3SENA

Structure of caskin1 tandem sams
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
KSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA01
3SENA 5KNIA 1UCVA 1SXEA 4IS7A 2E8NA 5F3XB 2KMDA 2K60A 2LMRA 2QARA 1X66A 2L5YA 3TADA 2EANA 2QARB 1PK1A 1LKYB 1PK1B 1SXDA 2KG5A 2EAPA 2Y9UA 1UQVA 2QB1A 1B0XA 3KKAC 2F44A 2EAOA 2E8PA 2D3DA 4NL9C 5JTIA 2QB0A 1COKA 1SGGA 2QB0B 4MHVA 2JV3A 5JU5A 1Z1VA 3TADC 2F3NA 2KIVA 1LKYA 2ES6A 2QKQA 1B4FA 3K1RB 5J8YA 2Y9TA 2LPEA 1WWUA 1RG6A 4RQMA 5JRTA 2DKXA 2E8MA 4NJ8A 1X40A 3BS5A 2D8CA 3BS5B 1V38A 2ESEA 1X9XA 2DKZA 2DL0A 2E8OA 1V85A 3HILA 2KSOB 4PZOA 1PK3A 2YTUA 1SV0A 2FE9A 3IDWA 2KE7A 1F0MA 3BQ7A 2GLEA 2EAMA 4PZNA 5L1MA 3BS7A 1WWVA 2K4PA 1OW5A 5J8YC 1JI7A 3H8MA 2KSOA 3SEIA 1SV4A 4RQNA 3TACB 2F8KA 1KW4A 3KKAA 2B6GA 1SV0C 1DXSA 4NL9A 1OXJA
chains in the Genus database with same CATH superfamily
5KNIA 3TQ1A 2YB1A 5KT6A 1LV5A 2H3IA 5KFOA 4M6WB 1L8LA 4GXKA 1TAMA 3AQFA 2JEFA 2V9WA 2H3VA 2PMZF 5AI9A 3ED5A 5IIOA 5DB6A 1IV8A 2O6KA 4HYKA 4ECYA 2Y9UA 2ZTEA 1TK8A 3NRWA 3OPXA 9ICTA 5D49A 1FIQA 2OH2A 2D3DA 4YFKA 2BCVA 4PJ0U 4DEZA 1ZD5A 2ZIUB 4YR3A 1ZQBA 3RBEA 9ICSA 4QZ9A 2HVHA 4DQPA 2ZJ5A 3LVWA 4DSKA 1T7PA 3AMZA 5ALHA 3HW8A 3GV8B 4BXOB 7ICEA 4WJ3B 3RB0A 5J0OA 3F53A 4RQMA 5H2FU 4J9MA 4CRXA 2ZUCA 4P4PA 3QEBZ 4EEYA 3WKCA 4DFKA 2HOFA 3QE9Y 1VDVA 4UARA 4UBCA 2DL0A 3JPQA 7ICQA 2KHQA 1PK3A 1S77D 2XC9A 1RZTA 4Q8EA 1Z00A 2RDIA 5C0YA 2WAQC 3WKEA 4O3QA 4DOCA 4CGZA 2G08A 4BJQA 2YX8A 3RJHA 3O0FA 4Y2UA 1LVHA 1ZQZA 2LYHA 2HHXA 2KFNA 9ICVA 4FZLA 3L5KA 1NZPA 3ALRA 4F4WA 1U9LA 2GOLA 3RH5A 2KFZA 4YXMA 4C4SA 5KG6A 3TFRA 1DXSA 4DQQA 5KG7A 1B4FA 2DFLA 1BPZA 1ZYQA 2PFQA 2C2EA 4KLHA 5DBAA 3JPOA 2F2AB 3TARA 2JHDA 3SQIA 3TADA 1D9DA 2EANA 5B5EU 1XO1A 1SWWA 4C8KA 7ICRA 3PY8A 3C28A 2BCUA 7ICIA 2JZBB 1TV9A 2G5IB 4B9LA 1IM4A 3A0HU 4CDGA 1ZQAA 3OJUA 2RQ5A 1RXWA 5KT2A 1KFTA 2PXIA 3Q8PB 3LYSA 4U6PA 4MFFA 2XO7A 2KNJA 5L1LA 2Y0SC 5D46A 3C1YA 2NYVA 1NJYA 4XA5A 2DQNB 5J2EA 4CCHA 1AQ6A 2P35A 1PVPA 3H4BA 2DUYA 3AUOA 4C8OA 5AM5A 4MF8A 4IQUA 2WHEA 1DGSA 1GO3F 3HPOA 2MSNA 1X40A 3V7KA 1RDFA 1VJ5A 4J9QA 4ECQA 2YB4A 5AKIA 4PZOA 1NK4A 3KBBA 3PMLA 2MUTB 1F0MA 3PX4A 5AI0A 4I28A 4J9PA 7ICHA 3IRUA 4EYIB 5KFGA 1S5LU 2NV3A 5DLGA 4BWJA 1SKSA 5DG7A 1RYUA 3I1YA 3WK6A 4QW8A 5KFLA 3HWTA 1ZQSA 4OJLA 2V4RA 2ALZA 9ICRA 3EZ5A 3MFIA 3KHHA 4QJFB 3NVYA 3HKZF 4JV1A 1IXRA 5AKJA 5IINA 5HHIA 4P0PA 3KFUF 1S97A 2HBJA 4OJ5A 3QUTA 1MC8A 4RQ2A 4EBCA 3N4MB 3M6KA 2KVSA 4A8EA 1L8OA 2YQEA 4ED3A 3T5HA 1RM6C 4QW9A 5FP0A 4ECXA 3IM1A 9ICXA 5DG8A 4NLCA 3RFAA 3RH4A 5CRXA 4KN7A 7ICOA 4Y2PA 3CRXA 2LM1A 5F9NA 3C2MA 3TANA 4KLUA 1T4GA 4PHEA 1QSSA 3MFHA 2YMPA 4O3PA 5DB7A 4Y2QA 4G9BA 2HHSA 4DL3A 5ALNA 4MF2A 3LWMA 4YR0A 4TUQA 3F5EA 1LKYA 2KJ5A 4EELA 5HR7A 3DV9A 4RT2A 2G09A 3WK7A 3PW0A 4UAZA 3QNMA 2A1AA 2FMSA 5D4BA 1MQ2A 4DSLA 2NRWA 5KG3A 1N60A 4C8MA 4PHDA 2ESEA 2KJ8A 2DKZA 4Y2SA 2WF8A 4DLGA 4EBDA 9ICGA 2EZZA 4UB5A 4O9MA 4ED7A 4NLBA 3GV5B 3OJSA 5KG2A 1KQQA 4I2EA 2ZJAA 4DWIA 4M9LA 3WK8A 2GLEA 5CEHA 5L9XA 2B21A 2ZUBA 1TAUA 8ICKA 3UMBA 1PUZA 3UQ2A 1XC9A 2OEHA 4JB3A 4CNQA 4RQ6A 3FC4A 4PPXA 4TUSA 1IIPA 2XIDA 2DPIA 2R8IA 1KRPA 2XVTA 2HBLA 3D6JA 2GO7A 8ICPA 4NL9A 4FBUA 4EX7A 1RYRA 3MGHA 1BVSA 2ISOA 2KKVA 2ZJ8A 1L7OA 3H0RB 2J6UA 2C22A 5HMMA 2EQYA 2FDRA 3WK9A 1PK1A 2JR5A 3K1ZA 2LM4A 5IILA 9ICJA 2P6UA 4I2CA 4B9NA 5EE1A 3H0MB 4F5QA 4DOAA 1ZQVA 1SL1A 3PSIA 2VIXA 2QB0A 4FZMA 4JV2A 2JRZA 3U26A 4F5OA 3TADC 1X9MA 2KIVA 3JPTA 5JRTA 2DKXA 3F2BA 4IR1A 2J6SA 4KLIA 3A0BU 3QXGA 5EE0A 3E0FA 2XCAA 4YVZA 4UAUA 3H8JA 4DS5A 2OYYA 4ELVA 2KE7A 4BUGA 4ED0A 4P4MA 3OSPA 5J29A 2ZTCA 3Q8KA 3ORYA 3BQ7A 3G6YA 5DQGA 2NRXA 2ZIVA 3EPGA 5KFUA 8ICCA 5ALOA 5AM0A 2UVRA 1Q8KA 4R65A 5BPCA 5J2JA 7ICGA 1SWVA 4UB1A 4JK1A 1JX4A 4RUCA 5AK4A 4C0ZA 2E1EA 3H8SA 3IV6A 4QZGA 5A0LA 2LYAA 3QZ7A 4OCZA 1J2NA 2HSZA 1KFSA 4R8UA 1X66A 4Q45A 1WUDA 2IBKA 2FPMA 3MR3A 3ONNA 1WG8A 1QH9A 3N7RC 3SV3A 4YXJA 8ICEA 4RQ8A 1LKYB 3RTVA 2KTQA 3SMVA 3WKAA 3PSTA 4ACOA 2F44A 3TFSA 8ICJA 3Q8RB 5ALYA 