3SENA

Structure of caskin1 tandem sams
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
b'KSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
molecule tags Signaling protein
source organism Homo sapiens
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA01
2YTUA 1X40A 5L1MA 1LKYA 5J8YC 1SXDA 2L5YA 1COKA 2JV3A 4RQNA 5JU5A 2DKXA 3BS5A 2DKZA 5JTIA 1UQVA 1OW5A 2K60A 2K4PA 2F44A 1PK1B 3TADA 1OXJA 2KSOA 3KKAA 4PZOA 2EAPA 1SV4A 1JI7A 2B6GA 1B4FA 3IDWA 3H8MA 5J8YA 3KKAC 3K1RB 2E8MA 1V85A 2Y9UA 2DL0A 1X66A 2Y9TA 4NL9A 2D3DA 2QB0A 1PK1A 5JRTA 3HILA 2QB0B 4NJ8A 3SEIA 4MHVA 1RG6A 5KNIA 1PK3A 1SV0A 2QKQA 2D8CA 4RQMA 1LKYB 1B0XA 2FE9A 2KSOB 2F8KA 2LPEA 2E8OA 2LMRA 1SV0C 2QARB 1SGGA 3BQ7A 1X9XA 1WWUA 2KIVA 2QB1A 2ES6A 3BS7A 4NL9C 1F0MA 3BS5B 2KMDA 5F3XB 2ESEA 2KG5A 2EAMA 1DXSA 1KW4A 2F3NA 1UCVA 1Z1VA 2EANA 2EAOA 3TADC 3TACB 3SENA 2QARA 4PZNA 2GLEA 1V38A 1SXEA 2E8PA 4IS7A 1WWVA 2E8NA 2KE7A
chains in the Genus database with same CATH superfamily
1LKYA 5B5EU 4F4KA 4RQNA 5G5GA 5KFNA 9ICPA 2MSNA 3V6HA 2C2RA 5J2CA 4O0IA 1ZQGA 2XY6A 1OW5A 4ECYA 2V4QA 2WB1F 4F4YA 2YX8A 4UASA 3GIJA 4TURA 1SB3C 3IN5A 5AI6A 3GDXA 3KFUF 2ZIUA 2HHXA 1JI7A 8ICQA 1TE2A 2YB1A 1DOQA 3UQ0A 3KTQA 5BOMA 5AM4A 4DCCA 3GIIA 5KAFU 4RQ6A 4FZNA 4J9QA 3FC4A 4PHEA 4IRCA 3QU2A 1RZTA 4RQ7A 5IIJA 4UAWA 4OCZA 3ZDAA 1S0OA 2HHVA 3RBDA 4NJ8A 5J2KA 1U45A 1QLNA 4KLSA 3CYMA 2PFPA 1SWVA 2DQNB 4RQMA 4YXJA 3QX7A 3IV6A 2VJ4A 4P4MA 3ALRA 4YCXA 1ZQJA 4KLOA 1F44A 4X5VA 5L9XA 4I2HA 1RDFA 1HIWA 3E58A 2WF9A 4B9LA 4DQPA 1TAUA 1RQNA 1LV5A 2VA3A 2KG5A 2EAMA 2WF6A 2A1AA 4JMUA 5CRXA 5F9NA 3AQEA 4QZHA 1RYUA 2K8BB 2E5SA 3AM9A 1JIHA 2KE7A 4R8UB 3EPGA 1N63A 5KFAA 3BQ1A 3SI8A 2JHDA 1K1SA 2KFZA 5JU5A 1ZQTA 3ORYA 5L1LA 2W3RA 2RRDA 2G08A 3SV4A 2R8JA 2KHVA 4DQRA 1XU4A 4J9OA 3NVVA 5EWEA 2C28A 5ALPA 4FBUA 3RAXA 3L3FX 3JPRA 5DG7A 3M6ZA 5KG6A 3H8SA 1U48A 1QTMA 2W54A 1NK5A 1B4FA 3GZFA 3H8MA 3PSTA 4FS1A 2V9WA 4DSLA 1L8OA 4TUQA 3EZ5A 4QZAA 4OO1J 2HVIA 2BGWA 2WF8A 1ZETA 5AKIA 3RH6A 4BDPA 1X6JA 2N1RA 9ICEA 3OHAA 3RJGA 1SIJA 4EZ9A 2KSOB 5J0WA 8ICOA 2YB4A 4R66A 2UVWA 1MSWD 4US8A 2KICA 1HUOA 3MR6A 1WYGA 2HCFA 1S0NA 1NZBA 3RH5A 9ICAA 4PJ0U 3SAHA 1ZQHA 3AU6A 4IR1A 4NL9C 2ASJA 4OD0A 2EZYA 2W9BB 2F1JA 1ZJNA 3T5JA 4P2HA 5DB9A 4CRXA 1WCNA 4EENA 3MR2A 4Z6CA 4F8RA 5DQHA 2XC9A 4DSKA 2W9AA 2BCSA 3C2MA 2XY5A 1RPLA 4QNLA 4YQWA 1ZQFA 2BCRA 1FIQA 5KG2A 3IG8A 2FPKA 2I6XA 1Q46A 3M1YA 5EWGA 2DF4B 7ICMA 4RQ3A 3KHRA 4DSIA 4PGYA 5ALRA 2DKZA 5KFPA 2FMPA 1UQVA 5AKYA 5J2GA 4B9MA 4I2IA 1COOA 4OJPA 2F44A 2PXIA 4YD1A 3ZDBA 2HMXA 2I1QA 4QIWF 5IIIA 4CF3A 2E1EA 2XO7A 2PI5A 3RJJA 4ECRA 5JUMA 9ICQA 8ICCA 2ZIVB 3LVVA 3RJKA 5K4LA 2E8MA 4M9GA 2K4IA 4I29A 4A8EA 1S97A 2Y1IA 4RQ2A 1ZJMA 4NL9A 5AM5A 3PR5B 2QB0A 1D8LA 1V97A 4MF8A 4DFJA 4XUSA 3C23A 3ZD9A 2O6KA 2KZZA 1KSPA 4EYIB 2NRXA 4Y2QA 5KL1B 2WHEA 5KT6A 7ICRA 2JH1A 4O5CA 5KFCA 4ECZA 2EZZA 4NLBA 2CPRA 4RNMA 2NRVA 4ED8A 2JZBA 9ICRA 3BQ7A 3SAGA 3PX0A 1BVSA 2FMSA 4QZCA 4M0AA 4US9A 5ALYA 3K4GA 4KMUA 4OJ6A 1J97A 4M9NA 4BWMA 3AEVA 3M7DA 5IILA 1L3SA 1MN8A 4PZNA 3N28A 5AKLA 3SYZA 5HHIA 3MC1A 2FMQA 3SD7A 3WKEA 2YMQA 3A0HU 2BPCA 4UBBA 2ZTEA 1SKRA 1ZQCA 4F92B 2BDPA 2HOQA 1H38A 1COKA 2ZJAA 3A0BU 1MC8A 2FLNA 1N56A 1Z1BA 2W9BA 3Q8KA 4UQGA 2K60A 4YMNA 2HSZA 5AM3A 2W43A 2ZIXA 5AIBA 9ICCA 2EAPA 2I5HA 2ZJ8A 4JWNA 3TARA 3FDSA 5H2FU 4PGXA 1UPHA 5EE9A 3C1ZA 1HUZA 3EW9A 4Y2TA 2IOHA 2W03A 4MEYA 4B9VA 4DF4A 3MR3A 2G0AA 8ICNA 3PX4A 1N5WA 4ELUA 3IRUA 3QUQA 2HOIA 1JN3A 1XNSA 4NY8A 1D9FA 3MABA 3K1ZA 1V9PA 2ZTCA 5DG9A 1KFTA 1PK3A 2A1JA 8ICMA 4P0PB 8ICWA 8ICFA 3LDAA 4KLTA 1ZD2P 2AGOA 4B9TA 2LMRA 4I2BA 2AGQA 1CUKA 2ZTDA 2PMZF 5KFLA 1F0MA 2KJ9A 3HJEA 4PHDA 4NLKA 4FBTA 3HRDD 1Z1VA 2W7OA 2W55A 4EZ6A 3OJSA 1JALA 4QJFB 2GLEA 2GOLA 3RR7A 3QE9Y 1U9LA 1NJYA 5IIMA 3E0FA 4C8NA 7ICOA 5KAIU 4QWCA 3Q8PB 1QH9A 4ECWA 1NK0A 4O9MA 2C2DA 1L7PA 4DEZA 5CB1A 2HHTA 2JEGA 1L7MA 2H5XA 5HP4A 4I2EA 3H8JA 2J6UA 5GTIU 9ICLA 4RQ8A 2IA6A 3OHBA 2H3ZA 2AQ0A 1DK2A 5KFHA 4M6WB 4LZDA 2JRZA 5HR7A 1MQ2A 