA 1IG3A 4FAHA 1JYCA 2BP6A 2DBNA 4E9KA 4QB6A 5IHRA 1IQAA 5KC6A 1FT9A 3ORJA 1RUC2 4PIYA 1LR5A 4OI1A 1CESA 2HWE3 3NNFA 5IVJA 1UYXA 2VMDA 3IBMA 3WX5A 4G9SB 5IAXA 2CY6A 1O5LA 3S5QA 3I59B 1HKDA 4QGMA 1QWRA 1JH5A 1RB8G 2XBO3 3BTYA 3BUCA 3OY8B 1AYM1 2QQWA 1PIV3 1WMXA 2CV6A 3OUJA 4MGKE 1N1YA 3CQOA 4FXGB 3ASIA 4IV1C 4BJ0A 2BNOA 2OIIA 3J8F3 5H9SA 5CZKA 1ZZ9A 1NA1B 2HWC1 2JEMA 5FAXA 2AUYA 3N9PA 1MZFA 1HRI1 2UWCA 1VBB2 4HT1T 2Q30A 4QKFA 1G9FA 4DO0A 1QY4A 5C4WA 3ZKYA 1CAVA 5FP9A 2Q8EA 1CAWB 2L9LA 3T2PA 1DQ6A 1WUVA 4L97A 4QXBA 5FXWA 2LUWA 4LKEA 4OLLA 4S2GA 5FQ0B 5FZBA 2EA7A 3KV5A 2D6MA 3ZXAC 3O0VA 5GLWA 3JD71 2GC3A 3O0WA 1WBFA 2JE8A 3GYDA 3S0MA 5FLIA 2F17A 5KC5A 3OJBA 2FDHA 1W6NB 2C9KA 1XYOA 4H14A 5DPNA 1HB2A 3ZFFA 4XCAA 5F5CA 4NN0A 4AEJA 3ZVXA 4D7TA 1EV13 4LHNA 1Z0HA 4D6QA 2R071 4FP3A 4YZ5A 2HWD3 4Y22B 5HV0A 2ZPXA 1VMFA 4PIZA 1PMHX 1Q43A 1ZZCA 3IIAA 4WVZA 3RYPA 1SZBA 2J1VA 3VDDC 3MEPA 4QPGC 5JXHA 2JDNA 2QJVA 1LNSA 3OPZA 1OKQA 1H8TB 2Y6GA 1RUJ3 2RM22 3VBFC 1UMIA 3UK9A 1PO23 1BEV2 3LA7A 5I0RA 1J3QA 3IDAA 4NHLA 1PIV1 1BK1A 1CZSA 3ACGA 3K48A 4PQQA 3SEEA 4Q4Y3 1C4RA 5A7SA 4R9DA 1NZIA 1YHFA 2GN3A 2YC0A 5IVCA 1RVF3 5IVVA 4XACA 4QQLA 1QJY1 3H3LA 1L7QA 1YO8A 1EY2A 2O1QA 3NJVA 1PVC1 2P37A 2RDQA 4MGSA 3POEA 4JHTA 4NIAA 3QH6A 3RZHA 1DZTA 1J83A 1DLCA 3PLQA 4D0QA 4L0PA 2WSVA 4KU7A 3MW2A 2E6VA 1R1A3 4EN6B 4P5HA 4B4RA 5E88A 5A70A 5F3CA 1FI2A 1LB2A 4Q4V2 4CDQB 1F8VA 2PAMA 1UZWA 4OHVA 2JECA 3RG0A 4OVEA 4D8MA 4E2QA 2NMOA 1ULOA 1OURA 4DEVA 3PU3A 5TSWA 3UL2A 4AG4A 1QJU2 1WLDA 1OBNA 1UY1A 4UWDA 3RZKA 5BNOB 3DV8A 4NUBA 2FDKA 1JYVA 1IPKA 2VCMA 3MIFA 3S5AA 4JVAA 5JZGB 4H7MA 4HPKA 5ANNA 1UL9A 2OUJA 4IV3A 4J25A 5FWEA 1NAEA 4DRRA 4P5YA 3OYWA 2PHWA 3IIIA 2A6VA 4IL7A 4M4RA 1VBE3 1I5ZA 3KMHA 3JU9A 5CKNA 3IPVA 4LIVA 4AEMA 5IK8A 1X7NA 3AMHA 4LO7A 4M3CA 5ISLA 1WD3A 2YMZA 4UT5A 4YVWB 1LOEA 1JS9A 3RS6A 1LHOA 4DB5A 2E31A 1H1IA 1SCRA 1AXZA 1RUD2 3N3HA 4OHXA 4HKLA 2G19A 3J26N 1NYWA 4QQPA 2YUEA 2WJSA 4YW6A 4IW3A 1FXZA 2N7GA 2WABA 2LW8A 4JGZB 2JD9A 5A3OA 5HPOA 4R52A 2P3KA 4UBGA 3DKQA 3Q8BA 3Q8CA 3S7EA 1UN1A 5I0SA 1VR3A 4DRVA 1JN2P 5EPAA 1BBT2 2GMPA 4FAGA 3ACLA 5BNPC 5FV3A 4HK9A 1MQTA 2VPVA 3OG2A 2XB6C 5FZDA 5FZAA 1UOFA 1OLMA 3GZUC 2UYAA 2X5IC 4H55A 2BWCA 3H1WA 4IV1B 1UAIA 2VUCA 2BBAA 5SV8A 4FTEA 3DPRC 5A6ZA 2WNUC 4CDWB 2WQZC 3THCA 2CNAA 2GP5A 1V6NA 4LBJA 2RDNA 2WNVC 3U78A 2P1BA 4YW7A 2EXHA 4IEOA 1AXKA 2VJXA 1LHNA 3HD8B 4CDXB 4N7UA 5F5QA 5JCTA 3WF0A 1LAJA 2OZJA 3CZUA 4WM7A 4Q0SA 1O3TA 1LRHA 2YBSA 1JOJA 3OBZA 1TZOA 1YFXA 3EXUA 4X8NA 3O12A 5FTTC 1AXYA 2WDBA 1W6QB 3LPGA 5AVAA 1W3VA 4QX3A 5FYZA 5GALA 1F9KA 1WCDJ 4BWOA 4K40A 5CIRA 4EQVA 1E5IA 2W0XA 5BNNC 3F2ZA 3POBA 4WV8A 3UJQA 2BGCA 1GQPA 5FPZA 4CXXA 1AJOA 1JZ7A 5FYIA 1SEFA 3A21A 2G4IA 4WVMB 4ZXKA 3E6BA 3ATGA 4YW4A 4CEWA 4NIGA 1FMD2 3OCPA 5I91A 1BLZA 1UXXX 2R043 3WP6A 2VD7A 3UYJA 1SFNA 4MXWA 3WINE 3AVRA 1VBD2 4QM9A 2HWF3 3LGRA 2G9GA 2ID4A 1IPJA 3WG2A 5CISA 1H4GA 3ZLIA 4BE3A 1D2SA 3T2TA 3GF6A 4GZ9A 3OPWA 5A7WA 4ASKA 1YCIA 4EE2A 3HBKA 3J4UH 5DG1A 2PHFA 2OT7A 1HQLA 2HWB3 1OF3A 3VBHB 2BERA 4CCOA 2ZGSA 5K8SA 2W1UA 2Q0AA 5DAXA 4MGQA 5A1AA 3OF1A 2WS93 1X9TA 4Q0QA 3BIEA 2BV4A 5FP8A 1Q8QA 3TNQA 3VBUC 2XJUA 4FBFA 3H42B 4GALA 2W9XA 2BVBA 4XJ9A 1QDCA 4CUCA 1GR3A 4XFHA 5FZ0A 2CWMA 1GZ9A 3OTFA 3V0AA 4I09A 2WO3A 1ZBE2 4M3CE 1ULEA 2CGNA 3GHNA 1LODA 1MVQA 4CPBD 1Q56A 3ZYGA 2NN8A 1XE7A 4S2DA 5KR7A 3KCYA 3VHRA 2TUNA 2B7YA 4PLMA 4JGYA 2PHXA 1AR92 3NNGA 4GMP3 1W8OA 3DKWA 5K7PA 3KSCA 3M1HA 1MS8A 1W3XA 3N9MA 1SBDA 4ITCA 2XQRA 5DAWA 3UGHA 1IS6A 4NIHA 3OSDA 1DDLA 2QQIA 3CZJA 4OZOA 1RITA 3R6SA 1UXZA 1NCQA 1GZTA 3VZOA 4IESA 2E7QA 4KQ7A 4QXHA 2R0FA 3D3AA 2DWRA 5FKBA 4FPCA 3M2MA 1OLME 4AI0A 2VE1A 4OZXA 2DFBA 2ZHMA 1UY3A 3TEZA 1ZBA2 3U10A 1IS3A 2ZX2A 1YJKA 3OBAA 4PHZA 4HMZA 2VL4A 2CAVA 1A78A 2JIJA 2RJKA 4AZZA 1LJ7A 1TVGA 2VOTA 3R4UA 2XBO2 1DGRN 2AEZA 2YFUA 4EZHA 5JI7A 4IE5A 4QT6A 5C9AA 1CAXA 1OXCA 4JQRA 1TMF3 1UKGA 1QJX2 5EZWA 1ULCA 1YEWA 2XLGA 3ACHA 3ZFFC 2ZHKA 3J8F2 2ET1A 5FMCA 3KCCA 1C8M2 4GQ7A 1GV9A 4AAXA 3B93A 4BLIA 1YQCA 3OEBA 4Y3OA 4GKYA 3T3YA 5BNPB 1OUSA 4DUXA 3RFRA 4LJHA 1D4M1 1VAMA 3HQUA 3UKVA 3M7AA 1AR63 2GNMA 2IFWA 5C3QA 1KITA 2W47A 5HXMA 4QQ2A 2YU2A 2ZBJA 2IUWA 2D5FA 4YVSB 4D6RA 2WKKA 3SH4A 3ZN6B 4ES9A 1RUF2 2HKXA 2I07B 2R1BA 4RN5A 4QDQA 3RMYA 3HN1A 2FCTA 5A3PA 5BYNA 1CQ9A 4QHBA 4XFCA 4XF0A 3H0OA 4S2FA 4ZS2A 3WNXA 1MS3A 2VO5A 3TNPB 1W9YA 3UGFA 4Y5TA 5JSPA 1RUI1 3VN4A 4N53B 1ASJ1 4ZZ8A 4P02B 1PZ7A 4CE8A 5KHIA 2SLIA 1LCLA 2WT1A 2PYTA 1OMIA 2XJSA 3IN9A 4XHXA 3WV6A 4W8JA 1B35A 1RUJ2 1ZYBA 4NIIA 2X05A 4CP1A 3FFZA 1PO22 2EF6A 2AGSA 1SDWA 5LRRA 1OA2A 4NRMA 4XZPA 1O7FA 4Y26A 2DTWA 1H9PA 1OVPA 1G6NA 3IMMA 3NV4A 3JQXA 1SCSA 4HL0A 4LA3A 4Q4Y2 4YG0A 5F5AA 4RR3B 2HH9A 4AI3A 5FUPA 1YRZA 2R063 4KNCA 3GNEA 4ZS3A 4FCAA 1VJ2A 2JDUA 4Q0PA 3VV1A 3AMNA 3PUIA 3KGZA 2D3SA 4FFIA 4OFGA 5FYBA 5T3NA 1WMDA 4IV3C 2D44A 4P9WA 5JWPA 5CYYA 2BFUL 2GALA 1YWKA 2IVIB 4MGZE 1RUH2 4XDPA 2P34A 4AVVA 5FPAA 4Y1XA 1JZ6A 3V0BB 1R1A2 2WLPA 1AR72 2YROA 1S0DA 4N9HA 4Y5SA 5AFEA 2AREA 4BK5A 4DXTA 3APBA 4IEXA 1R083 3M8LA 1FV2A 3DEMA 3S30A 3E6CC 5AC91 3HT1A 3POGA 1KD7A 4BA6A 5C8WA 5L7OA 3ES4A 1TG7A 4XILA 5GLTA 1W8UA 2XXZA 3GZAA 3U14A 5F7UA 1JYIA 2A70A 3T0BA 1FPN3 3WG4A 4R8HA 2KD7A 1NY71 2Q1MA 4R4XA 1AR83 1HRV3 4XUTA 4YW5A 1O91A 5FR3A 4ET7A 3WD5A 5I8YA 3NJYA 1LECA 1H30A 2NLRA 4O7XA 1RUG1 1S2BA 3LSEA 1HXS3 2VXJA 3H7JA 4QX8A 3WDVA 4EWAA 1W0OA 2RS32 1DG6A 4Q0VA 1MQTC 3HNYM 2Y33A 1DU3D 3K75B 4BISA 4E4SA 1X82A 5E89A 2WUHA 3WG3A 4OHWA 1WLTA 4A44A 2GC1A 3A0NA 2Y0OA 5C3RA 1F35A 2RS51 5FYYA 1DFQA 5HV4A 5ABJB 5D8AB 3SH5A 4AVAA 3FE5A 1R092 4DQAA 3FWEA 5JR7B 2BNNA 1BCXA 3VD3A 2DUQA 3ZM8A 1LU2A 3UGGA 1CPMA 2JJ6A 1HV0A 2VCCA 5G04L 2GNBA 4YFZA 1DGWX 4AFBA 3OUIA 4WZCA 4X6QB 1LESA 4YW1A 1RHI2 4W6WA 2PQSA 1RYYA 3RJ2X 1WKYA 2JDZA 5FKCA 2DVDA 4AWDA 4WM7C 4CCEA 4GH4A 1KS4A 3K46A 4IGPA 4KWJA 2Q1FA 2RR13 2WL1A 4OMCA 4JQTA 2IZWA 5LBCA 3RDIA 2ZEYA 1KRIA 2W95A 1AVBA 3M3IA 1XQNA 2QVSB 2W91A 5FO7B 1IOAA 1K3IA 4AFMA 3EMRA 3SLIA 5EV7A 1AR81 3M3CA 3BIWE 3ZFFB 1XRUA 1CPNA 3ON7A 1RXGA 5J48A 1FNZA 4CEWC 2DCJA 2HYXA 4FFGA 3AL5A 1MZ5A 4LBQB 3POWA 1NLQA 2XWJB 1HXS1 1C3HA 2XVGA 4OYUA 5JOYA 3G6JB 3ZOIA 3BTXA 1R1ZA 3RYKA 5J37A 4KGQA 3RZLA 1KQRA 1XNDA 3AXDA 3PTRB 3N7MA 3RGBA 1YNAA 4RHV3 2ZMNA 2XQXA 5I0DA 3H8RA 4EROA 2ETEA 3VLBB 3DECA 4Q4W1 3PDQA 4YLZA 2P3JA 1SACA 3WW1A 4IEPA 3B94A 2C6SA 2Y8KA 3USUB 2D7FA 4AEDB 1NOVA 2HLEA 2XWBB 1I6XA 2IXLA 4MOAA 4RS5B 4RQPA 1OUXA 4I30A 4PDWA 3T2QA 1URXA 1OA4A 3T0DA 4IEZA 4DMIA 1TME3 2PAKA 5FJKA 5FYUA 5GM0A 3IWZA 4CCKA 2LTNA 4AHXA 1GP5A 5CFCA 4OHYA 4HG6B 2YG0A 5HCFA 3RZMA 1V6JA 1Q8SA 2DVGA 2JKXA 2PMWB 2R042 3B7MA 3EBRA 3LIGA 3R4SA 4KU8A 1YLLA 2C5DA 3J7NA 1CAUA 4XJWA 3ZFEB 4BXSV 1PM4A 3IT8A 2HWF2 4PT6A 1HQNA 1SLLA 2FHRA 3S6PA 3LDKA 3V65A 2CWSA 1V00A 1H6XA 2OX0A 4Q4X2 3C7GA 2RM21 3TN91 4ZY9A 1SFPA 1O4YA 4U2AA 5A7QA 4JGYC 1BEV1 1UWWA 1XJAA 1QNWA 5CNAA 1VBA3 2HWB2 4AVTA 2SBAA 1G9BA 5FIXA 2WBKA 4P9LA 4A2UA 2VXRA 4WM8A 2FDGA 1UX7A 4GD4A 4C8DA 3BTAA 1WMFA 2VH9A 3KQ4B 1ULPA 1R64A 4BMBA 1RXFA 1NCQC 3FUOA 1MVEA 2G9ZA 1W2AX 1SMVA 3AL6A 3MIBA 5K0UB 2XMLA 5FYSA 2VZUA 3ME2A 1D7PM 1QU0A 1WZXA 2Q5TA 3KS7A 1JXNA 1KS5A 3PL0A 5CKMA 5AVPA 1G8WA 2BYVE 5FYMA 4I2OA 4LBMA 1Y43B 4MO3M 4LBQD 4NJ4A 4BB3A 2WAAA 5FLJA 1OVSA 3N9LA 5DUWA 2MEV3 4CU8A 5CEHA 1PGL1 1WD4A 4XMIA 1OT5A 3L2HA 2ERFA 3IM0A 4U36A 1QJU1 1G9CA 3LPFA 4BCUA 3WLUA 5C9AC 3IDBB 4LMFA 1RUE3 1SLCA 1FNYA 2D6PA 3CHXA 2FMYA 4B7EA 4CUGA 1UOGA 2IXJA 2ZEWA 3WNOA 4G4FA 3ZYJB 1AYN2 3AP7A 4DY5A 5FMDA 2CGOA 3BOPA 3IKWA 4NHMA 5DQ0A 1W6PA 2OS2A 4P9IA 4XQWA 1COV3 4CYDA 3AKTA 3UT0A 1DQ5A 2UWAA 1AJKA 4OCTA 5F6KA 4GWMA 5KHHA 1VAKA 3CJIB 3FZ3A 4HZFA 2GH8A 2W1WA 3IMNA 2ZHNA 4P00B 1IKPA 1VBA1 4LTAA 3ZFGB 2KXLA 4IEWA 1V6LA 3KV4A 4URTA 5LBBA 3RZJA 1B09A 1ST8A 3VGIA 2XUEA 1WCKA 4I02A 4RSUA 3RPQA 4EN8B 2VZOA 1WBLA
