3SENA

Structure of caskin1 tandem sams
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
KSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Caskin-1
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA01
5JTIA 4NJ8A 2D3DA 2GLEA 1X40A 4PZNA 2LPEA 2E8NA 1LKYA 2K4PA 1SV0C 3BS5B 5F3XB 2DL0A 2QB0A 1X66A 2KE7A 1WWVA 1F0MA 5L1MA 2Y9UA 2Y9TA 2DKXA 4PZOA 1SV0A 2EAMA 3BS7A 5JU5A 2ES6A 3HILA 1PK3A 4MHVA 1OXJA 5JRTA 1B0XA 4NL9C 3K1RB 2LMRA 2KSOA 2K60A 4NL9A 1Z1VA 2QARA 2E8OA 1SXDA 3H8MA 2QB1A 2EAPA 2FE9A 1SGGA 2E8PA 1PK1A 2JV3A 2KG5A 2F3NA 1KW4A 2ESEA 1JI7A 1COKA 2D8CA 1SV4A 2KMDA 2DKZA 1B4FA 3SEIA 1LKYB 2QKQA 4RQNA 5J8YA 3BS5A 3KKAC 1DXSA 2EAOA 1RG6A 1UCVA 2E8MA 1UQVA 2KSOB 2QB0B 3IDWA 2B6GA 1V85A 5J8YC 2QARB 2EANA 1OW5A 1X9XA 2KIVA 3BQ7A 4IS7A 3TACB 2YTUA 2F44A 4RQMA 2F8KA 3SENA 1PK1B 1SXEA 3TADC 3TADA 1V38A 2L5YA 5KNIA 1WWUA 3KKAA
chains in the Genus database with same CATH superfamily
5JTIA 4NJ8A 4RQ7A 4C4RA 2D3DA 2GLEA 5EE0A 2ZIWB 4HAIA 5AK5A 4F5NA 3NVZA 3BS5B 4M47A 1L8LA 3H0MB 2ZXIA 4P0QA 4QW8A 4KLEA 1SKWA 2IMWP 1BNPA 1X66A 4MFAA 5L1MA 3G6XA 2NRXA 2DKXA 3NVVA 3QNMA 4I2BA 5ALMA 1KRPA 4J9LA 4JK1A 4KLUA 2UVRA 3JPRA 2PFOA 2J6TA 4NLBA 2XGQA 3C2KA 3RR7A 2XVTA 2JMGA 2PMZC 3TANA 4B9MA 1Z00B 2ZIXA 4JWMA 3V6JA 1Y88A 5FP0A 5G5GA 2FLLA 3OHAA 4Y2XA 4A8EA 2OXOA 7ICTA 2JV3A 2W9CA 4Z6DA 3NVWA 4DSKA 4F5OA 2H3FA 1U48A 3M7DA 7ICEA 5KG5A 2IOFA 1ZQYA 3QU7A 2W9AA 2LM4A 5BOLA 3V6HA 3ZDAA 2WHEA 4ED0A 3D2QA 2Z7JA 4DSIA 4AYBC 1Z19A 2EZZA 5DQHA 4UASA 2AGOA 4CE6A 1O03A 4QJFB 2K4IA 1MQ2A 2KIVA 2K89A 3M6KA 3KHGA 1KBUA 5IIOA 5KT2A 3SYZA 2AHOB 1ZQZA 2V4QA 2R18A 3B9JA 1T7PA 4R63A 1U49A 2AU0A 3TARA 2CPRA 3QUQA 1SL2A 1CRXA 1ZQQA 9ICIA 1N5WA 3GFKB 1AQ6A 1B22A 4KN4A 3HPOA 5K4LA 2C22A 3EZ5A 4F8RA 2MUTB 4F71A 2Y1IA 4ICAA 4LJXA 4O9MA 2Q4TA 4OJPA 3PX0A 4E0DA 1BPDA 1NK0A 4I2HA 8ICUA 2HHVA 3KHRA 3NRWA 1ZQMA 9ICKA 4MHVA 2BR0A 5JRTA 5KFLA 5KG4A 3PMLA 4LVSA 1ZQPA 4P4PA 4AYBF 4GXKA 3IG5A 4PHDA 1Q46A 2XCPA 8ICIA 2ZIUB 2WB1C 3RH6A 4YD2A 1NKCA 2EAPA 5IIKA 4Y2YA 1SKSA 3PW5A 3NASA 9ICJA 1RXWA 2ESEA 4IR1A 2Q0ZX 4MF8A 5KG2A 3IRUA 3OHBA 2BCUA 2UVVA 4KLOA 1JN3A 1SWVA 1WCNA 3GDXA 4PJ0U 1NJYA 1LKYB 2NRTA 2GO7A 3D2SA 2FPLA 3WK6A 2ASLA 3ZD9A 1XO0A 4NY8A 1OW5A 8ICCA 3C1YA 5HP4A 4O0IA 9ICNA 1TK8A 3WKDA 1T3NA 5BOMA 4PPXA 9ICQA 2LYBA 5KFRA 2XY6A 4I2GA 3IHQB 3LYSA 3NRZA 4C7ZA 2J6SA 3RJIA 3TKAA 4RT3A 1XC9A 1S10A 1BVSA 1Z00A 4GFJA 2MSNA 1N61A 4CDGA 4DEZA 7ICIA 4FBUA 3UMBA 2ZJAA 4Q44A 1ZQKA 2IBKA 5DB7A 1S77D 1WWVA 2F77X 4LZDA 4XQ8A 2OWOA 1ZQOA 2PMZF 4BUGA 1UPHA 2KVSA 4YP3A 3UQ0A 2KFZA 2WF9A 8ICPA 5KT7A 1T4GA 4RQ4A 5ALZA 2BCSA 5KFEA 2AH5A 2OM6A 1NNLA 2OHFA 4Q43A 3PZPA 5KFWA 2F2AB 4DFMA 5IIMA 3CYMA 1YZ6A 3JPQA 4F4WA 4NLCA 2W9MA 1PVRA 1L7MA 4Y2TA 3WKAA 3ZD8A 1KLNA 4QZHA 3ALRA 9ICCA 3OSNA 3PV8A 3UMCA 1RXVA 2M9NA 1NZPA 4KLMA 2DF4B 2BDPA 5KFJA 1D8YA 4Y2VA 4JV2A 3UQ2A 5F9NA 5KT6A 4ELUA 3Q8QB 1UT5A 4M9LA 4ELTA 4HYKA 5KFMA 1SL0A 3MR5A 2YMMA 5AM1A 3TACB 1ZYQA 2DWQA 2I9GA 1Q3UA 2ASJA 1DK3A 1ED1A 5KFVA 4QZAA 2RP5A 1TE2A 1Z3EB 1ZD3A 3OPXA 2YB1A 5J2CA 2DPIA 2EZXA 1WWUA 3MGVA 4EZ6A 4I2IA 3HX0A 1K1QA 3EWAA 3V7KA 2XY7A 4FZLA 5EE9A 2KFNA 2JH7A 3QYPA 4NV0A 3F5EA 1FEZA 4DL6A 1T94A 1F0MA 5H2FU 2JEFA 1TAUA 1FFUA 5DDYA 3RR8A 3Q8SB 2K8BB 4DLGA 3KHLA 2JZBA 3QU2A 4F2SA 4ECXA 4DL3A 3C28A 2G06A 4B9SA 2CRXA 1OXJA 1C20A 4DSEA 5J0WA 3RB3A 4KLHA 5KFNA 3AUOA 2BCQA 5EE3A 4IL6U 4RQ3A 4YQWA 3HRDD 5CJ7A 2W7PA 2HHTA 3KHHA 4YN4A 4PHEA 3CNHA 3BZCA 4IQUA 1PUZA 2K8AA 3SR6A 4IQTA 2C2DA 2ZTDA 1H38A 2ATLA 1Z1BA 2E8PA 4Q8EA 1V97A 1VDVA 5DB9A 5KFZA 2KOBA 9ICWA 1UA0A 5CEHA 5KFHA 3JPTA 2W3RA 2RDIA 4BWMA 4TUPA 2Y1JA 4UAZA 4NXZA 3PW7A 2QKQA 4DFPA 5HHHA 3RRGA 3PSPA 2JXJA 1ECWA 4B9LA 3SAFA 3IV6A 3OSPA 2BHNA 3BDPA 1DK2A 1ZETA 2RRDA 1SXEA 3DV9A 3I76A 4CF3A 3MBYA 2A1JA 8ICTA 3ISDA 1FFVA 3I28A 1A77A 4C0ZA 3ZDEA 4WJ3B 1J2NA 3MFHA 4PGYA 3WK4A 5ALQA 1BPXA 8ICOA 4PZNA 2KHVA 2K4PA 3GV8B 1X42A 2XGPA 4O3QA 1L8OA 2KEYA 1ZQNA 4EX7A 1ZQVA 3ISBA 7ICOA 1QCKA 5KFTA 3GILA 9ICTA 3WKEA 