3GU3A 5ALEA 1Q8KA 2FPMA 8ICEA 5J0QA 4CNQA 4UAUA 5CR0A 4K4GA 1KFDA 5AI9A 5J0UA 2HBMA 4C4TA 5ALQA 4RZRA 1ZYQA 2QB0B 2BPFA 4GXIA 3V72A 1HEKA 4NLZA 4O3SA 5KFXA 2FPLA 1BGXT 3OTQA 5DQGA 4DO9A 1N62A 2MU2A 1UT8A 2F8KA 2VA8A 2ZIVA 2EQYA 4YR2A 5J2IA 5DLFA 2FJ6A 1SGGA 2ZUBA 3TQ1A 1IIPA 1JXEA 1WWUA 1S76D 3ETLA 2K8CB 2KV2A 4PH5A 4NM1A 3T5HA 2EAOA 1BNPA 1JROA 3UMBA 4RPXA 3UM9A 1A77A 1ZQIA 2E8PA 1PZNA 2DPJA 1LVHA 1N61A 9ICMA 3C5GA 3F5EA 5ALLA 5HNKA 3T5KA 1SKWA 5L1MA 4ECXA 5FP0A 1TVAA 4FO6A 1NZPA 3NRZA 5ALIA 4J9PA 5AK6A 4RQ4A 4HAIA 5D4BA 4ACOA 5D46A 1ZD4A 2KOBA 1Q3UA 4FZLA 1HJPA 4B9NA 4YN4A 3QUCA 4I28A 3OPXA 1CRXA 3MDAA 2YY6A 3RJIA 5AKXA 4EX6A 1UT5A 1FO4A 5J29A 3B0YA 4QWDA 4O5EA 4EYHB 5AHXA 1N5XA 5C0YA 4MF2A 4J9RA 2Q0ZX 9ICNA 5KT5A 7ICVA 5AIAA 1BPDA 2G06A 3G6XA 2VKQA 2D3DA 1ZQWA 5AKKA 5KG4A 2PMZC 2BR0A 4OJLA 5EE3A 5KNIA 3RR8A 4UB2A 3QUTA 1GO3F 4FZMA 1ZQBA 1ZQNA 1ZQSA 3I76A 2GO7A 2LPEA 1OUQA 2NRZA 3GIKA 1SV0C 4JK1A 5KFVA 3TANA 4MFFA 3GV5B 3L4PA 3D2QA 4PL2A 4DF8A 4C8KA 2P66A 1WG8A 4ED2A 3JPTA 1UA1A 3QZ7A 3SAFA 4BUGA 1L7NA 4UB3A 3NVZA 1TFRA 3TACB 2A1JB 1S0VA 5ALHA 3LK9A 1S0MA 3RB3A 2Q4TA 2OWOA 2KP7A 4ELVA 2W8LA 2FDRA 1KL9A 3N7PD 4DL6A 4YR0A 1ZQKA 1JX4A 1SXDA 5EOZA 2R8HA 3QZ8A 4Y2JA 2XY7A 1M6YA 8ICUA 2B0CA 4ECSA 2HVHA 4Z6EA 1CEZA 1PK1B 5KT3A 3H7IA 2ZIUB 3KZXA 1ZQYA 5ALUA 2ZXIA 4KITB 5J2HA 4UAVA 4I2GA 4R63A 3GILA 4PGQA 1S10A 2AGPA 5DLGA 3K1RB 5J2JA 1L3VA 2BQ3A 4CF5A 1K1QA 3BZCA 2KZ3A 3ISDA 1VDVA 1PVRA 3N7RC 2Y1JA 4B9SA 4F50A 4ED0A 2AHOB 3JPSA 5ALVA 5CP2A 4YR3A 5KFZA 4MFCA 3QEAZ 4FE3A 4DL2A 2A3VA 5KFUA 2LYBA 4EBDA 2ZG6A 4UW9A 2AXTU 8ICRA 2BCUA 2KIWA 2ODGA 3GQCA 1S77D 1XWLA 2C2EA 2R8IA 2WTFA 3NUQA 2KMDA 2IOFA 5F3XB 3RRGA 3NVWA 4IQTA 3CNHA 4Q8FA 2W9MA 2KKVA 4KLFA 4UAZA 1ZQMA 4UB6U 2QARA 4RT3A 1SXEA 2RDJA 1SZPA 3H40A 5DBCA 2BPGA 9ICJA 1B22A 3R9KA 3GIMA 2LYHA 3CW2C 3LYSA 2XGQA 3PW7A 1TK0A 2NO4A 3F2BA 3HKZC 1UA0A 1X9SA 1L3TA 1JUDA 4XRHA 3L5KA 5TISU 1N2XA 5KFEA 3AQFA 1SKSA 3KZIU 3TADA 4C8LA 5DG8A 2OYYA 5KFWA 2OH2A 4QZGA 4PZOA 2PKEA 7ICLA 5HR6A 1VLBA 2WAQF 8ICJA 2K4EA 4CDGA 3ZDCA 1XO0A 2ASDA 2JEFA 2Y0SF 4TUSA 2F76X 3OGUA 1X2IA 1V85A 4IC9A 3BZKA 1KFSA 2LKYA 3F2DA 5ALTA 3H0MB 2XICA 4XQ8A 5DKWA 4DFKA 4Y2PA 3WKBA 2ZUDA 5DB8A 2ATLA 3PX6A 3N97B 3Q8LA 4DWIA 3RH4A 4BXOB 3UXOA 3F2CA 1U47A 1S8OA 3PY8A 4M6WA 1QQ5A 1AQ6A 7ICHA 3ZDDA 4F93B 4RPZA 1WCLA 5KG3A 5CJ7A 2KFNA 2ALZA 4Y2VA 3THVA 3EUB2 4M47A 1A76A 3D2SA 5F9LA 4NWIA 3M8SA 2WF5A 4RUAA 2UVVA 4ED1A 1ZQZA 5CWRA 3TADC 3CP8A 3IHQB 2ZIXB 3Q8RB 1N48A 4R8UA 2DBYA 4ZH4A 4QZEA 2BQRA 2BHNA 3HPOA 1U4BA 8ICPA 3PSIA 4IRDA 5B66U 1QSLA 1RYRA 8ICLA 4WJ3B 4ECUA 2GH1A 3OJUA 9ICWA 1BNOA 2R18A 4EX7A 3BS5A 2KEYA 2YMLA 3PW4A 2MA1A 4GXKA 3PSPA 3LWMA 2F77X 5DGBA 1OXJA 4G9BA 1T3QA 5ALXA 8ICKA 2E3TA 1SV4A 4P0PA 2JMGA 1Z4NA 4F4XA 1O08A 1MA7A 2AQ4A 1O03A 3ED5A 1S9FA 5AKZA 1ZQUA 3NRWA 2XI9A 1DRGA 7ICTA 1NNLA 1T8EA 3QU7A 5KT4A 4DQIA 3O0FA 4UB4A 1IG6A 2J6SA 4J9KA 3BDPA 3UMGA 3PZPA 3MR5A 2IMWP 1SV0A 4UATA 1Y88A 4ED7A 1NK8A 3VCBA 1T7PA 2RHFA 5J0YA 1A0PA 1L5UA 4R65A 2KK0A 4RQ5A 4F91B 1T4GA 3TAQA 4P0QB 1SWWA 2R8KA 3V7LA 4ELTA 3N4MB 3JPPA 3MFIA 2QARB 5HMLA 5AKHA 4QWBA 2WF7A 4YD2A 3MFHA 4DFPA 3H4DA 2EZXA 1BPZA 5ALKA 4Q44A 5AK4A 2XCAA 4AYBC 4DSFA 7ICKA 4JWMA 4DSJA 7ICNA 4R64A 1V38A 5BOLA 2XCPA 5ALMA 5IIOA 1XS9D 4C8OA 7ICJA 3NVYA 3ISBA 4LVSA 5EWFA 5KTQA 3BJYA 2VA2A 4NV0A 4LZGA 4KLHA 3WK5A 2WAQC 3ISCA 5E79U 5BPCA 5KFBA 3GV7B 2Y0SC 2AH5A 5AKJA 2ISOA 3ZDEA 5KFMA 4DLEA 1SL0A 3SQIA 4CGZA 2K4HA 3MGHA 3QU9A 2KNJA 4GC7A 5AICA 4BGDA 3EYZA 1QSYA 5KFSA 4U7CA 4DSEA 4MEXA 4KLJA 1SL2A 1VJ5A 5KG7A 3RB6A 3HILA 8ICYA 1D8YA 5DGAA 2A19A 5KFJA 2VANA 4QZDA 3RF9A 3AN1A 3ETRA 5EE1A 1DGSA 4BXOA 1LKYB 1PUZA 4UB8U 1PVQA 3PO4A 1B0XA 4UAYA 4QWEA 2IHMA 4DL5A 5KT7A 5AK5A 4KX5A 4E0DA 4DL4A 5ALFA 2HHWA 3RRHA 5CEHA 5DB6A 4UARA 1P7DA 4TQSA 3KHGA 1ZRNA 4BJQA 5A0LA 4Q43A 4CF4A 4YFKA 2NRTA 2CXYA 1IV8A 4P4OA 1NJWA 2GWSA 3SMVA 4UBCA 5KT2A 3B9JA 1LB2B 8ICIA 1ZQEA 9ICIA 2AU0A 1U49A 1ZD5A 4M2YA 3AU2A 4CE6A 2L5YA 3PVXA 2JV3A 5L1JA 