1XNSA 4JWMA 5KAFU 2XGQA 1BPXA 3MC1A 2ZIWA 3CW2C 3JPSA 2W11A 5AKEA 4Y2RA 1D8YA 5KFHA 1ZQLA 5KFEA 1NKCA 1ZQTA 1QTMA 5GTIU 1D8LA 2F1IA 5DDMA 3TKAA 3C2LA 2D8CA 1A6SA 2ZIXA 2NRZA 2YTUA 1RPLA 4QWAA 4UATA 4UB2A 4RQ0A 4J9RA 4XUSA 1DRGA 3RJGA 3GDXA 1HEKA 5BOLA 1OW5A 4DSIA 2RDJA 4KLDA 5J0SA 5KFVA 2DWQA 3IHQB 3SAFA 3PZPA 2W9CA 2WF5A 3MGVA 4OJOA 2CN1A 1YZ7A 4UAYA 3GFKB 1X6JA 2YMQA 3D2SA 5AKXA 4XQ8A 1UT8A 3WK4A 4CF4A 5F3XB 4DL4A 3EPIA 1U45A 3NASA 1EXNA 3QUBA 2WB1F 4RQ5A 2BDUA 4I2BA 3ISDA 3ZDCA 4RNOA 3MDAA 3QUCA 1Z4OA 4B9SA 1JALA 1ZD4A 3ZD9A 2EAPA 2IOHA 3M8SA 3E2EA 1N61A 5CWRA 4QZAA 3QU2A 5AK3A 4RQ1A 3PVXA 3M9MB 1ZQWA 4NL9C 2XY7A 3GIKA 4I2DA 4NXZA 4RUAA 1S0NA 2C2DA 4KTQA 5AM2A 5J2AA 5E79U 4PHPA 1ZQDA 1UA1A 5J0YA 4KMOB 3AM9A 2PKEA 2QKQA 2ZXIA 4LJXA 3F5AA 5J0UA 1CUKA 3ZI4A 4C7ZA 2A1JB 1ZOLA 1Q3VA 3OGUA 2F77X 4UB4A 4F4YA 3IG5A 1T8EA 3RAQA 2UVVA 3HILA 1SV0A 1CI4A 1B22A 2AH5A 3UM9A 5KT3A 4AYBC 4ED2A 4DLEA 2K4IA 3RB3A 2K4PA 4IRDA 3QZ8A 7ICJA 3QUQA 2KZMA 8ICFA 5HHHA 2AJQA 1ZQFA 1QCKA 3SEIA 1KLNA 3H4DA 1JIHA 1BPDA 4C8NA 5DBCA 5J2CA 1L3UA 1UPHA 9ICPA 4IS7A 4O0IA 2E8NA 2W55A 3H7IA 2UVWA 2BZFA 4P0QB 4O5EA 2XICA 2QARB 2LYBA 4TQSA 4O3NA 2F76X 1ZJMA 1KBUA 4I29A 4P2HA 1J97A 3THVA 4NLGA 1ZJNA 4IQVA 5AI4A 3R9KA 2JV3A 4RNNA 1MN8A 3C21A 2DGZA 5AKGA 1HUZA 7ICSA 5J2IA 4EZ6A 3WKDA 4PL2A 2ISPA 4YQWA 3FM9A 7ICVA 4KLQA 3BS5A 1KSPA 2BGWA 2KV2A 2BHNA 2E8OA 5KFSA 2F8LA 2K8AA 1X9WA 3Q8SB 2IMWP 5ALZA 5ALQA 4QIWF 2JXJA 1U4BA 5IIIA 2EAMA 3B0YA 1P7DA 5J0RA 2CXYA 2BPCA 5EE9A 4YD1A 2VJ4A 1L6NA 4Q8FA 2P66A 5J2KA 4TURA 4J9SA 3TACB 1Z1BA 2OHFA 1KW4A 1SL2A 2YN4A 7ICUA 3F2DA 5DLFA 5ALMA 1Y88A 1CRXA 4DFJA 1UCVA 4YG2A 2VJ5A 4C80A 2FLPA 2YMMA 4UAVA 1QQ7A 4F71A 1XS9D 9ICLA 4NLKA 2KOBA 4FO6A 4C4RA 2AGOA 1SXDA 1ZD2P 1HUOA 5G5GA 8ICNA 4GLXA 5DBBA 1L7NA 4FS1A 4F2SA 3KZXA 1FFVA 3M7DA 5JTIA 1LB2B 3SV4A 8ICLA 5ALWA 1SZHA 1BPYA 9ICOA 4DSFA 5AK6A 4F72A 7ICMA 3H8WA 3EWAA 5KFRA 5ALKA 4ELTA 1ZRMA 9ICKA 2E8MA 5KFXA 5ALFA 3CNHA 3B9JA 2KP7A 4F8RA 1N5WA 2PMZC 3EW9A 4AP9A 9ICBA 4R64A 2HHUA 3PO5A 5J0XA 5AI8A 5ALVA 3IDWA 1ZQHA 1ZQGA 1WCLA 5ALXA 3WK5A 4NLZA 1Z00B 1PVQA 1ZD3A 2ZTDA 5KG5A 2E3TA 2EZXA 3QU9A 2W04A 5J2FA 2FPKA 1FO4A 4J9KA 1NKEA 1KN5A 2OWOA 4QWCA 4QZIA 4I2AA 3GIJA 4I2HA 3QEAZ 3GZFA 4RQNA 3BQ2A 3WU2U 3RJFA 3JPNA 2WFAA 4IC9A 1SV0C 5AKLA 1T94A 3SENA 1BGXT 1O03A 1SL0A 4QZFA 3MBYA 4RQ4A 2KMDA 4ECUA 5ALPA 1XO0A 1ZQUA 1COOA 5AM4A 2YY6A 3M1YA 3GIMA 4KLJA 3RJEA 4RPXA 1X42A 2GH1A 3ZDAA 3LK9A 2PFOA 3K75D 2YMLA 4I2GA 3OHAA 2W7PA 3SAGA 1ZQNA 3DEEA 2I5HA 2EAOA 5J2HA 5KFIA 1O08A 3KD3A 1HIWA 4MHVA 3PW2A 2BQ3A 1DGJA 4M9HA 4PHAA 2JGAA 2KEYA 1SB3C 1IG6A 4BWMA 2Y9TA 1WWUA 1NK5A 1FEZA 3PMNA 2HVIA 3QU5A 5L1JA 3TAQA 1ZQPA 3V6HA 7ICTA 5AKHA 2NO5A 4ECWA 1ZQOA 4HAIA 1U47A 1V85A 1JROA 2K89A 1L3TA 4ECRA 5KFTA 4G3IA 2OCEA 3RJKA 8ICXA 2H5XA 1UHUA 5KG4A 4ELUA 2G0AA 9ICUA 3MABA 1T3NA 4PZNA 4PGXA 2G06A 2HDOA 1NK6A 4I27A 3JPPA 3ZD8A 3H40A 2BCRA 2KSOA 1TE2A 2HMXA 1S0OA 4K4GA 3M9NB 2W54A 3KKAA 3QU7A 4P0PB 2J6TA 5KG1A 1S9FA 1OXJA 4P4OA 1ZETA 4M6WA 1H38A 4O5KA 2R8HA 1NOMA 3M8RA 3TI0A 4F2RA 2L5YA 1D8BA 3NVVA 2ZXHA 4MFAA 3DDHA 1A76A 2W7OA 3BZKA 5ALSA 1NJZA 3AU2A 1B0XA 4PH5A 4F4XA 2DF4B 2BQRA 2MA1A 4QWEA 1ZQXA 4US8A 1MSWD 5TZVA 2WAQF 1S0VA 3BJYA 1MQ3A 3HKZC 1COKA 3MR6A 3PO4A 3QYPA 1NJXA 3I76A 4GC7A 1FFUA 9ICFA 1RQLA 3FYHA 3CYMA 3GILA 1L3SA 5JU5A 4DS4A 4KLSA 4DF8A 4BXOA 1L3VA 2F3NA 5HNKA 3K1RB 1SKWA 4B9TA 2LPEA 5J0QA 1T3QA 1KKXA 4NJ8A 3PR5B 2FMPA 1NZBA 1U49A 1U48A 5KFWA 1DOQA 4DL5A 3T79A 4EZ9A 5TISU 5J0TA 2AGQA 1ZQIA 3HRDD 1N48A 4QWDA 3RR7A 5EOZA 4KLOA 4QZ8A 3JPRA 2WF9A 5CA7A 1MA7A 4UB3A 4J9OA 3GU3A 1RXVA 3S6JA 1DK2A 3C2KA 4F4KA 9ICQA 4F92B 4DFDA 4ED8A 2AU0A 4DFPA 2JEGA 2ZUDA 3H8MA 3UXOA 1JXLA 2H3FA 2H3ZA 5KT7A 5EE3A 2LHTA 2VA2A 4NLNA 2Y0SF 1K1QA 8ICUA 2A3VA 4B9VA 3KHRA 2B6GA 3EUB2 2D6FC 3PW4A 5HR6A 3PNCA 4I2FA 4O3SA 2KZ3A 1N56A 2HW3A 3HX0A 4Y2YA 4PGQA 4O3OA 5KFYA 5EWEA 1F44A 2RLTA 1C20A 2G07A 1JN3A 3SR6A 4DQRA 3BDPA 4DL2A 2JZBA 3G6XA 5AHXA 1PK1B 1UQVA 