3SENA

Structure of caskin1 tandem sams
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
KSSEAVSQWLTAFQLQLYAPNFISAGYDLPTISRMTPEDLTAIGVTKPGHRKKIAAEISGLSIPDWLPEHKPANLAVWLSMIGLAQYYKVLVDNGYENIDFITDITWEDLQEIGITKLGHQKKLMLAVRKLAELQKAEYAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caskin-1
publication title Tandem SAM domain structure of human Caskin1: a presynaptic, self-assembling scaffold for CASK.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA02
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3senA01
2EAMA 1UCVA 3TACB 4NL9A 1SGGA 2ES6A 2DKXA 2QKQA 3IDWA 3TADC 2ESEA 2KE7A 1B4FA 2JV3A 1DXSA 2D8CA 4RQNA 1F0MA 5L1MA 3H8MA 1JI7A 1X66A 2QB1A 1LKYA 2K4PA 5F3XB 2Y9TA 2QB0B 1V85A 2GLEA 1SV0A 2KMDA 2E8OA 2LPEA 2E8PA 4IS7A 2QARA 2KSOB 4MHVA 1B0XA 4PZOA 2F44A 5JTIA 2F8KA 5J8YC 2B6GA 2L5YA 2KIVA 1X9XA 2DKZA 2Y9UA 3BQ7A 4NL9C 2KG5A 1SV4A 3SENA 3HILA 1SXDA 1KW4A 1WWVA 3BS5B 3KKAA 1PK1B 1OW5A 4PZNA 1LKYB 1RG6A 3K1RB 2FE9A 2K60A 1V38A 3TADA 2DL0A 5J8YA 5JRTA 2F3NA 2E8NA 2QARB 2EAOA 2LMRA 1UQVA 4NJ8A 3SEIA 4RQMA 1SXEA 2QB0A 1X40A 2E8MA 3BS5A 2EAPA 1PK1A 2KSOA 1PK3A 1WWUA 1SV0C 1COKA 1Z1VA 3KKAC 2D3DA 5KNIA 2EANA 3BS7A 1OXJA 5JU5A 2YTUA
chains in the Genus database with same CATH superfamily
2ZIXB 3U26A 2P6UA 2WFAA 3MGHA 1J2NA 3MGIA 3AMZA 3NVWA 3PO4A 2QKQA 4F50A 4PHEA 1HJPA 2KVCA 3M6KA 4I2CA 1ZQZA 4P0PA 1F0MA 3PX4A 3H8MA 1SKRA 1ZQCA 3H8WA 8ICTA 4RT3A 1NK6A 2A3VA 4RQ8A 1KEJA 3RTVA 5AI5A 2ZUDA 1PVQA 4C8OA 4F3OA 2BCVA 4PZOA 2F44A 4F4ZA 3ISDA 5AKGA 3UMCA 2KD1A 3T5JA 1ZD5A 5CEHA 4DS4A 5K4LA 1N60A 3QUQA 4JB3A 3MR2A 2KICA 2AQ4A 4A8EA 5KFCA 2UVRA 1ZQUA 3B0XA 3QYPA 2BDUA 3RJFA 3BS5B 4KLOA 5DB6A 1PK1B 3C1ZA 3F2BA 5EE1A 1D8BA 1ZQWA 1MC8A 4OJLA 4US8A 2AU0A 2AGPA 2W7OA 3HKZF 2FE9A 5L9XA 3H4DA 1QSSA 4OD0A 1KDHA 3QXGA 4RUAA 3GIIA 1RQNA 2KKPA 4EBCA 4Y2UA 4YCXA 5CRXA 2H3IA 1P7DA 4LJXA 5BOLA 1FFVA 5KG1A 2F2AB 1X9WA 7ICVA 2PMZC 9ICPA 4OCZA 3WK4A 1O03A 4QNLA 1BPXA 2A1JA 5AHXA 2DKXA 3QU9A 4FFDA 3KZXA 1TFRA 5ALWA 4DL6A 1NNLA 2AQ0A 5KT3A 4P0QB 4F5PA 1IM4A 5ALVA 4CF4A 3Q8PB 9ICVA 3N97B 2ZTEA 3RR7A 2HHQA 2KIWA 2HI0A 2NRVA 3ORYA 5EE3A 5AK3A 2LYHA 1Y88A 1YZ7A 2PKEA 2YMQA 3SMVA 5KTQA 5ALUA 3BQ2A 3QZ7A 2XO7A 1T3NA 1HUZA 4B9UA 8ICSA 2JZBA 4GFJA 5DBAA 3KTQA 4UASA 4MFAA 4EELA 1JIHA 4KLHA 1TK5A 1QH9A 4GXJA 1SV4A 1ZQAA 2DPJA 1PVPA 1S77D 1KW4A 2XY5A 5J0RA 3UQ0A 3EYZA 4KLMA 3T5LA 3RH4A 4BDPA 2R8HA 2ZJ8A 1UPHA 2DGZA 3ALRA 2R8KA 2KK0A 2OH2A 1TK8A 4C8KA 2J6UA 1TV9A 3AN1A 4CF5A 3PSIA 5DG7A 5ALSA 4QW8A 5KFXA 3HX0A 3RB0A 5L1LA 4CE6A 4ED2A 4FZNA 1F44A 2H3VA 1TE2A 4ACOA 8ICAA 5AK6A 4UB6U 4R66A 2RRDA 3G6XA 7ICGA 5KFJA 1L3VA 4M9LA 1XWLA 1S8OA 1ZQXA 2D3DA 5GTHU 2FPKA 4G3IA 4GXKA 2M0NA 1A6SA 4RQ1A 4JV2A 3TADC 3SZ2A 4Q43A 3RBEA 2KE7A 3ICXA 5CP2A 3NRWA 2NO4A 4MEYA 1QQ7A 2ZG6A 3IV6A 1V85A 1RPLA 4RQ0A 3UXNA 2ZIUB 2G5IB 1NKCA 5TISU 3PO5A 3HW8A 3QU2A 1S76D 1KFTA 4Y2RA 5KG3A 2F8KA 1L7PA 5CA7A 4RQ5A 4KTQA 2WB1F 3T79A 5AI8A 2BQUA 1Q8KA 5J2FA 3SYZA 4YD1A 1YT3A 3QEAZ 1F5SA 3F5AA 4DFMA 3AM9A 1WWVA 3KOOA 5HR6A 1IIPA 4P4MA 4DEZA 2PFNA 4HAIA 1RG6A 5KL8B 4DF4A 5AIBA 2DPIA 2YB1A 2YQEA 5HP4A 3RJEA 4OJPA 4DS5A 4RNNA 3RJKA 3I28A 4USAA 1ZQNA 2I1QA 2ODGA 1L3UA 1WCNA 2ASDA 5AIAA 2XI9A 3UPQA 1RYRA 4QJFB 1RDFA 1YZ6A 5ALGA 1S9FA 1SL0A 4K4IA 5C0YA 2AGQA 3WKCA 2V4QA 2JXJA 4TUSA 4B9MA 2V4RA 2JEFA 1MSWD 1UA0A 3IG8A 2Y0SC 1ZQVA 3E0FA 4KX5A 4QIWF 5AKZA 4J03A 2W7PA 3PW7A 2W8LA 1HEKA 1VLBA 4ED6A 2KV2A 2FLLA 5KFIA 8ICFA 4ZOHC 1N56A 1Z4OA 4Z6FA 2OWOA 1D9DA 1NK8A 4EZ6A 4Y2TA 3H0MB 5EE0A 5KT2A 8ICVA 4WJ3B 1B0XA 1TAUA 1ZQ1C 4CRXA 3SAHA 4O3SA 5G5HA 2XY7A 2RQ5A 4FS2A 1UT8A 2VANA 5KFGA 4FS1A 2C2DA 5KFPA 3D2SA 4KX3A 1QQ5A 2NRWA 3CP8A 3QU4A 4QZBA 2BZFA 5J0SA 2BDPA 4FZLA 3SD7A 5ALOA 1EXNA 4OJ6A 7ICNA 1ZQTA 1AQ6A 2W55A 1U9LA 4ED0A 4K4GA 2EH9A 8ICKA 4DQPA 5IIMA 2KFNA 4F4KA 3JPQA 2QARB 3C2MA 2LMRA 3JPTA 1UQVA 3WK7A 4UB4A 2HHUA 2IA6A 2WHEA 3V6JA 1FIQA 4P0PB 3H0LB 3LYSA 4KN4A 2ZIUA 2IBKA 3N7RC 1IXRA 5EWEA 2XVTA 2FMQA 3IN5A 5AKHA 4DL3A 2ASJA 4ELUA 1QQ6A 3C2KA 3GILA 3KKAC 1NI3A 8ICJA 2F1JA 