5B5EU 4M6WA 3M9NB 4C4SA 4RNOA 5IINA 1ZQSA 1X6JA 2VA2A 3LVWA 3LWMA 1HJPA 3HP6A 1NKBA 1ZQWA 4ECTA 3RJFA 2G5HB 1QLNA 4Q8FA 4DF4A 4QZ9A 4UARA 3EYZA 4KLIA 2JEJA 2FJ6A 4YR3A 5IIJA 4BX9C 1XNSA 1MQ3A 4EBCA 4RQ1A 1COOA 5F9LA 1D9FA 2H3IA 4J9PA 4IC9A 4QIWF 4O5CA 4P2HA 1VLBA 1NK8A 1HEKA 3RB4A 4EELA 3RJJA 5TISU 3K4GA 1JI7A 2LM1A 1KFSA 1Z4NA 1ZRNA 1RYUA 3RF9A 4U7CA 4M2YA 1B4FA 1BPBA 1ZD4A 4I2DA 1YT3A 3SEIA 4QZFA 5J8YA 1RYSA 2ZUBA 3ISCA 1DXSA 1ZJMA 5HMLA 5ALHA 4KLDA 4UW9A 1NJZA 2KSOB 3GQCA 1HUOA 2QB0B 4J9NA 4QWCA 4OJOA 2KJ5A 2JR5A 4NWIA 3AU6A 3LK9A 1UT8A 2QARB 3MR6A 2KIWA 3UM9A 1KQQA 3CW2C 4KLFA 5ALWA 2JZBB 3MR3A 5ALPA 3Q8RB 4G9BA 4DWIA 2O6KA 5ALUA 1IXRA 4ZOHC 3MGHA 2AQ4A 4NM2A 1K1SA 2F1HA 4BXOB 4OD0A 3QEBZ 1NOMA 1L3UA 2FI1A 5AI8A 2E8NA 3V6KA 4O3RA 5DGAA 3H0RB 2HBKA 1X9MA 4KN7A 1DGSA 4O3PA 3H4BA 2OH2A 1D9DA 2KNJA 2KK0A 2BQ3A 3LVVA 4DL4A 4YMOA 2DGZA 2ES6A 2W9BB 4DQIA 1ZRMA 3EW9A 1QH9A 3GIIA 4RQ8A 4DOAA 4P0PA 3MDCA 1X9SA 5TZVA 3ETLA 4NLKA 5ALTA 1SWWA 2A3VA 3PW0A 5AIBA 3B0XA 3M8SA 1SGGA 1ZQFA 3ZDDA 3MABA 2ODGA 4CNQA 3N7RC 3E58A 1XSNA 2YX8A 9ICGA 5L1KA 8ICAA 8ICFA 9ICXA 4QW9A 3L5KA 8ICJA 4TQRA 1ZQRA 2G09A 3C5FA 5AKZA 4M9GA 4R66A 2BDUA 4KLLA 9ICVA 2LHTA 3RAQA 5BPCA 3EPGA 2G0AA 7ICJA 5J0UA 2NO5A 3J81j 3AQEA 1ZQBA 4EYHB 3PO5A 4Z6EA 2JEGA 3BQ1A 4EEYA 3IG8A 2P35A 5KNIA 7ICGA 5EWFA 4MEYA 1L3TA 2ZUCA 1NK9A 2LPEA 2YMPA 4F50A 4KMUA 5CR0A 4J9QA 1KFDA 3EUB2 2W3SA 5ALRA 4I2EA 5CRXA 4EX6A 4EYIB 4Y2SA 4UB2A 2OEHA 3WK8A 4UB4A 2W11A 4UB6U 3RAXA 1JXLA 2ZUDA 3FM9A 4Z6FA 4GC6A 3F5AA 5AKHA 2Y0SC 4OJLA 2KP7A 4J9SA 5AM4A 2UVUA 2XICA 5KG7A 2QARA 1SZPA 4J9KA 3T5HA 4RQ5A 2ZTEA 1YZ7A 2F3NA 3NUQA 1L7OA 2JEIA 5AK6A 2G08A 4F93B 3C29A 1FIQA 2BGWA 4UBBA 1L3VA 4BXOA 3K75D 5GTIU 2D6FC 4RQNA 5AM5A 3WKCA 8ICKA 4JUZA 2HBLA 3OTQA 4RU9A 2VIXA 4O3SA 5L1LA 2IA6A 2AQ0A 3CRXA 5DG7A 4DOCA 4DL5A 2F8KA 1NI3A 4DL7A 5KFDA 1KN5A 1IIPA 2PXIA 3H4DA 4P0PB 1S0OA 2WTFA 4RQ6A 5ALFA 2DUYA 1X40A 4J9OA 5HR6A 4IQWA 3WKBA 8ICMA 5DKWA 2VA3A 2HHXA 4XA5A 5KTQA 3GIJA 3AEVA 2B0CA 2IOFK 4I27A 5J2AA 5AKJA 5ALLA 2WF8A 7ICUA 5J2HA 1N2XA 4DLEA 3H7IA 1KDHA 3N97B 1L7NA 4RT2A 9ICFA 2BZFA 2AJQA 4GLXA 2HHQA 2W8KA 3BQ0A 5ALVA 1ZQXA 1QSSA 2E8OA 4K4IA 7ICVA 2R8HA 3T5KA 3TQ1A 4RPZA 4TUSA 2MA1A 3B0YA 2HSZA 1SIJA 4UB3A 2XI9A 4MF2A 1TFRA 3OGUA 1SKRA 3M6ZA 5ALKA 3RB0A 3PX6A 1SV4A 2I5HA 2KMDA 4OCZA 4TQSA 1L6NA 3T5LA 1JALA 3WK7A 4KTQA 2ZIVA 3SV3A 5KG3A 5KFCA 4Y2JA 5KG1A 3M9OB 8ICQA 3BS5A 4P0QB 2E8MA 5J0TA 3G6VA 3H8SA 2C2EA 4M9NA 2VKQA 2W7OA 3AL0B 5KFQA 1A76A 2HCFA 4JV1A 4KLJA 1DGJA 2ISOA 2FDRA 4Y2RA 2P66A 4M9JA 4ECZA 4DL2A 7ICSA 2LI6A 2KV2A 1MA7A 4YXMA 1IG6A 2OYYA 4DSFA 1SV0C 2LKYA 3QU4A 4OJ5A 4IRCA 3DDHA 1IM4A 1NK5A 1RYRA 1LB2B 4QZIA 5AM2A 1PK3A 3QUTA 4FO6A 3OJUA 4X5VA 1HUZA 1ZQJA 4Y2QA 1XO1A 5KFBA 1XSPA 1ZD5A 2YMQA 5KFAA 2BCRA 3HWTA 2H3QA 4BDPA 2WF7A 1N56A 3TFRA 3RFAA 1RM6C 3PO4A 2FMPA 4TUQA 1CI4A 2JRZA 3GIMA 1OUQA 4B9VA 3S6JA 3TI0A 1NK4A 2ZJ5A 4C8NA 5DBCA 3GU3A 3IN5A 1S8OA 2E3TA 1TV9A 1T3QA 4QWBA 2KHQA 9ICRA 1WYGA 2B21A 4US8A 1NZBA 4ECUA 4QNLA 2MUTA 9ICUA 5KL1B 3RH4A 1S76D 5DB6A 2B6GA 1V85A 3D2NA 4YVZA 2LBOA 3M8RA 2ZIXB 4GIBA 4Z6CA 1F44A 2WF5A 3JPOA 2F44A 2PFQA 2RDJA 1PVQA 1PK1B 2V9WA 1ZQDA 2E1EA 3GZFA 3IP4B 5J2FA 3AN1A 2NRZA 5AIAA 5DB8A 4DQPA 1UQVA 8ICLA 1A6SA 2ZIUA 5C5JA 1XU4A 3BQ2A 4RNNA 5KFSA 1K5OA 4PHAA 5KT3A 2KJ8A 4MEXA 7ICQA 5J2DA 4UB8U 2DL0A 2R8KA 2ZXHA 4CRXA 5ALNA 4ZH4A 5KAIU 4DS4A 3RJGA 3C21A 8ICVA 3Q8PB 5AKGA 2Y9UA 2MRLA 2HOFA 4DFDA 3Q8LA 1KKXA 4ELVA 9ICAA 8ICEA 2IHMA 1U45A 7ICPA 4PZOA 1KTQA 2MU2A 3MFIA 3HILA 2HBMA 2ZIVB 3SMVA 8ICYA 3R9KA 2KZ3A 2HW3A 4F3OA 4C8MA 4DF8A 3VC8A 2YY6A 8ICGA 2A19A 4EBEA 5J2GA 1S0VA 5DG9A 4RQ2A 3BJYA 4ED8A 2H3VA 1Z1VA 5G5HA 3KZIU 1SXDA 3H8MA 2KN7A 4P4OA 5EWEA 4I2FA 3HW8A 4K4GA 2KG5A 3PW2A 2MAXA 1KW4A 3PVXA 2C28A 1RDFA 4DSJA 4NLGA 3T5JA 2UVWA 2EZYA 5DG8A 5CA7A 1BPZA 1NJXA 5A0LA 3PX4A 4ECVA 9ICMA 4KMOB 4KLGA 8ICRA 4AP9A 3AQFA 5KT5A 2YMLA 2WFAA 4B6JA 4FBTA 1S0NA 1RG6A 4M04A 4RPYA 3QE9Y 1ZQIA 5J0YA 4JB3A 1ZQUA 3IDWA 4M9HA 