2EZYA 4K4HA 2HBKA 2HHWA 7ICPA 1XSLA 3RRGA 4BGDA 3N7SC 3ISCA 4O5CA 8ICOA 2QB0B 1RQNA 4CF3A 5G5HA 5AKKA 1YT3A 3NTUA 2I9GA 2HHVA 4UAWA 5AM3A 3EYZA 2IHMA 3SD7A 2R8JA 4UB8U 5HP4A 3GV7B 3AEVA 9ICNA 4GXIA 1DK3A 3V7JA 2VKQA 5AI5A 4IR9A 4JUZA 1B43A 2W03A 3PX0A 1ZQRA 3ETRA 2KSOB 4QZEA 3RRHA 2MUTA 2FMQA 1A0PA 2FLLA 4C7YA 4RNMA 4YR2A 2WF7A 3M9OB 2HBMA 2KJ9A 3FAHA 8ICBA 8ICYA 3BS7A 3UMCA 2ATLA 1NK0A 2BPFA 2ZIVB 4GFJA 1D9FA 9ICHA 5ALEA 2HCFA 5DQIA 3PX6A 1BPEA 4IQWA 2WF6A 5J2GA 1A77A 5EWFA 3Q8QB 3LWLA 2BQUA 2IHNA 3KHLA 2ODGA 2R8KA 5AM1A 5KFBA 4TQRA 8ICZA 1TK5A 5EWGA 2W3SA 3ZDDA 2OXOA 5ALRA 2M0NA 3BZCA 4B9UA 5ALIA 1M6YA 2FPLA 1PZNA 4R8UB 8ICWA 3MGIA 4Y2XA 1TAQA 3MDCA 4DCCA 2Q0ZX 3KKAC 3BQ0A 2BKEA 4EX6A 1SKRA 2W43A 3NVZA 3C1ZA 4RQ3A 3SI8A 4RT3A 5DKWA 1HJPA 2Q4TA 2QLTA 2PFPA 3D2NA 2JEJA 1V9PA 4Z6FA 1Z1VA 2R8GA 3HT3A 2Y1JA 2I1QA 2ZIWB 5J8YA 2Y1IA 4J9NA 2XI9A 5KL8B 2CRXA 2MAXA 5KFQA 3AL0B 5KTQA 4IRKA 1V38A 4RU9A 1VLBA 3C5FA 3AU6A 1S76D 2FJ6A 5DB8A 1KDHA 2ZIXB 5CB1A 2E1FA 3IP4B 4UBBA 3J81j 1X9SA 2K8CB 2R18A 4QZHA 8ICTA 1JRPA 3H0LB 1JXEA 1TVAA 5J2DA 4ECSA 5KFDA 2RP5A 3VC8A 5KFNA 1WCNA 4DSJA 4DOBA 4Q44A 3ZDEA 3SZ2A 4NV0A 4X5VA 3UMGA 2Z7JA 5KFPA 3C29A 3NGDA 2W9CB 4F3OA 4B6JA 3LVVA 5KL1B 3MR5A 1BNPA 2BCSA 7ICLA 2JEIA 2NO4A 2JH7A 4GXJA 1SZPA 4YP3A 2AQ4A 2KVCA 2IA6A 3RAXA 3PSPA 2A19A 1TFRA 4DSEA 1S10A 3L4PA 1PVRA 2RHFA 1TK0A 3CP8A 3Q8LA 4CE6A 2KICA 4Y2JA 5L1KA 3RBDA 4F5NA 3LDAA 2E8PA 3HP6A 2HHTA 4NY8A 4EEKA 5CHGA 5J2BA 1YZ6A 1N62A 2HI0A 3ETLA 3PW5A 1ZQEA 4EBEA 2W9BA 4M9NA 1Z4NA 2KD1A 5DGBA 1K1SA 1RG6A 5T14A 3ICXA 5KAIU 2WB1C 4FE3A 8ICIA 4PL1A 5AICA 1NI3A 4O3MA 3K4GA 1ZQQA 4EENA 5J0PA 1WYGA 2B0CA 5AI6A 2XCPA 4MEYA 4KITB 1XWLA 1UA0A 4OD0A 4KMUA 2VA3A 1Q46A 2DBYA 1L7MA 4CF5A 4ZH4A 4QNLA 3T5KA 5J0WA 4IRCA 2AGPA 4LVSA 1NK9A 3GQCA 9ICWA 2LKYA 1C7YA 3HJEA 1ZQKA 4O3RA 2KHVA 8ICSA 3AN1A 5JUMA 1X6IA 5KFJA 1ZQJA 4NWIA 4QZCA 4GIBA 2ZG6A 3UPQA 5AKZA 4JMUA 4JV0A 2KZZA 4UQGA 3V7LA 1QQ6A 2LMRA 5IIJA 3N28A 3RF9A 3ISBA 3RJIA 4F5RA 4Q43A 4KN4A 2W9MA 2G5HB 2KN7A 1CEZA 4DL6A 5AKYA 2KG5A 4RQ7A 2C2RA 5DDYA 1N5XA 2IOFA 4MFCA 4KLLA 5CP2A 3PR4A 4R66A 3G6VA 2I6XA 7ICFA 5CJ7A 4U7CA 4RZRA 1TKDA 1NK8A 3WKBA 4F50A 8ICAA 1ZXIA 2W9AA 1KFDA 3TAPA 3I28A 3BS5B 1F5SA 1X9XA 5KFAA 2MRLA 1JUDA 2FLNA 3N7PD 2H3QA 3OTQA 5AIBA 2XY6A 1V97A 2GWSA 3V72A 2RRDA 1UT5A 4NM2A 5K4LA 3BQTA 3RB4A 1ECWA 1JMSA 5KFMA 3GIIA 5J8YC 5DB9A 4Z6CA 2HOIA 3T5JA 4J9LA 1X2IA 3IN5A 1Z19A 4UW9A 2HOQA 3Q8MA 1NJWA 4DL7A 5KFFA 4E0DA 5IIKA 2AQ0A 3V6JA 7ICNA 4ED6A 5C5JA 2V4QA 2PI4A 4Y2TA 5KFZA 1SXEA 1L7PA 3F2CA 4XRHA 2C28A 8ICRA 1KL9A 1KTQA 5ALJA 1N63A 4DFMA 4YCXA 3KHGA 4QIWC 2NRVA 4M04A 2JMGA 2W9BB 2NRTA 5HMLA 1ED1A 2QB1A 5L1IA 3BQ1A 4AYBF 4Z6DA 4M0AA 2HHQA 3VCBA 4FS2A 4JWNA 4ECZA 3UQ0A 1NNLA 3RJJA 8ICQA 4KX3A 4ED1A 5BOMA 9ICAA 3KZIU 1QQ5A 1ZQMA 4OJPA 1J2MA 2BCQA 3B0XA 3UXPA 2CPRA 2DPJA 3T5LA 2K4HA 3M6ZA 2A1JA 5AK5A 2XGPA 2PFNA 1ZQ1C 3NRZA 5B66U 2XY5A 8ICGA 2KK0A 2ZIUA 4I2IA 2P6RA 2ASJA 1OUQA 4YD2A 1NKBA 2W3RA 4I2JA 3RH6A 5DG9A 2F1JA 2FE9A 3RB6A 2ASLA 3V6KA 4ZOHC 4DF4A 1SIJA 1KEJA 1QLNA 1BNOA 1XSPA 2BDPA 4M9JA 4OO1J 1Q3UA 5ALLA 1XSNA 5KG0A 1WWVA 3T3FA 2VANA 4ECVA 4YMMA 3QX7A 4F5PA 1N2XA 5ALDA 1L5UA 4F91B 5KFKA 4NM1A 2UVUA 4UB6U 3QU4A 4C8LA 3C5GA 1AROP 1SV4A 4UASA 3KTQA 9ICMA 2F8KA 3OHBA 4YMOA 2KKPA 1XU4A 3D2QA 4LZDA 4OJ6A 4M9GA 2E5SA 4Z6EA 4RPYA 4FBTA 3L3FX 4BX9C 4KLMA 4LZGA 5KT5A 3NVWA 2BR0A 4K4IA 4P0QA 3PSFA 2IOFK 5F9LA 3NUQA 2K60A 8ICVA 2QARA 3E58A 2FI1A 5AIAA 9ICIA 2LBOA 4KLTA 3NS1A 1ZQCA 4FFDA 4KLFA 3C23A 2F1HA 4PGYA 2M9NA 4M2YA 1K5OA 9ICEA 4MEXA 1ZQYA 7ICKA 1ZRNA 3SYZA 4YN4A 1Z3EB 5DGAA 4DQIA 8ICHA 5CR0A 5KT4A 1S8OA 1QSYA 3PW7A 4TUPA 5KFCA 3RR8A 4J03A 1SGGA 4GC6A 2LI6A 8ICMA 1S0MA 4FZNA 3UXNA 4YMNA 4IQTA 3FDSA 2K8BB 2ES6A 5DQHA 1QSLA 4B9MA 4QZDA 4F93B 4ICAA 4DQSA 4F4ZA 4IL6U 1BPBA 4RPZA 1URJA 4R63A 5ALTA 3SAHA 4KLEA 2EDUA 3N97B 4US9A 3ZDBA 4KLGA 2EH9A 4BDPA 4DO9A 2KIWA 4KX5A 4C4TA 9ICCA 2N1RA 2MU2A 1NK7A 5GTHU 3KOOA 5L1MA 2K4EA 4M47A 4EYHB 2BPGA 2W8LA 2AHOB 1JI7A 3OSNA 2PI5A 4ECTA 2W8KA 3PV8A 3IG8A 2ASDA 2AXTU 2WTFA 2JH1A 3MR2A 3AQEA 5ALUA 4QZBA 4USAA 5IIMA 4Y2VA 1RYSA 2VA8A 5ALGA 4QWBA 2OM6A