4Z6DA 4RUCA 4C4RA 1TK8A 3PSFA 2HW3A 3Q8QB 4NLNA 4F5RA 1TAQA 4YVZA 3C1YA 2YN4A 3Q8SB 3PO5A 2H3IA 4DFMA 4AP9A 4Q8EA 1UHUA 2EH9A 4Y2XA 5KFIA 3NS1A 3TFRA 4KLQA 3AL0B 3C29A 7ICGA 1NJXA 3H0LB 5GTHU 4DS4A 8ICSA 2OHFA 2VIXA 4F5PA 4GIBA 1Z00A 3G6VA 2CRXA 1B43A 1L8LA 5AKEA 1ZXIA 2ZJ5A 7ICFA 1ZD3A 2HHQA 3WKDA 5CA7A 2DL0A 9ICSA 3HKZF 2KJ8A 2HI0A 2Y9TA 4C80A 1FEZA 2E1FA 4GC6A 7ICQA 2I9GA 2YQEA 3SR6A 1BPBA 2JGAA 1BPYA 3IM1A 2MUTA 4ED6A 3SEIA 4KMOB 2JEJA 2W9CB 5AI5A 2RDIA 2DWQA 2G09A 2P6UA 3M9NB 2E8OA 4IQVA 1AROP 9ICUA 2PI4A 4O3MA 3GV8B 2DUYA 2DGZA 1KDHA 3TI0A 4PPXA 4ICAA 2QB1A 2YMPA 3HW8A 3OSNA 2KD1A 1ZOLA 7ICPA 3ICXA 3PNCA 4RPYA 1KW4A 3ONNA 1UCVA 1SL1A 2IBKA 3JPOA 9ICFA 5IINA 3UPQA 4O3QA 3PW0A 2UVUA 4U6PA 1WWVA 4IQUA 2DPIA 2FLPA 3H0RB 4J9NA 2E8NA 4P0QA 3C2KA 1X40A 3WK4A 5J8YC 1IM4A 3RFAA 4DQSA 1X9MA 3QNMA 5JTIA 3UMCA 1NKBA 3RTVA 4C0ZA 5J0PA 2H3FA 2F1IA 2KSOA 3U26A 4QWAA 1NOMA 5T14A 3KKAA 2H3QA 3V6KA 2RQ5A 5KG0A 7ICSA 1ZQPA 3NTUA 2M0NA 2BQUA 1ZQDA 4KLLA 9ICHA 1KLNA 5ALNA 2FLLA 1NKCA 4KLUA 4ECQA 7ICEA 5ALWA 4O5KA 4PL1A 4NLGA 3UQ2A 1NKEA 3Q8MA 3WKCA 5G5HA 5KG1A 3AUOA 1N60A 7ICUA 4KN4A 5ALJA 4J9MA 3RJHA 4USAA 8ICTA 1BPXA 4FS2A 2FI1A 3G6YA 1NK6A 1KEJA 2YMMA 2OCEA 3TAPA 3NGDA 5KL8B 3E2EA 4Y2YA 3KD3A 1X9XA 2KIVA 5J2BA 1C7YA 2W04A 3SZ2A 2IOFK 1D8BA 1QQ6A 5D49A 9ICGA 2W9CA 2F3NA 3V6JA 1XSPA 3ZD8A 8ICVA 3SENA 1TV9A 4ZOHC 4F2SA 4NXZA 2UVRA 1RM6C 2NRWA 1RQLA 5J0TA 2H3VA 3F53A 5AKGA 2QLTA 2JZBB 1YZ7A 1YT3A 3WK7A 4QZFA 3BQ0A 5ALGA 4DLGA 4O3NA 3HWTA 5AM2A 2EDUA 3NASA 3V7JA 5J0RA 2K4PA 1XC9A 4F72A 3ZI4A 2ZXHA 1J2MA 3M6KA 4C8MA 2DFLA 1NJZA 5DBAA 4MFAA 5J2DA 1ED1A 1KN5A 3KOOA 9ICXA 1T3NA 3WU2U 5KFKA 4IRKA 3HX0A 3PV8A 2AJQA 3BQ2A 2PFQA 4KLDA 2JEIA 2KKPA 2RLTA 2HOFA 5C5JA 3EWAA 5HHHA 2XGPA 1S5LU 3IG5A 2VJ5A 4FFDA 1F5SA 2HDOA 4KN7A 4TQRA 2BCQA 4DL3A 1ZQAA 1D9DA 1RG6A 3QXGA 4RQ1A 5L1IA 4KLGA 2QKQA 2OEHA 2D8CA 9ICVA 4ED3A 4QZ9A 3KHHA 4EELA 4JB3A 1Z00B 1KTQA 2WFAA 4F4ZA 5KFGA 1TKDA 2NV3A 5ALZA 4Y2UA 4O3OA 1YZ6A 2KN7A 3BS5B 2RP5A 3CRXA 1ZQXA 3M9OB 1FFVA 2MUTB 2EANA 5AI0A 2LBOA 1L3UA 4QZBA 2KHQA 4CCHA 3D6JA 4JV1A 4J9LA 2ZIWB 4IQWA 4O3RA 3PMNA 2MRLA 1KKXA 3VC8A 1DXSA 1KRPA 5KFOA 4OJOA 2YTUA 3LVWA 4DOBA 3BQTA 4YG2A 5L1KA 3M9MB 5J2EA 2XVTA 4AYBF 2K89A 2W3SA 3UXNA 2PFOA 4BWJA 5ALDA 3UXPA 2V4RA 3KBBA 4YP3A 2G5IB 3QU4A 2KJ5A 1EXNA 5AI8A 4RT2A 1NK4A 3WK8A 2OM6A 1FFUA 4RQ0A 3T79A 3V7KA 1IXRA 2LI6A 4M04A 4OJ5A 4Z6FA 1X9WA 1DGJA 2Y9UA 2BDUA 4PHAA 4J03A 5EE0A 4B6JA 1ZQ1C 5DBBA 5AI4A 5JRTA 2BCVA 3B0XA 3C2LA 4I2DA 5J0SA 4F2RA 4Y2RA 4I2FA 4RNNA 2KVSA 3HP6A 1QCKA 2C22A 4ECTA 4KLMA 4M9HA 3I28A 3AMZA 4J9SA 4B9UA 3WK6A 1TK5A 3PR4A 5KFYA 2JR5A 1XSLA 4YXMA 4KTQA 5KFTA 2ES6A 5AK3A 8ICBA 2G5HB 2ISPA 1NK9A 3FYHA 4JV2A 3RAQA 5J2AA 2KZMA 5AM1A 2IHNA 1KQQA 3K75D 3S6JA 1X6IA 5DQIA 3MGVA 3T3FA 4QZ8A 5AM0A 1A6SA 4ECVA 3RBEA 4EBEA 2BKEA 2R8GA 2ZIWA 4KX3A 4QIWC 3H4BA 4DOCA 2KTQA 3SV3A 4HYKA 3RJEA 3KHLA 2P35A 4DFDA 3MBYA 4NM2A 3QUBA 2LHTA 4EBCA 9ICOA 4I2JA 4DL7A 2ASLA 3WKAA 2JXJA 3DV9A 1RYSA 1TAMA 3OSPA 2G07A 3N7SC 2MAXA 4QW8A 4DS5A 5ALSA 4KLEA 5J8YA 1ZRMA 3KKAC 1PVPA 4C7YA 1SZHA 2WB1C 1URJA 2JH7A 1XSNA 2F2AB 4Q45A 3QYPA 3J81j 4C4SA 4GFJA 4YMMA 4F3OA 1ZQOA 2XIDA 5IIKA 3PMLA 4UB1A 1KBUA 2F8LA 9ICKA 1RXWA 8ICGA 5TZVA 2BZFA 1X42A 1JRPA 4YMOA 5KFDA 4QZIA 2NO5A 2FE9A 4F4WA 1Z19A 5HMMA 3TFSA 2F1HA 4KLIA 2CN1A 4QW9A 3FAHA 5CHGA 2OXOA 3IP4B 2HBKA 3BS7A 1Q3VA 3MGIA 4GLXA 4XA5A 4NLCA 1L7OA 2W7PA 1Z3EB 4RNOA 4M9LA 1DK3A 5DDYA 3QEBZ 1T94A 1RXVA 3TKAA 2NYVA 5J0OA 4IS7A 1WUDA 3DDHA 4K4HA 1JXLA 1C20A 3M8RA 1QQ7A 4O3PA 2J6TA 3C21A 1ZQVA 2LM4A 5J0XA 5J2FA 1Z4OA 1ZQQA 2DKXA 3FM9A 1ECWA 1JMSA 4JUZA 4I2AA 2HHSA 4BX9C 4I2CA 2HBJA 1XO1A 1BPEA 4LJXA 4F71A 3PW2A 3WK9A 1K5OA 4IL6U 2B6GA 1QSSA 1CI4A 4RU9A 4F5OA 3IDWA 2LM1A 3QU5A 2HBLA 3D2NA 2W8KA 4PHPA 1X66A 1MQ3A 8ICZA 3LWLA 4G3IA 8ICAA 4C7ZA 3RB4A 1PK1A 4P4PA 1J2NA 2HHUA 3PW5A 2Z7JA 4EEKA 4M9JA 3C5FA 3JPNA 4F5NA 4MHVA 4IR9A 5KFRA 4I27A 5KFFA 8ICHA 3T5LA 7ICIA 9ICTA 3F5AA 3JPQA 4GXJA 3MDCA 3H8WA 5DB7A 2ZUCA 2K8AA 1ZQLA 2W11A 3EPIA 3I1YA 3GFKB 5KG5A 1NI3A 3DEEA 3HT3A 2B21A 5ALOA 2D6FC 5DDMA 1NK7A 3RB0A 2M9NA 4JV0A 4Y2SA 9ICBA 2ESEA 2PFNA 5KFQA 4EEYA 3C28A 3RJFA 1ZQRA 4DOAA 2KVCA 4TUPA 4DQQA 2P6RA 4K4IA 1L6NA 4F5QA 8ICXA 2LYAA 4UB5A