5JU5A 2YTUA 3DEEA 5CWRA 5DBCA 2YMPA 2AXTU 4J9NA 1NJWA 3IDWA 4BUGA 2PFOA 3NRZA 3KHRA 3RH6A 4R64A 1TAQA 5IIKA 3JPNA 5AM4A 5KG5A 5ALEA 2Y9TA 1Z4NA 2GLEA 1NKEA 4KLTA 3ZD9A 1K5OA 3ETLA 3UMBA 4QZGA 1PUZA 2CN1A 2F8LA 3KHLA 3LK9A 2MU2A 8ICGA 2HOIA 5KFRA 2JR5A 2H3QA 3OHAA 4ECYA 2G08A 2RP5A 2UVUA 1L6NA 1SL1A 1ZQIA 2WAQF 3EPIA 2B6GA 1NK0A 1DGSA 3BQ7A 4NL9C 4O3OA 3G6YA 5ALHA 3QX7A 3HILA 4C8NA 2R8IA 3HJEA 2H3ZA 1SZHA 2K60A 3KZIU 3PMLA 3TFSA 3GFKB 1CRXA 4UB8U 1QTMA 1ZD2P 1PVRA 4DQRA 2E8NA 3MR3A 5ALDA 1BPZA 4M6WB 3WK9A 2HBMA 4Y2QA 5BOMA 4JV1A 1UHUA 2IOFK 1J97A 2XY6A 2HW3A 3BQTA 3TKAA 3SR6A 1JRPA 2BR0A 2VA2A 3M8RA 1ZQBA 4MF2A 3UXPA 5AM3A 4F5RA 1ZRMA 1WWUA 1MQ2A 4MFFA 4F5OA 5AM5A 2K8BB 5KNIA 1ZD4A 4UQGA 4O5CA 4QWCA 5J29A 1X2IA 2EAMA 1QLNA 5ALQA 1HUOA 3IG5A 1SL2A 1KFDA 3OSNA 1B4FA 5J2CA 5AK4A 4KLSA 5B66U 3QUTA 4RQNA 3CRXA 3AUOA 4GC6A 2QB0B 2EDUA 3RJHA 3N4MB 2OEHA 5DLFA 5HHHA 2LHTA 2K4EA 3M6ZA 3V7LA 3FM9A 1L5UA 3Q8KA 5AI4A 3PR4A 2KJ5A 2QARA 2KEYA 3FAHA 4PPXA 1X9MA 8ICZA 3AU2A 1JUDA 3WKAA 3GZFA 3H8JA 2YX8A 4JMUA 5DKWA 4R63A 1X9XA 4KLEA 5J0UA 3PR5B 1U47A 9ICTA 2I9GA 4E0DA 5AI9A 2HBJA 2JHDA 3M1YA 4RUCA 5CHGA 1H38A 1RQLA 1CEZA 4Q44A 5J0XA 2CXYA 3GDXA 2OM6A 9ICHA 1V38A 3Q8MA 5KAIU 1SZPA 4DFDA 2LYBA 2K8CB 3SEIA 4YXJA 2W43A 3Q8LA 4I2IA 3PSTA 4MFCA 2DF4B 1A0PA 1KL9A 3ZDDA 3H7IA 3C29A 5AKXA 2BKEA 1S0VA 2C28A 2F1HA 3IHQB 3N7PD 1TK0A 1ZETA 1L3SA 4DSLA 5D49A 3FYHA 4C4TA 4F91B 4Y2PA 1COKA 4Z6EA 3CNHA 3ETRA 1NOMA 4PH5A 2IHMA 2BCUA 1DRGA 4XA5A 3LVWA 4M9HA 2H3FA 2XCPA 5KFHA 2P66A 8ICIA 4IQWA 9ICEA 4RQ6A 1XC9A 4FO6A 2HBKA 3M8SA 3DV9A 2K89A 3QUBA 2K4PA 4QWBA 3RH5A 3PX0A 7ICUA 1JMSA 1L3TA 4PJ0U 5J0WA 3KHHA 4LZGA 4ECTA 3MABA 2RDJA 1OUQA 1D8LA 3N7SC 3HP6A 4Y2VA 4O5KA 1L7MA 4M6WA 2HVIA 2HVHA 1S0NA 4OJ5A 4AYBC 4QZAA 4GLXA 4QWEA 4QWDA 2P6RA 4NXZA 4UAZA 2BPCA 4RT2A 5GTIU 1OW5A 3N28A 5ALZA 1ZD3A 4KITB 1LKYB 1K1QA 9ICNA 2E5SA 3JPSA 1B22A 4NLNA 4YG2A 2DUYA 3UQ2A 2KJ9A 4J9SA 4DL4A 4JWMA 1JX4A 2NRTA 5J2BA 3R9KA 2MA1A 4BX9C 4OO1J 2IMWP 3GU3A 3V7JA 2QB0A 3MDAA 2ISOA 2EAPA 4YVZA 7ICKA 4DSEA 1FEZA 2YB4A 4DCCA 5DGAA 5IIOA 4C7ZA 5KG2A 2W9CA 1TAMA 4ED8A 4M04A 2FMPA 4PGYA 4KLUA 3C28A 4ED1A 3GV8B 2EQYA 5E79U 4M47A 2W03A 3L4PA 3OGUA 2JV3A 2M9NA 4DFPA 4EEYA 9ICGA 5ALYA 5L1MA 5KG0A 3D2QA 3Q8RB 2ISPA 4IRDA 9ICLA 2JGAA 4KLGA 5ALTA 3GQCA 7ICJA 2D6FC 4B9LA 4JUZA 4LVSA 3PX6A 9ICSA 4BJQA 5JUMA 4RZRA 3WK5A 1ZJNA 1RYUA 3PVXA 4UB2A 1JROA 4RPXA 9ICJA 1K1SA 2C2RA 2ZXIA 5AICA 5J0YA 3B0YA 5AKJA 2PMZF 4F2RA 1L7NA 2FPMA 3MGVA 4KLFA 5J2GA 1SIJA 4RPZA 4ZH4A 4IC9A 5EWGA 4KLDA 4C80A 1NK4A 4EEKA 2IOHA 1NK5A 2O6KA 4DSIA 3D6JA 4I2EA 3TAPA 1TVAA 1T8EA 1J2MA 4PGQA 4J9LA 2VKQA 4F93B 4C7YA 3EW9A 5B5EU 7ICEA 4TUQA 1MA7A 2JMGA 2BGWA 4J9MA 4O3MA 2MAXA 2WF6A 1XSNA 5EOZA 3GIJA 3NASA 5FP0A 3QUCA 4ECWA 1NKBA 2FMSA 2KJ8A 3ZI4A 2W8KA 1ZYQA 2KHQA 2G09A 5L1IA 9ICAA 3TACB 4UAUA 4QZ8A 1JALA 2XIDA 4FZMA 2EZZA 5G5GA 1N5XA 4DSKA 2B0CA 1MN8A 5IIJA 2Q4TA 1XU4A 3JPPA 1Z1BA 2A19A 2ZIWB 4EBEA 2GH1A 2NRZA 3MDCA 1LKYA 9ICUA 4F92B 2W9MA 2KTQA 8ICUA 4KLJA 3ONNA 2GOLA 1XSLA 4IRCA 4F5QA 4O9MA 4JK1A 8ICBA 5J2HA 2I5HA 2JH7A 4QZDA 3PW0A 3MFIA 3H8SA 4UAWA 1SB3C 5CB1A 4NLZA 4ED3A 5KL1B 4OJOA 3JPOA 3I1YA 3C5GA 5J2AA 5KFLA 4EX7A 4IQUA 3RJJA 2G0AA 1PZNA 5DG8A 3C5FA 4YFKA 3TARA 3RFAA 1N63A 2BPGA 5KFKA 5ALMA 2NO5A 4TURA 2K4HA 3EZ5A 3SQIA 8ICNA 1ZQMA 3B9JA 4F72A 4B6JA 4RQ3A 7ICHA 4UARA 5AM2A 8ICPA 3C2LA 5KFTA 4GXIA 4B9NA 4IQTA 3RRHA 2FLPA 2W9BB 5DB7A 1D8YA 4M9NA 1WYGA 3BS7A 4P4PA 2JEGA 4NY8A 1XS9D 1KTQA 4GC7A 4ED7A 5HHIA 1ZQJA 4AP9A 7ICLA 4EYIB 3SAFA 4ECUA 1DXSA 1QCKA 4MEXA 1S0MA 4DSFA 3GV7B 1U48A 2ZIVB 3HWTA 5F3XB 2ZUBA 2KN7A 4O3RA 3E2EA 3F53A 1ZQPA 1BPDA 3MFHA 5EE9A 1T4GA 2JH1A 4O0IA 2W9AA 3MR6A 4MHVA 1NJXA 4I2DA 3T3FA 1NK9A 2C22A 1Q3UA 4DOCA 4I2AA 4BWJA 2FDRA 9ICQA 1L8OA 4U6PA 4CDGA 4RPYA 2I6XA 3WK6A 2KG5A 3AEVA 4TQSA 4PL2A 2HDOA 3IRUA 4ICAA 3WU2U 5DQIA 3T5KA 3TANA 2Y0SF 2E3TA 4PHDA 4PZNA 2YMLA 5ALNA 4QZEA 3M9NB 4ECZA 2DFLA 3V6HA 5KFAA 1LVHA 2VA3A 3Q8SB 3EWAA 2B21A 5KAFU 5J2EA 3K1ZA 4YXMA 2IHNA 2KZMA 2BQRA 2ZIWA 