2R8GA 1L3SA 4O5EA 7ICFA 2M0NA 4IS7A 3L4PA 2YTUA 5KAFU 4PGQA 2VJ5A 3V7LA 4QZCA 4RNMA 2BPCA 2XIDA 1ZD2P 3RH5A 2GOLA 4F72A 3N4MB 2V4RA 7ICHA 1J97A 5AICA 1Q8KA 3PR4A 1TK0A 3PR5B 4PGXA 4C8OA 4YMMA 1LKYA 4QIWC 5AKEA 3L3FX 1MSWD 5DLFA 1WCLA 1JX4A 2K8CB 2LYAA 4I2JA 2KE7A 3QEAZ 1S9FA 8ICNA 1F5SA 3GV7B 2Y9TA 1DRGA 4BWJA 4ECRA 4YMNA 3EPIA 4IQVA 2KVCA 5CP2A 9ICEA 3RJEA 8ICWA 3K1ZA 4DFJA 2ZTCA 1GO3F 4NL9C 4NLZA 2BCVA 1X9WA 4M0AA 1KFTA 3FC4A 4DFKA 5CB1A 2K60A 4GXIA 3SV4A 5D4BA 2DQNB 2G07A 3TAQA 5ALXA 2IHNA 5DLGA 5EE1A 1U47A 2F8LA 2QB1A 5ALYA 4QWAA 2BKEA 2VA8A 1PK1A 1X2IA 1NK7A 3BZKA 2FPKA 5EOZA 5ALGA 2PFPA 4GC7A 4KX3A 2HDOA 3UPQA 1S5LU 1RQNA 3O0FA 5DQIA 4MFFA 4O5KA 2XCAA 1ZQGA 2RHFA 1UHUA 1X9XA 5AKKA 5KFKA 8ICBA 5D46A 4RQMA 3Q8KA 5KFGA 4UBCA 1QQ5A 5HMMA 1ZQLA 3UXNA 4DQRA 2R8IA 2GWSA 4DSLA 2KTQA 2W03A 4KITB 2PI4A 5J0PA 5EWGA 4FS2A 4ECYA 8ICXA 2P6RA 4TURA 3UXPA 2HVIA 4UATA 5ALIA 4YXJA 2F1IA 4EENA 1PZNA 3SAGA 4F4YA 4ACOA 1P7DA 3SI8A 7ICKA 4C8LA 5L9XA 4DS5A 5L1IA 3LWLA 3BS7A 2J6UA 3TAPA 3A0HU 2A1AA 4YCXA 3N7SC 4Y2PA 4KLSA 4P4MA 4XRHA 3NTUA 3F2DA 3RB6A 2FMQA 3C2LA 1NJWA 4F91B 1TVAA 5AK3A 5ALOA 2JHDA 4QWDA 1S0MA 1Z4OA 5ALJA 3ZI4A 3NVYA 5L1JA 2CXYA 2HOQA 2I6XA 3V72A 5KG6A 1ZQHA 2KD1A 1RQLA 5DBAA 4F5RA 1RPLA 3H8JA 1KSPA 4FS1A 4QZDA 4G3IA 2F1JA 5KFYA 1ZQEA 2NO4A 3NGDA 1CUKA 2Y0SF 1EXNA 3WK9A 3BQ7A 2K4HA 3QUBA 3QUCA 8ICHA 1TAQA 2ZJ8A 3KTQA 2DBYA 4RPXA 3RBEA 1O08A 7ICMA 3OJSA 2ISPA 7ICNA 5HNKA 3LDAA 5AHXA 1V38A 5J0SA 3GV5B 3ORYA 4JMUA 5HHIA 2K4EA 2HOIA 1C7YA 2OCEA 1SZHA 4K4HA 1B43A 4C7YA 2JGAA 2KICA 3PSIA 4C80A 9ICBA 3AM9A 3DEEA 4UAVA 4ED7A 5KFUA 3MDAA 4IRDA 3T79A 2W8LA 2XC9A 4XUSA 1XSLA 8ICSA 5J0XA 5J2JA 4JV0A 5ALEA 3MR2A 4ED2A 1SV0A 1L5UA 2LYHA 3SZ2A 4O3OA 1XS9D 5J0QA 2A1JB 4IRKA 3F53A 7ICLA 3K1RB 1BPEA 3UMGA 4DOBA 4CGZA 1Q3VA 2KSOA 3SD7A 2PKEA 4YFKA 2W04A 3FYHA 3WU2U 3ETRA 3QU5A 4FZMA 1WG8A 2EQYA 2FE9A 3T3FA 3PSFA 2GH1A 1LV5A 2KZZA 2WAQF 1KEJA 4F4KA 4OO1J 3C23A 4M6WB 5CHGA 1KL9A 3MC1A 3KD3A 4LZGA 5C0YA 3N28A 4KLQA 1T8EA 4UB1A 4PH5A 4US9A 2P6UA 5KFFA 2BPGA 3ICXA 2EANA 2NV3A 3QZ8A 2HHUA 1MC8A 2WF6A 2YB4A 3Q8MA 2HI0A 5AKXA 4EBDA 2F76X 2FLPA 3TADC 4I29A 3RBDA 1JROA 3H40A 2HBJA 5B66U 1UA1A 5HR7A 3KKAA 4BJQA 3JPSA 1LVHA 5GTHU 4I2CA 3M9MB 2KZMA 3QX7A 1IV8A 1U4BA 4UQGA 5J2EA 2W54A 2YN4A 1JRPA 4C4TA 2QB0A 5J2IA 1N60A 4FZNA 2WAQC 2WB1F 3BQTA 8ICZA 5ALSA 1MN8A 5JUMA 3GIKA 1QSYA 4CF5A 4NLNA 1D8BA 3U26A 4QZ8A 2HMXA 3D6JA 1N62A 4F4XA 4EEKA 3PNCA 3FAHA 4UB5A 3A0BU 4O3NA 4FE3A 1N5XA 3PMNA 4NM1A 4I2AA 2YQEA 4F4ZA 1NK6A 5DDMA 4B9TA 4RQ0A 4YR2A 1M6YA 1QSLA 4DQQA 4KLTA 4ECWA 1BPYA 1X6IA 2D8CA 4U6PA 1PVPA 3RJHA 3RRHA 5KL8B 2DKZA 1S97A 4PL2A 2W9BA 5J0RA 1ZQ1C 2HHWA 1UCVA 4B9UA 4UAWA 2VJ4A 5J2KA 5J8YC 1SL1A 3HKZF 4RUCA 2RQ5A 2R8JA 3QXGA 5AI6A 4F2RA 1TKDA 3PSTA 4MFCA 2PFNA 3SENA 4BGDA 1V9PA 3WK5A 1VJ5A 5AM0A 5KFXA 3MGIA 1JMSA 3UXOA 1QTMA 2HHSA 3IM1A 3JPPA 2AXTU 1ZQCA 3PW4A 5AKYA 4UAYA 2EDUA 3TFSA 1AROP 3G6YA 5T14A 4FFDA 4QWEA 4R65A 2AGPA 2EH9A 3QU9A 3C2MA 3FDSA 3KZXA 2N1RA 5KT4A 3ONNA 4ECQA 1FO4A 4R8UA 3H0LB 5DBBA 4J9RA 5J29A 9ICLA 2LMRA 3THVA 4RZRA 5KFOA 1SB3C 4I28A 4ED1A 1QQ6A 3AU2A 4GXJA 3ZDBA 2H5XA 2ZIWA 2QLTA 4DCCA 3E2EA 3RTVA 4Y2UA 5DGBA 4J9MA 1D8LA 2KJ9A 4UAUA 2XY5A 1CEZA 1ZJNA 3E0FA 5KFPA 4ED3A 2RLTA 2PI5A 4IR9A 1COKA 1TAMA 3HT3A 3HJEA 4PL1A 2FPMA 5D49A 9ICHA 2IOHA 4QZBA 9ICPA 3ED5A 3SQIA 4QZEA 2NRVA 3KKAC 2EAOA 2NRWA 4ED6A 4O3MA 3QZ7A 3RJKA 1J2MA 5AKIA 2DPJA 5E79U 2ASDA 4F5QA 4USAA 3C1ZA 7ICRA 3CP8A 4QZGA 2W9CB 4KX5A 2L5YA 5IILA 1JUDA 5J0OA 4R64A 3KFUF 2CN1A 5AI4A 1ZQTA 1QQ7A 1BNOA 3KOOA 1ZOLA 2G5IB 2W43A 2BQRA 2I1QA 1RZTA 1U9LA 5DQGA 5AKLA 4F92B 5AK4A 1WUDA 1DOQA 4OJ6A 5F3XB 2E5SA 5IIIA 2W55A 3N7PD 2ALZA 3AMZA 2E1FA 2EAMA 5JU5A 1JIHA 2DFLA 4RUAA 3HKZC 1B0XA 4J03A 4DQSA 3JPNA 4NL9A 4YR0A 1N63A 1JXEA 3F2CA 3PY8A 1L7PA 3H8WA 3NS1A 1BGXT 1ZQAA 1XWLA 2FMSA 5ALDA 4PHPA 1ZXIA 2BQUA 2NYVA 3ZDCA 2C2RA 2KKVA 3V7JA 1N48A 2JH1A 3SAHA 1TK5A 4DO9A 5AI5A 4EZ9A 2BPFA 3C5GA 1HIWA 4YD1A 4CCHA 2AGQA 5AI0A 9ICOA 4Q45A 4CF4A 4JWNA 2KKPA 4C8KA 3I1YA 2XO7A 9ICSA 4ECSA 2VANA 5KG0A 5AM3A 1NKEA 2HVHA 1URJA 3M1YA 3KBBA 2FLNA 4B9NA 2H3ZA 2ZG6A 4YG2A 5CWRA 3VCBA 4R8UB 3TADA 5AI9A 5KFIA 5J2BA 3F2BA 1A0PA 4F5PA