chains in the Genus database with same CATH topology
2YTUA 1X40A 5L1MA 1LKYA 5J8YC 1SXDA 2L5YA 1COKA 2JV3A 4RQNA 5JU5A 2DKXA 3BS5A 2DKZA 5JTIA 1UQVA 1OW5A 2K60A 2K4PA 2F44A 1PK1B 3TADA 1OXJA 2KSOA 3KKAA 4PZOA 2EAPA 1SV4A 1JI7A 2B6GA 1B4FA 3IDWA 3H8MA 5J8YA 3KKAC 3K1RB 2E8MA 1V85A 2Y9UA 2DL0A 1X66A 2Y9TA 4NL9A 2D3DA 2QB0A 1PK1A 5JRTA 3HILA 2QB0B 4NJ8A 3SEIA 4MHVA 1RG6A 5KNIA 1PK3A 1SV0A 2QKQA 2D8CA 4RQMA 1LKYB 1B0XA 2FE9A 2KSOB 2F8KA 2LPEA 2E8OA 2LMRA 1SV0C 2QARB 1SGGA 3BQ7A 1X9XA 1WWUA 2KIVA 2QB1A 2ES6A 3BS7A 4NL9C 1F0MA 3BS5B 2KMDA 5F3XB 2ESEA 2KG5A 2EAMA 1DXSA 1KW4A 2F3NA 1UCVA 1Z1VA 2EANA 2EAOA 3TADC 3TACB 3SENA 2QARA 4PZNA 2GLEA 1V38A 1SXEA 2E8PA 4IS7A 1WWVA 2E8NA 2KE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTU A;  1X40 A;  5L1M A;  1LKY A;  5J8Y C;  1SXD A;  2L5Y A;  1COK A;  2JV3 A;  4RQN A;  5JU5 A;  2DKX A;  3BS5 A;  2DKZ A;  5JTI A;  1UQV A;  1OW5 A;  2K60 A;  2K4P A;  2F44 A;  1PK1 B;  3TAD A;  1OXJ A;  2KSO A;  3KKA A;  4PZO A;  2EAP A;  1SV4 A;  1JI7 A;  2B6G A;  1B4F A;  3IDW A;  3H8M A;  5J8Y A;  3KKA C;  3K1R B;  2E8M A;  1V85 A;  2Y9U A;  2DL0 A;  1X66 A;  2Y9T A;  4NL9 A;  2D3D A;  2QB0 A;  1PK1 A;  5JRT A;  3HIL A;  2QB0 B;  4NJ8 A;  3SEI A;  4MHV A;  1RG6 A;  5KNI A;  1PK3 A;  1SV0 A;  2QKQ A;  2D8C A;  4RQM A;  1LKY B;  1B0X A;  2FE9 A;  2KSO B;  2F8K A;  2LPE A;  2E8O A;  2LMR A;  1SV0 C;  2QAR B;  1SGG A;  3BQ7 A;  1X9X A;  1WWU A;  2KIV A;  2QB1 A;  2ES6 A;  3BS7 A;  4NL9 C;  1F0M A;  3BS5 B;  2KMD A;  5F3X B;  2ESE A;  2KG5 A;  2EAM A;  1DXS A;  1KW4 A;  2F3N A;  1UCV A;  1Z1V A;  2EAN A;  2EAO A;  3TAD C;  3TAC B;  3SEN A;  2QAR A;  4PZN A;  2GLE A;  1V38 A;  1SXE A;  2E8P A;  4IS7 A;  1WWV A;  2E8N A;  2KE7 A; 
#chains in the Genus database with same CATH topology
 1LKY A;  5B5E U;  4F4K A;  4RQN A;  5G5G A;  5KFN A;  9ICP A;  2MSN A;  3V6H A;  2C2R A;  5J2C A;  4O0I A;  1ZQG A;  2XY6 A;  1OW5 A;  4ECY A;  2V4Q A;  2WB1 F;  4F4Y A;  2YX8 A;  4UAS A;  3GIJ A;  4TUR A;  1SB3 C;  3IN5 A;  5AI6 A;  3GDX A;  3KFU F;  2ZIU A;  2HHX A;  1JI7 A;  8ICQ A;  1TE2 A;  2YB1 A;  1DOQ A;  3UQ0 A;  3KTQ A;  5BOM A;  5AM4 A;  4DCC A;  3GII A;  5KAF U;  4RQ6 A;  4FZN A;  4J9Q A;  3FC4 A;  4PHE A;  4IRC A;  3QU2 A;  1RZT A;  4RQ7 A;  5IIJ A;  4UAW A;  4OCZ A;  3ZDA A;  1S0O A;  2HHV A;  3RBD A;  4NJ8 A;  5J2K A;  1U45 A;  1QLN A;  4KLS A;  3CYM A;  2PFP A;  1SWV A;  2DQN B;  4RQM A;  4YXJ A;  3QX7 A;  3IV6 A;  2VJ4 A;  4P4M A;  3ALR A;  4YCX A;  1ZQJ A;  4KLO A;  1F44 A;  4X5V A;  5L9X A;  4I2H A;  1RDF A;  1HIW A;  3E58 A;  2WF9 A;  4B9L A;  4DQP A;  1TAU A;  1RQN A;  1LV5 A;  2VA3 A;  2KG5 A;  2EAM A;  2WF6 A;  2A1A A;  4JMU A;  5CRX A;  5F9N A;  3AQE A;  4QZH A;  1RYU A;  2K8B B;  2E5S A;  3AM9 A;  1JIH A;  2KE7 A;  4R8U B;  3EPG A;  1N63 A;  5KFA A;  3BQ1 A;  3SI8 A;  2JHD A;  1K1S A;  2KFZ A;  5JU5 A;  1ZQT A;  3ORY A;  5L1L A;  2W3R A;  2RRD A;  2G08 A;  3SV4 A;  2R8J A;  2KHV A;  4DQR A;  1XU4 A;  4J9O A;  3NVV A;  5EWE A;  2C28 A;  5ALP A;  4FBU A;  3RAX A;  3L3F X;  3JPR A;  5DG7 A;  3M6Z A;  5KG6 A;  3H8S A;  1U48 A;  1QTM A;  2W54 A;  1NK5 A;  1B4F A;  3GZF A;  3H8M A;  3PST A;  4FS1 A;  2V9W A;  4DSL A;  1L8O A;  4TUQ A;  3EZ5 A;  4QZA A;  4OO1 J;  2HVI A;  2BGW A;  2WF8 A;  1ZET A;  5AKI A;  3RH6 A;  4BDP A;  1X6J A;  2N1R A;  9ICE A;  3OHA A;  3RJG A;  1SIJ A;  4EZ9 A;  2KSO B;  5J0W A;  8ICO A;  2YB4 A;  4R66 A;  2UVW A;  1MSW D;  4US8 A;  2KIC A;  1HUO A;  3MR6 A;  1WYG A;  2HCF A;  1S0N A;  1NZB A;  3RH5 A;  9ICA A;  4PJ0 U;  3SAH A;  1ZQH A;  3AU6 A;  4IR1 A;  4NL9 C;  2ASJ A;  4OD0 A;  2EZY A;  2W9B B;  2F1J A;  1ZJN A;  3T5J A;  4P2H A;  5DB9 A;  4CRX A;  1WCN A;  4EEN A;  3MR2 A;  4Z6C A;  4F8R A;  