chains in the Genus database with same CATH topology
3SENA 5KNIA 1UCVA 1SXEA 4IS7A 2E8NA 5F3XB 2KMDA 2K60A 2LMRA 2QARA 1X66A 2L5YA 3TADA 2EANA 2QARB 1PK1A 1LKYB 1PK1B 1SXDA 2KG5A 2EAPA 2Y9UA 1UQVA 2QB1A 1B0XA 3KKAC 2F44A 2EAOA 2E8PA 2D3DA 4NL9C 5JTIA 2QB0A 1COKA 1SGGA 2QB0B 4MHVA 2JV3A 5JU5A 1Z1VA 3TADC 2F3NA 2KIVA 1LKYA 2ES6A 2QKQA 1B4FA 3K1RB 5J8YA 2Y9TA 2LPEA 1WWUA 1RG6A 4RQMA 5JRTA 2DKXA 2E8MA 4NJ8A 1X40A 3BS5A 2D8CA 3BS5B 1V38A 2ESEA 1X9XA 2DKZA 2DL0A 2E8OA 1V85A 3HILA 2KSOB 4PZOA 1PK3A 2YTUA 1SV0A 2FE9A 3IDWA 2KE7A 1F0MA 3BQ7A 2GLEA 2EAMA 4PZNA 5L1MA 3BS7A 1WWVA 2K4PA 1OW5A 5J8YC 1JI7A 3H8MA 2KSOA 3SEIA 1SV4A 4RQNA 3TACB 2F8KA 1KW4A 3KKAA 2B6GA 1SV0C 1DXSA 4NL9A 1OXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SEN A;  5KNI A;  1UCV A;  1SXE A;  4IS7 A;  2E8N A;  5F3X B;  2KMD A;  2K60 A;  2LMR A;  2QAR A;  1X66 A;  2L5Y A;  3TAD A;  2EAN A;  2QAR B;  1PK1 A;  1LKY B;  1PK1 B;  1SXD A;  2KG5 A;  2EAP A;  2Y9U A;  1UQV A;  2QB1 A;  1B0X A;  3KKA C;  2F44 A;  2EAO A;  2E8P A;  2D3D A;  4NL9 C;  5JTI A;  2QB0 A;  1COK A;  1SGG A;  2QB0 B;  4MHV A;  2JV3 A;  5JU5 A;  1Z1V A;  3TAD C;  2F3N A;  2KIV A;  1LKY A;  2ES6 A;  2QKQ A;  1B4F A;  3K1R B;  5J8Y A;  2Y9T A;  2LPE A;  1WWU A;  1RG6 A;  4RQM A;  5JRT A;  2DKX A;  2E8M A;  4NJ8 A;  1X40 A;  3BS5 A;  2D8C A;  3BS5 B;  1V38 A;  2ESE A;  1X9X A;  2DKZ A;  2DL0 A;  2E8O A;  1V85 A;  3HIL A;  2KSO B;  4PZO A;  1PK3 A;  2YTU A;  1SV0 A;  2FE9 A;  3IDW A;  2KE7 A;  1F0M A;  3BQ7 A;  2GLE A;  2EAM A;  4PZN A;  5L1M A;  3BS7 A;  1WWV A;  2K4P A;  1OW5 A;  5J8Y C;  1JI7 A;  3H8M A;  2KSO A;  3SEI A;  1SV4 A;  4RQN A;  3TAC B;  2F8K A;  1KW4 A;  3KKA A;  2B6G A;  1SV0 C;  1DXS A;  4NL9 A;  1OXJ A; 
#chains in the Genus database with same CATH topology
 5KNI A;  3TQ1 A;  2YB1 A;  5KT6 A;  1LV5 A;  2H3I A;  5KFO A;  4M6W B;  1L8L A;  4GXK A;  1TAM A;  3AQF A;  2JEF A;  2V9W A;  2H3V A;  2PMZ F;  5AI9 A;  3ED5 A;  5IIO A;  5DB6 A;  1IV8 A;  2O6K A;  4HYK A;  4ECY A;  2Y9U A;  2ZTE A;  1TK8 A;  3NRW A;  3OPX A;  9ICT A;  5D49 A;  1FIQ A;  2OH2 A;  2D3D A;  4YFK A;  2BCV A;  4PJ0 U;  4DEZ A;  1ZD5 A;  2ZIU B;  4YR3 A;  1ZQB A;  3RBE A;  9ICS A;  4QZ9 A;  2HVH A;  4DQP A;  2ZJ5 A;  3LVW A;  4DSK A;  1T7P A;  3AMZ A;  5ALH A;  3HW8 A;  3GV8 B;  4BXO B;  7ICE A;  4WJ3 B;  3RB0 A;  5J0O A;  3F53 A;  4RQM A;  5H2F U;  4J9M A;  4CRX A;  2ZUC A;  4P4P A;  3QEB Z;  4EEY A;  3WKC A;  4DFK A;  2HOF A;  3QE9 Y;  1VDV A;  4UAR A;  4UBC A;  2DL0 A;  3JPQ A;  7ICQ A;  2KHQ A;  1PK3 A;  1S77 D;  2XC9 A;  1RZT A;  4Q8E A;  1Z00 A;  2RDI A;  5C0Y A;  2WAQ C;  3WKE A;  4O3Q A;  4DOC A;  4CGZ A;  2G08 A;  4BJQ A;  2YX8 A;  3RJH A;  3O0F A;  4Y2U A;  1LVH A;  1ZQZ A;  2LYH A;  2HHX A;  2KFN A;  9ICV A;  4FZL A;  3L5K A;  1NZP A;  3ALR A;  4F4W A;  1U9L A;  2GOL A;  3RH5 A;  2KFZ A;  4YXM A;  4C4S A;  5KG6 A;  3TFR A;  1DXS A;  4DQQ A;  5KG7 A;  1B4F A;  2DFL A;  1BPZ A;  1ZYQ A;  2PFQ A;  2C2E A;  4KLH A;  5DBA A;  3JPO A;  2F2A B;  3TAR A;  2JHD A;  3SQI A;  3TAD A;  1D9D A;  2EAN A;  5B5E U;  1XO1 A;  1SWW A;  4C8K A;  7ICR A;  3PY8 A;  3C28 A;  2BCU A;  7ICI A;  2JZB B;  1TV9 A;  2G5I B;  4B9L A;  1IM4 A;  3A0H U;  4CDG A;  1ZQA A;  3OJU A;  2RQ5 A;  1RXW A;  5KT2 A;  1KFT A;  2PXI A;  3Q8P B;  3LYS A;  4U6P A;  4MFF A;  2XO7 A;  2KNJ A;  5L1L A;  2Y0S C;  5D46 A;  3C1Y A;  2NYV A;  1NJY A;  4XA5 A;  2DQN B;  5J2E A;  4CCH A;  1AQ6 A;  2P35 A;  1PVP A;  3H4B A;  2DUY A;  3AUO A;  4C8O A;  5AM5 A;  4MF8 A;  4IQU A;  2WHE A;  1DGS A;  1GO3 F;  3HPO A;  2MSN A;  1X40 A;  3V7K A;  1RDF A;  1VJ5 A;  4J9Q A;  4ECQ A;  2YB4 A;  5AKI A;  4PZO A;  1NK4 A;  3KBB A;  3PML A;  2MUT B;  1F0M A;  3PX4 A;  5AI0 A;  4I28 A;  4J9P A;  7ICH A;  3IRU A;  4EYI B;  5KFG A;  1S5L U;  2NV3 