chains in the Genus database with same CATH topology
5JTIA 4NJ8A 2D3DA 2GLEA 1X40A 4PZNA 2LPEA 2E8NA 1LKYA 2K4PA 1SV0C 3BS5B 5F3XB 2DL0A 2QB0A 1X66A 2KE7A 1WWVA 1F0MA 5L1MA 2Y9UA 2Y9TA 2DKXA 4PZOA 1SV0A 2EAMA 3BS7A 5JU5A 2ES6A 3HILA 1PK3A 4MHVA 1OXJA 5JRTA 1B0XA 4NL9C 3K1RB 2LMRA 2KSOA 2K60A 4NL9A 1Z1VA 2QARA 2E8OA 1SXDA 3H8MA 2QB1A 2EAPA 2FE9A 1SGGA 2E8PA 1PK1A 2JV3A 2KG5A 2F3NA 1KW4A 2ESEA 1JI7A 1COKA 2D8CA 1SV4A 2KMDA 2DKZA 1B4FA 3SEIA 1LKYB 2QKQA 4RQNA 5J8YA 3BS5A 3KKAC 1DXSA 2EAOA 1RG6A 1UCVA 2E8MA 1UQVA 2KSOB 2QB0B 3IDWA 2B6GA 1V85A 5J8YC 2QARB 2EANA 1OW5A 1X9XA 2KIVA 3BQ7A 4IS7A 3TACB 2YTUA 2F44A 4RQMA 2F8KA 3SENA 1PK1B 1SXEA 3TADC 3TADA 1V38A 2L5YA 5KNIA 1WWUA 3KKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JTI A;  4NJ8 A;  2D3D A;  2GLE A;  1X40 A;  4PZN A;  2LPE A;  2E8N A;  1LKY A;  2K4P A;  1SV0 C;  3BS5 B;  5F3X B;  2DL0 A;  2QB0 A;  1X66 A;  2KE7 A;  1WWV A;  1F0M A;  5L1M A;  2Y9U A;  2Y9T A;  2DKX A;  4PZO A;  1SV0 A;  2EAM A;  3BS7 A;  5JU5 A;  2ES6 A;  3HIL A;  1PK3 A;  4MHV A;  1OXJ A;  5JRT A;  1B0X A;  4NL9 C;  3K1R B;  2LMR A;  2KSO A;  2K60 A;  4NL9 A;  1Z1V A;  2QAR A;  2E8O A;  1SXD A;  3H8M A;  2QB1 A;  2EAP A;  2FE9 A;  1SGG A;  2E8P A;  1PK1 A;  2JV3 A;  2KG5 A;  2F3N A;  1KW4 A;  2ESE A;  1JI7 A;  1COK A;  2D8C A;  1SV4 A;  2KMD A;  2DKZ A;  1B4F A;  3SEI A;  1LKY B;  2QKQ A;  4RQN A;  5J8Y A;  3BS5 A;  3KKA C;  1DXS A;  2EAO A;  1RG6 A;  1UCV A;  2E8M A;  1UQV A;  2KSO B;  2QB0 B;  3IDW A;  2B6G A;  1V85 A;  5J8Y C;  2QAR B;  2EAN A;  1OW5 A;  1X9X A;  2KIV A;  3BQ7 A;  4IS7 A;  3TAC B;  2YTU A;  2F44 A;  4RQM A;  2F8K A;  3SEN A;  1PK1 B;  1SXE A;  3TAD C;  3TAD A;  1V38 A;  2L5Y A;  5KNI A;  1WWU A;  3KKA A; 
#chains in the Genus database with same CATH topology
 5JTI A;  4NJ8 A;  4RQ7 A;  4C4R A;  2D3D A;  2GLE A;  5EE0 A;  2ZIW B;  4HAI A;  5AK5 A;  4F5N A;  3NVZ A;  3BS5 B;  4M47 A;  1L8L A;  3H0M B;  2ZXI A;  4P0Q A;  4QW8 A;  4KLE A;  1SKW A;  2IMW P;  1BNP A;  1X66 A;  4MFA A;  5L1M A;  3G6X A;  2NRX A;  2DKX A;  3NVV A;  3QNM A;  4I2B A;  5ALM A;  1KRP A;  4J9L A;  4JK1 A;  4KLU A;  2UVR A;  3JPR A;  2PFO A;  2J6T A;  4NLB A;  2XGQ A;  3C2K A;  3RR7 A;  2XVT A;  2JMG A;  2PMZ C;  3TAN A;  4B9M A;  1Z00 B;  2ZIX A;  4JWM A;  3V6J A;  1Y88 A;  5FP0 A;  5G5G A;  2FLL A;  3OHA A;  4Y2X A;  4A8E A;  2OXO A;  7ICT A;  2JV3 A;  2W9C A;  4Z6D A;  3NVW A;  4DSK A;  4F5O A;  2H3F A;  1U48 A;  3M7D A;  7ICE A;  5KG5 A;  2IOF A;  1ZQY A;  3QU7 A;  2W9A A;  2LM4 A;  5BOL A;  3V6H A;  3ZDA A;  2WHE A;  4ED0 A;  3D2Q A;  2Z7J A;  4DSI A;  4AYB C;  1Z19 A;  2EZZ A;  5DQH A;  4UAS A;  2AGO A;  4CE6 A;  1O03 A;  4QJF B;  2K4I A;  1MQ2 A;  2KIV A;  2K89 A;  3M6K A;  3KHG A;  1KBU A;  5IIO A;  5KT2 A;  3SYZ A;  2AHO B;  1ZQZ A;  2V4Q A;  2R18 A;  3B9J A;  1T7P A;  4R63 A;  1U49 A;  2AU0 A;  3TAR A;  2CPR A;  3QUQ A;  1SL2 A;  1CRX A;  1ZQQ A;  9ICI A;  1N5W A;  3GFK B;  1AQ6 A;  1B22 A;  4KN4 A;  3HPO A;  5K4L A;  2C22 A;  3EZ5 A;  4F8R A;  2MUT B;  4F71 A;  2Y1I A;  4ICA A;  4LJX A;  4O9M A;  2Q4T A;  4OJP A;  3PX0 A;  4E0D A;  1BPD A;  1NK0 A;  4I2H A;  8ICU A;  2HHV A;  3KHR A;  3NRW A;  1ZQM A;  9ICK A;  4MHV A;  2BR0 A;  5JRT A;  5KFL A;  5KG4 A;  3PML A;  4LVS A;  1ZQP A;  4P4P A;  4AYB F;  4GXK A;  3IG5 A;  4PHD A;  1Q46 A;  2XCP A;  8ICI A;  2ZIU B;  2WB1 C;  3RH6 A;  4YD2 A;  1NKC A;  2EAP A;  5IIK A;  4Y2Y A;  1SKS A;  3PW5 A;  3NAS A;  9ICJ A;  1RXW A;  2ESE A;  4IR1 A;  2Q0Z X;  4MF8 A;  5KG2 A;  3IRU A;  3OHB A;  2BCU A;  2UVV A;  4KLO A;  1JN3 A;  1SWV A;  1WCN A;  3GDX A;  4PJ0 U;  1NJY A;  1LKY B;  2NRT A;  2GO7 A;  3D2S A;  2FPL A;  3WK6 A;  2ASL A;  3ZD9 A;  1XO0 A;  4NY8 A;  1OW5 A;  8ICC A;  3C1Y A;  5HP4 A;  4O0I A;  