1S10A 4XQ8A 2WTFA 1Q3VA 3NTUA 4BXOB 1KKXA 3SV4A 1B43A 1KBUA 8ICRA 1ZQKA 9ICFA 4ECRA 2J6SA 5KFOA 2LKYA 3CYMA 3MBYA 4M9GA 3NVYA 4UB5A 8ICCA 5DLGA 2HHWA 4I29A 1Z1VA 3F2DA 5ALFA 2WF7A 3BZKA 3SI8A 4ELVA 3QU7A 1SGGA 4RQ2A 5J2DA 2KFZA 2ES6A 1BPBA 3HKZC 3QEBZ 1L7OA 9ICIA 3MC1A 4YR3A 3PW5A 2HOFA 4CGZA 4M9JA 2WF8A 3BZCA 2UVWA 3KBBA 5CJ7A 5DDYA 3AL0B 5KFQA 5F9NA 1MQ3A 3GIMA 1COOA 4UAYA 3ZDCA 4KMOB 2LPEA 3DDHA 3WK8A 2E8PA 4M0AA 5ALLA 5J2JA 3UXOA 5J8YC 4I28A 1ZQHA 2HBLA 5KFFA 4IR1A 3RAXA 3KD3A 1JN3A 3PSFA 4F5NA 2AGOA 3RAQA 1WCLA 3L3FX 4ELTA 4DO9A 4EENA 5DDMA 9ICCA 3SENA 1T3QA 2F76X 5AKLA 2G06A 2W9BA 3LWLA 4JV0A 1ZQYA 4ECQA 7ICQA 2BQ3A 4R8UB 3K1RB 1X6JA 2XGQA 2W9CB 4QZ9A 1XO1A 5AI0A 3MR5A 2XC9A 5AKKA 4I2BA 4F4XA 2F3NA 4XRHA 2CPRA 1IV8A 4F4YA 5KFYA 2F1IA 2EAOA 5HMMA 3LWMA 2KVSA 9ICOA 5AK5A 2OHFA 5AKIA 4CCHA 9ICWA 2ZIVA 4YMOA 4Y2YA 4QZFA 2KZ3A 1Q46A 2HHSA 2YMMA 4C8MA 2WF5A 7ICRA 1SV0C 3V72A 2LYAA 1SKSA 3PW4A 5J2IA 2EANA 2NRXA 4Z6DA 4RU9A 3SV3A 1AROP 2DBYA 2KKVA 3QNMA 1ZQDA 2XCAA 5J0QA 3OHBA 4ECSA 2D8CA 3RF9A 5AI6A 4YP3A 3OJSA 2G07A 4F8RA 3RR8A 4DL5A 4FE3A 2VJ5A 5KFWA 5KFVA 3L5KA 3IP4B 4RNMA 7ICMA 4DQQA 3HRDD 3ZD8A 3T5HA 2KSOB 2RLTA 4UBCA 1DK3A 3EUB2 1ED1A 4Y2JA 4DL2A 3EPGA 3Q8QB 4BXOA 2E1FA 2KIVA 2DKZA 2XICA 3NVVA 4YR2A 2Y9UA 4F71A 1CI4A 2JRZA 5L1JA 2Y1IA 3RBDA 2R18A 3PMNA 3A0HU 4Y2XA 2V9WA 3KFUF 1NJZA 5KFUA 3C1YA 4O3QA 2EZXA 8ICMA 2CRXA 3I76A 3NS1A 5KFSA 4KLQA 5AM0A 1QSYA 4RNOA 3TADA 1KFSA 3BJYA 1Z00B 4UATA 5DG9A 1RZTA 4CNQA 3H4BA 1VDVA 4YD2A 5IILA 1SXEA 4DL7A 4FBTA 4DFJA 4K4HA 1X40A 2YY6A 7ICSA 2WF9A 2E8MA 8ICHA 7ICOA 1ZQFA 1VJ5A 2WB1C 4IQVA 1BNOA 4NWIA 1URJA 4P4OA 5KFNA 2G5HB 1PK3A 2ATLA 4DSJA 4F4WA 3PY8A 3PW2A 2GWSA 2JEJA 2ZJ5A 1FO4A 3OPXA 4EX6A 2HHVA 2K8AA 2HOQA 5AM1A 3PV8A 2NV3A 2KOBA 4R8UA 4NM1A 1SKWA 2W54A 5ALPA 4BWMA 5KG6A 3PNCA 4I27A 4PGXA 4NLCA 4C4RA 2LI6A 5C5JA 1N62A 2OXOA 3V6KA 1RXVA 2FPLA 2ZIXA 2KNJA 3ED5A 4NM2A 2W11A 1V97A 2L5YA 2KHVA 1C20A 4B9SA 1DK2A 3HPOA 1DOQA 2N1RA 4KN7A 4QIWC 4UAVA 1BNPA 5KFEA 4YQWA 3F2CA 1LV5A 1ZOLA 1BVSA 4YMNA 5AKYA 1D9FA 1WUDA 3NVZA 2C2EA 2F77X 4I2JA 5HNKA 5J0OA 2HHXA 4HYKA 4Y2SA 3BQ1A 1ZQEA 4NJ8A 3RB4A 1WG8A 4QZHA 2HHTA 4YMMA 2ZTDA 1ZQGA 2A1AA 5F9LA 3OJUA 1X9SA 4RQ4A 4DWIA 4B9TA 3K4GA 2ALZA 4NLKA 3BS5A 2FI1A 1PK1A 1RYSA 2KSOA 2MUTB 1BPEA 4TUPA 3ZDEA 1ECWA 2DWQA 4AYBF 1KRPA 2OCEA 4DFKA 2VIXA 1IG6A 1OXJA 2FLNA 1T7PA 4UBBA 2HSZA 1UA1A 4KMUA 9ICKA 2E1EA 7ICIA 1NZBA 1T94A 4BGDA 3M9MB 2MSNA 2AH5A 1GO3F 4NV0A 3S6JA 2AHOB 4CF3A 4RQ7A 3UMGA 2RDIA 5T14A 2QLTA 3C21A 4YR0A 3AQFA 4QW9A 1Z00A 4J9KA 3TI0A 1U45A 8ICYA 2MRLA 3F5EA 1TKDA 5J0TA 9ICBA 5JTIA 4US9A 2PXIA 3KHGA 4ECXA 1U49A 2RHFA 5BPCA 2W3RA 4C0ZA 1BPYA 5KFBA 5KG4A 1RXWA 4P0QA 1Z3EB 4YN4A 5KG7A 1SXDA 5DBBA 1JXLA 4DF8A 3KKAA 3BDPA 4DLGA 3CW2C 1N2XA 3RB3A 4NLBA 3O0FA 3J81j 2KZZA 4J9PA 4U7CA 3HT3A 1S0OA 2DL0A 1KSPA 4EYHB 2HMXA 2ZJAA 7ICFA 2ZTCA 3LDAA 4MF8A 2PFPA 3H40A 4EZ9A 3C23A 4UW9A 4IL6U 3VCBA 2H5XA 3RB6A 2WAQC 2W3SA 4P2HA 2PI4A 4M2YA 4I2GA 5KT6A 1S5LU 1ZQSA 8ICWA 4ECVA 5J2KA 8ICEA 3FC4A 8ICLA 5HMLA 2Z7JA 2HCFA 1X6IA 1FFUA 1UCVA 4NL9A 2LM4A 1DGJA 3PSPA 5DQHA 4I2FA 2DQNB 4Q8FA 1BGXT 1NJYA 1JXEA 4TQRA 7ICTA 4O3PA 3GIKA 1NK7A 5KFMA 5IINA 4KLLA 5TZVA 3WKEA 1JI7A 2QB1A 5ALIA 4R65A 5ALKA 3TQ1A 2BPFA 5A0LA 1ZQLA 4Z6CA 5AKEA 4I2HA 2FJ6A 5KT5A 1U4BA 1N5WA 7ICPA 2KMDA 1V9PA 2W04A 4IS7A 3SAGA 3QU5A 4Q45A 3NGDA 4JWNA 2OYYA 3M7DA 4EBDA 3WKDA 5J0PA 1N61A 5EWFA 4QZIA 1A76A 1ZXIA 1NZPA 3IM1A 4LZDA 1XNSA 4C8LA 3OTQA 1UT5A 2MUTA 4J9RA 2ASLA 4NLGA 5D46A 2IOFA 5DB9A 3RJGA 3TFRA 3VC8A 4C4SA 3K75D 4X5VA 3D2NA 5ALRA 1S97A 3AU6A 9ICXA 2BHNA 3AQEA 5J8YA 2VA8A 5JRTA 1C7YA 5ALXA 4PHPA 2J6TA 2LBOA 2BCQA 3GV5B 2JEIA 4RQMA 3V7KA 1ZRNA 2BCRA 3ISBA 4DLEA 1M6YA 4PL1A 5KT4A 1X42A 3E58A 4GIBA 4O3NA 2R8JA 3M9OB 4KLIA 3ZDAA 2EZYA 1QSLA 2PI5A 2KP7A 1O08A 2YN4A 5D4BA 3PZPA 4B9VA 2AJQA 5KFDA 1XO0A 1L8LA 2ESEA 4G9BA 4DOAA 3QE9Y 4UB1A 1Z19A 3UM9A 1X66A 2BCSA 1KLNA 9ICRA 1SV0A 3ZDBA 9ICMA 2PFQA 1KN5A 8ICQA 2E8OA 8ICXA 2Y1JA 3LVVA 1ZJMA 5KFZA 4F2SA 2XGPA 2R8GA 5HR7A 5KT7A 5IIIA 4QWAA 4DOBA 3OSPA 5DB8A 2ZUCA 3FDSA 2A1JB 2Q0ZX 3RRGA 5H2FU 5L1KA 3THVA 4IRKA 4IR9A 2ZXHA 5DGBA 4DQIA 8ICOA 2LM1A 1ZQQA 4Q8EA 4FBUA 2VJ4A 1SWVA 4J9QA 1A77A 4J9OA 5CR0A 3G6VA 1ZQOA 1N48A 1CUKA 5DQGA 3BQ0A 2K4IA 1ZQRA 1HIWA 3H0RB 3NUQA 1XSPA 2JZBB 1KQQA 4QZCA 2UVVA 4UB3A 1SWWA 3ISCA 3QZ8A 2P35A 4PHAA 4DQSA 3A0BU 1RM6C 2NYVA 2GO7A 4O5EA 5ALJA 3RJIA 3JPRA 3WKBA 1LB2B 3TAQA 4XUSA