5DQH A;  2XC9 A;  4DSK A;  2W9A A;  2BCS A;  3C2M A;  2XY5 A;  1RPL A;  4QNL A;  4YQW A;  1ZQF A;  2BCR A;  1FIQ A;  5KG2 A;  3IG8 A;  2FPK A;  2I6X A;  1Q46 A;  3M1Y A;  5EWG A;  2DF4 B;  7ICM A;  4RQ3 A;  3KHR A;  4DSI A;  4PGY A;  5ALR A;  2DKZ A;  5KFP A;  2FMP A;  1UQV A;  5AKY A;  5J2G A;  4B9M A;  4I2I A;  1COO A;  4OJP A;  2F44 A;  2PXI A;  4YD1 A;  3ZDB A;  2HMX A;  2I1Q A;  4QIW F;  5III A;  4CF3 A;  2E1E A;  2XO7 A;  2PI5 A;  3RJJ A;  4ECR A;  5JUM A;  9ICQ A;  8ICC A;  2ZIV B;  3LVV A;  3RJK A;  5K4L A;  2E8M A;  4M9G A;  2K4I A;  4I29 A;  4A8E A;  1S97 A;  2Y1I A;  4RQ2 A;  1ZJM A;  4NL9 A;  5AM5 A;  3PR5 B;  2QB0 A;  1D8L A;  1V97 A;  4MF8 A;  4DFJ A;  4XUS A;  3C23 A;  3ZD9 A;  2O6K A;  2KZZ A;  1KSP A;  4EYI B;  2NRX A;  4Y2Q A;  5KL1 B;  2WHE A;  5KT6 A;  7ICR A;  2JH1 A;  4O5C A;  5KFC A;  4ECZ A;  2EZZ A;  4NLB A;  2CPR A;  4RNM A;  2NRV A;  4ED8 A;  2JZB A;  9ICR A;  3BQ7 A;  3SAG A;  3PX0 A;  1BVS A;  2FMS A;  4QZC A;  4M0A A;  4US9 A;  5ALY A;  3K4G A;  4KMU A;  4OJ6 A;  1J97 A;  4M9N A;  4BWM A;  3AEV A;  3M7D A;  5IIL A;  1L3S A;  1MN8 A;  4PZN A;  3N28 A;  5AKL A;  3SYZ A;  5HHI A;  3MC1 A;  2FMQ A;  3SD7 A;  3WKE A;  2YMQ A;  3A0H U;  2BPC A;  4UBB A;  2ZTE A;  1SKR A;  1ZQC A;  4F92 B;  2BDP A;  2HOQ A;  1H38 A;  1COK A;  2ZJA A;  3A0B U;  1MC8 A;  2FLN A;  1N56 A;  1Z1B A;  2W9B A;  3Q8K A;  4UQG A;  2K60 A;  4YMN A;  2HSZ A;  5AM3 A;  2W43 A;  2ZIX A;  5AIB A;  9ICC A;  2EAP A;  2I5H A;  2ZJ8 A;  4JWN A;  3TAR A;  3FDS A;  5H2F U;  4PGX A;  1UPH A;  5EE9 A;  3C1Z A;  1HUZ A;  3EW9 A;  4Y2T A;  2IOH A;  2W03 A;  4MEY A;  4B9V A;  4DF4 A;  3MR3 A;  2G0A A;  8ICN A;  3PX4 A;  1N5W A;  4ELU A;  3IRU A;  3QUQ A;  2HOI A;  1JN3 A;  1XNS A;  4NY8 A;  1D9F A;  3MAB A;  3K1Z A;  1V9P A;  2ZTC A;  5DG9 A;  1KFT A;  1PK3 A;  2A1J A;  8ICM A;  4P0P B;  8ICW A;  8ICF A;  3LDA A;  4KLT A;  1ZD2 P;  2AGO A;  4B9T A;  2LMR A;  4I2B A;  2AGQ A;  1CUK A;  2ZTD A;  2PMZ F;  5KFL A;  1F0M A;  2KJ9 A;  3HJE A;  4PHD A;  4NLK A;  4FBT A;  3HRD D;  1Z1V A;  2W7O A;  2W55 A;  4EZ6 A;  3OJS A;  1JAL A;  4QJF B;  2GLE A;  2GOL A;  3RR7 A;  3QE9 Y;  1U9L A;  1NJY A;  5IIM A;  3E0F A;  4C8N A;  7ICO A;  5KAI U;  4QWC A;  3Q8P B;  1QH9 A;  4ECW A;  1NK0 A;  4O9M A;  2C2D A;  1L7P A;  4DEZ A;  5CB1 A;  2HHT A;  2JEG A;  1L7M A;  2H5X A;  5HP4 A;  4I2E A;  3H8J A;  2J6U A;  5GTI U;  9ICL A;  4RQ8 A;  2IA6 A;  3OHB A;  2H3Z A;  2AQ0 A;  1DK2 A;  5KFH A;  4M6W B;  4LZD A;  2JRZ A;  5HR7 A;  1MQ2 A;  3GU3 A;  5ALE A;  1Q8K A;  2FPM A;  8ICE A;  5J0Q A;  4CNQ A;  4UAU A;  5CR0 A;  4K4G A;  1KFD A;  5AI9 A;  5J0U A;  2HBM A;  4C4T A;  5ALQ A;  4RZR A;  1ZYQ A;  2QB0 B;  2BPF A;  4GXI A;  3V72 A;  1HEK A;  4NLZ A;  4O3S A;  5KFX A;  2FPL A;  1BGX T;  3OTQ A;  5DQG A;  4DO9 A;  1N62 A;  2MU2 A;  1UT8 A;  2F8K A;  2VA8 A;  2ZIV A;  2EQY A;  4YR2 A;  5J2I A;  5DLF A;  2FJ6 A;  1SGG A;  2ZUB A;  3TQ1 A;  1IIP A;  1JXE A;  1WWU A;  1S76 D;  3ETL A;  2K8C B;  2KV2 A;  4PH5 A;  4NM1 A;  3T5H A;  2EAO A;  1BNP A;  1JRO A;  3UMB A;  4RPX A;  3UM9 A;  1A77 A;  1ZQI A;  2E8P A;  1PZN A;  2DPJ A;  1LVH A;  1N61 A;  9ICM A;  3C5G A;  3F5E A;  5ALL A;  5HNK A;  3T5K A;  1SKW A;  5L1M A;  4ECX A;  5FP0 A;  1TVA A;  4FO6 A;  1NZP A;  3NRZ A;  5ALI A;  4J9P A;  5AK6 A;  4RQ4 A;  4HAI A;  5D4B A;  4ACO A;  5D46 A;  1ZD4 A;  2KOB A;  1Q3U A;  4FZL A;  1HJP A;  4B9N A;  4YN4 A;  3QUC A;  4I28 A;  3OPX A;  1CRX A;  3MDA A;  2YY6 A;  3RJI A;  5AKX A;  4EX6 A;  1UT5 A;  1FO4 A;  5J29 A;  3B0Y A;  4QWD A;  4O5E A;  4EYH B;  5AHX A;  1N5X A;  5C0Y A;  4MF2 A;  4J9R A;  2Q0Z X;  9ICN A;  5KT5 A;  7ICV A;  5AIA A;  1BPD A;  2G06 A;  3G6X A;  2VKQ A;  2D3D A;  1ZQW A;  5AKK A;  5KG4 A;  2PMZ C;  2BR0 A;  4OJL A;  5EE3 A;  5KNI A;  3RR8 A;  4UB2 A;  3QUT A;  1GO3 F;  4FZM A;  1ZQB A;  1ZQN A;  1ZQS A;  3I76 A;  2GO7 A;  2LPE A;  1OUQ A;  2NRZ A;  3GIK A;  1SV0 C;  4JK1 A;  5KFV A;  3TAN A;  4MFF A;  