chains in the Genus database with same CATH topology
2Y64A 4P08A 4D8MA 2QQOA 2VZTA 4KI5M 1XNTA 3I3BA 1ULOA 2YC2A 2W1QA 4DEVA 4W4ZA 2V4VA 4AG4A 3SKVA 1UY1A 4BDVB 1YQ2A 4ARYA 1JYVA 5IYYA 2C26A 3UNPA 3C7HA 3ECQA 1O8PA 1JYNA 2YB7A 1NAEA 2DCKA 3OGVA 4P5YA 3MBWA 4CU9A 3IIIA 5IFPA 4LHSA 4M4RA 1GMMA 2VZVA 2EIBA 2Y6HA 2Y6LA 2WAOA 1PMJX 2E31A 2WZEA 3WF1A 2J1SA 3HN3A 5LCWL 4OMDA 2J22A 2W92A 3A7QA 3WF3A 1EUUA 3AC0A 4ZZ5A 3K4AA 2WABA 2ZEZA 2LW8A 2JD9A 3LEKA 5HPOA 2WYSA 4IUGA 1UZ0A 1T2XA 4DUVA 2C4XA 2J1UA 3FHQA 3NRUA 2ORZA 2EICA 2W94A 2WO2A 1CIYA 1WCQA 3I2IA 3OG2A 4UI9L 1DYOA 3C8XA 3VD7A 3HOBA 4DUWA 4RYDA 2BBAA 1UY2A 3IAPA 1US3A 3VD4A 2VZPA 2QQKA 2VQUA 3THCA 3THDA 3MUZ1 3ACIA 2J1TA 4JKLA 1JZ3A 2VJXA 4W50A 3WF0A 3I2FA 3CZUA 3K4ZA 1K12A 3GM8A 4BK4A 3BGAA 4CU6A 2WDBA 2VCAA 1GOHA 2WN2A 3C7FA 1JHJA 3LPGA 4QX3A 2E26A 3CMGA 1KEXA 3F2ZA 2VMFA 4OUEA 4UOJA 1EUTA 1GQPA 5JMOA 3WNPA 1JZ7A 3A21A 3OEAA 1UXXX 4JHZA 4TXWA 3SKJE 3K4DA 3WNMA 1GNYA 2ID4A 3LQCA 2EIEA 3MV01 4GZ9A 3K77A 3WSOA 3MO4A 3LEGA 4A45A 1JZ8A 5C70A 2WO1A 1OF3A 2WZ8A 2BERA 2W1UA 4A41A 4CU7A 4MGQA 3I2JA 2QQNA 5A1AA 2W1SA 2JDAA 3A22A 5B4XA 2W87A 5JXIA 2W9XA 4ZXEA 4CUCA 3I3EA 3E1F1 1W9SA 2WO3A 4DEQA 2E33A 3I97A 4A6OA 1UYYA 3U37A 2V5DA 4M4PA 5LA2A 5C71A 2VM9A 1CX1A 3CIHA 2QQLA 1OH4A 1O8SA 3CDZB 3NNGA 3EYPA 1W8OA 2XHNA 3IAQA 3MUY1 3SEPA 1NX9A 3MV11 4DXRA 3P1IA 2RV9A 2QQIA 3CZJA 4XUNA 4OZOA 1MPXA 5JXJA 1UXZA 2BGPA 4XUPA 3VDCA 4Z2AA 3D3AA 4JX0A 4FI9A 5IFTA 1XPWA 1UY3A 1UYZA 2VR4A 4QDSA 3OBAA 2VL4A 1P8JA 2VOTA 1TVGA 2YFUA 1GOFA 3GXUA 1JZ2A 5LA1A 3I2HA 4CUAA 1JZ5A 1F4AA 3ACHA 5EJ1B 5JXGA 2V72A 3I2GA 4GWIA 4QB2A 4AAXA 4JKKA 3OEBA 3EB7A 4DUXA 5EJZB 2W47A 4A4AA 5HXMA 2VZRA 4CVUA 1O59A 1UMHA 3C7EA 3LEIA 3A23A 1CZTA 2YFZA 2QQJA 1I5PA 3GGLA 3BN6A 3DYOA 4QDQA 1K45A 4RN5A 1JI6A 1W9TA 1W9WA 1DP0A 2XONA 2R7EB 1SG3A 2VO5A 2YC4A 3OGRA 1US2A 3P6BA 4ZZ8A 4P02B 2WN3A 2ORXA 3WF2A 1L7RA 2DDUA 1IQDC 2VCBA 4W8JA 2X05A 1JU3A 2W5FA 2ZEXA 3JXSA 2Z4FA 2B9VA 4UAPA 1XNAA 2VZ3A 3WNLA 4XUOA 3PUIA 1H6YA 4MADA 5CYYA 4QDRA 1JZ6A 3C7OA 3I2KA 3T2OA 4PF1A 5EIYB 5JUVA 4BK5A 5LA0A 4DXTA 5J1XA 3VDAA 2VZSA 1F4HA 2E32A 1XC6A 1GOGA 3VD5A 2VZ1A 1TG7A 2J7MA 3FN9A 5F7UA 2ZXQA 3T0BA 2KD7A 2VQTA 4XUTA 4XUQA 1PX4A 4TTGA 4ET7A 3W5MA 1SHWB 5B4NA 2WQ8A 4LPLA 2X10A 1NKGA 3WEZA 3WNNA 2LS6A 1UY4A 5JR2A 3HNYM 4QX0A 2VMCA 3K75B 2WUHA 3HJRA 4GWJA 4A44A 3WF4A 4CUBA 2OKXA 1CZVA 3HNBM 1BHGA 2QBXA 3VD9A 2RJ2A 4LQRA 2EIDA 3VD3A 3OGSA 1W8NA 4XURA 3ZM8A 1SDDB 2VZQA 2VCCA 5G04L 2QQMA 2PQSA 1RYYA 1WKYA 3OB8A 4QAWA 1JZ4A 2RVAA 2Y6JA 3LE0A 4JKMA 3HNMA 3K46A 1PX3A 2XOMA 3WNKA 2BGOA 3W5NA 2J1AA 3HEIA 4OMCA 3CKHA 2BZDA 4QX1A 2ZEYA 4E8DA 3T09A 2W95A 4QX2A 2X09A 1UY0A 4A42A 2W91A 3NQHA 4XVHA 1K3IA 1K42A 2W3JA 3FHAA 3IB3A 2DCJA 2HYXA 4KMQA 3FL7A 1JYWA 4OYUA 5IJRA 4YPJA 2XQXA 5I0DA 3DECA 3NJXA 5DMYA 3UESA 2VMEA 2Y8KA 3GDBA 2J1EA 2VTFA 2HLEA 1JU4A 4MOAA 1KGYA 3T2QA 3T0DA 3J7HA 3ACFA 4QB6A 4E8CA 5IHRA 4QB1A 1UYXA 4HG6B 2VMDA 2YG0A 2CDOA 1OD3A 3T08A 2JKXA 4A3ZA 1JYXA 4BXSV 4PT6A 5FUIA 4BJ0A 3CQOA 1H6XA 3C7GA 4ARXA 5CZKA 4ZY9A 3HPNA 4QPWA 1UWWA 1NUKA 2WBKA 3ABZA 1UX7A 2L9LA 3T2PA 2J1RA 1ULPA 1R64A 2CDPA 3UETA 5G05L 3VDBA 2JE8A 1GUIA 2VZUA 1D7PM 2Y6KA 1W0NA 2C9KA 5DN2A 2W46A 1HN1A 5DPNA 4MO3M 2WAAA 1OF4A 4CU8A 3I3DA 1OT5A 3T0AA 1PMHX 3LPFA 2J1VA 5JXHA 4KWUA 1LNSA 2Y6GA 3PUHA 1UMIA 2ZEWA 3WNOA 2VC9A 3IDAA 5DQ0A 1CZSA 3ACGA 4PQQA 3SEEA 3ETPA 3DYPA 1GU3A 4DXSA 2W1WA 4P00B 1L7QA 5C7GA 3DYMA 4MGSA 3NJVA 3WQBA 4XZUG 4LKSA 1J83A 1J84A 1DLCA 4D0QA 4L0PA 2B4KA 2VZOA 1W99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y64 A;  4P08 A;  4D8M A;  2QQO A;  2VZT A;  4KI5 M;  1XNT A;  3I3B A;  1ULO A;  2YC2 A;  2W1Q A;  4DEV A;  4W4Z A;  2V4V A;  4AG4 A;  3SKV A;  1UY1 A;  4BDV B;  1YQ2 A;  4ARY A;  1JYV A;  5IYY A;  2C26 A;  3UNP A;  3C7H A;  3ECQ A;  1O8P A;  1JYN A;  2YB7 A;  1NAE A;  2DCK A;  3OGV A;  4P5Y A;  3MBW A;  4CU9 A;  3III A;  5IFP A;  4LHS A;  4M4R A;  1GMM A;  2VZV A;  2EIB A;  2Y6H A;  2Y6L A;  2WAO A;  1PMJ X;  2E31 A;  2WZE A;  3WF1 A;  2J1S A;  3HN3 A;  5LCW L;  4OMD A;  2J22 A;  2W92 A;  3A7Q A;  3WF3 A;  1EUU A;  3AC0 A;  4ZZ5 A;  3K4A A;  2WAB A;  2ZEZ A;  2LW8 A;  2JD9 A;  3LEK A;  5HPO A;  2WYS A;  4IUG A;  1UZ0 A;  1T2X A;  4DUV A;  2C4X A;  2J1U A;  3FHQ A;  3NRU A;  2ORZ A;  2EIC A;  2W94 A;  2WO2 A;  1CIY A;  1WCQ A;  3I2I A;  3OG2 A;  4UI9 L;  1DYO A;  3C8X A;  3VD7 A;  3HOB A;  4DUW A;  4RYD A;  2BBA A;  1UY2 A;  3IAP A;  1US3 A;  3VD4 A;  2VZP A;  2QQK A;  2VQU A;  3THC A;  3THD A;  3MUZ 1;  3ACI A;  2J1T A;  4JKL A;  1JZ3 A;  2VJX A;  4W50 A;  3WF0 A;  3I2F A;  3CZU A;  3K4Z A;  1K12 A;  3GM8 A;  4BK4 A;  3BGA A;  4CU6 A;  2WDB A;  2VCA A;  1GOH A;  2WN2 A;  3C7F A;  1JHJ A;  3LPG A;  4QX3 A;  2E26 A;  3CMG A;  1KEX A;  3F2Z A;  2VMF A;  4OUE A;  4UOJ A;  1EUT A;  1GQP A;  5JMO A;  3WNP A;  1JZ7 A;  3A21 A;  3OEA A;  1UXX X;  4JHZ A;  4TXW A;  3SKJ E;  3K4D A;  3WNM A;  1GNY A;  2ID4 A;  3LQC A;  2EIE A;  3MV0 1;  4GZ9 A;  3K77 A;  3WSO A;  3MO4 A;  3LEG A;  4A45 A;  1JZ8 A;  5C70 A;  2WO1 A;  1OF3 A;  2WZ8 A;  2BER A;  2W1U A;  4A41 A;  4CU7 A;  4MGQ A;  3I2J A;  2QQN A;  5A1A A;  2W1S A;  2JDA A;  3A22 A;  5B4X A;  2W87 A;  5JXI A;  2W9X A;  4ZXE A;  4CUC A;  3I3E A;  3E1F 1;  1W9S A;  2WO3 A;  4DEQ A;  2E33 A;  3I97 A;  4A6O A;  1UYY A;  3U37 A;  2V5D A;  4M4P A;  5LA2 A;  5C71 A;  2VM9 A;  1CX1 A;  3CIH A;  2QQL A;  1OH4 A;  1O8S A;  3CDZ B;  3NNG A;  3EYP A;  1W8O A;  2XHN A;  3IAQ A;  3MUY 1;  3SEP A;  1NX9 A;  3MV1 1;  4DXR A;  3P1I A;  2RV9 A;  2QQI A;  3CZJ A;  4XUN A;  4OZO A;  1MPX A;  5JXJ A;  1UXZ A;  2BGP A;  4XUP A;  3VDC A;  4Z2A A;  3D3A A;  4JX0 A;  4FI9 A;  5IFT A;  1XPW A;  1UY3 A;  1UYZ A;  2VR4 A;  4QDS A;  3OBA A;  2VL4 A;  1P8J A;  2VOT A;  1TVG A;  2YFU A;  1GOF A;  3GXU A;  1JZ2 A;  5LA1 A;  3I2H A;  4CUA A;  1JZ5 A;  1F4A A;  3ACH A;  5EJ1 B;  5JXG A;  2V72 A;  3I2G A;  4GWI A;  4QB2 A;  4AAX A;  4JKK A;  3OEB A;  3EB7 A;  4DUX A;  5EJZ B;  2W47 A;  4A4A A;  5HXM A;  2VZR A;  4CVU A;  1O59 A;  1UMH A;  3C7E A;  3LEI A;  3A23 A;  1CZT A;  2YFZ A;  2QQJ A;  1I5P A;  3GGL A;  3BN6 A;  3DYO A;  4QDQ A;  1K45 A;  4RN5 A;  1JI6 A;  1W9T A;  1W9W A;  1DP0 A;  2XON A;  2R7E B;  1SG3 A;  2VO5 A;  2YC4 A;  3OGR A;  1US2 A;  3P6B A;  4ZZ8 A;  4P02 B;  2WN3 A;  2ORX A;  3WF2 A;  1L7R A;  2DDU A;  1IQD C;  2VCB A;  4W8J A;  2X05 A;  1JU3 A;  2W5F A;  2ZEX A;  3JXS A;  2Z4F A;  2B9V A;  4UAP A;  1XNA A;  2VZ3 A;  3WNL A;  4XUO A;  3PUI A;  1H6Y A;  4MAD A;  5CYY A;  4QDR A;  1JZ6 A;  3C7O A;  3I2K A;  3T2O A;  4PF1 A;  5EIY B;  5JUV A;  4BK5 A;  5LA0 A;  4DXT A;  5J1X A;  3VDA A;  2VZS A;  1F4H A;  2E32 A;  1XC6 A;  1GOG A;  3VD5 A;  2VZ1 A;  1TG7 A;  2J7M A;  3FN9 A;  5F7U A;  2ZXQ A;  3T0B A;  2KD7 A;  2VQT A;  4XUT A;  4XUQ A;  1PX4 A;  4TTG A;  4ET7 A;  3W5M A;  1SHW B;  5B4N A;  2WQ8 A;  4LPL A;  2X10 A;  1NKG A;  3WEZ A;  3WNN A;  2LS6 A;  1UY4 A;  5JR2 A;  3HNY M;  4QX0 A;  2VMC A;  3K75 B;  2WUH A;  3HJR A;  4GWJ A;  4A44 A;  3WF4 A;  4CUB A;  2OKX A;  1CZV A;  3HNB M;  1BHG A;  2QBX A;  3VD9 A;  2RJ2 A;  4LQR A;  2EID A;  3VD3 A;  3OGS A;  1W8N A;  4XUR A;  3ZM8 A;  1SDD B;  2VZQ A;  2VCC A;  5G04 L;  2QQM A;  2PQS A;  1RYY A;  1WKY A;  3OB8 A;  4QAW A;  1JZ4 A;  2RVA A;  2Y6J A;  3LE0 A;  4JKM A;  3HNM A;  3K46 A;  1PX3 A;  2XOM A;  3WNK A;  2BGO A;  