chains in the Genus database with same CATH topology
2EAMA 1UCVA 3TACB 4NL9A 1SGGA 2ES6A 2DKXA 2QKQA 3IDWA 3TADC 2ESEA 2KE7A 1B4FA 2JV3A 1DXSA 2D8CA 4RQNA 1F0MA 5L1MA 3H8MA 1JI7A 1X66A 2QB1A 1LKYA 2K4PA 5F3XB 2Y9TA 2QB0B 1V85A 2GLEA 1SV0A 2KMDA 2E8OA 2LPEA 2E8PA 4IS7A 2QARA 2KSOB 4MHVA 1B0XA 4PZOA 2F44A 5JTIA 2F8KA 5J8YC 2B6GA 2L5YA 2KIVA 1X9XA 2DKZA 2Y9UA 3BQ7A 4NL9C 2KG5A 1SV4A 3SENA 3HILA 1SXDA 1KW4A 1WWVA 3BS5B 3KKAA 1PK1B 1OW5A 4PZNA 1LKYB 1RG6A 3K1RB 2FE9A 2K60A 1V38A 3TADA 2DL0A 5J8YA 5JRTA 2F3NA 2E8NA 2QARB 2EAOA 2LMRA 1UQVA 4NJ8A 3SEIA 4RQMA 1SXEA 2QB0A 1X40A 2E8MA 3BS5A 2EAPA 1PK1A 2KSOA 1PK3A 1WWUA 1SV0C 1COKA 1Z1VA 3KKAC 2D3DA 5KNIA 2EANA 3BS7A 1OXJA 5JU5A 2YTUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAM A;  1UCV A;  3TAC B;  4NL9 A;  1SGG A;  2ES6 A;  2DKX A;  2QKQ A;  3IDW A;  3TAD C;  2ESE A;  2KE7 A;  1B4F A;  2JV3 A;  1DXS A;  2D8C A;  4RQN A;  1F0M A;  5L1M A;  3H8M A;  1JI7 A;  1X66 A;  2QB1 A;  1LKY A;  2K4P A;  5F3X B;  2Y9T A;  2QB0 B;  1V85 A;  2GLE A;  1SV0 A;  2KMD A;  2E8O A;  2LPE A;  2E8P A;  4IS7 A;  2QAR A;  2KSO B;  4MHV A;  1B0X A;  4PZO A;  2F44 A;  5JTI A;  2F8K A;  5J8Y C;  2B6G A;  2L5Y A;  2KIV A;  1X9X A;  2DKZ A;  2Y9U A;  3BQ7 A;  4NL9 C;  2KG5 A;  1SV4 A;  3SEN A;  3HIL A;  1SXD A;  1KW4 A;  1WWV A;  3BS5 B;  3KKA A;  1PK1 B;  1OW5 A;  4PZN A;  1LKY B;  1RG6 A;  3K1R B;  2FE9 A;  2K60 A;  1V38 A;  3TAD A;  2DL0 A;  5J8Y A;  5JRT A;  2F3N A;  2E8N A;  2QAR B;  2EAO A;  2LMR A;  1UQV A;  4NJ8 A;  3SEI A;  4RQM A;  1SXE A;  2QB0 A;  1X40 A;  2E8M A;  3BS5 A;  2EAP A;  1PK1 A;  2KSO A;  1PK3 A;  1WWU A;  1SV0 C;  1COK A;  1Z1V A;  3KKA C;  2D3D A;  5KNI A;  2EAN A;  3BS7 A;  1OXJ A;  5JU5 A;  2YTU A; 
#chains in the Genus database with same CATH topology
 2ZIX B;  3U26 A;  2P6U A;  2WFA A;  3MGH A;  1J2N A;  3MGI A;  3AMZ A;  3NVW A;  3PO4 A;  2QKQ A;  4F50 A;  4PHE A;  1HJP A;  2KVC A;  3M6K A;  4I2C A;  1ZQZ A;  4P0P A;  1F0M A;  3PX4 A;  3H8M A;  1SKR A;  1ZQC A;  3H8W A;  8ICT A;  4RT3 A;  1NK6 A;  2A3V A;  4RQ8 A;  1KEJ A;  3RTV A;  5AI5 A;  2ZUD A;  1PVQ A;  4C8O A;  4F3O A;  2BCV A;  4PZO A;  2F44 A;  4F4Z A;  3ISD A;  5AKG A;  3UMC A;  2KD1 A;  3T5J A;  1ZD5 A;  5CEH A;  4DS4 A;  5K4L A;  1N60 A;  3QUQ A;  4JB3 A;  3MR2 A;  2KIC A;  2AQ4 A;  4A8E A;  5KFC A;  2UVR A;  1ZQU A;  3B0X A;  3QYP A;  2BDU A;  3RJF A;  3BS5 B;  4KLO A;  5DB6 A;  1PK1 B;  3C1Z A;  3F2B A;  5EE1 A;  1D8B A;  1ZQW A;  1MC8 A;  4OJL A;  4US8 A;  2AU0 A;  2AGP A;  2W7O A;  3HKZ F;  2FE9 A;  5L9X A;  3H4D A;  1QSS A;  4OD0 A;  1KDH A;  3QXG A;  4RUA A;  3GII A;  1RQN A;  2KKP A;  4EBC A;  4Y2U A;  4YCX A;  5CRX A;  2H3I A;  1P7D A;  4LJX A;  5BOL A;  1FFV A;  5KG1 A;  2F2A B;  1X9W A;  7ICV A;  2PMZ C;  9ICP A;  4OCZ A;  3WK4 A;  1O03 A;  4QNL A;  1BPX A;  2A1J A;  5AHX A;  2DKX A;  3QU9 A;  4FFD A;  3KZX A;  1TFR A;  5ALW A;  4DL6 A;  1NNL A;  2AQ0 A;  5KT3 A;  4P0Q B;  4F5P A;  1IM4 A;  5ALV A;  4CF4 A;  3Q8P B;  9ICV A;  3N97 B;  2ZTE A;  3RR7 A;  2HHQ A;  2KIW A;  2HI0 A;  2NRV A;  3ORY A;  5EE3 A;  5AK3 A;  2LYH A;  1Y88 A;  1YZ7 A;  2PKE A;  2YMQ A;  3SMV A;  5KTQ A;  5ALU A;  3BQ2 A;  3QZ7 A;  2XO7 A;  1T3N A;  1HUZ A;  4B9U A;  8ICS A;  2JZB A;  4GFJ A;  5DBA A;  3KTQ A;  4UAS A;  4MFA A;  4EEL A;  1JIH A;  4KLH A;  1TK5 A;  1QH9 A;  4GXJ A;  1SV4 A;  1ZQA A;  2DPJ A;  1PVP A;  1S77 D;  1KW4 A;  2XY5 A;  5J0R A;  3UQ0 A;  3EYZ A;  4KLM A;  3T5L A;  3RH4 A;  4BDP A;  2R8H A;  2ZJ8 A;  1UPH A;  2DGZ A;  3ALR A;  2R8K A;  2KK0 A;  2OH2 A;  1TK8 A;  4C8K A;  2J6U A;  1TV9 A;  3AN1 A;  