9ICN A;  1TK8 A;  3WKD A;  1T3N A;  5BOM A;  4PPX A;  9ICQ A;  2LYB A;  5KFR A;  2XY6 A;  4I2G A;  3IHQ B;  3LYS A;  3NRZ A;  4C7Z A;  2J6S A;  3RJI A;  3TKA A;  4RT3 A;  1XC9 A;  1S10 A;  1BVS A;  1Z00 A;  4GFJ A;  2MSN A;  1N61 A;  4CDG A;  4DEZ A;  7ICI A;  4FBU A;  3UMB A;  2ZJA A;  4Q44 A;  1ZQK A;  2IBK A;  5DB7 A;  1S77 D;  1WWV A;  2F77 X;  4LZD A;  4XQ8 A;  2OWO A;  1ZQO A;  2PMZ F;  4BUG A;  1UPH A;  2KVS A;  4YP3 A;  3UQ0 A;  2KFZ A;  2WF9 A;  8ICP A;  5KT7 A;  1T4G A;  4RQ4 A;  5ALZ A;  2BCS A;  5KFE A;  2AH5 A;  2OM6 A;  1NNL A;  2OHF A;  4Q43 A;  3PZP A;  5KFW A;  2F2A B;  4DFM A;  5IIM A;  3CYM A;  1YZ6 A;  3JPQ A;  4F4W A;  4NLC A;  2W9M A;  1PVR A;  1L7M A;  4Y2T A;  3WKA A;  3ZD8 A;  1KLN A;  4QZH A;  3ALR A;  9ICC A;  3OSN A;  3PV8 A;  3UMC A;  1RXV A;  2M9N A;  1NZP A;  4KLM A;  2DF4 B;  2BDP A;  5KFJ A;  1D8Y A;  4Y2V A;  4JV2 A;  3UQ2 A;  5F9N A;  5KT6 A;  4ELU A;  3Q8Q B;  1UT5 A;  4M9L A;  4ELT A;  4HYK A;  5KFM A;  1SL0 A;  3MR5 A;  2YMM A;  5AM1 A;  3TAC B;  1ZYQ A;  2DWQ A;  2I9G A;  1Q3U A;  2ASJ A;  1DK3 A;  1ED1 A;  5KFV A;  4QZA A;  2RP5 A;  1TE2 A;  1Z3E B;  1ZD3 A;  3OPX A;  2YB1 A;  5J2C A;  2DPI A;  2EZX A;  1WWU A;  3MGV A;  4EZ6 A;  4I2I A;  3HX0 A;  1K1Q A;  3EWA A;  3V7K A;  2XY7 A;  4FZL A;  5EE9 A;  2KFN A;  2JH7 A;  3QYP A;  4NV0 A;  3F5E A;  1FEZ A;  4DL6 A;  1T94 A;  1F0M A;  5H2F U;  2JEF A;  1TAU A;  1FFU A;  5DDY A;  3RR8 A;  3Q8S B;  2K8B B;  4DLG A;  3KHL A;  2JZB A;  3QU2 A;  4F2S A;  4ECX A;  4DL3 A;  3C28 A;  2G06 A;  4B9S A;  2CRX A;  1OXJ A;  1C20 A;  4DSE A;  5J0W A;  3RB3 A;  4KLH A;  5KFN A;  3AUO A;  2BCQ A;  5EE3 A;  4IL6 U;  4RQ3 A;  4YQW A;  3HRD D;  5CJ7 A;  2W7P A;  2HHT A;  3KHH A;  4YN4 A;  4PHE A;  3CNH A;  3BZC A;  4IQU A;  1PUZ A;  2K8A A;  3SR6 A;  4IQT A;  2C2D A;  2ZTD A;  1H38 A;  2ATL A;  1Z1B A;  2E8P A;  4Q8E A;  1V97 A;  1VDV A;  5DB9 A;  5KFZ A;  2KOB A;  9ICW A;  1UA0 A;  5CEH A;  5KFH A;  3JPT A;  2W3R A;  2RDI A;  4BWM A;  4TUP A;  2Y1J A;  4UAZ A;  4NXZ A;  3PW7 A;  2QKQ A;  4DFP A;  5HHH A;  3RRG A;  3PSP A;  2JXJ A;  1ECW A;  4B9L A;  3SAF A;  3IV6 A;  3OSP A;  2BHN A;  3BDP A;  1DK2 A;  1ZET A;  2RRD A;  1SXE A;  3DV9 A;  3I76 A;  4CF3 A;  3MBY A;  2A1J A;  8ICT A;  3ISD A;  1FFV A;  3I28 A;  1A77 A;  4C0Z A;  3ZDE A;  4WJ3 B;  1J2N A;  3MFH A;  4PGY A;  3WK4 A;  5ALQ A;  1BPX A;  8ICO A;  4PZN A;  2KHV A;  2K4P A;  3GV8 B;  1X42 A;  2XGP A;  4O3Q A;  1L8O A;  2KEY A;  1ZQN A;  4EX7 A;  1ZQV A;  3ISB A;  7ICO A;  1QCK A;  5KFT A;  3GIL A;  9ICT A;  3WKE A;  5B5E U;  4M6W A;  3M9N B;  4C4S A;  4RNO A;  5IIN A;  1ZQS A;  1X6J A;  2VA2 A;  3LVW A;  3LWM A;  1HJP A;  3HP6 A;  1NKB A;  1ZQW A;  4ECT A;  3RJF A;  2G5H B;  1QLN A;  4Q8F A;  4DF4 A;  4QZ9 A;  4UAR A;  3EYZ A;  4KLI A;  2JEJ A;  2FJ6 A;  4YR3 A;  5IIJ A;  4BX9 C;  1XNS A;  1MQ3 A;  4EBC A;  4RQ1 A;  1COO A;  5F9L A;  1D9F A;  2H3I A;  4J9P A;  4IC9 A;  4QIW F;  4O5C A;  4P2H A;  1VLB A;  1NK8 A;  1HEK A;  3RB4 A;  4EEL A;  3RJJ A;  5TIS U;  3K4G A;  1JI7 A;  2LM1 A;  1KFS A;  1Z4N A;  1ZRN A;  1RYU A;  3RF9 A;  4U7C A;  4M2Y A;  1B4F A;  1BPB A;  1ZD4 A;  4I2D A;  1YT3 A;  3SEI A;  4QZF A;  5J8Y A;  1RYS A;  2ZUB A;  3ISC A;  1DXS A;  1ZJM A;  5HML A;  5ALH A;  4KLD A;  4UW9 A;  1NJZ A;  2KSO B;  3GQC A;  1HUO A;  2QB0 B;  4J9N A;  4QWC A;  4OJO A;  2KJ5 A;  2JR5 A;  4NWI A;  3AU6 A;  3LK9 A;  1UT8 A;  2QAR B;  3MR6 A;  2KIW A;  3UM9 A;  1KQQ A;  3CW2 C;  4KLF A;  5ALW A;  2JZB B;  3MR3 A;  5ALP A;  3Q8R B;  4G9B A;  4DWI A;  2O6K A;  5ALU A;  1IXR A;  4ZOH C;  3MGH A;  2AQ4 A;  4NM2 A;  1K1S A;  2F1H A;  4BXO B;  4OD0 A;  3QEB Z;  1NOM A;  1L3U A;  2FI1 A;  5AI8 A;  2E8N A;  3V6K A;  4O3R A;  5DGA A;  3H0R B;  2HBK A;  1X9M A;  4KN7 A;  1DGS A;  4O3P A;  3H4B A;  2OH2 A;  1D9D A;  2KNJ A;  2KK0 A;  2BQ3 A;  3LVV A;  4DL4 A;  4YMO A;  2DGZ A;  2ES6 A;  2W9B B;  4DQI A;  1ZRM A;  3EW9 A;  1QH9 A;  3GII A;  4RQ8 A;  4DOA