A;  5DLG A;  4BWJ A;  1SKS A;  5DG7 A;  1RYU A;  3I1Y A;  3WK6 A;  4QW8 A;  5KFL A;  3HWT A;  1ZQS A;  4OJL A;  2V4R A;  2ALZ A;  9ICR A;  3EZ5 A;  3MFI A;  3KHH A;  4QJF B;  3NVY A;  3HKZ F;  4JV1 A;  1IXR A;  5AKJ A;  5IIN A;  5HHI A;  4P0P A;  3KFU F;  1S97 A;  2HBJ A;  4OJ5 A;  3QUT A;  1MC8 A;  4RQ2 A;  4EBC A;  3N4M B;  3M6K A;  2KVS A;  4A8E A;  1L8O A;  2YQE A;  4ED3 A;  3T5H A;  1RM6 C;  4QW9 A;  5FP0 A;  4ECX A;  3IM1 A;  9ICX A;  5DG8 A;  4NLC A;  3RFA A;  3RH4 A;  5CRX A;  4KN7 A;  7ICO A;  4Y2P A;  3CRX A;  2LM1 A;  5F9N A;  3C2M A;  3TAN A;  4KLU A;  1T4G A;  4PHE A;  1QSS A;  3MFH A;  2YMP A;  4O3P A;  5DB7 A;  4Y2Q A;  4G9B A;  2HHS A;  4DL3 A;  5ALN A;  4MF2 A;  3LWM A;  4YR0 A;  4TUQ A;  3F5E A;  1LKY A;  2KJ5 A;  4EEL A;  5HR7 A;  3DV9 A;  4RT2 A;  2G09 A;  3WK7 A;  3PW0 A;  4UAZ A;  3QNM A;  2A1A A;  2FMS A;  5D4B A;  1MQ2 A;  4DSL A;  2NRW A;  5KG3 A;  1N60 A;  4C8M A;  4PHD A;  2ESE A;  2KJ8 A;  2DKZ A;  4Y2S A;  2WF8 A;  4DLG A;  4EBD A;  9ICG A;  2EZZ A;  4UB5 A;  4O9M A;  4ED7 A;  4NLB A;  3GV5 B;  3OJS A;  5KG2 A;  1KQQ A;  4I2E A;  2ZJA A;  4DWI A;  4M9L A;  3WK8 A;  2GLE A;  5CEH A;  5L9X A;  2B21 A;  2ZUB A;  1TAU A;  8ICK A;  3UMB A;  1PUZ A;  3UQ2 A;  1XC9 A;  2OEH A;  4JB3 A;  4CNQ A;  4RQ6 A;  3FC4 A;  4PPX A;  4TUS A;  1IIP A;  2XID A;  2DPI A;  2R8I A;  1KRP A;  2XVT A;  2HBL A;  3D6J A;  2GO7 A;  8ICP A;  4NL9 A;  4FBU A;  4EX7 A;  1RYR A;  3MGH A;  1BVS A;  2ISO A;  2KKV A;  2ZJ8 A;  1L7O A;  3H0R B;  2J6U A;  2C22 A;  5HMM A;  2EQY A;  2FDR A;  3WK9 A;  1PK1 A;  2JR5 A;  3K1Z A;  2LM4 A;  5IIL A;  9ICJ A;  2P6U A;  4I2C A;  4B9N A;  5EE1 A;  3H0M B;  4F5Q A;  4DOA A;  1ZQV A;  1SL1 A;  3PSI A;  2VIX A;  2QB0 A;  4FZM A;  4JV2 A;  2JRZ A;  3U26 A;  4F5O A;  3TAD C;  1X9M A;  2KIV A;  3JPT A;  5JRT A;  2DKX A;  3F2B A;  4IR1 A;  2J6S A;  4KLI A;  3A0B U;  3QXG A;  5EE0 A;  3E0F A;  2XCA A;  4YVZ A;  4UAU A;  3H8J A;  4DS5 A;  2OYY A;  4ELV A;  2KE7 A;  4BUG A;  4ED0 A;  4P4M A;  3OSP A;  5J29 A;  2ZTC A;  3Q8K A;  3ORY A;  3BQ7 A;  3G6Y A;  5DQG A;  2NRX A;  2ZIV A;  3EPG A;  5KFU A;  8ICC A;  5ALO A;  5AM0 A;  2UVR A;  1Q8K A;  4R65 A;  5BPC A;  5J2J A;  7ICG A;  1SWV A;  4UB1 A;  4JK1 A;  1JX4 A;  4RUC A;  5AK4 A;  4C0Z A;  2E1E A;  3H8S A;  3IV6 A;  4QZG A;  5A0L A;  2LYA A;  3QZ7 A;  4OCZ A;  1J2N A;  2HSZ A;  1KFS A;  4R8U A;  1X66 A;  4Q45 A;  1WUD A;  2IBK A;  2FPM A;  3MR3 A;  3ONN A;  1WG8 A;  1QH9 A;  3N7R C;  3SV3 A;  4YXJ A;  8ICE A;  4RQ8 A;  1LKY B;  3RTV A;  2KTQ A;  3SMV A;  3WKA A;  3PST A;  4ACO A;  2F44 A;  3TFS A;  8ICJ A;  3Q8R B;  5ALY A;  1XNS A;  4JWM A;  5KAF U;  2XGQ A;  1BPX A;  3MC1 A;  2ZIW A;  3CW2 C;  3JPS A;  2W11 A;  5AKE A;  4Y2R A;  1D8Y A;  5KFH A;  1ZQL A;  5KFE A;  1NKC A;  1ZQT A;  1QTM A;  5GTI U;  1D8L A;  2F1I A;  5DDM A;  3TKA A;  3C2L A;  2D8C A;  1A6S A;  2ZIX A;  2NRZ A;  2YTU A;  1RPL A;  4QWA A;  4UAT A;  4UB2 A;  4RQ0 A;  4J9R A;  4XUS A;  1DRG A;  3RJG A;  3GDX A;  1HEK A;  5BOL A;  1OW5 A;  4DSI A;  2RDJ A;  4KLD A;  5J0S A;  5KFV A;  2DWQ A;  3IHQ B;  3SAF A;  3PZP A;  2W9C A;  2WF5 A;  3MGV A;  4OJO A;  2CN1 A;  1YZ7 A;  4UAY A;  3GFK B;  1X6J A;  2YMQ A;  3D2S A;  5AKX A;  4XQ8 A;  1UT8 A;  3WK4 A;  4CF4 A;  5F3X B;  4DL4 A;  3EPI A;  1U45 A;  3NAS A;  1EXN A;  3QUB A;  2WB1 F;  4RQ5 A;  2BDU A;  4I2B A;  3ISD A;  3ZDC A;  4RNO A;  3MDA A;  3QUC A;  1Z4O A;  4B9S A;  1JAL A;  1ZD4 A;  3ZD9 A;  2EAP A;  2IOH A;  3M8S A;  3E2E A;  1N61 A;  5CWR A;  4QZA A;  3QU2 A;  5AK3 A;  4RQ1 A;  3PVX A;  3M9M B;  1ZQW A;  4NL9 C;  2XY7 A;  3GIK A;  4I2D A;  4NXZ A;  4RUA A;  1S0N A;  2C2D A;  4KTQ A;  5AM2 A;  5J2A A;  5E79 U;  4PHP A;  1ZQD A;  1UA1 A;  5J0Y A;  4KMO B;  3AM9 A;  2PKE A;  2QKQ A;  2ZXI A;  4LJX A;  3F5A A;  5J0U A;  1CUK A;  3ZI4 A;  4C7Z A;  2A1J B;  1ZOL A;  1Q3V A;  3OGU A;  2F77 X;  4UB4 A;  4F4Y A;  3IG5 A;  1T8E A;  3RAQ A;  2UVV A;  3HIL A;  1SV0 A;  