4CF5 A;  3PSI A;  5DG7 A;  5ALS A;  4QW8 A;  5KFX A;  3HX0 A;  3RB0 A;  5L1L A;  4CE6 A;  4ED2 A;  4FZN A;  1F44 A;  2H3V A;  1TE2 A;  4ACO A;  8ICA A;  5AK6 A;  4UB6 U;  4R66 A;  2RRD A;  3G6X A;  7ICG A;  5KFJ A;  1L3V A;  4M9L A;  1XWL A;  1S8O A;  1ZQX A;  2D3D A;  5GTH U;  2FPK A;  4G3I A;  4GXK A;  2M0N A;  1A6S A;  4RQ1 A;  4JV2 A;  3TAD C;  3SZ2 A;  4Q43 A;  3RBE A;  2KE7 A;  3ICX A;  5CP2 A;  3NRW A;  2NO4 A;  4MEY A;  1QQ7 A;  2ZG6 A;  3IV6 A;  1V85 A;  1RPL A;  4RQ0 A;  3UXN A;  2ZIU B;  2G5I B;  1NKC A;  5TIS U;  3PO5 A;  3HW8 A;  3QU2 A;  1S76 D;  1KFT A;  4Y2R A;  5KG3 A;  2F8K A;  1L7P A;  5CA7 A;  4RQ5 A;  4KTQ A;  2WB1 F;  3T79 A;  5AI8 A;  2BQU A;  1Q8K A;  5J2F A;  3SYZ A;  4YD1 A;  1YT3 A;  3QEA Z;  1F5S A;  3F5A A;  4DFM A;  3AM9 A;  1WWV A;  3KOO A;  5HR6 A;  1IIP A;  4P4M A;  4DEZ A;  2PFN A;  4HAI A;  1RG6 A;  5KL8 B;  4DF4 A;  5AIB A;  2DPI A;  2YB1 A;  2YQE A;  5HP4 A;  3RJE A;  4OJP A;  4DS5 A;  4RNN A;  3RJK A;  3I28 A;  4USA A;  1ZQN A;  2I1Q A;  2ODG A;  1L3U A;  1WCN A;  2ASD A;  5AIA A;  2XI9 A;  3UPQ A;  1RYR A;  4QJF B;  1RDF A;  1YZ6 A;  5ALG A;  1S9F A;  1SL0 A;  4K4I A;  5C0Y A;  2AGQ A;  3WKC A;  2V4Q A;  2JXJ A;  4TUS A;  4B9M A;  2V4R A;  2JEF A;  1MSW D;  1UA0 A;  3IG8 A;  2Y0S C;  1ZQV A;  3E0F A;  4KX5 A;  4QIW F;  5AKZ A;  4J03 A;  2W7P A;  3PW7 A;  2W8L A;  1HEK A;  1VLB A;  4ED6 A;  2KV2 A;  2FLL A;  5KFI A;  8ICF A;  4ZOH C;  1N56 A;  1Z4O A;  4Z6F A;  2OWO A;  1D9D A;  1NK8 A;  4EZ6 A;  4Y2T A;  3H0M B;  5EE0 A;  5KT2 A;  8ICV A;  4WJ3 B;  1B0X A;  1TAU A;  1ZQ1 C;  4CRX A;  3SAH A;  4O3S A;  5G5H A;  2XY7 A;  2RQ5 A;  4FS2 A;  1UT8 A;  2VAN A;  5KFG A;  4FS1 A;  2C2D A;  5KFP A;  3D2S A;  4KX3 A;  1QQ5 A;  2NRW A;  3CP8 A;  3QU4 A;  4QZB A;  2BZF A;  5J0S A;  2BDP A;  4FZL A;  3SD7 A;  5ALO A;  1EXN A;  4OJ6 A;  7ICN A;  1ZQT A;  1AQ6 A;  2W55 A;  1U9L A;  4ED0 A;  4K4G A;  2EH9 A;  8ICK A;  4DQP A;  5IIM A;  2KFN A;  4F4K A;  3JPQ A;  2QAR B;  3C2M A;  2LMR A;  3JPT A;  1UQV A;  3WK7 A;  4UB4 A;  2HHU A;  2IA6 A;  2WHE A;  3V6J A;  1FIQ A;  4P0P B;  3H0L B;  3LYS A;  4KN4 A;  2ZIU A;  2IBK A;  3N7R C;  1IXR A;  5EWE A;  2XVT A;  2FMQ A;  3IN5 A;  5AKH A;  4DL3 A;  2ASJ A;  4ELU A;  1QQ6 A;  3C2K A;  3GIL A;  3KKA C;  1NI3 A;  8ICJ A;  2F1J A;  5JU5 A;  2YTU A;  3DEE A;  5CWR A;  5DBC A;  2YMP A;  2AXT U;  4J9N A;  1NJW A;  3IDW A;  4BUG A;  2PFO A;  3NRZ A;  3KHR A;  3RH6 A;  4R64 A;  1TAQ A;  5IIK A;  3JPN A;  5AM4 A;  5KG5 A;  5ALE A;  2Y9T A;  1Z4N A;  2GLE A;  1NKE A;  4KLT A;  3ZD9 A;  1K5O A;  3ETL A;  3UMB A;  4QZG A;  1PUZ A;  2CN1 A;  2F8L A;  3KHL A;  3LK9 A;  2MU2 A;  8ICG A;  2HOI A;  5KFR A;  2JR5 A;  2H3Q A;  3OHA A;  4ECY A;  2G08 A;  2RP5 A;  2UVU A;  1L6N A;  1SL1 A;  1ZQI A;  2WAQ F;  3EPI A;  2B6G A;  1NK0 A;  1DGS A;  3BQ7 A;  4NL9 C;  4O3O A;  3G6Y A;  5ALH A;  3QX7 A;  3HIL A;  4C8N A;  2R8I A;  3HJE A;  2H3Z A;  1SZH A;  2K60 A;  3KZI U;  3PML A;  3TFS A;  3GFK B;  1CRX A;  4UB8 U;  1QTM A;  1ZD2 P;  1PVR A;  4DQR A;  2E8N A;  3MR3 A;  5ALD A;  1BPZ A;  4M6W B;  3WK9 A;  2HBM A;  4Y2Q A;  5BOM A;  4JV1 A;  1UHU A;  2IOF K;  1J97 A;  2XY6 A;  2HW3 A;  3BQT A;  3TKA A;  3SR6 A;  1JRP A;  2BR0 A;  2VA2 A;  3M8R A;  1ZQB A;  4MF2 A;  3UXP A;  5AM3 A;  4F5R A;  1ZRM A;  1WWU A;  1MQ2 A;  4MFF A;  4F5O A;  5AM5 A;  2K8B B;  5KNI A;  1ZD4 A;  4UQG A;  4O5C A;  4QWC A;  5J29 A;  1X2I A;  2EAM A;  1QLN A;  5ALQ A;  1HUO A;  3IG5 A;  1SL2 A;  1KFD A;  3OSN A;  1B4F A;  5J2C A;  5AK4 A;  4KLS A;  5B66 U;  3QUT A;  4RQN A;  3CRX A;  3AUO A;  4GC6 A;  2QB0 B;  2EDU A;  3RJH A;  3N4M B;  2OEH A;  5DLF A;  5HHH A;  2LHT A;  2K4E A;  3M6Z A;  3V7L A;  3FM9 A;  1L5U A;  3Q8K A;  5AI4 A;  3PR4 A;  2KJ5 A;  2QAR A;  2KEY A;  3FAH A;  4PPX A;  1X9M A;  8ICZ A;  3AU2 A;  1JUD A;  3WKA A;  3GZF A;  3H8J A;  2YX8 A;  4JMU A;  5DKW A;  4R63 A;  1X9X A;  4KLE A;  5J0U A;  3PR5 B;  1U47 A;  9ICT A;  2I9G A;  4E0D A;  5AI9 A;  2HBJ A;  2JHD A;  3M1Y