3W5N A;  2J1A A;  3HEI A;  4OMC A;  3CKH A;  2BZD A;  4QX1 A;  2ZEY A;  4E8D A;  3T09 A;  2W95 A;  4QX2 A;  2X09 A;  1UY0 A;  4A42 A;  2W91 A;  3NQH A;  4XVH A;  1K3I A;  1K42 A;  2W3J A;  3FHA A;  3IB3 A;  2DCJ A;  2HYX A;  4KMQ A;  3FL7 A;  1JYW A;  4OYU A;  5IJR A;  4YPJ A;  2XQX A;  5I0D A;  3DEC A;  3NJX A;  5DMY A;  3UES A;  2VME A;  2Y8K A;  3GDB A;  2J1E A;  2VTF A;  2HLE A;  1JU4 A;  4MOA A;  1KGY A;  3T2Q A;  3T0D A;  3J7H A;  3ACF A;  4QB6 A;  4E8C A;  5IHR A;  4QB1 A;  1UYX A;  4HG6 B;  2VMD A;  2YG0 A;  2CDO A;  1OD3 A;  3T08 A;  2JKX A;  4A3Z A;  1JYX A;  4BXS V;  4PT6 A;  5FUI A;  4BJ0 A;  3CQO A;  1H6X A;  3C7G A;  4ARX A;  5CZK A;  4ZY9 A;  3HPN A;  4QPW A;  1UWW A;  1NUK A;  2WBK A;  3ABZ A;  1UX7 A;  2L9L A;  3T2P A;  2J1R A;  1ULP A;  1R64 A;  2CDP A;  3UET A;  5G05 L;  3VDB A;  2JE8 A;  1GUI A;  2VZU A;  1D7P M;  2Y6K A;  1W0N A;  2C9K A;  5DN2 A;  2W46 A;  1HN1 A;  5DPN A;  4MO3 M;  2WAA A;  1OF4 A;  4CU8 A;  3I3D A;  1OT5 A;  3T0A A;  1PMH X;  3LPF A;  2J1V A;  5JXH A;  4KWU A;  1LNS A;  2Y6G A;  3PUH A;  1UMI A;  2ZEW A;  3WNO A;  2VC9 A;  3IDA A;  5DQ0 A;  1CZS A;  3ACG A;  4PQQ A;  3SEE A;  3ETP A;  3DYP A;  1GU3 A;  4DXS A;  2W1W A;  4P00 B;  1L7Q A;  5C7G A;  3DYM A;  4MGS A;  3NJV A;  3WQB A;  4XZU G;  4LKS A;  1J83 A;  1J84 A;  1DLC A;  4D0Q A;  4L0P A;  2B4K A;  2VZO A;  1W99 A; 
#chains in the Genus database with same CATH topology
 1YIF A;  3H8U A;  3NVC A;  3VBS B;  5APA A;  2I45 A;  3ZXG A;  5IVE A;  1GIC A;  3UV9 A;  4Q2F A;  3I3B A;  1N3O A;  2JDM A;  1DGL A;  1SLB A;  1DZR A;  2YC2 A;  5A80 A;  4AQS A;  4CP2 A;  4S2H A;  3SKV A;  4NRQ A;  2D98 A;  1AYM 3;  2RMU 2;  4N90 A;  3I3Q A;  1YQ2 A;  4EWD A;  5FP4 A;  2AAC A;  1XBF A;  1BBT 1;  2C1F A;  2PAE A;  3SQO A;  4YZ3 A;  3ZSK A;  4LT5 A;  1MAC A;  1AR6 2;  5IYY A;  1QDO A;  3BB6 A;  3WOG A;  1UMZ A;  1B35 C;  1HN0 A;  2HWC 3;  4D6S A;  3VKF C;  4URA A;  2RS1 2;  2Z2S B;  4YG6 A;  4CP0 A;  1O8P A;  2VVE A;  3TRS B;  2CL2 A;  3EQE A;  4AVB A;  4BXF A;  4D7Y A;  1HRI 3;  2JWP A;  2PHU A;  1H2N A;  1PGW 2;  1EAH 2;  3Q8A A;  4CU9 A;  2D40 A;  5KXB A;  4BOW A;  3LD8 A;  4HVO A;  2D3R A;  4CEW B;  1YI9 A;  5BXX A;  1UU4 A;  1GAN A;  4CDU A;  3TEY A;  1U5I A;  2Y6H A;  5A32 A;  3R05 A;  1COV 1;  2D93 A;  3OPT A;  3RI8 A;  4GB3 2;  5JPN B;  1JW6 A;  5FZO A;  2WZE A;  3JD7 3;  3ZYP A;  2YY1 A;  2BPA 2;  1S0F A;  1S0I A;  3HQR A;  2JG8 B;  3Q8E A;  2J1S A;  4GUL A;  1O3Q A;  2YZ4 A;  3HN3 A;  3JZV A;  2H6B A;  2P6C A;  4NAM A;  3VKM A;  3WZ1 A;  3MYX A;  1EUU A;  3K4A A;  1RJ8 A;  5JSR A;  2WZR 2;  2VMI A;  2R07 3;  3LEK A;  3O1P A;  3WW3 A;  1QKQ A;  3UKT A;  3POI A;  4CP9 B;  5L7O C;  2VOX A;  3FHQ A;  4NWW A;  4IET A;  2ORZ A;  4L99 A;  1VP6 A;  2A73 B;  1QJF A;  2ZAH A;  1QIQ A;  5EYY A;  3VBR A;  2JG9 A;  2W94 A;  3O14 A;  2DTY A;  4TLG A;  2R06 2;  2WO2 A;  2A6W A;  1W2T A;  3D82 A;  1WCQ A;  1RIN A;  4LXL A;  4E4H A;  3T1M A;  3C8X A;  4MUV A;  3VD7 A;  4GMP 0;  4AOC A;  4FQ4 A;  1H1M A;  1VBD 1;  1GLH A;  2ZGT A;  5IW0 A;  1IKQ A;  1H1A A;  1RGS A;  1VBC 2;  2VEC A;  4AHZ A;  5BY5 A;  5LK5 A;  3PVO A;  2NM1 A;  2JDK A;  4SBV A;  4C0H A;  4JCK A;  3MUZ 1;  1QJY 3;  1UQX A;  3W21 A;  2J1T A;  1C8N A;  4K21 A;  1PVC 3;  4WZF A;  4COW A;  1R08 2;  3MDP A;  3EO6 A;  2VNG A;  5FZ1 A;  3VKN A;  4PF5 A;  1ZM1 A;  3N7K A;  3DUI A;  2PXJ A;  2B8M A;  1UO9 A;  2V4A A;  3AYD A;  2FZ1 A;  3H3U A;  4LO5 B;  1RUN A;  4MVT A;  4K1Z A;  1K12 A;  3GM8 A;  1BK0 A;  4BK4 A;  5FP3 A;  2QQU A;  4FOY A;  2XL7 A;  1N3P A;  4QGL A;  4E4Z A;  5T5L A;  3ZDV A;  1VPH A;  3KHB A;  1AL2 2;  4K20 A;  2WN2 A;  2ZX1 A;  1S55 A;  1XSR A;  5JPM B;  5KBF A;  3CMG A;  2WII B;  3VL9 A;  3D0J A;  4E27 A;  2XLA A;  1ZBE 1;  1KEX A;  4UOJ A;  5JLV A;  2HBU A;  1ODM A;  3FJS A;  4O9E A;  3WNP A;  1S0E A;  4GH4 C;  5L9V A;  2GND A;  3ILN A;  4E2G A;  2XVK A;  4XQD A;  5J98 B;  4TXW A;  4JAA A;  4UFM A;  3SKJ E;  3K4D A;  4Y5Z 0;  1MS1 A;  1MEC 2;  2VW1 A;  4DIN B;  5LRS A;  1UF2 C;  1UD1 A;  3K77 A;  4OI2 A;  4E4D X;  1YQ5 A;  3MO4 A;  4XF4 A;  3LEG A;  4QXC A;  1F31 A;  4Y20 A;  3WSO A;  4P9X A;  4DPN A;  1JZ8 A;  4Q5O A;  3LCP A;  4CZS A;  1Z7S 1;  2JDH A;  2BOJ A;  3ZYF A;  3M3E A;  1IZ3 A;  2YV8 A;  5FZ8 A;  2GC2 A;  5FO9 B;  3ILF A;  1VRH 2;  1PO1 1;  4AGR A;  2VOW A;  2QQN A;  2W1S A;  3D8C A;  4QU1 A;  4RL7 A;  2W87 A;  5FPU A;  1OOP A;  4N8M A;  3U11 A;  1NZC A;  4LKD A;  3BKZ A;  1ZBA 1;  1RMU 1;  1LEN A;  4A7Y A;  3I3E A;  4HOO A;  2VBP A;  4AHW A;  4AW7 A;  1HDK A;  5FMO S;  3NW4 A;  3E1F 1;  4NR1 A;  2E33 A;  1XXN A;  3N35 A;  4P9J A;  4PDW C;  5DZF A;  5F3E A;  4A6O A;  2Y0I A;  1UYY A;  1O3R A;  3RWN A;  1K5M B;  4M4P A;  5C71 A;  1QJX 1;  4JTO A;  5CFC C;  1V70 A;  3AKR A;  3VHO A;  3MHZ A;  1E57 A;  3I4I A;  2WYF A;  1C8M 1;  1O8S A;  3CDZ B;  4LBL A;  1BVV A;  3EYP A;  4OUS A;  3U07 A;  1N1T A;  1UZY A;  3IAQ A;  5HXV A;  3MUY 1;  3SEP A;  5C7G A;  4OQ8 A;  2UY9 A;  4NID A;  1RC6 A;  2AH2 A;  2IXK A;  3OUH A;  4YG3 A;  4FT8 A;  5F5I A;  2RV9 A;  2ZCW A;  2GNT A;  1POV 1;  1G86 A;  1MPX A;  2E51 A;  5DAP A;  3WG1 A;  4AI8 A;  5ACA 1;  2VQ0 A;  2A6X A;  2WT2 A;  4B1L A;  4XUP A;  2W08 A;  5C8C A;  1RIR A;  1RUF 1;  2OPW A;  2K2S A;  5I0T A;  4WM8 C;  4K7J A;  4MHR A;  1ZA4 A;  1WA6 X;  4HKW A;  3AMP A;  1NCR A;  4M0H A;  4QDS A;  2RG4 A;  1TEI A;  1YI7 A;  1RTV A;  1P8J A;  1W28 A;  3VBO B;  2BEO A;  1F15 A;  1ZNP A;  4A7Z A;  3GXU A;  2PN5 A;  2ARB A;  1IS4 A;  2W52 A;  2YBK A;  4CUA A;  1H2L A;  2B5H A;  1Y7B A;  4ORF A;  2FCV A;  5FZ6 A;  4MXV A;  5JI9 A;  4OI4 A;  4N43 B;  1D4V B;  1ND2 A;  1BMV 2;  1NE6 A;  4YM0 A;  1CJP A;  4N9I A;  3ZR6 A;  3U4X A;  2B9U A;  3BU7 A;  4XET A;  1PMI A;  5KHG A;  3S57 A;  5FYC A;  4QKN A;  2WFF 1;  1X33 A;  4XJU A;  2D6K A;  2VZR A;  1OQ1 A;  4IEQ A;  4CVU A;  5F8P A;  2ZAC A;  1O59 A;  5I8S A;  3L2Y A;  1IS5 A;  3JB4 C;  2YFZ A;  1EP0 A;  4NPR A;  1DQ1 A;  1RUH 1;  1I5P A;  4Z82 A;  3GGL A;  3DYO A;  5BV6 A;  1W2U A;  1LGC A;  1X36 A;  2UUR A;  1GP6 A;  3K3O A;  2BQP A;  1JI6 A;  2CAU A;  2VVF A;  1SG3 A;  2R7E B;  3ZR5 A;  2YC4 A;  5FOJ B;  4Y1V A;  2OPK A;  4KBZ A;  2ZGR A;  1US2 A;  3PVB B;  1A6C A;  3P6B A;  4COV A;  2MEV 2;  4QKD A;  4YSF A;  2ZX0 A;  2V5Y A;  2UWB A;  5LEJ A;  1C28 A;  2WN3 A;  4MZU A;  3URF A;  5FCC A;  2ZAA A;  1RUE 2;  3OBR A;  1MS5 A;  3AP6 A;  4L9B A;  5FY0 A;  1T6G C;  2GH2 A;  4AL9 A;  1HQW A;  1JU3 A;  4ATF A;  2JEN A;  2W5F A;  3WP5 A;  4PJY A;  1SPP A;  1W03 A;  2WR9 A;  3OBT A;  2NP0 A;  1JYT A;  1UOJ A;  1BQP A;  2Z4F A;  3G7D A;  4JDO A;  1ACC A;  3LDR A;  4FOW A;  4YNI A;  5CG9 A;  1S2K A;  1QQP 1;  5DG2 A;  4C91 A;  5JIU A;  1XNA A;  4R9C A;  1L3J A;  2VZ3 A;  2RS3 1;  4YWA A;  5LBE A;  2DCZ A;  2OQ7 A;  3KV9 A;  1NE4 A;  2X53 S;  1GZW A;  3AZZ A;  3VDD B;  2FMD A;  4PI0 A;  1H6Y A;  4QPG B;  4I01 A;  1U5Y A;  1BXH A;  4QDR A;  5FZ9 A;  3C7O A;  4QPI A;  3O1V A;  3VBF B;  4PF1 A;  1UOB A;  1YC6 1;  3JBG 1;  1AF9 A;  3SCG A;  5LA0 A;  3WR0 A;  1PNF A;  1R09 1;  4MV2 A;  4CDU C;  3BVC A;  2R6Q A;  3AP9 A;  4KBB A;  5JAX A;  4W65 A;  3W59 A;  1W6M B;  3AMQ A;  2K0G A;  3VD5 A;  1REF A;  1ZRE A;  1AYM 2;  2A3Y A;  1LHU A;  4NRO A;  5T50 A;  3K3N A;  3MLL A;  2ZXQ A;  2FQP A;  3AYA A;  1LOC A;  1PX4 A;  1Q3E A;  3KWV A;  4FQZ A;  3NV2 A;  3ZMN A;  5IWF A;  4DY3 A;  1SHW B;  2R32 A;  4HLT A;  4O9G A;  4P9G A;  4Z1V A;  5B4N A;  5FY8 A;  1QF3 A;  4PDW B;  1HRI 2;  3AZW A;  4CEY A;  2X10 A;  5T5O A;  5LB6 A;  2QTW B;  