1CI4 A;  1B22 A;  2AH5 A;  3UM9 A;  5KT3 A;  4AYB C;  4ED2 A;  4DLE A;  2K4I A;  3RB3 A;  2K4P A;  4IRD A;  3QZ8 A;  7ICJ A;  3QUQ A;  2KZM A;  8ICF A;  5HHH A;  2AJQ A;  1ZQF A;  1QCK A;  3SEI A;  1KLN A;  3H4D A;  1JIH A;  1BPD A;  4C8N A;  5DBC A;  5J2C A;  1L3U A;  1UPH A;  9ICP A;  4IS7 A;  4O0I A;  2E8N A;  2W55 A;  3H7I A;  2UVW A;  2BZF A;  4P0Q B;  4O5E A;  2XIC A;  2QAR B;  2LYB A;  4TQS A;  4O3N A;  2F76 X;  1ZJM A;  1KBU A;  4I29 A;  4P2H A;  1J97 A;  3THV A;  4NLG A;  1ZJN A;  4IQV A;  5AI4 A;  3R9K A;  2JV3 A;  4RNN A;  1MN8 A;  3C21 A;  2DGZ A;  5AKG A;  1HUZ A;  7ICS A;  5J2I A;  4EZ6 A;  3WKD A;  4PL2 A;  2ISP A;  4YQW A;  3FM9 A;  7ICV A;  4KLQ A;  3BS5 A;  1KSP A;  2BGW A;  2KV2 A;  2BHN A;  2E8O A;  5KFS A;  2F8L A;  2K8A A;  1X9W A;  3Q8S B;  2IMW P;  5ALZ A;  5ALQ A;  4QIW F;  2JXJ A;  1U4B A;  5III A;  2EAM A;  3B0Y A;  1P7D A;  5J0R A;  2CXY A;  2BPC A;  5EE9 A;  4YD1 A;  2VJ4 A;  1L6N A;  4Q8F A;  2P66 A;  5J2K A;  4TUR A;  4J9S A;  3TAC B;  1Z1B A;  2OHF A;  1KW4 A;  1SL2 A;  2YN4 A;  7ICU A;  3F2D A;  5DLF A;  5ALM A;  1Y88 A;  1CRX A;  4DFJ A;  1UCV A;  4YG2 A;  2VJ5 A;  4C80 A;  2FLP A;  2YMM A;  4UAV A;  1QQ7 A;  4F71 A;  1XS9 D;  9ICL A;  4NLK A;  2KOB A;  4FO6 A;  4C4R A;  2AGO A;  1SXD A;  1ZD2 P;  1HUO A;  5G5G A;  8ICN A;  4GLX A;  5DBB A;  1L7N A;  4FS1 A;  4F2S A;  3KZX A;  1FFV A;  3M7D A;  5JTI A;  1LB2 B;  3SV4 A;  8ICL A;  5ALW A;  1SZH A;  1BPY A;  9ICO A;  4DSF A;  5AK6 A;  4F72 A;  7ICM A;  3H8W A;  3EWA A;  5KFR A;  5ALK A;  4ELT A;  1ZRM A;  9ICK A;  2E8M A;  5KFX A;  5ALF A;  3CNH A;  3B9J A;  2KP7 A;  4F8R A;  1N5W A;  2PMZ C;  3EW9 A;  4AP9 A;  9ICB A;  4R64 A;  2HHU A;  3PO5 A;  5J0X A;  5AI8 A;  5ALV A;  3IDW A;  1ZQH A;  1ZQG A;  1WCL A;  5ALX A;  3WK5 A;  4NLZ A;  1Z00 B;  1PVQ A;  1ZD3 A;  2ZTD A;  5KG5 A;  2E3T A;  2EZX A;  3QU9 A;  2W04 A;  5J2F A;  2FPK A;  1FO4 A;  4J9K A;  1NKE A;  1KN5 A;  2OWO A;  4QWC A;  4QZI A;  4I2A A;  3GIJ A;  4I2H A;  3QEA Z;  3GZF A;  4RQN A;  3BQ2 A;  3WU2 U;  3RJF A;  3JPN A;  2WFA A;  4IC9 A;  1SV0 C;  5AKL A;  1T94 A;  3SEN A;  1BGX T;  1O03 A;  1SL0 A;  4QZF A;  3MBY A;  4RQ4 A;  2KMD A;  4ECU A;  5ALP A;  1XO0 A;  1ZQU A;  1COO A;  5AM4 A;  2YY6 A;  3M1Y A;  3GIM A;  4KLJ A;  3RJE A;  4RPX A;  1X42 A;  2GH1 A;  3ZDA A;  3LK9 A;  2PFO A;  3K75 D;  2YML A;  4I2G A;  3OHA A;  2W7P A;  3SAG A;  1ZQN A;  3DEE A;  2I5H A;  2EAO A;  5J2H A;  5KFI A;  1O08 A;  3KD3 A;  1HIW A;  4MHV A;  3PW2 A;  2BQ3 A;  1DGJ A;  4M9H A;  4PHA A;  2JGA A;  2KEY A;  1SB3 C;  1IG6 A;  4BWM A;  2Y9T A;  1WWU A;  1NK5 A;  1FEZ A;  3PMN A;  2HVI A;  3QU5 A;  5L1J A;  3TAQ A;  1ZQP A;  3V6H A;  7ICT A;  5AKH A;  2NO5 A;  4ECW A;  1ZQO A;  4HAI A;  1U47 A;  1V85 A;  1JRO A;  2K89 A;  1L3T A;  4ECR A;  5KFT A;  4G3I A;  2OCE A;  3RJK A;  8ICX A;  2H5X A;  1UHU A;  5KG4 A;  4ELU A;  2G0A A;  9ICU A;  3MAB A;  1T3N A;  4PZN A;  4PGX A;  2G06 A;  2HDO A;  1NK6 A;  4I27 A;  3JPP A;  3ZD8 A;  3H40 A;  2BCR A;  2KSO A;  1TE2 A;  2HMX A;  1S0O A;  4K4G A;  3M9N B;  2W54 A;  3KKA A;  3QU7 A;  4P0P B;  2J6T A;  5KG1 A;  1S9F A;  1OXJ A;  4P4O A;  1ZET A;  4M6W A;  1H38 A;  4O5K A;  2R8H A;  1NOM A;  3M8R A;  3TI0 A;  4F2R A;  2L5Y A;  1D8B A;  3NVV A;  2ZXH A;  4MFA A;  3DDH A;  1A76 A;  2W7O A;  3BZK A;  5ALS A;  1NJZ A;  3AU2 A;  1B0X A;  4PH5 A;  4F4X A;  2DF4 B;  2BQR A;  2MA1 A;  4QWE A;  1ZQX A;  4US8 A;  1MSW D;  5TZV A;  2WAQ F;  1S0V A;  3BJY A;  1MQ3 A;  3HKZ C;  1COK A;  3MR6 A;  3PO4 A;  3QYP A;  1NJX A;  3I76 A;  4GC7 A;  1FFU A;  9ICF A;  1RQL A;  3FYH A;  3CYM A;  3GIL A;  1L3S A;  5JU5 A;  4DS4 A;  4KLS A;  4DF8 A;  4BXO A;  1L3V A;  2F3N A;  5HNK A;  3K1R B;  1SKW A;  4B9T A;  2LPE A;  5J0Q A;  1T3Q A;  1KKX A;  4NJ8 A;  3PR5 B;  2FMP A;  1NZB A;  1U49 A;  1U48 A;  5KFW A;  1DOQ A;  4DL5 A;  3T79 A;  4EZ9 A;  5TIS U;  5J0T A;  2AGQ A;  1ZQI A;  3HRD D;  1N48 A;  4QWD A;  3RR7 A;  