A;  4P0P A;  3MDC A;  1X9S A;  5TZV A;  3ETL A;  4NLK A;  5ALT A;  1SWW A;  2A3V A;  3PW0 A;  5AIB A;  3B0X A;  3M8S A;  1SGG A;  1ZQF A;  3ZDD A;  3MAB A;  2ODG A;  4CNQ A;  3N7R C;  3E58 A;  1XSN A;  2YX8 A;  9ICG A;  5L1K A;  8ICA A;  8ICF A;  9ICX A;  4QW9 A;  3L5K A;  8ICJ A;  4TQR A;  1ZQR A;  2G09 A;  3C5F A;  5AKZ A;  4M9G A;  4R66 A;  2BDU A;  4KLL A;  9ICV A;  2LHT A;  3RAQ A;  5BPC A;  3EPG A;  2G0A A;  7ICJ A;  5J0U A;  2NO5 A;  3J81 j;  3AQE A;  1ZQB A;  4EYH B;  3PO5 A;  4Z6E A;  2JEG A;  3BQ1 A;  4EEY A;  3IG8 A;  2P35 A;  5KNI A;  7ICG A;  5EWF A;  4MEY A;  1L3T A;  2ZUC A;  1NK9 A;  2LPE A;  2YMP A;  4F50 A;  4KMU A;  5CR0 A;  4J9Q A;  1KFD A;  3EUB 2;  2W3S A;  5ALR A;  4I2E A;  5CRX A;  4EX6 A;  4EYI B;  4Y2S A;  4UB2 A;  2OEH A;  3WK8 A;  4UB4 A;  2W11 A;  4UB6 U;  3RAX A;  1JXL A;  2ZUD A;  3FM9 A;  4Z6F A;  4GC6 A;  3F5A A;  5AKH A;  2Y0S C;  4OJL A;  2KP7 A;  4J9S A;  5AM4 A;  2UVU A;  2XIC A;  5KG7 A;  2QAR A;  1SZP A;  4J9K A;  3T5H A;  4RQ5 A;  2ZTE A;  1YZ7 A;  2F3N A;  3NUQ A;  1L7O A;  2JEI A;  5AK6 A;  2G08 A;  4F93 B;  3C29 A;  1FIQ A;  2BGW A;  4UBB A;  1L3V A;  4BXO A;  3K75 D;  5GTI U;  2D6F C;  4RQN A;  5AM5 A;  3WKC A;  8ICK A;  4JUZ A;  2HBL A;  3OTQ A;  4RU9 A;  2VIX A;  4O3S A;  5L1L A;  2IA6 A;  2AQ0 A;  3CRX A;  5DG7 A;  4DOC A;  4DL5 A;  2F8K A;  1NI3 A;  4DL7 A;  5KFD A;  1KN5 A;  1IIP A;  2PXI A;  3H4D A;  4P0P B;  1S0O A;  2WTF A;  4RQ6 A;  5ALF A;  2DUY A;  1X40 A;  4J9O A;  5HR6 A;  4IQW A;  3WKB A;  8ICM A;  5DKW A;  2VA3 A;  2HHX A;  4XA5 A;  5KTQ A;  3GIJ A;  3AEV A;  2B0C A;  2IOF K;  4I27 A;  5J2A A;  5AKJ A;  5ALL A;  2WF8 A;  7ICU A;  5J2H A;  1N2X A;  4DLE A;  3H7I A;  1KDH A;  3N97 B;  1L7N A;  4RT2 A;  9ICF A;  2BZF A;  2AJQ A;  4GLX A;  2HHQ A;  2W8K A;  3BQ0 A;  5ALV A;  1ZQX A;  1QSS A;  2E8O A;  4K4I A;  7ICV A;  2R8H A;  3T5K A;  3TQ1 A;  4RPZ A;  4TUS A;  2MA1 A;  3B0Y A;  2HSZ A;  1SIJ A;  4UB3 A;  2XI9 A;  4MF2 A;  1TFR A;  3OGU A;  1SKR A;  3M6Z A;  5ALK A;  3RB0 A;  3PX6 A;  1SV4 A;  2I5H A;  2KMD A;  4OCZ A;  4TQS A;  1L6N A;  3T5L A;  1JAL A;  3WK7 A;  4KTQ A;  2ZIV A;  3SV3 A;  5KG3 A;  5KFC A;  4Y2J A;  5KG1 A;  3M9O B;  8ICQ A;  3BS5 A;  4P0Q B;  2E8M A;  5J0T A;  3G6V A;  3H8S A;  2C2E A;  4M9N A;  2VKQ A;  2W7O A;  3AL0 B;  5KFQ A;  1A76 A;  2HCF A;  4JV1 A;  4KLJ A;  1DGJ A;  2ISO A;  2FDR A;  4Y2R A;  2P66 A;  4M9J A;  4ECZ A;  4DL2 A;  7ICS A;  2LI6 A;  2KV2 A;  1MA7 A;  4YXM A;  1IG6 A;  2OYY A;  4DSF A;  1SV0 C;  2LKY A;  3QU4 A;  4OJ5 A;  4IRC A;  3DDH A;  1IM4 A;  1NK5 A;  1RYR A;  1LB2 B;  4QZI A;  5AM2 A;  1PK3 A;  3QUT A;  4FO6 A;  3OJU A;  4X5V A;  1HUZ A;  1ZQJ A;  4Y2Q A;  1XO1 A;  5KFB A;  1XSP A;  1ZD5 A;  2YMQ A;  5KFA A;  2BCR A;  3HWT A;  2H3Q A;  4BDP A;  2WF7 A;  1N56 A;  3TFR A;  3RFA A;  1RM6 C;  3PO4 A;  2FMP A;  4TUQ A;  1CI4 A;  2JRZ A;  3GIM A;  1OUQ A;  4B9V A;  3S6J A;  3TI0 A;  1NK4 A;  2ZJ5 A;  4C8N A;  5DBC A;  3GU3 A;  3IN5 A;  1S8O A;  2E3T A;  1TV9 A;  1T3Q A;  4QWB A;  2KHQ A;  9ICR A;  1WYG A;  2B21 A;  4US8 A;  1NZB A;  4ECU A;  4QNL A;  2MUT A;  9ICU A;  5KL1 B;  3RH4 A;  1S76 D;  5DB6 A;  2B6G A;  1V85 A;  3D2N A;  4YVZ A;  2LBO A;  3M8R A;  2ZIX B;  4GIB A;  4Z6C A;  1F44 A;  2WF5 A;  3JPO A;  2F44 A;  2PFQ A;  2RDJ A;  1PVQ A;  1PK1 B;  2V9W A;  1ZQD A;  2E1E A;  3GZF A;  3IP4 B;  5J2F A;  3AN1 A;  2NRZ A;  5AIA A;  5DB8 A;  4DQP A;  1UQV A;  8ICL A;  1A6S A;  2ZIU A;  5C5J A;  1XU4 A;  3BQ2 A;  4RNN A;  5KFS A;  1K5O A;  4PHA A;  5KT3 A;  2KJ8 A;  4MEX A;  7ICQ A;  5J2D A;  4UB8 U;  2DL0 A;  2R8K A;  2ZXH A;  4CRX A;  5ALN A;  4ZH4 A;  5KAI U;  4DS4 A;  3RJG A;  3C21 A;  8ICV A;  3Q8P B;  5AKG A;  2Y9U A;  2MRL A;  2HOF A;  4DFD A;  3Q8L A;  1KKX A;  4ELV A;  9ICA A;  8ICE A;  2IHM A;  1U45 A;  7ICP A;  4PZO A;  1KTQ A;  2MU2 A;  3MFI A;  3HIL A;  2HBM A;  2ZIV B;  3SMV A;  8ICY A;  3R9K A;  2KZ3 A;  2HW3 A;  4F3O A;  4C8M A;  4DF8 A;  3VC8 