2CSG A;  3WEZ A;  1D0G A;  1D4M 3;  1ULF A;  2LS6 A;  3LKJ A;  3NO8 A;  3VBR C;  5JR2 A;  1I3H A;  2JG9 C;  2WWS A;  2PLV 2;  4J6G A;  3OGG A;  4YW2 A;  4I0W B;  2ARX A;  5A3L A;  3HJR A;  5KXC A;  1C5I A;  1E5H A;  1GWL A;  4XHB A;  1J3P A;  1CZV A;  5FZG A;  2QFE A;  3CF6 E;  1BHG A;  3HNB M;  4DFS A;  1APN A;  3I59 A;  2IXH A;  3USS A;  1AX2 A;  3GJB A;  2RJ2 A;  4LQR A;  2EID A;  2NMN A;  5FPV A;  3SIT A;  3RWK X;  3ELN A;  3V64 A;  5L9R A;  3O1M A;  2VZQ A;  2G1M A;  2ZGM A;  1OHF A;  5IAT A;  2R07 2;  3ZMO A;  1RUI 3;  5C4W C;  1ASJ 3;  3KLS A;  4YZ4 A;  3OB8 A;  1QH7 A;  4QAW A;  4Z8B A;  1JZ4 A;  4IER A;  2RVA A;  4BH9 A;  3LE0 A;  5LK7 B;  4M01 A;  3KT1 A;  2XOM A;  1A3K A;  2HWE 2;  2BGO A;  5FJH A;  3WNK A;  1JUH A;  5IK4 A;  3GCW A;  4GJZ A;  4YYO A;  2QQP A;  3ZXL A;  1AX1 A;  2ZMK A;  1CAW A;  4B7K A;  1OQE A;  1RED A;  3BTZ A;  3I54 A;  1XU2 A;  5A33 B;  1PIV 2;  5FQ0 A;  4XVH A;  2W3J A;  3FHA A;  5FXV A;  3IB3 A;  3O7O A;  4Q4X 1;  4FTS A;  4KMQ A;  4BQ3 A;  1W6N A;  4ZU4 A;  1OQD A;  2O0O A;  3RZZ A;  1JYW A;  5FBZ A;  4QX7 A;  3AMM A;  2JXA A;  4DS0 A;  1JTZ X;  2H6C A;  4YPJ A;  2QZ3 A;  3QCW A;  4Y22 A;  4LHL A;  3T4V A;  4UFJ A;  5J3U A;  3HT2 A;  5FBJ A;  5JVV A;  2X5I B;  4B1M A;  4CA9 A;  4EN7 B;  2VME A;  1H8T A;  3GDB A;  5GZE A;  3DPR B;  5AC9 3;  2WNU B;  2FBE A;  1VE0 A;  3WXP A;  4JC1 A;  1BJQ A;  4RGK A;  2WNV B;  2XLF A;  3J7H A;  4QPY A;  4AFD A;  3TB0 A;  1MS9 A;  4QB1 A;  2PHL A;  1OOP C;  1OI6 A;  2ZS6 B;  2VOV A;  2EIG A;  1FOD 1;  1EV1 2;  3VZM A;  1OD3 A;  2HWD 2;  4Y1U A;  1JYX A;  1RUG 3;  1CGP A;  2XKP A;  3WHU A;  2DUO A;  3ENR A;  5FUI A;  1S4C A;  5JIA A;  5A6Y A;  5LBF A;  1LKN A;  4XF3 A;  2VTX A;  2V09 A;  3KZ4 C;  3THP A;  4ARX A;  2QZ2 A;  3ZDS A;  4QPW A;  3MF9 A;  5BNN B;  4AEK A;  3BOW A;  4EN9 B;  1AYN 1;  4CDQ A;  1VRB A;  1HIX A;  3N9Q A;  3K2O A;  4LOR A;  1W8W A;  5SV5 A;  4XJ8 A;  5F1R A;  1NUK A;  4MG2 A;  4YZ1 A;  2KM2 A;  2RS5 3;  1HJG A;  2Y38 A;  3ABZ A;  5FZL A;  1RVF 2;  4XW3 A;  2VUJ A;  3FBY A;  4QQH A;  5IVB A;  2Q8D A;  3T30 A;  2RDS A;  2CDP A;  5BNO A;  3QD6 A;  3DN7 A;  3UET A;  4JDM A;  5G05 L;  3ZSJ A;  5C8C C;  1EPW A;  1AZD A;  3KGL A;  1S2E A;  2HJI A;  1U12 A;  2WA4 A;  4EYU A;  5FOB B;  3NNL A;  4LE4 A;  1ODN A;  2DYC A;  1VLN A;  2VG9 A;  1W0N A;  5DN2 A;  4HON A;  2W46 A;  1S0B A;  1HN1 A;  4LBK A;  1NCR C;  4UF0 B;  2JB8 A;  5GJ6 A;  4IE7 A;  2OVU A;  4QHO A;  3WP3 A;  1OF4 A;  3AX4 A;  5FZO B;  4K6B A;  3I3D A;  3WQ7 A;  3WHT A;  5LZ6 A;  2P5B A;  4YGB A;  4YVW A;  2RMU 1;  3TAY A;  4L92 A;  5F2W A;  3VBU B;  1GKB A;  1IG0 A;  1POQ A;  3FC0 A;  3RVH A;  4HVQ A;  4XIK A;  2R16 A;  3PUH A;  3AB0 A;  1HV1 A;  1J3R A;  2VC9 A;  3HMY A;  1ND2 C;  3WW4 A;  1Y4W A;  2RS1 1;  3TYJ A;  3KQR A;  5C33 A;  1W8Z A;  2GZW A;  4HAN A;  4JGZ A;  4BQY A;  1PGW 1;  3ETP A;  1EAH 1;  4NWV A;  1VBE 2;  3VBR B;  5A3U A;  1GU3 A;  2ZOE B;  5DAB A;  3CU7 A;  1MZ6 A;  3ZSL A;  2XVL A;  4Q4W 3;  3RJR A;  5A1F A;  4YAR A;  3ETQ A;  1LGN A;  3DYM A;  2QE3 A;  4FPJ A;  4FVV A;  4K3U A;  3WQB A;  4XZU G;  3LWC A;  4LKS A;  4LNV A;  1PZ9 A;  3QLQ A;  4GB3 1;  2RHP A;  4GJY A;  1OKO A;  4IGQ A;  1UU6 A;  3PHM A;  5DDJ 1;  2B46 X;  3NNJ A;  4YRD A;  4LHK A;  4SLI A;  2Y64 A;  4P08 A;  1GZC A;  3KM5 A;  1V9U 1;  1DQ2 A;  2Y34 A;  4B29 A;  3AVS A;  3S7I A;  2VZT A;  4CDW A;  1XNT A;  4CPB A;  5GZC A;  2W1Q A;  5C4W B;  1CAV B;  2WZR 1;  3FHI B;  2V4V A;  4HFS A;  1XNK A;  4W4Z A;  3KT7 A;  4BLJ A;  4BDV B;  5I8T A;  3BOD A;  1RUC 1;  4CDX A;  5T5P A;  3LOI A;  4QD2 A;  3UNP A;  2RM2 3;  3TN9 3;  2PFW A;  3ECQ A;  1BEV 3;  1POV 0;  1FAY A;  2WIN B;  1JYN A;  4XTP A;  1Y9G A;  1AUY A;  2IC1 A;  1W6Q A;  4HXC A;  2DCK A;  3OGV A;  1U0A A;  1SBE A;  4L11 A;  4EWE A;  3MBW A;  4UFL A;  5IFP A;  1VBC 1;  4LHS A;  2QUO A;  2XKO A;  3ZN4 A;  2P2K A;  2YPJ A;  5HCH A;  2CGP A;  3PVE A;  4BQW A;  2Q8O A;  5D21 A;  5BPX A;  2Y6L A;  4MSV A;  3GHM A;  5IUQ A;  3HVD A;  1VBB 1;  2WAO A;  4WVM A;  4XDO A;  5T55 A;  1PMJ X;  5FY5 A;  1F2N A;  3WF1 A;  4QPI C;  1DQ0 A;  4I3G A;  2E7A A;  1DQ4 A;  2ZKL A;  4NAO A;  4RGA A;  3UJO A;  2DCY A;  3AJY A;  4Y20 B;  5IVF A;  2J22 A;  1G9A A;  3NWK A;  1OD5 A;  2W92 A;  4R9B A;  2Z5W A;  3MLK A;  3AYE A;  3WF3 A;  1LOF A;  3AC0 A;  3T08 A;  2ZEZ A;  1D2Q A;  5EFU A;  2XJP A;  3CL1 A;  4MGY E;  1AL2 1;  4CXW A;  1ULD A;  1ENR A;  2P3I A;  2D6O X;  1GWM A;  2WYS A;  4FFF A;  1UZ0 A;  1T2X A;  1QJU 3;  3VBH A;  2C4X A;  1KFX L;  3FMG A;  4CXY A;  3NRU A;  5DZE A;  3NAP A;  5CB7 A;  4PBP A;  4XAA A;  1CIY A;  2OA2 A;  3WDU A;  2HEW F;  5C5U A;  4AAP A;  1PGS A;  1DYO A;  4DUW A;  1MEC 1;  4RYD A;  4CEY C;  1DF0 A;  3IAP A;  4JTN A;  5DAQ A;  3WVJ A;  3VD4 A;  2VZP A;  2MPF A;  3NJZ A;  2QQK A;  5GLU A;  1ONA A;  3THD A;  1ZVF A;  1HJF A;  2JE7 A;  3AKS A;  2VNR A;  3NV3 A;  3QBQ A;  3NST A;  4JKL A;  1JZ3 A;  5CKQ A;  4XC9 A;  1J59 A;  1LED A;  4W50 A;  1OPO A;  2WFP A;  3WQ0 A;  1VRH 1;  2WS9 2;  3MIE A;  4RGG A;  4BIF A;  4NHK A;  4GA9 A;  4HPK B;  3PUR A;  4KWL A;  4KL1 A;  4IV3 B;  3BGA A;  3SXW A;  5K9Y A;  2XL9 A;  3DGT A;  3RYR A;  4NVP A;  1U5X A;  1ZA7 A;  1N1V A;  2GME A;  2VCA A;  5C8C B;  3OYW B;  3C7F A;  1JHJ A;  2VBD A;  3H9A A;  4ZKT B;  2E26 A;  1ENS A;  4Z92 B;  3WW2 A;  3IPV B;  2VMF A;  3K51 A;  1V6I A;  3M3O A;  3U4S A;  1IPS A;  2E7T A;  3N36 A;  4Q4V 1;  2JIC A;  4M3C B;  5FDB A;  5JMO A;  1BBT 3;  1ZX5 A;  2YXS A;  1D4M 2;  1LHW A;  4DNY A;  3OEA A;  1ULG A;  3TOJ A;  3ZIW A;  2ZX4 A;  3L9J T;  3DXU A;  3KCX A;  4FOV A;  4UFI A;  2QNK A;  5ANQ A;  3WNM A;  2PQQ A;  1WME A;  5A7N A;  1FX5 A;  2KA3 A;  2EXI A;  2ZGL A;  1WWY A;  4ZU5 A;  2EIE A;  5L73 A;  3VZJ A;  2ATF A;  2ARC A;  4A45 A;  2OUH A;  5C70 A;  4R4Z A;  3ZKU A;  4XFF A;  2NYY A;  2WO1 A;  1NLS A;  3LDB A;  3CJX A;  2ZA9 A;  3NL1 A;  3W9A A;  5BUV A;  5JOZ A;  2WZ8 A;  1HX6 A;  4UW5 A;  3SH3 A;  5GKA C;  1ND3 A;  1DBN A;  1LOG A;  1S0J A;  1MQT B;  1RUI 2;  3KD4 A;  4K8F A;  4QKB A;  4A7K A;  4LOT A;  5CVR A;  2W39 A;  3PMS A;  2X8K A;  2P4E A;  4NE9 A;  5BNP A;  5JXI A;  1H9W A;  4ZXE A;  4B4P A;  4XFG A;  2GDF A;  1H8T C;  2I2S A;  3WDW A;  1RUD 1;  1WW7 A;  2VY0 A;  4Y4Y A;  2DVA A;  2UU8 A;  1WLW A;  3I97 A;  3Q8F A;  2IXI A;  4LBO A;  4Q1R A;  4YVS A;  4F3J A;  5E1R A;  4JDN A;  1TMF 2;  3ZN6 A;  3U37 A;  3O1R A;  5IVY A;  5FK7 A;  1QEX A;  2KR2 A;  2V5D A;  5LA2 A;  2PHT A;  2F4L A;  3O1U A;  3LAG A;  4AVC A;  1W06 A;  4BQ1 A;  4AK3 A;  4O65 A;  3BPZ A;  3OD0 A;  4WM7 B;  2D6L X;  4QXK A;  5DUV A;  1VBD 3;  3MLJ A;  3POS A;  2D6N A;  3WDT A;  2XHN A;  2ZTN A;  4COY A;  1J1L A;  4XOG A;  3MV1 1;  1G7Y A;  4N53 A;  4QMA A;  5K4L A;  2VVD A;  3P1I A;  1OC1 A;  2LM3 A;  2X29 A;  1HB4 A;  2BGP A;  4HSJ A;  4FPH A;  4CDQ C;  1PHM A;  3VDC A;  1A8M A;  4JX0 A;  3RI9 A;  2VNO A;  4IEU A;  3M4F A;  3AZV A;  1DZQ A;  1C1F A;  3VZL A;  4LUM A;  5CFD A;  2RJL A;  4MXW B;  5JMC A;  3WY6 A;  5FXX A;  1OPM A;  4W6Y A;  1UYZ A;  2A3W A;  2VR4 A;  3MF6 A;  5FY4 A;  3FUQ A;  5BNO C;  2WO7 A;  4RR3 A;  2VMG A;  4XPV A;  4NPL A;  5A1L A;  4BQ5 A;  1CIW A;  3WDX A;  4IE0 A;  1HB3 A;  4QX5 A;  1ZBE 3;  1RUG 2;  2RE9 A;  2YHJ A;  4M3C F;  4XMA A;  5A7W B;  3VZK A;  5LA1 A;  1JZ5 A;  1JOP A;  3GJA A;  3O5S A;  1F4A A;  5FZC A;  4CSW A;  3V0B A;  2JKB A;  2TEP A;  4MLO A;  5F6L B;  1AHS A;  4MYE A;  2V72 A;  5A7O A;  4BIO A;  3SC7 X;  4RD7 A;  1RJ7 A;  1DYK A;  3HQX A;  3I2G A;  2AEN A;  3QH7 A;  4GWI A;  