5EOZ A;  4KLO A;  4QZ8 A;  3JPR A;  2WF9 A;  5CA7 A;  1MA7 A;  4UB3 A;  4J9O A;  3GU3 A;  1RXV A;  3S6J A;  1DK2 A;  3C2K A;  4F4K A;  9ICQ A;  4F92 B;  4DFD A;  4ED8 A;  2AU0 A;  4DFP A;  2JEG A;  2ZUD A;  3H8M A;  3UXO A;  1JXL A;  2H3F A;  2H3Z A;  5KT7 A;  5EE3 A;  2LHT A;  2VA2 A;  4NLN A;  2Y0S F;  1K1Q A;  8ICU A;  2A3V A;  4B9V A;  3KHR A;  2B6G A;  3EUB 2;  2D6F C;  3PW4 A;  5HR6 A;  3PNC A;  4I2F A;  4O3S A;  2KZ3 A;  1N56 A;  2HW3 A;  3HX0 A;  4Y2Y A;  4PGQ A;  4O3O A;  5KFY A;  5EWE A;  1F44 A;  2RLT A;  1C20 A;  2G07 A;  1JN3 A;  3SR6 A;  4DQR A;  3BDP A;  4DL2 A;  2JZB A;  3G6X A;  5AHX A;  1PK1 B;  1UQV A;  2EZY A;  4K4H A;  2HBK A;  2HHW A;  7ICP A;  1XSL A;  3RRG A;  4BGD A;  3N7S C;  3ISC A;  4O5C A;  8ICO A;  2QB0 B;  1RQN A;  4CF3 A;  5G5H A;  5AKK A;  1YT3 A;  3NTU A;  2I9G A;  2HHV A;  4UAW A;  5AM3 A;  3EYZ A;  2IHM A;  3SD7 A;  2R8J A;  4UB8 U;  5HP4 A;  3GV7 B;  3AEV A;  9ICN A;  4GXI A;  1DK3 A;  3V7J A;  2VKQ A;  5AI5 A;  4IR9 A;  4JUZ A;  1B43 A;  2W03 A;  3PX0 A;  1ZQR A;  3ETR A;  2KSO B;  4QZE A;  3RRH A;  2MUT A;  2FMQ A;  1A0P A;  2FLL A;  4C7Y A;  4RNM A;  4YR2 A;  2WF7 A;  3M9O B;  2HBM A;  2KJ9 A;  3FAH A;  8ICB A;  8ICY A;  3BS7 A;  3UMC A;  2ATL A;  1NK0 A;  2BPF A;  2ZIV B;  4GFJ A;  1D9F A;  9ICH A;  5ALE A;  2HCF A;  5DQI A;  3PX6 A;  1BPE A;  4IQW A;  2WF6 A;  5J2G A;  1A77 A;  5EWF A;  3Q8Q B;  3LWL A;  2BQU A;  2IHN A;  3KHL A;  2ODG A;  2R8K A;  5AM1 A;  5KFB A;  4TQR A;  8ICZ A;  1TK5 A;  5EWG A;  2W3S A;  3ZDD A;  2OXO A;  5ALR A;  2M0N A;  3BZC A;  4B9U A;  5ALI A;  1M6Y A;  2FPL A;  1PZN A;  4R8U B;  8ICW A;  3MGI A;  4Y2X A;  1TAQ A;  3MDC A;  4DCC A;  2Q0Z X;  3KKA C;  3BQ0 A;  2BKE A;  4EX6 A;  1SKR A;  2W43 A;  3NVZ A;  3C1Z A;  4RQ3 A;  3SI8 A;  4RT3 A;  5DKW A;  1HJP A;  2Q4T A;  2QLT A;  2PFP A;  3D2N A;  2JEJ A;  1V9P A;  4Z6F A;  1Z1V A;  2R8G A;  3HT3 A;  2Y1J A;  2I1Q A;  2ZIW B;  5J8Y A;  2Y1I A;  4J9N A;  2XI9 A;  5KL8 B;  2CRX A;  2MAX A;  5KFQ A;  3AL0 B;  5KTQ A;  4IRK A;  1V38 A;  4RU9 A;  1VLB A;  3C5F A;  3AU6 A;  1S76 D;  2FJ6 A;  5DB8 A;  1KDH A;  2ZIX B;  5CB1 A;  2E1F A;  3IP4 B;  4UBB A;  3J81 j;  1X9S A;  2K8C B;  2R18 A;  4QZH A;  8ICT A;  1JRP A;  3H0L B;  1JXE A;  1TVA A;  5J2D A;  4ECS A;  5KFD A;  2RP5 A;  3VC8 A;  5KFN A;  1WCN A;  4DSJ A;  4DOB A;  4Q44 A;  3ZDE A;  3SZ2 A;  4NV0 A;  4X5V A;  3UMG A;  2Z7J A;  5KFP A;  3C29 A;  3NGD A;  2W9C B;  4F3O A;  4B6J A;  3LVV A;  5KL1 B;  3MR5 A;  1BNP A;  2BCS A;  7ICL A;  2JEI A;  2NO4 A;  2JH7 A;  4GXJ A;  1SZP A;  4YP3 A;  2AQ4 A;  2KVC A;  2IA6 A;  3RAX A;  3PSP A;  2A19 A;  1TFR A;  4DSE A;  1S10 A;  3L4P A;  1PVR A;  2RHF A;  1TK0 A;  3CP8 A;  3Q8L A;  4CE6 A;  2KIC A;  4Y2J A;  5L1K A;  3RBD A;  4F5N A;  3LDA A;  2E8P A;  3HP6 A;  2HHT A;  4NY8 A;  4EEK A;  5CHG A;  5J2B A;  1YZ6 A;  1N62 A;  2HI0 A;  3ETL A;  3PW5 A;  1ZQE A;  4EBE A;  2W9B A;  4M9N A;  1Z4N A;  2KD1 A;  5DGB A;  1K1S A;  1RG6 A;  5T14 A;  3ICX A;  5KAI U;  2WB1 C;  4FE3 A;  8ICI A;  4PL1 A;  5AIC A;  1NI3 A;  4O3M A;  3K4G A;  1ZQQ A;  4EEN A;  5J0P A;  1WYG A;  2B0C A;  5AI6 A;  2XCP A;  4MEY A;  4KIT B;  1XWL A;  1UA0 A;  4OD0 A;  4KMU A;  2VA3 A;  1Q46 A;  2DBY A;  1L7M A;  4CF5 A;  4ZH4 A;  4QNL A;  3T5K A;  5J0W A;  4IRC A;  2AGP A;  4LVS A;  1NK9 A;  3GQC A;  9ICW A;  2LKY A;  1C7Y A;  3HJE A;  1ZQK A;  4O3R A;  2KHV A;  8ICS A;  3AN1 A;  5JUM A;  1X6I A;  5KFJ A;  1ZQJ A;  4NWI A;  4QZC A;  4GIB A;  2ZG6 A;  3UPQ A;  5AKZ A;  4JMU A;  4JV0 A;  2KZZ A;  4UQG A;  3V7L A;  1QQ6 A;  2LMR A;  5IIJ A;  3N28 A;  3RF9 A;  3ISB A;  3RJI A;  4F5R A;  4Q43 A;  4KN4 A;  2W9M A;  2G5H B;  2KN7 A;  1CEZ A;  4DL6 A;  5AKY A;  2KG5 A;  4RQ7 A;  2C2R A;  5DDY A;  1N5X A;  2IOF A;  4MFC A;  4KLL A;  5CP2 A;  3PR4 A;  4R66 A;  3G6V A;  2I6X A;  7ICF A;  5CJ7 A;  4U7C A;  4RZR A;  1TKD A;  1NK8 A;  3WKB A;  4F50 A;  8ICA A;  1ZXI A;  2W9A A;  1KFD A;  3TAP A;  3I28 