A;  2YY6 A;  8ICG A;  2A19 A;  4EBE A;  5J2G A;  1S0V A;  5DG9 A;  4RQ2 A;  3BJY A;  4ED8 A;  2H3V A;  1Z1V A;  5G5H A;  3KZI U;  1SXD A;  3H8M A;  2KN7 A;  4P4O A;  5EWE A;  4I2F A;  3HW8 A;  4K4G A;  2KG5 A;  3PW2 A;  2MAX A;  1KW4 A;  3PVX A;  2C28 A;  1RDF A;  4DSJ A;  4NLG A;  3T5J A;  2UVW A;  2EZY A;  5DG8 A;  5CA7 A;  1BPZ A;  1NJX A;  5A0L A;  3PX4 A;  4ECV A;  9ICM A;  4KMO B;  4KLG A;  8ICR A;  4AP9 A;  3AQF A;  5KT5 A;  2YML A;  2WFA A;  4B6J A;  4FBT A;  1S0N A;  1RG6 A;  4M04 A;  4RPY A;  3QE9 Y;  1ZQI A;  5J0Y A;  4JB3 A;  1ZQU A;  3IDW A;  4M9H A;  2R8G A;  1L3S A;  4O5E A;  7ICF A;  2M0N A;  4IS7 A;  3L4P A;  2YTU A;  5KAF U;  4PGQ A;  2VJ5 A;  3V7L A;  4QZC A;  4RNM A;  2BPC A;  2XID A;  1ZD2 P;  3RH5 A;  2GOL A;  4F72 A;  3N4M B;  2V4R A;  7ICH A;  1J97 A;  5AIC A;  1Q8K A;  3PR4 A;  1TK0 A;  3PR5 B;  4PGX A;  4C8O A;  4YMM A;  1LKY A;  4QIW C;  5AKE A;  3L3F X;  1MSW D;  5DLF A;  1WCL A;  1JX4 A;  2K8C B;  2LYA A;  4I2J A;  2KE7 A;  3QEA Z;  1S9F A;  8ICN A;  1F5S A;  3GV7 B;  2Y9T A;  1DRG A;  4BWJ A;  4ECR A;  4YMN A;  3EPI A;  4IQV A;  2KVC A;  5CP2 A;  9ICE A;  3RJE A;  8ICW A;  3K1Z A;  4DFJ A;  2ZTC A;  1GO3 F;  4NL9 C;  4NLZ A;  2BCV A;  1X9W A;  4M0A A;  1KFT A;  3FC4 A;  4DFK A;  5CB1 A;  2K60 A;  4GXI A;  3SV4 A;  5D4B A;  2DQN B;  2G07 A;  3TAQ A;  5ALX A;  2IHN A;  5DLG A;  5EE1 A;  1U47 A;  2F8L A;  2QB1 A;  5ALY A;  4QWA A;  2BKE A;  2VA8 A;  1PK1 A;  1X2I A;  1NK7 A;  3BZK A;  2FPK A;  5EOZ A;  5ALG A;  2PFP A;  4GC7 A;  4KX3 A;  2HDO A;  3UPQ A;  1S5L U;  1RQN A;  3O0F A;  5DQI A;  4MFF A;  4O5K A;  2XCA A;  1ZQG A;  2RHF A;  1UHU A;  1X9X A;  5AKK A;  5KFK A;  8ICB A;  5D46 A;  4RQM A;  3Q8K A;  5KFG A;  4UBC A;  1QQ5 A;  5HMM A;  1ZQL A;  3UXN A;  4DQR A;  2R8I A;  2GWS A;  4DSL A;  2KTQ A;  2W03 A;  4KIT B;  2PI4 A;  5J0P A;  5EWG A;  4FS2 A;  4ECY A;  8ICX A;  2P6R A;  4TUR A;  3UXP A;  2HVI A;  4UAT A;  5ALI A;  4YXJ A;  2F1I A;  4EEN A;  1PZN A;  3SAG A;  4F4Y A;  4ACO A;  1P7D A;  3SI8 A;  7ICK A;  4C8L A;  5L9X A;  4DS5 A;  5L1I A;  3LWL A;  3BS7 A;  2J6U A;  3TAP A;  3A0H U;  2A1A A;  4YCX A;  3N7S C;  4Y2P A;  4KLS A;  4P4M A;  4XRH A;  3NTU A;  3F2D A;  3RB6 A;  2FMQ A;  3C2L A;  1NJW A;  4F91 B;  1TVA A;  5AK3 A;  5ALO A;  2JHD A;  4QWD A;  1S0M A;  1Z4O A;  5ALJ A;  3ZI4 A;  3NVY A;  5L1J A;  2CXY A;  2HOQ A;  2I6X A;  3V72 A;  5KG6 A;  1ZQH A;  2KD1 A;  1RQL A;  5DBA A;  4F5R A;  1RPL A;  3H8J A;  1KSP A;  4FS1 A;  4QZD A;  4G3I A;  2F1J A;  5KFY A;  1ZQE A;  2NO4 A;  3NGD A;  1CUK A;  2Y0S F;  1EXN A;  3WK9 A;  3BQ7 A;  2K4H A;  3QUB A;  3QUC A;  8ICH A;  1TAQ A;  2ZJ8 A;  3KTQ A;  2DBY A;  4RPX A;  3RBE A;  1O08 A;  7ICM A;  3OJS A;  2ISP A;  7ICN A;  5HNK A;  3LDA A;  5AHX A;  1V38 A;  5J0S A;  3GV5 B;  3ORY A;  4JMU A;  5HHI A;  2K4E A;  2HOI A;  1C7Y A;  2OCE A;  1SZH A;  4K4H A;  1B43 A;  4C7Y A;  2JGA A;  2KIC A;  3PSI A;  4C80 A;  9ICB A;  3AM9 A;  3DEE A;  4UAV A;  4ED7 A;  5KFU A;  3MDA A;  4IRD A;  3T79 A;  2W8L A;  2XC9 A;  4XUS A;  1XSL A;  8ICS A;  5J0X A;  5J2J A;  4JV0 A;  5ALE A;  3MR2 A;  4ED2 A;  1SV0 A;  1L5U A;  2LYH A;  3SZ2 A;  4O3O A;  1XS9 D;  5J0Q A;  2A1J B;  4IRK A;  3F53 A;  7ICL A;  3K1R B;  1BPE A;  3UMG A;  4DOB A;  4CGZ A;  1Q3V A;  2KSO A;  3SD7 A;  2PKE A;  4YFK A;  2W04 A;  3FYH A;  3WU2 U;  3ETR A;  3QU5 A;  4FZM A;  1WG8 A;  2EQY A;  2FE9 A;  3T3F A;  3PSF A;  2GH1 A;  1LV5 A;  2KZZ A;  2WAQ F;  1KEJ A;  4F4K A;  4OO1 J;  3C23 A;  4M6W B;  5CHG A;  1KL9 A;  3MC1 A;  3KD3 A;  4LZG A;  5C0Y A;  3N28 A;  4KLQ A;  1T8E A;  4UB1 A;  4PH5 A;  4US9 A;  2P6U A;  5KFF A;  2BPG A;  3ICX A;  2EAN A;  2NV3 A;  3QZ8 A;  2HHU A;  1MC8 A;  2WF6 A;  2YB4 A;  3Q8M A;  2HI0 A;  5AKX A;  4EBD A;  2F76 X;  2FLP A;  3TAD C;  4I29 A;  3RBD A;  1JRO A;  3H40 A;  2HBJ A;  5B66 U;  1UA1 A;  5HR7 A;  3KKA A;  4BJQ A;  3JPS A;  1LVH A;  5GTH U;  4I2C A;  3M9M B;  2KZM A;  3QX7 A;  1IV8 A;  1U4B