4QB2 A;  4ZPI A;  4BZ4 A;  4JKK A;  2WA3 A;  2LAL A;  1DCS A;  3EB7 A;  4YVW C;  3PUQ A;  2H0V A;  2VMH A;  5E8A A;  2E53 A;  5EJZ B;  2RS5 2;  4YGE A;  1FMD 1;  4A4A A;  3A4U A;  1X8E A;  3V0A B;  2C9A A;  2JIG A;  3KVA A;  2G9F A;  3U0Z A;  3T1L A;  1DHK B;  1YFU A;  3ES1 A;  4MH0 E;  4UFK A;  1UMH A;  1Z7S 3;  4L8Q A;  4IEV A;  2QQJ A;  4AFC A;  3AP4 A;  1O5U A;  1PO1 3;  4FO9 A;  4JGZ C;  2EAA A;  3BN6 A;  2WZP P;  1K45 A;  2YGL A;  4JGY B;  4PBO A;  1CR7 A;  3ZXF A;  3BU0 A;  3N9O A;  5FK8 A;  4ZU7 A;  4XCB A;  4X6R B;  1W9T A;  1ZBA 3;  1DP0 A;  3N7J A;  2F4P A;  4AGV A;  1RMU 3;  2DU1 A;  3OGR A;  4AVS A;  4XJZ A;  3PIG A;  4AQT A;  3B5L B;  3OD4 A;  4YFW A;  1GYK A;  3D6E A;  3W20 A;  4XBN A;  2XH6 A;  2PEL A;  1Z78 A;  2ORX A;  3PJY A;  3MW4 A;  2EAL A;  1GFF 2;  1FPN 2;  4LLF A;  1NCQ B;  3LFM A;  2ZGQ A;  4Y33 A;  4OHZ A;  3WF2 A;  4FTB A;  1AR8 2;  1HRV 2;  1QJX 3;  2VCB A;  4BQX A;  5ABJ A;  5D8A A;  4CDW C;  1NXM A;  4H3W A;  3I3M A;  2QKD A;  1C8M 3;  4MGT A;  1HXS 2;  1D0H A;  4HBN A;  1DGW A;  4QM8 A;  1GNZ A;  2BFU S;  2B9V A;  4PQ9 A;  4JRA A;  3ST7 A;  4CDX C;  2R1D A;  1DLL A;  1STM A;  3VUO A;  2OYZ A;  4FOQ A;  4LOS A;  4Q4W 2;  3TBD A;  4ATE A;  2PLV 1;  1POV 3;  4LEJ A;  5ACA 3;  5KWR A;  5C9A B;  1AR9 1;  1LTE A;  2H0B A;  2XJT A;  3E6D A;  1CAX B;  4IEY A;  2BW8 A;  1WW6 A;  1RUF 3;  3I2K A;  4LIT A;  5EIY B;  2BDR A;  3KVB A;  4P9Y A;  4XYX A;  4AXO A;  3D4K A;  5EHD A;  4WBB A;  4WVW A;  3RMX A;  5LA9 A;  1W6O A;  3KF3 A;  2QQV A;  4QGN A;  2BBV A;  2Q8C A;  4BM8 A;  2ZGO A;  4CCM A;  3ZPO A;  2P6H A;  2JD4 A;  1WW4 A;  1XC6 A;  4LBQ A;  2VZ1 A;  5H9P A;  4OQ9 A;  1T6B X;  2K46 A;  3WT3 A;  3A0K A;  2HWE 1;  2RR1 2;  1VIW B;  1V6O A;  2VQT A;  2Y6F A;  4HN1 A;  5EP9 A;  1LOF C;  1LOA A;  4Y24 A;  3TN9 2;  1NQD A;  2VGD A;  2JDP A;  4GIQ A;  1M06 G;  4RQP C;  3JUU A;  2IFR A;  1QNY A;  2XBO 1;  4FPG A;  3I2O A;  1PK6 A;  1NKG A;  3USU A;  4AED A;  2BOI A;  3VBH C;  2CTV A;  4AI9 A;  3GZT B;  2OZ6 A;  2WFF 3;  1UY4 A;  4RS5 A;  3NAP C;  3T4H B;  3J8F 1;  3DCQ A;  4QX0 A;  1ZZ8 A;  2VW0 A;  5HBA A;  1LUL A;  4BYY A;  1XE0 A;  5FRA A;  1MS4 A;  2ZAB A;  1N3Q A;  3AKP A;  4WVV A;  3WF4 A;  2OKX A;  4J1W A;  1BYH A;  4RHV 2;  1RUH 3;  2GC0 A;  3ZPY A;  1B35 B;  2PTM A;  4ASM B;  3FLR A;  2VAU A;  3ZFE A;  1AR7 3;  2QBX A;  4V2W A;  2WSU A;  2AEY A;  4TSV A;  1W39 A;  2NQY A;  3OGS A;  1QOT A;  1W8N A;  3LA2 A;  3GBF A;  2EVX A;  1C57 A;  3BAL A;  5FYV A;  3ZYR A;  1PGL 2;  1XNC A;  1W8F A;  2WNO A;  1J1T A;  1Q8P A;  1TME 2;  2Y6J A;  4KG8 A;  2ET7 A;  3VKL A;  4YZ2 A;  1WW5 A;  3AZX A;  3HNM A;  4EJR A;  1KJL A;  1PX3 A;  2OXB A;  3HEI A;  3CKH A;  4JZR A;  1YQ8 A;  2FDJ A;  4PIX A;  2WC2 A;  4QX1 A;  1EV1 1;  3T09 A;  2HWD 1;  1S0C A;  1W8T A;  4QX2 A;  2X09 A;  2YU1 A;  4JV4 A;  3H8X A;  4EZ4 A;  1UY0 A;  1WGP A;  3PME A;  4A42 A;  5A7P A;  1ZZ6 A;  5GLV A;  5CG8 A;  3NQH A;  1K42 A;  3DXT A;  2YDE A;  4LR4 A;  3GBG A;  5F37 A;  2A75 A;  1Q8O A;  4CCC A;  1QQP 3;  2BUK A;  1DYP A;  5K0U A;  3H1Y A;  1RUJ 1;  2RS3 3;  2ZZQ A;  1PO2 1;  5L7O B;  4NHY A;  2ILM A;  2ADD A;  2XPJ A;  1VBA 2;  2JB4 A;  4G3Y C;  5IJR A;  4DZG A;  1BVP 1;  4CCN A;  4UXA A;  4Q4Y 1;  1UW8 A;  1W04 A;  1UPI A;  4CTE A;  2DVF A;  5DZG A;  1Q5O A;  3VHP A;  1GSL A;  1RVF 1;  1SLA A;  3JBG 3;  3N4M A;  4YGC A;  1ENX A;  1R09 3;  1W2O A;  4LUK A;  3BI3 A;  4PI2 A;  4Q27 A;  1SFY A;  2VTF A;  4UYB A;  5EXO A;  4AF9 A;  1ND3 C;  2XUM A;  1NQJ A;  5FO8 B;  4IQP A;  1R1A 1;  1RHI 3;  1AR7 1;  3NMB A;  3FLP A;  4XE9 A;  3ACF A;  5L36 A;  3OGJ A;  4E8C A;  2C0Z A;  2A5Z A;  3WCS A;  3IDE A;  4OUL A;  3N9N A;  3B00 A;  3FBM A;  1ZRC A;  3ZXD A;  3RRD A;  2CDO A;  2ZJC A;  3CJI A;  2Z69 A;  4AYU A;  2TBV A;  4A3Z A;  4XBL A;  2VNV A;  3SIS A;  4QU2 A;  3ZFG A;  3MIG A;  3I8T A;  4GAZ A;  3O1O A;  5F3G A;  3GZE A;  4YVS C;  2XJV A;  2D3P A;  2CHH A;  2DFC A;  2XG3 A;  2ZX3 A;  4EN0 A;  4PCR A;  5JOX A;  1W90 A;  3POF A;  1O3S A;  3HPN A;  4CCJ A;  1S0G A;  1XE8 A;  3H7Y A;  5T52 A;  3VBS A;  2AC1 A;  5H9R A;  3HR9 A;  3FX3 A;  1COV 2;  5A3T A;  4GH4 B;  3LOB A;  1K5J A;  2XR4 A;  2B42 B;  4NPM A;  1UZZ A;  1XSQ A;  1YQ6 A;  1H8V A;  4LK7 A;  1VBE 1;  3HAG A;  4N53 C;  4YM1 A;  1UIJ A;  4TZD A;  2J1R A;  1SLI A;  4FP2 A;  5DAV A;  5GZG A;  2YYO A;  2O8Q A;  2R30 A;  3PTY A;  4RFT 0;  2BTV C;  4YM2 A;  3IDC B;  3VDB A;  2QDR A;  1GUI A;  2Y26 A;  3PVN A;  4M0N A;  3TEW A;  5FZI A;  1F5J A;  2Y6K A;  4COU A;  4UW6 A;  5L19 A;  5FZF A;  5CFD C;  3GBW A;  3I49 A;  1UZV A;  2B39 A;  1TE1 B;  3OOX A;  4RR3 C;  2P3Y A;  5KHK A;  1CVN A;  4C0B A;  2YPD A;  1MS0 A;  1RHI 1;  4I3P A;  4XIO A;  4COZ A;  3VL8 A;  5A6Q A;  3EJK A;  4XAE A;  1RL3 A;  3T0A A;  2ADE A;  2JDY A;  4D3W A;  1X8M A;  3BCW A;  1Y3T A;  3D0S A;  4KWU A;  5EYX A;  2ES3 A;  3KT4 A;  4YM3 A;  2HEY F;  2JG8 A;  2HWC 2;  4GXL A;  4NHX A;  4Q4X 3;  3VZN A;  1KJR A;  1H2M A;  3AYC A;  4RQP B;  4ASL A;  4R9A A;  1QXR A;  5GZF A;  5C3S A;  1F5F A;  2R0H A;  2ZKN A;  5CFC B;  3J7M A;  3E97 A;  1LOB A;  3DYP A;  3NAP B;  2DV9 A;  3I2D A;  4XXP A;  4DXS A;  1YIP A;  1OA3 A;  4CP9 A;  3AFK A;  4LIU A;  5HI0 A;  4Y1Y A;  4C1X A;  2DBI A;  5IK7 A;  1CAU B;  1JUI A;  3BYW A;  5J09 A;  1OLQ A;  1QJZ A;  5LY2 A;  4LO4 B;  1QH6 A;  1DIW A;  3JD7 2;  3KF5 A;  1J84 A;  3MW3 A;  5C3O A;  2B4K A;  5FLH A;  3LFI A;  3OY8 A;  3J7L A;  1W99 A;  1O4Z A;  1MR5 A;  1YFY A;  1SLT A;  3EHK A;  1UCX A;  1KDK A;  2BNM A;  1FOD 3;  1UKR A;  2AR6 A;  2EAK A;  2EXK A;  2QQO A;  1TNR A;  2WWU A;  4KI5 M;  5GLZ A;  2PHR A;  4D7S A;  1NA1 A;  1LHV A;  4KGG A;  4WM8 B;  3RZG A;  1WLC A;  2WQ4 A;  4XJA A;  4FXK B;  5T54 A;  4FPF A;  5F9T A;  1RUO A;  4TLF A;  3AZY A;  5HCB A;  5LEK A;  2MNG A;  4ARY A;  4I0B A;  4YW3 A;  5FWJ A;  3ZYI B;  2C26 A;  1O4T A;  2ZGN A;  3P3P A;  3C7H A;  2R04 1;  2E63 A;  5ABJ C;  5D8A C;  4BPZ A;  1AYN 3;  4BQ4 A;  5EQU A;  1Z7S 2;  2YB7 A;  2HWF 1;  3MI8 A;  4K8R B;  3VB9 A;  1V6K A;  1CJD A;  2W2I A;  1N47 A;  5A3W A;  1PO1 2;  4K9S A;  3MFA A;  5FYH A;  1OSG A;  1Y9M A;  2JX9 A;  5F32 A;  5LW9 A;  4XXA A;  1GMM A;  1QJY 2;  3AP5 A;  5C5T A;  2VZV A;  1PVC 2;  1E5S A;  2EIB A;  2MHF A;  4AHY A;  2A71 A;  2HWB 1;  3WQ1 A;  2RDR A;  1RMU 2;  1H4H A;  2WNE A;  5FZE A;  1BKZ A;  1CX4 A;  2J42 A;  4E2S A;  1Q8V A;  1LGB A;  4AQ6 A;  2BRT A;  3R0R A;  5LCW L;  2WS9 1;  4AI1 A;  3D5O A;  4OMD A;  1A8D A;  1OFS A;  5FY9 A;  3A7Q A;  3E5Q A;  2ZGP A;  3SMH A;  1W6P B;  4ZZ5 A;  1ND3 B;  3CEW A;  3FFQ A;  3ZXE A;  2VBB A;  2BU9 A;  4IUG A;  4QHZ A;  4DUV A;  2P17 A;  3MIH A;  3RSJ A;  2RMU 3;  2UYB A;  3AM2 A;  3SCF A;  2J1U A;  2XHK A;  2C24 A;  4UBH A;  4ISQ A;  2PA7 A;  2EIC A;  1ZZ7 A;  5A6X A;  1YUD A;  3C3V A;  4AGG A;  1HW5 A;  3DF0 A;  3I2I A;  4UI9 L;  5B2G B;  2RS1 3;  1W05 A;  5ACA 2;  3AK0 A;  2ZML A;  1UX6 A;  3AJZ A;  3MID A;  5F39 A;  3HOB A;  2BJS A;  4GMP 1;  4LLO A;  2IVJ A;  5C6C A;  3JCI A;  2VU9 A;  1PK6 C;  1UY2 A;  1EAH 3;  1HLC A;  1US3 A;  3B01 A;  3POY A;  3QAC A;  3TWI A;  3ZSM A;  4AED C;  2DVB A;  2VQU A;  4RS5 C;  4XFB A;  4ES8 A;  5KXE A;  3ACI A;  3C2U A;  3AKQ A;  1H2K A;  4B3N A;  1FV3 A;  4AE2 A;  4EV0 A;  5FMB A;  4JRL A;  1K5M A;  2ARA A;  2ZGK A;  3P5B A;  4LBN A;  2GP3 A;  5EWS A;  4CCL A;  4HET A;  3H50 A;  5H9Q A;  1TNF A;  4GB3 3;  3MPP G;  5CAZ A;  2ENR A;  3SNM A;  3I2F A;  4P14 A;  5FUN A;  5DDJ 3;  5J96 B;  3K4Z A;  2TNF A;  4H7L A;  3ZFE C;  1KFU L;  1JOD A;  3LSD A;  1V9U 