A;  3BS5 B;  1F5S A;  1X9X A;  5KFA A;  2MRL A;  1JUD A;  2FLN A;  3N7P D;  2H3Q A;  3OTQ A;  5AIB A;  2XY6 A;  1V97 A;  2GWS A;  3V72 A;  2RRD A;  1UT5 A;  4NM2 A;  5K4L A;  3BQT A;  3RB4 A;  1ECW A;  1JMS A;  5KFM A;  3GII A;  5J8Y C;  5DB9 A;  4Z6C A;  2HOI A;  3T5J A;  4J9L A;  1X2I A;  3IN5 A;  1Z19 A;  4UW9 A;  2HOQ A;  3Q8M A;  1NJW A;  4DL7 A;  5KFF A;  4E0D A;  5IIK A;  2AQ0 A;  3V6J A;  7ICN A;  4ED6 A;  5C5J A;  2V4Q A;  2PI4 A;  4Y2T A;  5KFZ A;  1SXE A;  1L7P A;  3F2C A;  4XRH A;  2C28 A;  8ICR A;  1KL9 A;  1KTQ A;  5ALJ A;  1N63 A;  4DFM A;  4YCX A;  3KHG A;  4QIW C;  2NRV A;  4M04 A;  2JMG A;  2W9B B;  2NRT A;  5HML A;  1ED1 A;  2QB1 A;  5L1I A;  3BQ1 A;  4AYB F;  4Z6D A;  4M0A A;  2HHQ A;  3VCB A;  4FS2 A;  4JWN A;  4ECZ A;  3UQ0 A;  1NNL A;  3RJJ A;  8ICQ A;  4KX3 A;  4ED1 A;  5BOM A;  9ICA A;  3KZI U;  1QQ5 A;  1ZQM A;  4OJP A;  1J2M A;  2BCQ A;  3B0X A;  3UXP A;  2CPR A;  2DPJ A;  3T5L A;  2K4H A;  3M6Z A;  2A1J A;  5AK5 A;  2XGP A;  2PFN A;  1ZQ1 C;  3NRZ A;  5B66 U;  2XY5 A;  8ICG A;  2KK0 A;  2ZIU A;  4I2I A;  2P6R A;  2ASJ A;  1OUQ A;  4YD2 A;  1NKB A;  2W3R A;  4I2J A;  3RH6 A;  5DG9 A;  2F1J A;  2FE9 A;  3RB6 A;  2ASL A;  3V6K A;  4ZOH C;  4DF4 A;  1SIJ A;  1KEJ A;  1QLN A;  1BNO A;  1XSP A;  2BDP A;  4M9J A;  4OO1 J;  1Q3U A;  5ALL A;  1XSN A;  5KG0 A;  1WWV A;  3T3F A;  2VAN A;  4ECV A;  4YMM A;  3QX7 A;  4F5P A;  1N2X A;  5ALD A;  1L5U A;  4F91 B;  5KFK A;  4NM1 A;  2UVU A;  4UB6 U;  3QU4 A;  4C8L A;  3C5G A;  1ARO P;  1SV4 A;  4UAS A;  3KTQ A;  9ICM A;  2F8K A;  3OHB A;  4YMO A;  2KKP A;  1XU4 A;  3D2Q A;  4LZD A;  4OJ6 A;  4M9G A;  2E5S A;  4Z6E A;  4RPY A;  4FBT A;  3L3F X;  4BX9 C;  4KLM A;  4LZG A;  5KT5 A;  3NVW A;  2BR0 A;  4K4I A;  4P0Q A;  3PSF A;  2IOF K;  5F9L A;  3NUQ A;  2K60 A;  8ICV A;  2QAR A;  3E58 A;  2FI1 A;  5AIA A;  9ICI A;  2LBO A;  4KLT A;  3NS1 A;  1ZQC A;  4FFD A;  4KLF A;  3C23 A;  2F1H A;  4PGY A;  2M9N A;  4M2Y A;  1K5O A;  9ICE A;  4MEX A;  1ZQY A;  7ICK A;  1ZRN A;  3SYZ A;  4YN4 A;  1Z3E B;  5DGA A;  4DQI A;  8ICH A;  5CR0 A;  5KT4 A;  1S8O A;  1QSY A;  3PW7 A;  4TUP A;  5KFC A;  3RR8 A;  4J03 A;  1SGG A;  4GC6 A;  2LI6 A;  8ICM A;  1S0M A;  4FZN A;  3UXN A;  4YMN A;  4IQT A;  3FDS A;  2K8B B;  2ES6 A;  5DQH A;  1QSL A;  4B9M A;  4QZD A;  4F93 B;  4ICA A;  4DQS A;  4F4Z A;  4IL6 U;  1BPB A;  4RPZ A;  1URJ A;  4R63 A;  5ALT A;  3SAH A;  4KLE A;  2EDU A;  3N97 B;  4US9 A;  3ZDB A;  4KLG A;  2EH9 A;  4BDP A;  4DO9 A;  2KIW A;  4KX5 A;  4C4T A;  9ICC A;  2N1R A;  2MU2 A;  1NK7 A;  5GTH U;  3KOO A;  5L1M A;  2K4E A;  4M47 A;  4EYH B;  2BPG A;  2W8L A;  2AHO B;  1JI7 A;  3OSN A;  2PI5 A;  4ECT A;  2W8K A;  3PV8 A;  3IG8 A;  2ASD A;  2AXT U;  2WTF A;  2JH1 A;  3MR2 A;  3AQE A;  5ALU A;  4QZB A;  4USA A;  5IIM A;  4Y2V A;  1RYS A;  2VA8 A;  5ALG A;  4QWB A;  2OM6 A; 
#chains in the Genus database with same CATH homology
 3SEN A;  5KNI A;  1UCV A;  1SXE A;  4IS7 A;  2E8N A;  5F3X B;  2KMD A;  2K60 A;  2LMR A;  2QAR A;  1X66 A;  2L5Y A;  3TAD A;  2EAN A;  2QAR B;  1PK1 A;  1LKY B;  1PK1 B;  1SXD A;  2KG5 A;  2EAP A;  2Y9U A;  1UQV A;  2QB1 A;  1B0X A;  3KKA C;  2F44 A;  2EAO A;  2E8P A;  2D3D A;  4NL9 C;  5JTI A;  2QB0 A;  1COK A;  1SGG A;  2QB0 B;  4MHV A;  2JV3 A;  5JU5 A;  1Z1V A;  3TAD C;  2F3N A;  2KIV A;  1LKY A;  2ES6 A;  2QKQ A;  1B4F A;  3K1R B;  5J8Y A;  2Y9T A;  2LPE A;  1WWU A;  1RG6 A;  4RQM A;  5JRT A;  2DKX A;  2E8M A;  4NJ8 A;  1X40 A;  3BS5 A;  2D8C A;  3BS5 B;  1V38 A;  2ESE A;  1X9X A;  2DKZ A;  2DL0 A;  2E8O A;  1V85 A;  3HIL A;  2KSO B;  4PZO A;  1PK3 A;  2YTU A;  1SV0 A;  2FE9 A;  3IDW A;  2KE7 A;  1F0M A;  3BQ7 A;  2GLE A;  2EAM A;  4PZN A;  5L1M A;  3BS7 A;  1WWV A;  2K4P A;  1OW5 A;  5J8Y C;  1JI7 A;  3H8M A;  2KSO A;  3SEI A;  1SV4 A;  4RQN A;  3TAC B;  2F8K A;  1KW4 A;  3KKA A;  2B6G A;  1SV0 C;  1DXS A;  4NL9 A;  1OXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...