3GV5 B;  3L4P A;  3D2Q A;  4PL2 A;  4DF8 A;  4C8K A;  2P66 A;  1WG8 A;  4ED2 A;  3JPT A;  1UA1 A;  3QZ7 A;  3SAF A;  4BUG A;  1L7N A;  4UB3 A;  3NVZ A;  1TFR A;  3TAC B;  2A1J B;  1S0V A;  5ALH A;  3LK9 A;  1S0M A;  3RB3 A;  2Q4T A;  2OWO A;  2KP7 A;  4ELV A;  2W8L A;  2FDR A;  1KL9 A;  3N7P D;  4DL6 A;  4YR0 A;  1ZQK A;  1JX4 A;  1SXD A;  5EOZ A;  2R8H A;  3QZ8 A;  4Y2J A;  2XY7 A;  1M6Y A;  8ICU A;  2B0C A;  4ECS A;  2HVH A;  4Z6E A;  1CEZ A;  1PK1 B;  5KT3 A;  3H7I A;  2ZIU B;  3KZX A;  1ZQY A;  5ALU A;  2ZXI A;  4KIT B;  5J2H A;  4UAV A;  4I2G A;  4R63 A;  3GIL A;  4PGQ A;  1S10 A;  2AGP A;  5DLG A;  3K1R B;  5J2J A;  1L3V A;  2BQ3 A;  4CF5 A;  1K1Q A;  3BZC A;  2KZ3 A;  3ISD A;  1VDV A;  1PVR A;  3N7R C;  2Y1J A;  4B9S A;  4F50 A;  4ED0 A;  2AHO B;  3JPS A;  5ALV A;  5CP2 A;  4YR3 A;  5KFZ A;  4MFC A;  3QEA Z;  4FE3 A;  4DL2 A;  2A3V A;  5KFU A;  2LYB A;  4EBD A;  2ZG6 A;  4UW9 A;  2AXT U;  8ICR A;  2BCU A;  2KIW A;  2ODG A;  3GQC A;  1S77 D;  1XWL A;  2C2E A;  2R8I A;  2WTF A;  3NUQ A;  2KMD A;  2IOF A;  5F3X B;  3RRG A;  3NVW A;  4IQT A;  3CNH A;  4Q8F A;  2W9M A;  2KKV A;  4KLF A;  4UAZ A;  1ZQM A;  4UB6 U;  2QAR A;  4RT3 A;  1SXE A;  2RDJ A;  1SZP A;  3H40 A;  5DBC A;  2BPG A;  9ICJ A;  1B22 A;  3R9K A;  3GIM A;  2LYH A;  3CW2 C;  3LYS A;  2XGQ A;  3PW7 A;  1TK0 A;  2NO4 A;  3F2B A;  3HKZ C;  1UA0 A;  1X9S A;  1L3T A;  1JUD A;  4XRH A;  3L5K A;  5TIS U;  1N2X A;  5KFE A;  3AQF A;  1SKS A;  3KZI U;  3TAD A;  4C8L A;  5DG8 A;  2OYY A;  5KFW A;  2OH2 A;  4QZG A;  4PZO A;  2PKE A;  7ICL A;  5HR6 A;  1VLB A;  2WAQ F;  8ICJ A;  2K4E A;  4CDG A;  3ZDC A;  1XO0 A;  2ASD A;  2JEF A;  2Y0S F;  4TUS A;  2F76 X;  3OGU A;  1X2I A;  1V85 A;  4IC9 A;  3BZK A;  1KFS A;  2LKY A;  3F2D A;  5ALT A;  3H0M B;  2XIC A;  4XQ8 A;  5DKW A;  4DFK A;  4Y2P A;  3WKB A;  2ZUD A;  5DB8 A;  2ATL A;  3PX6 A;  3N97 B;  3Q8L A;  4DWI A;  3RH4 A;  4BXO B;  3UXO A;  3F2C A;  1U47 A;  1S8O A;  3PY8 A;  4M6W A;  1QQ5 A;  1AQ6 A;  7ICH A;  3ZDD A;  4F93 B;  4RPZ A;  1WCL A;  5KG3 A;  5CJ7 A;  2KFN A;  2ALZ A;  4Y2V A;  3THV A;  3EUB 2;  4M47 A;  1A76 A;  3D2S A;  5F9L A;  4NWI A;  3M8S A;  2WF5 A;  4RUA A;  2UVV A;  4ED1 A;  1ZQZ A;  5CWR A;  3TAD C;  3CP8 A;  3IHQ B;  2ZIX B;  3Q8R B;  1N48 A;  4R8U A;  2DBY A;  4ZH4 A;  4QZE A;  2BQR A;  2BHN A;  3HPO A;  1U4B A;  8ICP A;  3PSI A;  4IRD A;  5B66 U;  1QSL A;  1RYR A;  8ICL A;  4WJ3 B;  4ECU A;  2GH1 A;  3OJU A;  9ICW A;  1BNO A;  2R18 A;  4EX7 A;  3BS5 A;  2KEY A;  2YML A;  3PW4 A;  2MA1 A;  4GXK A;  3PSP A;  3LWM A;  2F77 X;  5DGB A;  1OXJ A;  4G9B A;  1T3Q A;  5ALX A;  8ICK A;  2E3T A;  1SV4 A;  4P0P A;  2JMG A;  1Z4N A;  4F4X A;  1O08 A;  1MA7 A;  2AQ4 A;  1O03 A;  3ED5 A;  1S9F A;  5AKZ A;  1ZQU A;  3NRW A;  2XI9 A;  1DRG A;  7ICT A;  1NNL A;  1T8E A;  3QU7 A;  5KT4 A;  4DQI A;  3O0F A;  4UB4 A;  1IG6 A;  2J6S A;  4J9K A;  3BDP A;  3UMG A;  3PZP A;  3MR5 A;  2IMW P;  1SV0 A;  4UAT A;  1Y88 A;  4ED7 A;  1NK8 A;  3VCB A;  1T7P A;  2RHF A;  5J0Y A;  1A0P A;  1L5U A;  4R65 A;  2KK0 A;  4RQ5 A;  4F91 B;  1T4G A;  3TAQ A;  4P0Q B;  1SWW A;  2R8K A;  3V7L A;  4ELT A;  3N4M B;  3JPP A;  3MFI A;  2QAR B;  5HML A;  5AKH A;  4QWB A;  2WF7 A;  4YD2 A;  3MFH A;  4DFP A;  3H4D A;  2EZX A;  1BPZ A;  5ALK A;  4Q44 A;  5AK4 A;  2XCA A;  4AYB C;  4DSF A;  7ICK A;  4JWM A;  4DSJ A;  7ICN A;  4R64 A;  1V38 A;  5BOL A;  2XCP A;  5ALM A;  5IIO A;  1XS9 D;  4C8O A;  7ICJ A;  3NVY A;  3ISB A;  4LVS A;  5EWF A;  5KTQ A;  3BJY A;  2VA2 A;  4NV0 A;  4LZG A;  4KLH A;  3WK5 A;  2WAQ C;  3ISC A;  5E79 U;  5BPC A;  5KFB A;  3GV7 B;  2Y0S C;  2AH5 A;  5AKJ A;  2ISO A;  3ZDE A;  5KFM A;  4DLE A;  1SL0 A;  3SQI A;  4CGZ A;  2K4H A;  3MGH A;  3QU9 A;  2KNJ A;  4GC7 A;  5AIC A;  4BGD A;  3EYZ A;  1QSY A;  5KFS A;  4U7C A;  4DSE A;  4MEX A;  4KLJ A;  1SL2 A;  1VJ5 A;  5KG7 A;  3RB6 A;  3HIL A;  8ICY A;  1D8Y A;  5DGA A;  2A19 A;  5KFJ A;  2VAN A;  4QZD A;  3RF9 A;  3AN1 A;  