3;  4HN0 A;  3KHC A;  1IGO A;  4GWN A;  5FY7 A;  4CU6 A;  4D94 A;  3U1X A;  5IT6 A;  5JDB A;  1WCS A;  1GOH A;  3BPS A;  5JZG A;  2WZR 3;  2GU9 A;  4UW4 A;  4NMI A;  4AQ2 A;  1VMJ A;  4OUE A;  5CFD B;  2QCS B;  4CDU B;  1EUT A;  1RUC 3;  1TMF 1;  5A32 B;  4MET A;  3W58 A;  4Y1Z A;  2WFF 2;  1XU1 A;  3INA A;  5HCA A;  3ZXJ A;  3NV1 A;  5IK5 A;  4MHU A;  5ERL A;  5I0U A;  2HYK A;  2B45 X;  4JHZ A;  4W6X A;  2NZ9 A;  2YBP A;  4QWN A;  1CWP A;  2FDF A;  1GNY A;  3O0X A;  1C1L A;  1QMJ A;  1SQ4 A;  2PHD A;  3P3N A;  1UU5 A;  3LQC A;  1J58 A;  1PM7 A;  1VBC 3;  3MV0 1;  3VBO A;  1AR6 1;  2FD8 A;  2ZGU A;  5K0U C;  5E6H A;  4GKX A;  5FZ3 A;  5DXD A;  1C5H A;  1JBC A;  1VB2 A;  1VBB 3;  3JB8 A;  3PIJ A;  4KWK A;  4XAB A;  3VHN A;  3WP4 A;  1GNH A;  4N43 A;  4A41 A;  4CU7 A;  2VQA A;  4ZHN A;  2XJQ A;  2JG9 B;  2JE9 A;  3I2J A;  5FXZ A;  3M3Q A;  1NT0 A;  2JDA A;  1CON A;  1JMU B;  3A22 A;  5B4X A;  5FYT A;  1EPZ A;  3N7L A;  4I0A A;  1ZRD A;  1REE A;  1VB4 A;  2A3X A;  4B8E A;  1AL2 3;  3F95 A;  5BNQ A;  1XYP A;  1JHN A;  1W9S A;  3E5X A;  4DEQ A;  3ZN5 A;  4FPE A;  4IE4 A;  4IV1 A;  5D1I A;  4XQ4 A;  5FZ4 A;  4KH9 A;  3ROU A;  2OW4 A;  4F7Z A;  4UW3 A;  1QQP 2;  2VM9 A;  5FPL A;  1I9R A;  1CX1 A;  5FMO L;  3CJI C;  1FYU A;  1UYP A;  3CIH A;  2QQL A;  1OH4 A;  4AR2 A;  3PUS A;  5I93 A;  3ZX7 A;  4D69 A;  3ZFG C;  1MEC 3;  2CU5 A;  3B3Q E;  4MX3 A;  2A7A A;  1NX9 A;  4IXL A;  4DXR A;  5F3I A;  1OLR A;  2R06 1;  1PNG A;  1EYB A;  4XEZ A;  1ZRI A;  3POJ A;  3JBG 2;  4FPY A;  3H3Z A;  5FPB A;  4X8P A;  4XUN A;  5CA6 A;  5JXJ A;  3VKO A;  3VBS C;  1Y9Q A;  3O1T A;  1NXD 1;  4NO4 A;  4Z2A A;  4FI9 A;  3JQW A;  4NOT A;  3ZO0 B;  5IFT A;  1VRH 3;  4V1P A;  3WCR A;  3MIC A;  1XPW A;  4J1X A;  5A3M A;  1ZRF A;  4XDQ A;  5LY1 A;  2QDN A;  4LO8 A;  1R08 1;  5DUU A;  2A1X A;  4N7I A;  4V2V A;  3H8O A;  3LIH A;  4L2N A;  2LRP A;  2XGX A;  3VDD A;  1GOF A;  2BWA A;  4QPG A;  1JZ2 A;  2O8O A;  4FSJ A;  2CYF A;  1E5R A;  1QHD A;  3I2H A;  4Q4V 3;  4B4Q A;  1FPN 1;  3CLP A;  3J9S A;  3VBF A;  1W6O B;  1HRV 1;  4ZON A;  5M0T A;  3B9C A;  5EJ1 B;  1XYN A;  2VOK A;  4HK8 A;  5FFO C;  2Q4S A;  3WDY A;  5JXG A;  3M70 A;  5AFB A;  1DGR A;  5L9B A;  3MZH A;  1QGL A;  1OFN A;  2VW2 A;  1OOP B;  2A6Z A;  4IGO A;  2D43 A;  2XDV A;  3SHR A;  1KDM A;  2FDI A;  1W6M A;  3PU8 A;  2W68 A;  2WWJ A;  1AX0 A;  2AYH A;  3CNA A;  1IHM A;  4K1Y A;  2JG8 C;  1ALY A;  5IAV A;  5D2A A;  4M00 A;  4XTM A;  3C7E A;  3LEI A;  3B69 A;  3A23 A;  1PK6 B;  1CZT A;  4LE3 A;  3V56 A;  2ZHL A;  5CU1 A;  4TWT A;  4LK6 A;  4IE6 A;  1GP4 A;  2VUD A;  2WRA A;  5EJ3 A;  2DUR A;  3H1M A;  3ALQ A;  1S1A A;  3HWJ A;  1GWK A;  1MZE A;  2K9Z A;  1W9W A;  4Q0U A;  2XON A;  1UPS A;  1W2N A;  4C1W A;  1W8H A;  1M4W A;  5LAS A;  1V6M A;  1X50 A;  1PVX A;  4Q8L A;  2AZ5 A;  2IXC A;  1RUD 3;  4LKF A;  1QOO A;  1A34 A;  5FZ7 A;  4XF9 A;  3LB9 A;  1QXJ A;  4CCD A;  4KG0 A;  4A6S A;  4FPO B;  3AXE A;  3AFG A;  1YJL A;  1SBF A;  1L7R A;  2DDU A;  4LO6 B;  2A6Y A;  1IQD C;  2RR1 1;  1PZ8 A;  4BHP A;  5KHJ A;  2WLQ A;  2WT0 A;  3B9I A;  1NA1 C;  3MGU A;  4CRQ A;  1YFW A;  2ZEX A;  1LEM A;  3JXS A;  3LF7 A;  3DL3 A;  1NCR B;  2F6B A;  1WA4 A;  4UAP A;  1ENQ A;  4MGI E;  3NKG A;  2Y60 A;  1QOS A;  4IDZ A;  4OUM A;  4Z07 A;  3B02 A;  3WNL A;  3ZYH A;  3NNM A;  1X9P A;  1XNB A;  1FAT A;  4H2A A;  4XUO A;  3HBZ A;  1HB1 A;  3RQ0 A;  3I7D A;  3NKT A;  1BZW A;  4MAD A;  1H0B A;  4Y4R A;  5JSO A;  4UFH A;  2HEV F;  1VAV A;  4RHV 1;  4TYS A;  2HBT A;  3T2O A;  4F8A A;  1ND2 B;  1NG0 A;  5A33 A;  2YGM A;  1XB9 A;  4Q1P A;  5FRE A;  5FZM A;  5JUV A;  4YGD A;  4OI0 A;  5J1X A;  4PLO A;  4DIQ A;  1FOD 2;  3VDA A;  4Q8K A;  2VZS A;  2R49 A;  1JOB A;  1F4H A;  4XFI A;  3TEX A;  4AFA A;  2OQ6 A;  5J36 A;  1ASJ 2;  5CBL A;  2E32 A;  1GOG A;  2O14 A;  3CO2 A;  5C3P A;  1TME 1;  2J7M A;  4FPK A;  3FN9 A;  3FLT A;  2E9Q A;  3KV6 A;  4F83 A;  4XUQ A;  4TN7 A;  4XF1 A;  5GZD A;  4TTG A;  2FZ2 A;  3SCH A;  3W5M A;  3E5U A;  3O1S A;  4Q29 A;  1LU1 A;  1WCU A;  2WQ8 A;  4LPL A;  4BQ2 A;  2X5I A;  1I1E A;  3PUA A;  3ITQ A;  5FY1 A;  4XFA A;  3X29 B;  1CD3 G;  4HKO A;  5FPX A;  3WNN A;  3DPR A;  2WNU A;  4BME A;  2VUA A;  1QJE A;  5A3N A;  1FMD 3;  2WNV A;  2FCU A;  4NRP A;  4HSL A;  2VMC A;  1BMV 1;  1GBG A;  3GCX A;  1GQH A;  4GWJ A;  5KXD A;  4CUB A;  1L7L A;  3ZSE A;  1ZZB A;  5J7M A;  3LZZ A;  4ONU A;  1NLR A;  3ZXK A;  3MFC A;  1G9D A;  2EXJ A;  5LWB A;  3VD9 A;  1SPP B;  2V73 A;  3THT A;  2GMM A;  2Z79 A;  4XUR A;  1SDD B;  3MPB A;  1K5M C;  1KXG A;  1UIK A;  5E16 A;  5AC9 2;  3LA3 A;  2QQM A;  5BNN A;  3IZO A;  4RFR B;  5FZH A;  1U5Z A;  2GAU A;  2VTX J;  4JKM A;  1AL0 G;  1ZRR A;  3LEM A;  4DXZ A;  2ZZJ A;  5DUX A;  2DF7 A;  1GZW B;  3WUC A;  1NY7 2;  3Q9O A;  4HVR A;  3U75 A;  4BU2 A;  2J1A A;  3W5N A;  1YXW A;  2BZD A;  4FPL A;  1W0P A;  4QPI B;  4E8D A;  3R4D B;  2D5H A;  3HIF A;  2MEV 1;  5JZG C;  2DUP A;  3PJQ A;  4C90 A;  1W9F A;  3CBN A;  3ZIX A;  3GAL A;  1OH3 A;  2GN7 A;  5T5J A;  2DU0 A;  2LRO A;  1RUE 1;  1UNB A;  1XOY A;  3ZYB A;  3QOP A;  4ISR A;  5CAD A;  3RNS A;  2DCT A;  2IWG B;  5F2S A;  4LUL A;  4A3X A;  4DOU A;  2UY8 A;  3WUD A;  2Q1Z B;  2PLV 3;  3FL7 A;  1CN1 A;  5FZK A;  4PLN A;  1AR9 3;  4FFH A;  4UF0 A;  3UKN A;  1VMH A;  1V0A A;  2NPI A;  2XJR A;  2VUL A;  4LA2 A;  2Z42 A;  5LAT A;  5FP7 A;  3KB5 A;  4IND A;  5DDJ 2;  2BVV A;  4AI2 A;  3VBO C;  1N1S A;  5JOW A;  1YYN A;  2D97 A;  3NJX A;  4QQO A;  1V9U 2;  3VBU A;  1QXP A;  5DMY A;  3UES A;  1O6U A;  4CEY B;  4O61 A;  3PNA A;  1TQ5 A;  1VAL A;  2GSY A;  2J1E A;  4Q26 A;  4XBQ A;  4RA0 A;  3ILR A;  1JU4 A;  2I74 A;  4N43 C;  1GQG A;  4Z2W A;  1KGY A;  1IG3 A;  4FAH A;  1JYC A;  2BP6 A;  2DBN A;  4E9K A;  4QB6 A;  5IHR A;  1IQA A;  5KC6 A;  1FT9 A;  3ORJ A;  1RUC 2;  4PIY A;  1LR5 A;  4OI1 A;  1CES A;  2HWE 3;  3NNF A;  5IVJ A;  1UYX A;  2VMD A;  3IBM A;  3WX5 A;  4G9S B;  5IAX A;  2CY6 A;  1O5L A;  3S5Q A;  3I59 B;  1HKD A;  4QGM A;  1QWR A;  1JH5 A;  1RB8 G;  2XBO 3;  3BTY A;  3BUC A;  3OY8 B;  1AYM 1;  2QQW A;  1PIV 3;  1WMX A;  2CV6 A;  3OUJ A;  4MGK E;  1N1Y A;  3CQO A;  4FXG B;  3ASI A;  4IV1 C;  4BJ0 A;  2BNO A;  2OII A;  3J8F 3;  5H9S A;  5CZK A;  1ZZ9 A;  1NA1 B;  2HWC 1;  2JEM A;  5FAX A;  2AUY A;  3N9P A;  1MZF A;  1HRI 1;  2UWC A;  1VBB 2;  4HT1 T;  2Q30 A;  4QKF A;  1G9F A;  4DO0 A;  1QY4 A;  5C4W A;  3ZKY A;  1CAV A;  5FP9 A;  2Q8E A;  1CAW B;  2L9L A;  3T2P A;  1DQ6 A;  1WUV A;  4L97 A;  4QXB A;  5FXW A;  2LUW A;  4LKE A;  4OLL A;  4S2G A;  5FQ0 B;  5FZB A;  2EA7 A;  3KV5 A;  2D6M A;  3ZXA C;  3O0V A;  5GLW A;  3JD7 1;  2GC3 A;  3O0W A;  1WBF A;  2JE8 A;  3GYD A;  3S0M A;  5FLI A;  2F17 A;  5KC5 A;  3OJB A;  2FDH A;  1W6N B;  2C9K A;  1XYO A;  4H14 A;  5DPN A;  1HB2 A;  3ZFF A;  4XCA A;  5F5C A;  4NN0 A;  4AEJ A;  3ZVX A;  4D7T A;  1EV1 3;  4LHN A;  1Z0H A;  4D6Q A;  2R07 1;  4FP3 A;  4YZ5 A;  2HWD 3;  4Y22 B;  5HV0 A;  2ZPX A;  1VMF A;  4PIZ A;  1PMH X;  1Q43 A;  1ZZC A;  3IIA A;  4WVZ A;  3RYP A;  1SZB A;  2J1V A;  3VDD C;  3MEP A;  4QPG C;  5JXH A;  2JDN A;  2QJV A;  1LNS A;  3OPZ A;  1OKQ A;  1H8T B;  2Y6G A;  1RUJ 3;  2RM2 2;  3VBF C;  1UMI A;  3UK9 A;  1PO2 3;  1BEV 2;  3LA7 A;  5I0R A;  1J3Q A;  3IDA A;  4NHL A;  1PIV 1;  1BK1 A;  1CZS A;  3ACG A;  3K48 A;  4PQQ A;  3SEE A;  4Q4Y 3;  1C4R A;  5A7S A;  4R9D A;  1NZI A;  1YHF A;  2GN3 A;  2YC0 A;  5IVC A;  1RVF 3;  5IVV A;  4XAC A;  4QQL A;  1QJY 1;  3H3L A;  1L7Q A;  1YO8 A;  1EY2 A;  2O1Q A;  3NJV