A;  4RUC A;  5CHG A;  1H38 A;  1RQL A;  1CEZ A;  4Q44 A;  5J0X A;  2CXY A;  3GDX A;  2OM6 A;  9ICH A;  1V38 A;  3Q8M A;  5KAI U;  1SZP A;  4DFD A;  2LYB A;  2K8C B;  3SEI A;  4YXJ A;  2W43 A;  3Q8L A;  4I2I A;  3PST A;  4MFC A;  2DF4 B;  1A0P A;  1KL9 A;  3ZDD A;  3H7I A;  3C29 A;  5AKX A;  2BKE A;  1S0V A;  2C28 A;  2F1H A;  3IHQ B;  3N7P D;  1TK0 A;  1ZET A;  1L3S A;  4DSL A;  5D49 A;  3FYH A;  4C4T A;  4F91 B;  4Y2P A;  1COK A;  4Z6E A;  3CNH A;  3ETR A;  1NOM A;  4PH5 A;  2IHM A;  2BCU A;  1DRG A;  4XA5 A;  3LVW A;  4M9H A;  2H3F A;  2XCP A;  5KFH A;  2P66 A;  8ICI A;  4IQW A;  9ICE A;  4RQ6 A;  1XC9 A;  4FO6 A;  2HBK A;  3M8S A;  3DV9 A;  2K89 A;  3QUB A;  2K4P A;  4QWB A;  3RH5 A;  3PX0 A;  7ICU A;  1JMS A;  1L3T A;  4PJ0 U;  5J0W A;  3KHH A;  4LZG A;  4ECT A;  3MAB A;  2RDJ A;  1OUQ A;  1D8L A;  3N7S C;  3HP6 A;  4Y2V A;  4O5K A;  1L7M A;  4M6W A;  2HVI A;  2HVH A;  1S0N A;  4OJ5 A;  4AYB C;  4QZA A;  4GLX A;  4QWE A;  4QWD A;  2P6R A;  4NXZ A;  4UAZ A;  2BPC A;  4RT2 A;  5GTI U;  1OW5 A;  3N28 A;  5ALZ A;  1ZD3 A;  4KIT B;  1LKY B;  1K1Q A;  9ICN A;  2E5S A;  3JPS A;  1B22 A;  4NLN A;  4YG2 A;  2DUY A;  3UQ2 A;  2KJ9 A;  4J9S A;  4DL4 A;  4JWM A;  1JX4 A;  2NRT A;  5J2B A;  3R9K A;  2MA1 A;  4BX9 C;  4OO1 J;  2IMW P;  3GU3 A;  3V7J A;  2QB0 A;  3MDA A;  2ISO A;  2EAP A;  4YVZ A;  7ICK A;  4DSE A;  1FEZ A;  2YB4 A;  4DCC A;  5DGA A;  5IIO A;  4C7Z A;  5KG2 A;  2W9C A;  1TAM A;  4ED8 A;  4M04 A;  2FMP A;  4PGY A;  4KLU A;  3C28 A;  4ED1 A;  3GV8 B;  2EQY A;  5E79 U;  4M47 A;  2W03 A;  3L4P A;  3OGU A;  2JV3 A;  2M9N A;  4DFP A;  4EEY A;  9ICG A;  5ALY A;  5L1M A;  5KG0 A;  3D2Q A;  3Q8R B;  2ISP A;  4IRD A;  9ICL A;  2JGA A;  4KLG A;  5ALT A;  3GQC A;  7ICJ A;  2D6F C;  4B9L A;  4JUZ A;  4LVS A;  3PX6 A;  9ICS A;  4BJQ A;  5JUM A;  4RZR A;  3WK5 A;  1ZJN A;  1RYU A;  3PVX A;  4UB2 A;  1JRO A;  4RPX A;  9ICJ A;  1K1S A;  2C2R A;  2ZXI A;  5AIC A;  5J0Y A;  3B0Y A;  5AKJ A;  2PMZ F;  4F2R A;  1L7N A;  2FPM A;  3MGV A;  4KLF A;  5J2G A;  1SIJ A;  4RPZ A;  4ZH4 A;  4IC9 A;  5EWG A;  4KLD A;  4C80 A;  1NK4 A;  4EEK A;  2IOH A;  1NK5 A;  2O6K A;  4DSI A;  3D6J A;  4I2E A;  3TAP A;  1TVA A;  1T8E A;  1J2M A;  4PGQ A;  4J9L A;  2VKQ A;  4F93 B;  4C7Y A;  3EW9 A;  5B5E U;  7ICE A;  4TUQ A;  1MA7 A;  2JMG A;  2BGW A;  4J9M A;  4O3M A;  2MAX A;  2WF6 A;  1XSN A;  5EOZ A;  3GIJ A;  3NAS A;  5FP0 A;  3QUC A;  4ECW A;  1NKB A;  2FMS A;  2KJ8 A;  3ZI4 A;  2W8K A;  1ZYQ A;  2KHQ A;  2G09 A;  5L1I A;  9ICA A;  3TAC B;  4UAU A;  4QZ8 A;  1JAL A;  2XID A;  4FZM A;  2EZZ A;  5G5G A;  1N5X A;  4DSK A;  2B0C A;  1MN8 A;  5IIJ A;  2Q4T A;  1XU4 A;  3JPP A;  1Z1B A;  2A19 A;  2ZIW B;  4EBE A;  2GH1 A;  2NRZ A;  3MDC A;  1LKY A;  9ICU A;  4F92 B;  2W9M A;  2KTQ A;  8ICU A;  4KLJ A;  3ONN A;  2GOL A;  1XSL A;  4IRC A;  4F5Q A;  4O9M A;  4JK1 A;  8ICB A;  5J2H A;  2I5H A;  2JH7 A;  4QZD A;  3PW0 A;  3MFI A;  3H8S A;  4UAW A;  1SB3 C;  5CB1 A;  4NLZ A;  4ED3 A;  5KL1 B;  4OJO A;  3JPO A;  3I1Y A;  3C5G A;  5J2A A;  5KFL A;  4EX7 A;  4IQU A;  3RJJ A;  2G0A A;  1PZN A;  5DG8 A;  3C5F A;  4YFK A;  3TAR A;  3RFA A;  1N63 A;  2BPG A;  5KFK A;  5ALM A;  2NO5 A;  4TUR A;  2K4H A;  3EZ5 A;  3SQI A;  8ICN A;  1ZQM A;  3B9J A;  4F72 A;  4B6J A;  4RQ3 A;  7ICH A;  4UAR A;  5AM2 A;  8ICP A;  3C2L A;  5KFT A;  4GXI A;  4B9N A;  4IQT A;  3RRH A;  2FLP A;  2W9B B;  5DB7 A;  1D8Y A;  4M9N A;  1WYG A;  3BS7 A;  4P4P A;  2JEG A;  4NY8 A;  1XS9 D;  1KTQ A;  4GC7 A;  4ED7 A;  5HHI A;  1ZQJ A;  4AP9 A;  7ICL A;  4EYI B;  3SAF A;  4ECU A;  1DXS A;  1QCK A;  4MEX A;  1S0M A;  4DSF A;  3GV7 B;  1U48 A;  2ZIV B;  3HWT A;  5F3X B;  2ZUB A;  2KN7 A;  4O3R A;  3E2E A;  3F53 A;  1ZQP A;  1BPD A;  3MFH A;  5EE9 A;  1T4G A;  2JH1 A;  4O0I A;  2W9A A;  3MR6 A;  4MHV A;  1NJX A;  4I2D A;  3T3F A;  1NK9 A;  2C22 A;  1Q3U A;  4DOC A;  4I2A A;  4BWJ A;  2FDR A;  9ICQ A;  1L8O A;  4U6P A;  4CDG A;  4RPY A;  2I6X A;  3WK6 A;  2KG5 A;  3AEV A;  4TQS A;  