3ETR A;  5EE1 A;  1DGS A;  4BXO A;  1LKY B;  1PUZ A;  4UB8 U;  1PVQ A;  3PO4 A;  1B0X A;  4UAY A;  4QWE A;  2IHM A;  4DL5 A;  5KT7 A;  5AK5 A;  4KX5 A;  4E0D A;  4DL4 A;  5ALF A;  2HHW A;  3RRH A;  5CEH A;  5DB6 A;  4UAR A;  1P7D A;  4TQS A;  3KHG A;  1ZRN A;  4BJQ A;  5A0L A;  4Q43 A;  4CF4 A;  4YFK A;  2NRT A;  2CXY A;  1IV8 A;  4P4O A;  1NJW A;  2GWS A;  3SMV A;  4UBC A;  5KT2 A;  3B9J A;  1LB2 B;  8ICI A;  1ZQE A;  9ICI A;  2AU0 A;  1U49 A;  1ZD5 A;  4M2Y A;  3AU2 A;  4CE6 A;  2L5Y A;  3PVX A;  2JV3 A;  5L1J A;  4Z6D A;  4RUC A;  4C4R A;  1TK8 A;  3PSF A;  2HW3 A;  3Q8Q B;  4NLN A;  4F5R A;  1TAQ A;  4YVZ A;  3C1Y A;  2YN4 A;  3Q8S B;  3PO5 A;  2H3I A;  4DFM A;  4AP9 A;  4Q8E A;  1UHU A;  2EH9 A;  4Y2X A;  5KFI A;  3NS1 A;  3TFR A;  4KLQ A;  3AL0 B;  3C29 A;  7ICG A;  1NJX A;  3H0L B;  5GTH U;  4DS4 A;  8ICS A;  2OHF A;  2VIX A;  4F5P A;  4GIB A;  1Z00 A;  3G6V A;  2CRX A;  1B43 A;  1L8L A;  5AKE A;  1ZXI A;  2ZJ5 A;  7ICF A;  1ZD3 A;  2HHQ A;  3WKD A;  5CA7 A;  2DL0 A;  9ICS A;  3HKZ F;  2KJ8 A;  2HI0 A;  2Y9T A;  4C80 A;  1FEZ A;  2E1F A;  4GC6 A;  7ICQ A;  2I9G A;  2YQE A;  3SR6 A;  1BPB A;  2JGA A;  1BPY A;  3IM1 A;  2MUT A;  4ED6 A;  3SEI A;  4KMO B;  2JEJ A;  2W9C B;  5AI5 A;  2RDI A;  2DWQ A;  2G09 A;  2P6U A;  3M9N B;  2E8O A;  4IQV A;  1ARO P;  9ICU A;  2PI4 A;  4O3M A;  3GV8 B;  2DUY A;  2DGZ A;  1KDH A;  3TI0 A;  4PPX A;  4ICA A;  2QB1 A;  2YMP A;  3HW8 A;  3OSN A;  2KD1 A;  1ZOL A;  7ICP A;  3ICX A;  3PNC A;  4RPY A;  1KW4 A;  3ONN A;  1UCV A;  1SL1 A;  2IBK A;  3JPO A;  9ICF A;  5IIN A;  3UPQ A;  4O3Q A;  3PW0 A;  2UVU A;  4U6P A;  1WWV A;  4IQU A;  2DPI A;  2FLP A;  3H0R B;  4J9N A;  2E8N A;  4P0Q A;  3C2K A;  1X40 A;  3WK4 A;  5J8Y C;  1IM4 A;  3RFA A;  4DQS A;  1X9M A;  3QNM A;  5JTI A;  3UMC A;  1NKB A;  3RTV A;  4C0Z A;  5J0P A;  2H3F A;  2F1I A;  2KSO A;  3U26 A;  4QWA A;  1NOM A;  5T14 A;  3KKA A;  2H3Q A;  3V6K A;  2RQ5 A;  5KG0 A;  7ICS A;  1ZQP A;  3NTU A;  2M0N A;  2BQU A;  1ZQD A;  4KLL A;  9ICH A;  1KLN A;  5ALN A;  2FLL A;  1NKC A;  4KLU A;  4ECQ A;  7ICE A;  5ALW A;  4O5K A;  4PL1 A;  4NLG A;  3UQ2 A;  1NKE A;  3Q8M A;  3WKC A;  5G5H A;  5KG1 A;  3AUO A;  1N60 A;  7ICU A;  4KN4 A;  5ALJ A;  4J9M A;  3RJH A;  4USA A;  8ICT A;  1BPX A;  4FS2 A;  2FI1 A;  3G6Y A;  1NK6 A;  1KEJ A;  2YMM A;  2OCE A;  3TAP A;  3NGD A;  5KL8 B;  3E2E A;  4Y2Y A;  3KD3 A;  1X9X A;  2KIV A;  5J2B A;  1C7Y A;  2W04 A;  3SZ2 A;  2IOF K;  1D8B A;  1QQ6 A;  5D49 A;  9ICG A;  2W9C A;  2F3N A;  3V6J A;  1XSP A;  3ZD8 A;  8ICV A;  3SEN A;  1TV9 A;  4ZOH C;  4F2S A;  4NXZ A;  2UVR A;  1RM6 C;  2NRW A;  1RQL A;  5J0T A;  2H3V A;  3F53 A;  5AKG A;  2QLT A;  2JZB B;  1YZ7 A;  1YT3 A;  3WK7 A;  4QZF A;  3BQ0 A;  5ALG A;  4DLG A;  4O3N A;  3HWT A;  5AM2 A;  2EDU A;  3NAS A;  3V7J A;  5J0R A;  2K4P A;  1XC9 A;  4F72 A;  3ZI4 A;  2ZXH A;  1J2M A;  3M6K A;  4C8M A;  2DFL A;  1NJZ A;  5DBA A;  4MFA A;  5J2D A;  1ED1 A;  1KN5 A;  3KOO A;  9ICX A;  1T3N A;  3WU2 U;  5KFK A;  4IRK A;  3HX0 A;  3PV8 A;  2AJQ A;  3BQ2 A;  2PFQ A;  4KLD A;  2JEI A;  2KKP A;  2RLT A;  2HOF A;  5C5J A;  3EWA A;  5HHH A;  2XGP A;  1S5L U;  3IG5 A;  2VJ5 A;  4FFD A;  1F5S A;  2HDO A;  4KN7 A;  4TQR A;  2BCQ A;  4DL3 A;  1ZQA A;  1D9D A;  1RG6 A;  3QXG A;  4RQ1 A;  5L1I A;  4KLG A;  2QKQ A;  2OEH A;  2D8C A;  9ICV A;  4ED3 A;  4QZ9 A;  3KHH A;  4EEL A;  4JB3 A;  1Z00 B;  1KTQ A;  2WFA A;  4F4Z A;  5KFG A;  1TKD A;  2NV3 A;  5ALZ A;  4Y2U A;  4O3O A;  1YZ6 A;  2KN7 A;  3BS5 B;  2RP5 A;  3CRX A;  1ZQX A;  3M9O B;  1FFV A;  2MUT B;  2EAN A;  5AI0 A;  2LBO A;  1L3U A;  4QZB A;  2KHQ A;  4CCH A;  3D6J A;  4JV1 A;  4J9L A;  2ZIW B;  4IQW A;  4O3R A;  3PMN A;  2MRL A;  1KKX A;  3VC8 A;  1DXS A;  1KRP A;  5KFO A;  4OJO A;  2YTU A;  3LVW A;  4DOB A;  3BQT A;  4YG2 A;  5L1K A;  3M9M B;  5J2E A;  2XVT A;  4AYB F;  2K89 A;  2W3S A;  3UXN A;  2PFO A;  4BWJ A;  5ALD A;  3UXP A;  2V4R A;  3KBB A;  4YP3 A;  2G5I B;  