A;  1PVC 1;  2P37 A;  2RDQ A;  4MGS A;  3POE A;  4JHT A;  4NIA A;  3QH6 A;  3RZH A;  1DZT A;  1J83 A;  1DLC A;  3PLQ A;  4D0Q A;  4L0P A;  2WSV A;  4KU7 A;  3MW2 A;  2E6V A;  1R1A 3;  4EN6 B;  4P5H A;  4B4R A;  5E88 A;  5A70 A;  5F3C A;  1FI2 A;  1LB2 A;  4Q4V 2;  4CDQ B;  1F8V A;  2PAM A;  1UZW A;  4OHV A;  2JEC A;  3RG0 A;  4OVE A;  4D8M A;  4E2Q A;  2NMO A;  1ULO A;  1OUR A;  4DEV A;  3PU3 A;  5TSW A;  3UL2 A;  4AG4 A;  1QJU 2;  1WLD A;  1OBN A;  1UY1 A;  4UWD A;  3RZK A;  5BNO B;  3DV8 A;  4NUB A;  2FDK A;  1JYV A;  1IPK A;  2VCM A;  3MIF A;  3S5A A;  4JVA A;  5JZG B;  4H7M A;  4HPK A;  5ANN A;  1UL9 A;  2OUJ A;  4IV3 A;  4J25 A;  5FWE A;  1NAE A;  4DRR A;  4P5Y A;  3OYW A;  2PHW A;  3III A;  2A6V A;  4IL7 A;  4M4R A;  1VBE 3;  1I5Z A;  3KMH A;  3JU9 A;  5CKN A;  3IPV A;  4LIV A;  4AEM A;  5IK8 A;  1X7N A;  3AMH A;  4LO7 A;  4M3C A;  5ISL A;  1WD3 A;  2YMZ A;  4UT5 A;  4YVW B;  1LOE A;  1JS9 A;  3RS6 A;  1LHO A;  4DB5 A;  2E31 A;  1H1I A;  1SCR A;  1AXZ A;  1RUD 2;  3N3H A;  4OHX A;  4HKL A;  2G19 A;  3J26 N;  1NYW A;  4QQP A;  2YUE A;  2WJS A;  4YW6 A;  4IW3 A;  1FXZ A;  2N7G A;  2WAB A;  2LW8 A;  4JGZ B;  2JD9 A;  5A3O A;  5HPO A;  4R52 A;  2P3K A;  4UBG A;  3DKQ A;  3Q8B A;  3Q8C A;  3S7E A;  1UN1 A;  5I0S A;  1VR3 A;  4DRV A;  1JN2 P;  5EPA A;  1BBT 2;  2GMP A;  4FAG A;  3ACL A;  5BNP C;  5FV3 A;  4HK9 A;  1MQT A;  2VPV A;  3OG2 A;  2XB6 C;  5FZD A;  5FZA A;  1UOF A;  1OLM A;  3GZU C;  2UYA A;  2X5I C;  4H55 A;  2BWC A;  3H1W A;  4IV1 B;  1UAI A;  2VUC A;  2BBA A;  5SV8 A;  4FTE A;  3DPR C;  5A6Z A;  2WNU C;  4CDW B;  2WQZ C;  3THC A;  2CNA A;  2GP5 A;  1V6N A;  4LBJ A;  2RDN A;  2WNV C;  3U78 A;  2P1B A;  4YW7 A;  2EXH A;  4IEO A;  1AXK A;  2VJX A;  1LHN A;  3HD8 B;  4CDX B;  4N7U A;  5F5Q A;  5JCT A;  3WF0 A;  1LAJ A;  2OZJ A;  3CZU A;  4WM7 A;  4Q0S A;  1O3T A;  1LRH A;  2YBS A;  1JOJ A;  3OBZ A;  1TZO A;  1YFX A;  3EXU A;  4X8N A;  3O12 A;  5FTT C;  1AXY A;  2WDB A;  1W6Q B;  3LPG A;  5AVA A;  1W3V A;  4QX3 A;  5FYZ A;  5GAL A;  1F9K A;  1WCD J;  4BWO A;  4K40 A;  5CIR A;  4EQV A;  1E5I A;  2W0X A;  5BNN C;  3F2Z A;  3POB A;  4WV8 A;  3UJQ A;  2BGC A;  1GQP A;  5FPZ A;  4CXX A;  1AJO A;  1JZ7 A;  5FYI A;  1SEF A;  3A21 A;  2G4I A;  4WVM B;  4ZXK A;  3E6B A;  3ATG A;  4YW4 A;  4CEW A;  4NIG A;  1FMD 2;  3OCP A;  5I91 A;  1BLZ A;  1UXX X;  2R04 3;  3WP6 A;  2VD7 A;  3UYJ A;  1SFN A;  4MXW A;  3WIN E;  3AVR A;  1VBD 2;  4QM9 A;  2HWF 3;  3LGR A;  2G9G A;  2ID4 A;  1IPJ A;  3WG2 A;  5CIS A;  1H4G A;  3ZLI A;  4BE3 A;  1D2S A;  3T2T A;  3GF6 A;  4GZ9 A;  3OPW A;  5A7W A;  4ASK A;  1YCI A;  4EE2 A;  3HBK A;  3J4U H;  5DG1 A;  2PHF A;  2OT7 A;  1HQL A;  2HWB 3;  1OF3 A;  3VBH B;  2BER A;  4CCO A;  2ZGS A;  5K8S A;  2W1U A;  2Q0A A;  5DAX A;  4MGQ A;  5A1A A;  3OF1 A;  2WS9 3;  1X9T A;  4Q0Q A;  3BIE A;  2BV4 A;  5FP8 A;  1Q8Q A;  3TNQ A;  3VBU C;  2XJU A;  4FBF A;  3H42 B;  4GAL A;  2W9X A;  2BVB A;  4XJ9 A;  1QDC A;  4CUC A;  1GR3 A;  4XFH A;  5FZ0 A;  2CWM A;  1GZ9 A;  3OTF A;  3V0A A;  4I09 A;  2WO3 A;  1ZBE 2;  4M3C E;  1ULE A;  2CGN A;  3GHN A;  1LOD A;  1MVQ A;  4CPB D;  1Q56 A;  3ZYG A;  2NN8 A;  1XE7 A;  4S2D A;  5KR7 A;  3KCY A;  3VHR A;  2TUN A;  2B7Y A;  4PLM A;  4JGY A;  2PHX A;  1AR9 2;  3NNG A;  4GMP 3;  1W8O A;  3DKW A;  5K7P A;  3KSC A;  3M1H A;  1MS8 A;  1W3X A;  3N9M A;  1SBD A;  4ITC A;  2XQR A;  5DAW A;  3UGH A;  1IS6 A;  4NIH A;  3OSD A;  1DDL A;  2QQI A;  3CZJ A;  4OZO A;  1RIT A;  3R6S A;  1UXZ A;  1NCQ A;  1GZT A;  3VZO A;  4IES A;  2E7Q A;  4KQ7 A;  4QXH A;  2R0F A;  3D3A A;  2DWR A;  5FKB A;  4FPC A;  3M2M A;  1OLM E;  4AI0 A;  2VE1 A;  4OZX A;  2DFB A;  2ZHM A;  1UY3 A;  3TEZ A;  1ZBA 2;  3U10 A;  1IS3 A;  2ZX2 A;  1YJK A;  3OBA A;  4PHZ A;  4HMZ A;  2VL4 A;  2CAV A;  1A78 A;  2JIJ A;  2RJK A;  4AZZ A;  1LJ7 A;  1TVG A;  2VOT A;  3R4U A;  2XBO 2;  1DGR N;  2AEZ A;  2YFU A;  4EZH A;  5JI7 A;  4IE5 A;  4QT6 A;  5C9A A;  1CAX A;  1OXC A;  4JQR A;  1TMF 3;  1UKG A;  1QJX 2;  5EZW A;  1ULC A;  1YEW A;  2XLG A;  3ACH A;  3ZFF C;  2ZHK A;  3J8F 2;  2ET1 A;  5FMC A;  3KCC A;  1C8M 2;  4GQ7 A;  1GV9 A;  4AAX A;  3B93 A;  4BLI A;  1YQC A;  3OEB A;  4Y3O A;  4GKY A;  3T3Y A;  5BNP B;  1OUS A;  4DUX A;  3RFR A;  4LJH A;  1D4M 1;  1VAM A;  3HQU A;  3UKV A;  3M7A A;  1AR6 3;  2GNM A;  2IFW A;  5C3Q A;  1KIT A;  2W47 A;  5HXM A;  4QQ2 A;  2YU2 A;  2ZBJ A;  2IUW A;  2D5F A;  4YVS B;  4D6R A;  2WKK A;  3SH4 A;  3ZN6 B;  4ES9 A;  1RUF 2;  2HKX A;  2I07 B;  2R1B A;  4RN5 A;  4QDQ A;  3RMY A;  3HN1 A;  2FCT A;  5A3P A;  5BYN A;  1CQ9 A;  4QHB A;  4XFC A;  4XF0 A;  3H0O A;  4S2F A;  4ZS2 A;  3WNX A;  1MS3 A;  2VO5 A;  3TNP B;  1W9Y A;  3UGF A;  4Y5T A;  5JSP A;  1RUI 1;  3VN4 A;  4N53 B;  1ASJ 1;  4ZZ8 A;  4P02 B;  1PZ7 A;  4CE8 A;  5KHI A;  2SLI A;  1LCL A;  2WT1 A;  2PYT A;  1OMI A;  2XJS A;  3IN9 A;  4XHX A;  3WV6 A;  4W8J A;  1B35 A;  1RUJ 2;  1ZYB A;  4NII A;  2X05 A;  4CP1 A;  3FFZ A;  1PO2 2;  2EF6 A;  2AGS A;  1SDW A;  5LRR A;  1OA2 A;  4NRM A;  4XZP A;  1O7F A;  4Y26 A;  2DTW A;  1H9P A;  1OVP A;  1G6N A;  3IMM A;  3NV4 A;  3JQX A;  1SCS A;  4HL0 A;  4LA3 A;  4Q4Y 2;  4YG0 A;  5F5A A;  4RR3 B;  2HH9 A;  4AI3 A;  5FUP A;  1YRZ A;  2R06 3;  4KNC A;  3GNE A;  4ZS3 A;  4FCA A;  1VJ2 A;  2JDU A;  4Q0P A;  3VV1 A;  3AMN A;  3PUI A;  3KGZ A;  2D3S A;  4FFI A;  4OFG A;  5FYB A;  5T3N A;  1WMD A;  4IV3 C;  2D44 A;  4P9W A;  5JWP A;  5CYY A;  2BFU L;  2GAL A;  1YWK A;  2IVI B;  4MGZ E;  1RUH 2;  4XDP A;  2P34 A;  4AVV A;  5FPA A;  4Y1X A;  1JZ6 A;  3V0B B;  1R1A 2;  2WLP A;  1AR7 2;  2YRO A;  1S0D A;  4N9H A;  4Y5S A;  5AFE A;  2ARE A;  4BK5 A;  4DXT A;  3APB A;  4IEX A;  1R08 3;  3M8L A;  1FV2 A;  3DEM A;  3S30 A;  3E6C C;  5AC9 1;  3HT1 A;  3POG A;  1KD7 A;  4BA6 A;  5C8W A;  5L7O A;  3ES4 A;  1TG7 A;  4XIL A;  5GLT A;  1W8U A;  2XXZ A;  3GZA A;  3U14 A;  5F7U A;  1JYI A;  2A70 A;  3T0B A;  1FPN 3;  3WG4 A;  4R8H A;  2KD7 A;  1NY7 1;  2Q1M A;  4R4X A;  1AR8 3;  1HRV 3;  4XUT A;  4YW5 A;  1O91 A;  5FR3 A;  4ET7 A;  3WD5 A;  5I8Y A;  3NJY A;  1LEC A;  1H30 A;  2NLR A;  4O7X A;  1RUG 1;  1S2B A;  3LSE A;  1HXS 3;  2VXJ A;  3H7J A;  4QX8 A;  3WDV A;  4EWA A;  1W0O A;  2RS3 2;  1DG6 A;  4Q0V A;  1MQT C;  3HNY M;  2Y33 A;  1DU3 D;  3K75 B;  4BIS A;  4E4S A;  1X82 A;  5E89 A;  2WUH A;  3WG3 A;  4OHW A;  1WLT A;  4A44 A;  2GC1 A;  3A0N A;  2Y0O A;  5C3R A;  1F35 A;  2RS5 1;  5FYY A;  1DFQ A;  5HV4 A;  5ABJ B;  5D8A B;  3SH5 A;  4AVA A;  3FE5 A;  1R09 2;  4DQA A;  3FWE A;  5JR7 B;  2BNN A;  1BCX A;  3VD3 A;  2DUQ A;  3ZM8 A;  1LU2 A;  3UGG A;  1CPM A;  2JJ6 A;  1HV0 A;  2VCC A;  5G04 L;  2GNB A;  4YFZ A;  1DGW X;  4AFB A;  3OUI A;  4WZC A;  4X6Q B;  1LES A;  4YW1 A;  1RHI 2;  4W6W A;  2PQS A;  1RYY A;  3RJ2 X;  1WKY A;  2JDZ A;  5FKC A;  2DVD A;  4AWD A;  4WM7 C;  4CCE A;  4GH4 A;  1KS4 A;  3K46 A;  4IGP A;  4KWJ A;  2Q1F A;  2RR1 3;  2WL1 A;  4OMC A;  4JQT A;  2IZW A;  5LBC A;  3RDI A;  2ZEY A;  1KRI A;  2W95 A;  1AVB A;  3M3I A;  1XQN A;  2QVS B;  2W91 A;  5FO7 B;  1IOA A;  1K3I A;  4AFM A;  3EMR A;  3SLI A;  5EV7 A;  1AR8 1;  3M3C A;  3BIW E;  3ZFF B;  1XRU A;  1CPN A;  3ON7 A;  1RXG A;  5J48 A;  1FNZ A;  4CEW C;  2DCJ A;  2HYX A;  4FFG A;  3AL5 A;  1MZ5 A;  4LBQ B;  3POW A;  1NLQ A;  2XWJ B;  1HXS 1;  1C3H A;  2XVG A;  4OYU A;  5JOY A;  3G6J B;  3ZOI A;  3BTX A;  1R1Z A;  3RYK A;  5J37 A;  4KGQ A;  3RZL A;  1KQR A;  1XND A;  3AXD A;  3PTR B;  3N7M A;  3RGB A;  1YNA A;  4RHV 3;  2ZMN A;  2XQX A;  5I0D A;  3H8R A;  4ERO A;  2ETE A;  3VLB