A;  4UQG A;  5J2E A;  2W54 A;  2YN4 A;  1JRP A;  4C4T A;  2QB0 A;  5J2I A;  1N60 A;  4FZN A;  2WAQ C;  2WB1 F;  3BQT A;  8ICZ A;  5ALS A;  1MN8 A;  5JUM A;  3GIK A;  1QSY A;  4CF5 A;  4NLN A;  1D8B A;  3U26 A;  4QZ8 A;  2HMX A;  3D6J A;  1N62 A;  4F4X A;  4EEK A;  3PNC A;  3FAH A;  4UB5 A;  3A0B U;  4O3N A;  4FE3 A;  1N5X A;  3PMN A;  4NM1 A;  4I2A A;  2YQE A;  4F4Z A;  1NK6 A;  5DDM A;  4B9T A;  4RQ0 A;  4YR2 A;  1M6Y A;  1QSL A;  4DQQ A;  4KLT A;  4ECW A;  1BPY A;  1X6I A;  2D8C A;  4U6P A;  1PVP A;  3RJH A;  3RRH A;  5KL8 B;  2DKZ A;  1S97 A;  4PL2 A;  2W9B A;  5J0R A;  1ZQ1 C;  2HHW A;  1UCV A;  4B9U A;  4UAW A;  2VJ4 A;  5J2K A;  5J8Y C;  1SL1 A;  3HKZ F;  4RUC A;  2RQ5 A;  2R8J A;  3QXG A;  5AI6 A;  4F2R A;  1TKD A;  3PST A;  4MFC A;  2PFN A;  3SEN A;  4BGD A;  1V9P A;  3WK5 A;  1VJ5 A;  5AM0 A;  5KFX A;  3MGI A;  1JMS A;  3UXO A;  1QTM A;  2HHS A;  3IM1 A;  3JPP A;  2AXT U;  1ZQC A;  3PW4 A;  5AKY A;  4UAY A;  2EDU A;  3TFS A;  1ARO P;  3G6Y A;  5T14 A;  4FFD A;  4QWE A;  4R65 A;  2AGP A;  2EH9 A;  3QU9 A;  3C2M A;  3FDS A;  3KZX A;  2N1R A;  5KT4 A;  3ONN A;  4ECQ A;  1FO4 A;  4R8U A;  3H0L B;  5DBB A;  4J9R A;  5J29 A;  9ICL A;  2LMR A;  3THV A;  4RZR A;  5KFO A;  1SB3 C;  4I28 A;  4ED1 A;  1QQ6 A;  3AU2 A;  4GXJ A;  3ZDB A;  2H5X A;  2ZIW A;  2QLT A;  4DCC A;  3E2E A;  3RTV A;  4Y2U A;  5DGB A;  4J9M A;  1D8L A;  2KJ9 A;  4UAU A;  2XY5 A;  1CEZ A;  1ZJN A;  3E0F A;  5KFP A;  4ED3 A;  2RLT A;  2PI5 A;  4IR9 A;  1COK A;  1TAM A;  3HT3 A;  3HJE A;  4PL1 A;  2FPM A;  5D49 A;  9ICH A;  2IOH A;  4QZB A;  9ICP A;  3ED5 A;  3SQI A;  4QZE A;  2NRV A;  3KKA C;  2EAO A;  2NRW A;  4ED6 A;  4O3M A;  3QZ7 A;  3RJK A;  1J2M A;  5AKI A;  2DPJ A;  5E79 U;  2ASD A;  4F5Q A;  4USA A;  3C1Z A;  7ICR A;  3CP8 A;  4QZG A;  2W9C B;  4KX5 A;  2L5Y A;  5IIL A;  1JUD A;  5J0O A;  4R64 A;  3KFU F;  2CN1 A;  5AI4 A;  1ZQT A;  1QQ7 A;  1BNO A;  3KOO A;  1ZOL A;  2G5I B;  2W43 A;  2BQR A;  2I1Q A;  1RZT A;  1U9L A;  5DQG A;  5AKL A;  4F92 B;  5AK4 A;  1WUD A;  1DOQ A;  4OJ6 A;  5F3X B;  2E5S A;  5III A;  2W55 A;  3N7P D;  2ALZ A;  3AMZ A;  2E1F A;  2EAM A;  5JU5 A;  1JIH A;  2DFL A;  4RUA A;  3HKZ C;  1B0X A;  4J03 A;  4DQS A;  3JPN A;  4NL9 A;  4YR0 A;  1N63 A;  1JXE A;  3F2C A;  3PY8 A;  1L7P A;  3H8W A;  3NS1 A;  1BGX T;  1ZQA A;  1XWL A;  2FMS A;  5ALD A;  4PHP A;  1ZXI A;  2BQU A;  2NYV A;  3ZDC A;  2C2R A;  2KKV A;  3V7J A;  1N48 A;  2JH1 A;  3SAH A;  1TK5 A;  4DO9 A;  5AI5 A;  4EZ9 A;  2BPF A;  3C5G A;  1HIW A;  4YD1 A;  4CCH A;  2AGQ A;  5AI0 A;  9ICO A;  4Q45 A;  4CF4 A;  4JWN A;  2KKP A;  4C8K A;  3I1Y A;  2XO7 A;  9ICS A;  4ECS A;  2VAN A;  5KG0 A;  5AM3 A;  1NKE A;  2HVH A;  1URJ A;  3M1Y A;  3KBB A;  2FLN A;  4B9N A;  2H3Z A;  2ZG6 A;  4YG2 A;  5CWR A;  3VCB A;  4R8U B;  3TAD A;  5AI9 A;  5KFI A;  5J2B A;  3F2B A;  1A0P A;  4F5P A; 
#chains in the Genus database with same CATH homology
 5JTI A;  4NJ8 A;  2D3D A;  2GLE A;  1X40 A;  4PZN A;  2LPE A;  2E8N A;  1LKY A;  2K4P A;  1SV0 C;  3BS5 B;  5F3X B;  2DL0 A;  2QB0 A;  1X66 A;  2KE7 A;  1WWV A;  1F0M A;  5L1M A;  2Y9U A;  2Y9T A;  2DKX A;  4PZO A;  1SV0 A;  2EAM A;  3BS7 A;  5JU5 A;  2ES6 A;  3HIL A;  1PK3 A;  4MHV A;  1OXJ A;  5JRT A;  1B0X A;  4NL9 C;  3K1R B;  2LMR A;  2KSO A;  2K60 A;  4NL9 A;  1Z1V A;  2QAR A;  2E8O A;  1SXD A;  3H8M A;  2QB1 A;  2EAP A;  2FE9 A;  1SGG A;  2E8P A;  1PK1 A;  2JV3 A;  2KG5 A;  2F3N A;  1KW4 A;  2ESE A;  1JI7 A;  1COK A;  2D8C A;  1SV4 A;  2KMD A;  2DKZ A;  1B4F A;  3SEI A;  1LKY B;  2QKQ A;  4RQN A;  5J8Y A;  3BS5 A;  3KKA C;  1DXS A;  2EAO A;  1RG6 A;  1UCV A;  2E8M A;  1UQV A;  2KSO B;  2QB0 B;  3IDW A;  2B6G A;  1V85 A;  5J8Y C;  2QAR B;  2EAN A;  1OW5 A;  1X9X A;  2KIV A;  3BQ7 A;  4IS7 A;  3TAC B;  2YTU A;  2F44 A;  4RQM A;  2F8K A;  3SEN A;  1PK1 B;  1SXE A;  3TAD C;  3TAD A;  1V38 A;  2L5Y A;  5KNI A;  1WWU A;  3KKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...