4PL2 A;  2HDO A;  3IRU A;  4ICA A;  3WU2 U;  5DQI A;  3T5K A;  3TAN A;  2Y0S F;  2E3T A;  4PHD A;  4PZN A;  2YML A;  5ALN A;  4QZE A;  3M9N B;  4ECZ A;  2DFL A;  3V6H A;  5KFA A;  1LVH A;  2VA3 A;  3Q8S B;  3EWA A;  2B21 A;  5KAF U;  5J2E A;  3K1Z A;  4YXM A;  2IHN A;  2KZM A;  2BQR A;  2ZIW A;  1S10 A;  4XQ8 A;  2WTF A;  1Q3V A;  3NTU A;  4BXO B;  1KKX A;  3SV4 A;  1B43 A;  1KBU A;  8ICR A;  1ZQK A;  9ICF A;  4ECR A;  2J6S A;  5KFO A;  2LKY A;  3CYM A;  3MBY A;  4M9G A;  3NVY A;  4UB5 A;  8ICC A;  5DLG A;  2HHW A;  4I29 A;  1Z1V A;  3F2D A;  5ALF A;  2WF7 A;  3BZK A;  3SI8 A;  4ELV A;  3QU7 A;  1SGG A;  4RQ2 A;  5J2D A;  2KFZ A;  2ES6 A;  1BPB A;  3HKZ C;  3QEB Z;  1L7O A;  9ICI A;  3MC1 A;  4YR3 A;  3PW5 A;  2HOF A;  4CGZ A;  4M9J A;  2WF8 A;  3BZC A;  2UVW A;  3KBB A;  5CJ7 A;  5DDY A;  3AL0 B;  5KFQ A;  5F9N A;  1MQ3 A;  3GIM A;  1COO A;  4UAY A;  3ZDC A;  4KMO B;  2LPE A;  3DDH A;  3WK8 A;  2E8P A;  4M0A A;  5ALL A;  5J2J A;  3UXO A;  5J8Y C;  4I28 A;  1ZQH A;  2HBL A;  5KFF A;  4IR1 A;  3RAX A;  3KD3 A;  1JN3 A;  3PSF A;  4F5N A;  2AGO A;  3RAQ A;  1WCL A;  3L3F X;  4ELT A;  4DO9 A;  4EEN A;  5DDM A;  9ICC A;  3SEN A;  1T3Q A;  2F76 X;  5AKL A;  2G06 A;  2W9B A;  3LWL A;  4JV0 A;  1ZQY A;  4ECQ A;  7ICQ A;  2BQ3 A;  4R8U B;  3K1R B;  1X6J A;  2XGQ A;  2W9C B;  4QZ9 A;  1XO1 A;  5AI0 A;  3MR5 A;  2XC9 A;  5AKK A;  4I2B A;  4F4X A;  2F3N A;  4XRH A;  2CPR A;  1IV8 A;  4F4Y A;  5KFY A;  2F1I A;  2EAO A;  5HMM A;  3LWM A;  2KVS A;  9ICO A;  5AK5 A;  2OHF A;  5AKI A;  4CCH A;  9ICW A;  2ZIV A;  4YMO A;  4Y2Y A;  4QZF A;  2KZ3 A;  1Q46 A;  2HHS A;  2YMM A;  4C8M A;  2WF5 A;  7ICR A;  1SV0 C;  3V72 A;  2LYA A;  1SKS A;  3PW4 A;  5J2I A;  2EAN A;  2NRX A;  4Z6D A;  4RU9 A;  3SV3 A;  1ARO P;  2DBY A;  2KKV A;  3QNM A;  1ZQD A;  2XCA A;  5J0Q A;  3OHB A;  4ECS A;  2D8C A;  3RF9 A;  5AI6 A;  4YP3 A;  3OJS A;  2G07 A;  4F8R A;  3RR8 A;  4DL5 A;  4FE3 A;  2VJ5 A;  5KFW A;  5KFV A;  3L5K A;  3IP4 B;  4RNM A;  7ICM A;  4DQQ A;  3HRD D;  3ZD8 A;  3T5H A;  2KSO B;  2RLT A;  4UBC A;  1DK3 A;  3EUB 2;  1ED1 A;  4Y2J A;  4DL2 A;  3EPG A;  3Q8Q B;  4BXO A;  2E1F A;  2KIV A;  2DKZ A;  2XIC A;  3NVV A;  4YR2 A;  2Y9U A;  4F71 A;  1CI4 A;  2JRZ A;  5L1J A;  2Y1I A;  3RBD A;  2R18 A;  3PMN A;  3A0H U;  4Y2X A;  2V9W A;  3KFU F;  1NJZ A;  5KFU A;  3C1Y A;  4O3Q A;  2EZX A;  8ICM A;  2CRX A;  3I76 A;  3NS1 A;  5KFS A;  4KLQ A;  5AM0 A;  1QSY A;  4RNO A;  3TAD A;  1KFS A;  3BJY A;  1Z00 B;  4UAT A;  5DG9 A;  1RZT A;  4CNQ A;  3H4B A;  1VDV A;  4YD2 A;  5IIL A;  1SXE A;  4DL7 A;  4FBT A;  4DFJ A;  4K4H A;  1X40 A;  2YY6 A;  7ICS A;  2WF9 A;  2E8M A;  8ICH A;  7ICO A;  1ZQF A;  1VJ5 A;  2WB1 C;  4IQV A;  1BNO A;  4NWI A;  1URJ A;  4P4O A;  5KFN A;  2G5H B;  1PK3 A;  2ATL A;  4DSJ A;  4F4W A;  3PY8 A;  3PW2 A;  2GWS A;  2JEJ A;  2ZJ5 A;  1FO4 A;  3OPX A;  4EX6 A;  2HHV A;  2K8A A;  2HOQ A;  5AM1 A;  3PV8 A;  2NV3 A;  2KOB A;  4R8U A;  4NM1 A;  1SKW A;  2W54 A;  5ALP A;  4BWM A;  5KG6 A;  3PNC A;  4I27 A;  4PGX A;  4NLC A;  4C4R A;  2LI6 A;  5C5J A;  1N62 A;  2OXO A;  3V6K A;  1RXV A;  2FPL A;  2ZIX A;  2KNJ A;  3ED5 A;  4NM2 A;  2W11 A;  1V97 A;  2L5Y A;  2KHV A;  1C20 A;  4B9S A;  1DK2 A;  3HPO A;  1DOQ A;  2N1R A;  4KN7 A;  4QIW C;  4UAV A;  1BNP A;  5KFE A;  4YQW A;  3F2C A;  1LV5 A;  1ZOL A;  1BVS A;  4YMN A;  5AKY A;  1D9F A;  1WUD A;  3NVZ A;  2C2E A;  2F77 X;  4I2J A;  5HNK A;  5J0O A;  2HHX A;  4HYK A;  4Y2S A;  3BQ1 A;  1ZQE A;  4NJ8 A;  3RB4 A;  1WG8 A;  4QZH A;  2HHT A;  4YMM A;  2ZTD A;  1ZQG A;  2A1A A;  5F9L A;  3OJU A;  1X9S A;  4RQ4 A;  4DWI A;  4B9T A;  3K4G A;  2ALZ A;  4NLK A;  3BS5 A;  2FI1 A;  1PK1 A;  1RYS A;  2KSO A;  2MUT B;  1BPE A;  4TUP A;  3ZDE A;  1ECW A;  2DWQ A;  4AYB F;  1KRP A;  2OCE A;  4DFK A;  2VIX A;  1IG6 A;  1OXJ A;  2FLN A;  1T7P A;  4UBB A;  2HSZ A;  1UA1 A;  4KMU A;  9ICK A;  2E1E A;  7ICI A;  1NZB A;  1T94 A;  4BGD A;  3M9M B;  2MSN A;  2AH5 A;  1GO3 F;  4NV0 A;  3S6J A;  2AHO