3QU4 A;  2KJ5 A;  1EXN A;  5AI8 A;  4RT2 A;  1NK4 A;  3WK8 A;  2OM6 A;  1FFU A;  4RQ0 A;  3T79 A;  3V7K A;  1IXR A;  2LI6 A;  4M04 A;  4OJ5 A;  4Z6F A;  1X9W A;  1DGJ A;  2Y9U A;  2BDU A;  4PHA A;  4J03 A;  5EE0 A;  4B6J A;  1ZQ1 C;  5DBB A;  5AI4 A;  5JRT A;  2BCV A;  3B0X A;  3C2L A;  4I2D A;  5J0S A;  4F2R A;  4Y2R A;  4I2F A;  4RNN A;  2KVS A;  3HP6 A;  1QCK A;  2C22 A;  4ECT A;  4KLM A;  4M9H A;  3I28 A;  3AMZ A;  4J9S A;  4B9U A;  3WK6 A;  1TK5 A;  3PR4 A;  5KFY A;  2JR5 A;  1XSL A;  4YXM A;  4KTQ A;  5KFT A;  2ES6 A;  5AK3 A;  8ICB A;  2G5H B;  2ISP A;  1NK9 A;  3FYH A;  4JV2 A;  3RAQ A;  5J2A A;  2KZM A;  5AM1 A;  2IHN A;  1KQQ A;  3K75 D;  3S6J A;  1X6I A;  5DQI A;  3MGV A;  3T3F A;  4QZ8 A;  5AM0 A;  1A6S A;  4ECV A;  3RBE A;  4EBE A;  2BKE A;  2R8G A;  2ZIW A;  4KX3 A;  4QIW C;  3H4B A;  4DOC A;  2KTQ A;  3SV3 A;  4HYK A;  3RJE A;  3KHL A;  2P35 A;  4DFD A;  3MBY A;  4NM2 A;  3QUB A;  2LHT A;  4EBC A;  9ICO A;  4I2J A;  4DL7 A;  2ASL A;  3WKA A;  2JXJ A;  3DV9 A;  1RYS A;  1TAM A;  3OSP A;  2G07 A;  3N7S C;  2MAX A;  4QW8 A;  4DS5 A;  5ALS A;  4KLE A;  5J8Y A;  1ZRM A;  3KKA C;  1PVP A;  4C7Y A;  1SZH A;  2WB1 C;  1URJ A;  2JH7 A;  1XSN A;  2F2A B;  4Q45 A;  3QYP A;  3J81 j;  4C4S A;  4GFJ A;  4YMM A;  4F3O A;  1ZQO A;  2XID A;  5IIK A;  3PML A;  4UB1 A;  1KBU A;  2F8L A;  9ICK A;  1RXW A;  8ICG A;  5TZV A;  2BZF A;  1X42 A;  1JRP A;  4YMO A;  5KFD A;  4QZI A;  2NO5 A;  2FE9 A;  4F4W A;  1Z19 A;  5HMM A;  3TFS A;  2F1H A;  4KLI A;  2CN1 A;  4QW9 A;  3FAH A;  5CHG A;  2OXO A;  3IP4 B;  2HBK A;  3BS7 A;  1Q3V A;  3MGI A;  4GLX A;  4XA5 A;  4NLC A;  1L7O A;  2W7P A;  1Z3E B;  4RNO A;  4M9L A;  1DK3 A;  5DDY A;  3QEB Z;  1T94 A;  1RXV A;  3TKA A;  2NYV A;  5J0O A;  4IS7 A;  1WUD A;  3DDH A;  4K4H A;  1JXL A;  1C20 A;  3M8R A;  1QQ7 A;  4O3P A;  2J6T A;  3C21 A;  1ZQV A;  2LM4 A;  5J0X A;  5J2F A;  1Z4O A;  1ZQQ A;  2DKX A;  3FM9 A;  1ECW A;  1JMS A;  4JUZ A;  4I2A A;  2HHS A;  4BX9 C;  4I2C A;  2HBJ A;  1XO1 A;  1BPE A;  4LJX A;  4F71 A;  3PW2 A;  3WK9 A;  1K5O A;  4IL6 U;  2B6G A;  1QSS A;  1CI4 A;  4RU9 A;  4F5O A;  3IDW A;  2LM1 A;  3QU5 A;  2HBL A;  3D2N A;  2W8K A;  4PHP A;  1X66 A;  1MQ3 A;  8ICZ A;  3LWL A;  4G3I A;  8ICA A;  4C7Z A;  3RB4 A;  1PK1 A;  4P4P A;  1J2N A;  2HHU A;  3PW5 A;  2Z7J A;  4EEK A;  4M9J A;  3C5F A;  3JPN A;  4F5N A;  4MHV A;  4IR9 A;  5KFR A;  4I27 A;  5KFF A;  8ICH A;  3T5L A;  7ICI A;  9ICT A;  3F5A A;  3JPQ A;  4GXJ A;  3MDC A;  3H8W A;  5DB7 A;  2ZUC A;  2K8A A;  1ZQL A;  2W11 A;  3EPI A;  3I1Y A;  3GFK B;  5KG5 A;  1NI3 A;  3DEE A;  3HT3 A;  2B21 A;  5ALO A;  2D6F C;  5DDM A;  1NK7 A;  3RB0 A;  2M9N A;  4JV0 A;  4Y2S A;  9ICB A;  2ESE A;  2PFN A;  5KFQ A;  4EEY A;  3C28 A;  3RJF A;  1ZQR A;  4DOA A;  2KVC A;  4TUP A;  4DQQ A;  2P6R A;  4K4I A;  1L6N A;  4F5Q A;  8ICX A;  2LYA A;  4UB5 A; 
#chains in the Genus database with same CATH homology
 2YTU A;  1X40 A;  5L1M A;  1LKY A;  5J8Y C;  1SXD A;  2L5Y A;  1COK A;  2JV3 A;  4RQN A;  5JU5 A;  2DKX A;  3BS5 A;  2DKZ A;  5JTI A;  1UQV A;  1OW5 A;  2K60 A;  2K4P A;  2F44 A;  1PK1 B;  3TAD A;  1OXJ A;  2KSO A;  3KKA A;  4PZO A;  2EAP A;  1SV4 A;  1JI7 A;  2B6G A;  1B4F A;  3IDW A;  3H8M A;  5J8Y A;  3KKA C;  3K1R B;  2E8M A;  1V85 A;  2Y9U A;  2DL0 A;  1X66 A;  2Y9T A;  4NL9 A;  2D3D A;  2QB0 A;  1PK1 A;  5JRT A;  3HIL A;  2QB0 B;  4NJ8 A;  3SEI A;  4MHV A;  1RG6 A;  5KNI A;  1PK3 A;  1SV0 A;  2QKQ A;  2D8C A;  4RQM A;  1LKY B;  1B0X A;  2FE9 A;  2KSO B;  2F8K A;  2LPE A;  2E8O A;  2LMR A;  1SV0 C;  2QAR B;  1SGG A;  3BQ7 A;  1X9X A;  1WWU A;  2KIV A;  2QB1 A;  2ES6 A;  3BS7 A;  4NL9 C;  1F0M A;  3BS5 B;  2KMD A;  5F3X B;  2ESE A;  2KG5 A;  2EAM A;  1DXS A;  1KW4 A;  2F3N A;  1UCV A;  1Z1V A;  2EAN A;  2EAO A;  3TAD C;  3TAC B;  3SEN A;  2QAR A;  4PZN A;  2GLE A;  1V38 A;  1SXE A;  2E8P A;  4IS7 A;  1WWV A;  2E8N A;  2KE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...