B;  3DEC A;  4Q4W 1;  3PDQ A;  4YLZ A;  2P3J A;  1SAC A;  3WW1 A;  4IEP A;  3B94 A;  2C6S A;  2Y8K A;  3USU B;  2D7F A;  4AED B;  1NOV A;  2HLE A;  2XWB B;  1I6X A;  2IXL A;  4MOA A;  4RS5 B;  4RQP A;  1OUX A;  4I30 A;  4PDW A;  3T2Q A;  1URX A;  1OA4 A;  3T0D A;  4IEZ A;  4DMI A;  1TME 3;  2PAK A;  5FJK A;  5FYU A;  5GM0 A;  3IWZ A;  4CCK A;  2LTN A;  4AHX A;  1GP5 A;  5CFC A;  4OHY A;  4HG6 B;  2YG0 A;  5HCF A;  3RZM A;  1V6J A;  1Q8S A;  2DVG A;  2JKX A;  2PMW B;  2R04 2;  3B7M A;  3EBR A;  3LIG A;  3R4S A;  4KU8 A;  1YLL A;  2C5D A;  3J7N A;  1CAU A;  4XJW A;  3ZFE B;  4BXS V;  1PM4 A;  3IT8 A;  2HWF 2;  4PT6 A;  1HQN A;  1SLL A;  2FHR A;  3S6P A;  3LDK A;  3V65 A;  2CWS A;  1V00 A;  1H6X A;  2OX0 A;  4Q4X 2;  3C7G A;  2RM2 1;  3TN9 1;  4ZY9 A;  1SFP A;  1O4Y A;  4U2A A;  5A7Q A;  4JGY C;  1BEV 1;  1UWW A;  1XJA A;  1QNW A;  5CNA A;  1VBA 3;  2HWB 2;  4AVT A;  2SBA A;  1G9B A;  5FIX A;  2WBK A;  4P9L A;  4A2U A;  2VXR A;  4WM8 A;  2FDG A;  1UX7 A;  4GD4 A;  4C8D A;  3BTA A;  1WMF A;  2VH9 A;  3KQ4 B;  1ULP A;  1R64 A;  4BMB A;  1RXF A;  1NCQ C;  3FUO A;  1MVE A;  2G9Z A;  1W2A X;  1SMV A;  3AL6 A;  3MIB A;  5K0U B;  2XML A;  5FYS A;  2VZU A;  3ME2 A;  1D7P M;  1QU0 A;  1WZX A;  2Q5T A;  3KS7 A;  1JXN A;  1KS5 A;  3PL0 A;  5CKM A;  5AVP A;  1G8W A;  2BYV E;  5FYM A;  4I2O A;  4LBM A;  1Y43 B;  4MO3 M;  4LBQ D;  4NJ4 A;  4BB3 A;  2WAA A;  5FLJ A;  1OVS A;  3N9L A;  5DUW A;  2MEV 3;  4CU8 A;  5CEH A;  1PGL 1;  1WD4 A;  4XMI A;  1OT5 A;  3L2H A;  2ERF A;  3IM0 A;  4U36 A;  1QJU 1;  1G9C A;  3LPF A;  4BCU A;  3WLU A;  5C9A C;  3IDB B;  4LMF A;  1RUE 3;  1SLC A;  1FNY A;  2D6P A;  3CHX A;  2FMY A;  4B7E A;  4CUG A;  1UOG A;  2IXJ A;  2ZEW A;  3WNO A;  4G4F A;  3ZYJ B;  1AYN 2;  3AP7 A;  4DY5 A;  5FMD A;  2CGO A;  3BOP A;  3IKW A;  4NHM A;  5DQ0 A;  1W6P A;  2OS2 A;  4P9I A;  4XQW A;  1COV 3;  4CYD A;  3AKT A;  3UT0 A;  1DQ5 A;  2UWA A;  1AJK A;  4OCT A;  5F6K A;  4GWM A;  5KHH A;  1VAK A;  3CJI B;  3FZ3 A;  4HZF A;  2GH8 A;  2W1W A;  3IMN A;  2ZHN A;  4P00 B;  1IKP A;  1VBA 1;  4LTA A;  3ZFG B;  2KXL A;  4IEW A;  1V6L A;  3KV4 A;  4URT A;  5LBB A;  3RZJ A;  1B09 A;  1ST8 A;  3VGI A;  2XUE A;  1WCK A;  4I02 A;  4RSU A;  3RPQ A;  4EN8 B;  2VZO A;  1WBL A; 
#chains in the Genus database with same CATH homology
 2Y64 A;  4P08 A;  4D8M A;  2QQO A;  2VZT A;  4KI5 M;  1XNT A;  3I3B A;  1ULO A;  2YC2 A;  2W1Q A;  4DEV A;  4W4Z A;  2V4V A;  4AG4 A;  3SKV A;  1UY1 A;  4BDV B;  1YQ2 A;  4ARY A;  1JYV A;  5IYY A;  2C26 A;  3UNP A;  3C7H A;  3ECQ A;  1O8P A;  1JYN A;  2YB7 A;  1NAE A;  2DCK A;  3OGV A;  4P5Y A;  3MBW A;  4CU9 A;  3III A;  5IFP A;  4LHS A;  4M4R A;  1GMM A;  2VZV A;  2EIB A;  2Y6H A;  2Y6L A;  2WAO A;  1PMJ X;  2E31 A;  2WZE A;  3WF1 A;  2J1S A;  3HN3 A;  5LCW L;  4OMD A;  2J22 A;  2W92 A;  3A7Q A;  3WF3 A;  1EUU A;  3AC0 A;  4ZZ5 A;  3K4A A;  2WAB A;  2ZEZ A;  2LW8 A;  2JD9 A;  3LEK A;  5HPO A;  2WYS A;  4IUG A;  1UZ0 A;  1T2X A;  4DUV A;  2C4X A;  2J1U A;  3FHQ A;  3NRU A;  2ORZ A;  2EIC A;  2W94 A;  2WO2 A;  1CIY A;  1WCQ A;  3I2I A;  3OG2 A;  4UI9 L;  1DYO A;  3C8X A;  3VD7 A;  3HOB A;  4DUW A;  4RYD A;  2BBA A;  1UY2 A;  3IAP A;  1US3 A;  3VD4 A;  2VZP A;  2QQK A;  2VQU A;  3THC A;  3THD A;  3MUZ 1;  3ACI A;  2J1T A;  4JKL A;  1JZ3 A;  2VJX A;  4W50 A;  3WF0 A;  3I2F A;  3CZU A;  3K4Z A;  1K12 A;  3GM8 A;  4BK4 A;  3BGA A;  4CU6 A;  2WDB A;  2VCA A;  1GOH A;  2WN2 A;  3C7F A;  1JHJ A;  3LPG A;  4QX3 A;  2E26 A;  3CMG A;  1KEX A;  3F2Z A;  2VMF A;  4OUE A;  4UOJ A;  1EUT A;  1GQP A;  5JMO A;  3WNP A;  1JZ7 A;  3A21 A;  3OEA A;  1UXX X;  4JHZ A;  4TXW A;  3SKJ E;  3K4D A;  3WNM A;  1GNY A;  2ID4 A;  3LQC A;  2EIE A;  3MV0 1;  4GZ9 A;  3K77 A;  3WSO A;  3MO4 A;  3LEG A;  4A45 A;  1JZ8 A;  5C70 A;  2WO1 A;  1OF3 A;  2WZ8 A;  2BER A;  2W1U A;  4A41 A;  4CU7 A;  4MGQ A;  3I2J A;  2QQN A;  5A1A A;  2W1S A;  2JDA A;  3A22 A;  5B4X A;  2W87 A;  5JXI A;  2W9X A;  4ZXE A;  4CUC A;  3I3E A;  3E1F 1;  1W9S A;  2WO3 A;  4DEQ A;  2E33 A;  3I97 A;  4A6O A;  1UYY A;  3U37 A;  2V5D A;  4M4P A;  5LA2 A;  5C71 A;  2VM9 A;  1CX1 A;  3CIH A;  2QQL A;  1OH4 A;  1O8S A;  3CDZ B;  3NNG A;  3EYP A;  1W8O A;  2XHN A;  3IAQ A;  3MUY 1;  3SEP A;  1NX9 A;  3MV1 1;  4DXR A;  3P1I A;  2RV9 A;  2QQI A;  3CZJ A;  4XUN A;  4OZO A;  1MPX A;  5JXJ A;  1UXZ A;  2BGP A;  4XUP A;  3VDC A;  4Z2A A;  3D3A A;  4JX0 A;  4FI9 A;  5IFT A;  1XPW A;  1UY3 A;  1UYZ A;  2VR4 A;  4QDS A;  3OBA A;  2VL4 A;  1P8J A;  2VOT A;  1TVG A;  2YFU A;  1GOF A;  3GXU A;  1JZ2 A;  5LA1 A;  3I2H A;  4CUA A;  1JZ5 A;  1F4A A;  3ACH A;  5EJ1 B;  5JXG A;  2V72 A;  3I2G A;  4GWI A;  4QB2 A;  4AAX A;  4JKK A;  3OEB A;  3EB7 A;  4DUX A;  5EJZ B;  2W47 A;  4A4A A;  5HXM A;  2VZR A;  4CVU A;  1O59 A;  1UMH A;  3C7E A;  3LEI A;  3A23 A;  1CZT A;  2YFZ A;  2QQJ A;  1I5P A;  3GGL A;  3BN6 A;  3DYO A;  4QDQ A;  1K45 A;  4RN5 A;  1JI6 A;  1W9T A;  1W9W A;  1DP0 A;  2XON A;  2R7E B;  1SG3 A;  2VO5 A;  2YC4 A;  3OGR A;  1US2 A;  3P6B A;  4ZZ8 A;  4P02 B;  2WN3 A;  2ORX A;  3WF2 A;  1L7R A;  2DDU A;  1IQD C;  2VCB A;  4W8J A;  2X05 A;  1JU3 A;  2W5F A;  2ZEX A;  3JXS A;  2Z4F A;  2B9V A;  4UAP A;  1XNA A;  2VZ3 A;  3WNL A;  4XUO A;  3PUI A;  1H6Y A;  4MAD A;  5CYY A;  4QDR A;  1JZ6 A;  3C7O A;  3I2K A;  3T2O A;  4PF1 A;  5EIY B;  5JUV A;  4BK5 A;  5LA0 A;  4DXT A;  5J1X A;  3VDA A;  2VZS A;  1F4H A;  2E32 A;  1XC6 A;  1GOG A;  3VD5 A;  2VZ1 A;  1TG7 A;  2J7M A;  3FN9 A;  5F7U A;  2ZXQ A;  3T0B A;  2KD7 A;  2VQT A;  4XUT A;  4XUQ A;  1PX4 A;  4TTG A;  4ET7 A;  3W5M A;  1SHW B;  5B4N A;  2WQ8 A;  4LPL A;  2X10 A;  1NKG A;  3WEZ A;  3WNN A;  2LS6 A;  1UY4 A;  5JR2 A;  3HNY M;  4QX0 A;  2VMC A;  3K75 B;  2WUH A;  3HJR A;  4GWJ A;  4A44 A;  3WF4 A;  4CUB A;  2OKX A;  1CZV A;  3HNB M;  1BHG A;  2QBX A;  3VD9 A;  2RJ2 A;  4LQR A;  2EID A;  3VD3 A;  3OGS A;  1W8N A;  4XUR A;  3ZM8 A;  1SDD B;  2VZQ A;  2VCC A;  5G04 L;  2QQM A;  2PQS A;  1RYY A;  1WKY A;  3OB8 A;  4QAW A;  1JZ4 A;  2RVA A;  2Y6J A;  3LE0 A;  4JKM A;  3HNM A;  3K46 A;  1PX3 A;  2XOM A;  3WNK A;  2BGO A;  3W5N A;  2J1A A;  3HEI A;  4OMC A;  3CKH A;  2BZD A;  4QX1 A;  2ZEY A;  4E8D A;  3T09 A;  2W95 A;  4QX2 A;  2X09 A;  1UY0 A;  4A42 A;  2W91 A;  3NQH A;  4XVH A;  1K3I A;  1K42 A;  2W3J A;  3FHA A;  3IB3 A;  2DCJ A;  2HYX A;  4KMQ A;  3FL7 A;  1JYW A;  4OYU A;  5IJR A;  4YPJ A;  2XQX A;  5I0D A;  3DEC A;  3NJX A;  5DMY A;  3UES A;  2VME A;  2Y8K A;  3GDB A;  2J1E A;  2VTF A;  2HLE A;  1JU4 A;  4MOA A;  1KGY A;  3T2Q A;  3T0D A;  3J7H A;  3ACF A;  4QB6 A;  4E8C A;  5IHR A;  4QB1 A;  1UYX A;  4HG6 B;  2VMD A;  2YG0 A;  2CDO A;  1OD3 A;  3T08 A;  2JKX A;  4A3Z A;  1JYX A;  4BXS V;  4PT6 A;  5FUI A;  4BJ0 A;  3CQO A;  1H6X A;  3C7G A;  4ARX A;  5CZK A;  4ZY9 A;  3HPN A;  4QPW A;  1UWW A;  1NUK A;  2WBK A;  3ABZ A;  1UX7 A;  2L9L A;  3T2P A;  2J1R A;  1ULP A;  1R64 A;  2CDP A;  3UET A;  5G05 L;  3VDB A;  2JE8 A;  1GUI A;  2VZU A;  1D7P M;  2Y6K A;  1W0N A;  2C9K A;  5DN2 A;  2W46 A;  1HN1 A;  5DPN A;  4MO3 M;  2WAA A;  1OF4 A;  4CU8 A;  3I3D A;  1OT5 A;  3T0A A;  1PMH X;  3LPF A;  2J1V A;  5JXH A;  4KWU A;  1LNS A;  2Y6G A;  3PUH A;  1UMI A;  2ZEW A;  3WNO A;  2VC9 A;  3IDA A;  5DQ0 A;  1CZS A;  3ACG A;  4PQQ A;  3SEE A;  3ETP A;  3DYP A;  1GU3 A;  4DXS A;  2W1W A;  4P00 B;  1L7Q A;  5C7G A;  3DYM A;  4MGS A;  3NJV A;  3WQB A;  4XZU G;  4LKS A;  1J83 A;  1J84 A;  1DLC A;  4D0Q A;  4L0P A;  2B4K A;  2VZO A;  1W99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...