B;  4CF3 A;  4RQ7 A;  3UMG A;  2RDI A;  5T14 A;  2QLT A;  3C21 A;  4YR0 A;  3AQF A;  4QW9 A;  1Z00 A;  4J9K A;  3TI0 A;  1U45 A;  8ICY A;  2MRL A;  3F5E A;  1TKD A;  5J0T A;  9ICB A;  5JTI A;  4US9 A;  2PXI A;  3KHG A;  4ECX A;  1U49 A;  2RHF A;  5BPC A;  2W3R A;  4C0Z A;  1BPY A;  5KFB A;  5KG4 A;  1RXW A;  4P0Q A;  1Z3E B;  4YN4 A;  5KG7 A;  1SXD A;  5DBB A;  1JXL A;  4DF8 A;  3KKA A;  3BDP A;  4DLG A;  3CW2 C;  1N2X A;  3RB3 A;  4NLB A;  3O0F A;  3J81 j;  2KZZ A;  4J9P A;  4U7C A;  3HT3 A;  1S0O A;  2DL0 A;  1KSP A;  4EYH B;  2HMX A;  2ZJA A;  7ICF A;  2ZTC A;  3LDA A;  4MF8 A;  2PFP A;  3H40 A;  4EZ9 A;  3C23 A;  4UW9 A;  4IL6 U;  3VCB A;  2H5X A;  3RB6 A;  2WAQ C;  2W3S A;  4P2H A;  2PI4 A;  4M2Y A;  4I2G A;  5KT6 A;  1S5L U;  1ZQS A;  8ICW A;  4ECV A;  5J2K A;  8ICE A;  3FC4 A;  8ICL A;  5HML A;  2Z7J A;  2HCF A;  1X6I A;  1FFU A;  1UCV A;  4NL9 A;  2LM4 A;  1DGJ A;  3PSP A;  5DQH A;  4I2F A;  2DQN B;  4Q8F A;  1BGX T;  1NJY A;  1JXE A;  4TQR A;  7ICT A;  4O3P A;  3GIK A;  1NK7 A;  5KFM A;  5IIN A;  4KLL A;  5TZV A;  3WKE A;  1JI7 A;  2QB1 A;  5ALI A;  4R65 A;  5ALK A;  3TQ1 A;  2BPF A;  5A0L A;  1ZQL A;  4Z6C A;  5AKE A;  4I2H A;  2FJ6 A;  5KT5 A;  1U4B A;  1N5W A;  7ICP A;  2KMD A;  1V9P A;  2W04 A;  4IS7 A;  3SAG A;  3QU5 A;  4Q45 A;  3NGD A;  4JWN A;  2OYY A;  3M7D A;  4EBD A;  3WKD A;  5J0P A;  1N61 A;  5EWF A;  4QZI A;  1A76 A;  1ZXI A;  1NZP A;  3IM1 A;  4LZD A;  1XNS A;  4C8L A;  3OTQ A;  1UT5 A;  2MUT A;  4J9R A;  2ASL A;  4NLG A;  5D46 A;  2IOF A;  5DB9 A;  3RJG A;  3TFR A;  3VC8 A;  4C4S A;  3K75 D;  4X5V A;  3D2N A;  5ALR A;  1S97 A;  3AU6 A;  9ICX A;  2BHN A;  3AQE A;  5J8Y A;  2VA8 A;  5JRT A;  1C7Y A;  5ALX A;  4PHP A;  2J6T A;  2LBO A;  2BCQ A;  3GV5 B;  2JEI A;  4RQM A;  3V7K A;  1ZRN A;  2BCR A;  3ISB A;  4DLE A;  1M6Y A;  4PL1 A;  5KT4 A;  1X42 A;  3E58 A;  4GIB A;  4O3N A;  2R8J A;  3M9O B;  4KLI A;  3ZDA A;  2EZY A;  1QSL A;  2PI5 A;  2KP7 A;  1O08 A;  2YN4 A;  5D4B A;  3PZP A;  4B9V A;  2AJQ A;  5KFD A;  1XO0 A;  1L8L A;  2ESE A;  4G9B A;  4DOA A;  3QE9 Y;  4UB1 A;  1Z19 A;  3UM9 A;  1X66 A;  2BCS A;  1KLN A;  9ICR A;  1SV0 A;  3ZDB A;  9ICM A;  2PFQ A;  1KN5 A;  8ICQ A;  2E8O A;  8ICX A;  2Y1J A;  3LVV A;  1ZJM A;  5KFZ A;  4F2S A;  2XGP A;  2R8G A;  5HR7 A;  5KT7 A;  5III A;  4QWA A;  4DOB A;  3OSP A;  5DB8 A;  2ZUC A;  3FDS A;  2A1J B;  2Q0Z X;  3RRG A;  5H2F U;  5L1K A;  3THV A;  4IRK A;  4IR9 A;  2ZXH A;  5DGB A;  4DQI A;  8ICO A;  2LM1 A;  1ZQQ A;  4Q8E A;  4FBU A;  2VJ4 A;  1SWV A;  4J9Q A;  1A77 A;  4J9O A;  5CR0 A;  3G6V A;  1ZQO A;  1N48 A;  1CUK A;  5DQG A;  3BQ0 A;  2K4I A;  1ZQR A;  1HIW A;  3H0R B;  3NUQ A;  1XSP A;  2JZB B;  1KQQ A;  4QZC A;  2UVV A;  4UB3 A;  1SWW A;  3ISC A;  3QZ8 A;  2P35 A;  4PHA A;  4DQS A;  3A0B U;  1RM6 C;  2NYV A;  2GO7 A;  4O5E A;  5ALJ A;  3RJI A;  3JPR A;  3WKB A;  1LB2 B;  3TAQ A;  4XUS A; 
#chains in the Genus database with same CATH homology
 2EAM A;  1UCV A;  3TAC B;  4NL9 A;  1SGG A;  2ES6 A;  2DKX A;  2QKQ A;  3IDW A;  3TAD C;  2ESE A;  2KE7 A;  1B4F A;  2JV3 A;  1DXS A;  2D8C A;  4RQN A;  1F0M A;  5L1M A;  3H8M A;  1JI7 A;  1X66 A;  2QB1 A;  1LKY A;  2K4P A;  5F3X B;  2Y9T A;  2QB0 B;  1V85 A;  2GLE A;  1SV0 A;  2KMD A;  2E8O A;  2LPE A;  2E8P A;  4IS7 A;  2QAR A;  2KSO B;  4MHV A;  1B0X A;  4PZO A;  2F44 A;  5JTI A;  2F8K A;  5J8Y C;  2B6G A;  2L5Y A;  2KIV A;  1X9X A;  2DKZ A;  2Y9U A;  3BQ7 A;  4NL9 C;  2KG5 A;  1SV4 A;  3SEN A;  3HIL A;  1SXD A;  1KW4 A;  1WWV A;  3BS5 B;  3KKA A;  1PK1 B;  1OW5 A;  4PZN A;  1LKY B;  1RG6 A;  3K1R B;  2FE9 A;  2K60 A;  1V38 A;  3TAD A;  2DL0 A;  5J8Y A;  5JRT A;  2F3N A;  2E8N A;  2QAR B;  2EAO A;  2LMR A;  1UQV A;  4NJ8 A;  3SEI A;  4RQM A;  1SXE A;  2QB0 A;  1X40 A;  2E8M A;  3BS5 A;  2EAP A;  1PK1 A;  2KSO A;  1PK3 A;  1WWU A;  1SV0 C;  1COK A;  1Z1V A;  3KKA C;  2D3D A;  5KNI A;  2EAN A;  3BS7 A;  1OXJ A;  5JU5 A;  2YTU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...