3SEUA

Zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form iii)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
366
structure length
366
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 125
structure length 366
sequence length 366
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seuA01
3U94A 1M5DA 1POTA 3MJNA 1B2HA 3G3GA 2VGQA 4RA1A 4X9TA 1Y20A 2Q2AA 4YKKA 2DVCA 2DE3A 3H03A 4F3BA 4NTLA 3V8XB 2P1SA 1JW5A 5HBCA 1YAEA 1SD3A 2VP1A 1FQFA 3JV9A 5ISUA 3IOVA 1Y4CA 1MY1A 3CVGA 1XVYA 2DQVA 5JEIA 1XOCA 1P1WA 2HAUA 3IJOB 3T22A 4H6DA 3TTRA 1JQFA 4YB7A 1MQJA 4Z7EA 3ECRA 1P1UA 2VOZA 1QKBA 4WXJA 4DZ1A 4GLIA 3UORA 2QPQA 3K1PA 3L6GA 4OERA 4YB6A 1N84A 3TKDA 3IOWA 4DE8A 5DTBA 5F7VA 3K6UA 3CFZA 3K1MA 3CIJA 1MXXA 2NXOA 2ANJA 4NMYA 4KCCA 1B4ZA 1N0TA 3LC8A 3Q27A 1JEVA 4LONB 4GL0A 1H44A 4FEBA 5DT6A 2NWJA 3CFXA 3CG1A 3MVYA 4NF6B 1O64A 4QF9A 4IO3A 1PB7A 2D21A 5IAIA 3TTMA 3I5OA 2RINA 5CM6A 3G3KA 5EHMA 5DVJA 2ZNSA 4QFOA 1Y1ZA 4G68C 1NH7A 2BJJX 3PD8A 1IUDA 3DM0A 4KR5A 1B32A 3LSFB 2Y7IA 3C34A 3MVWA 2NUVA 1LGBC 4N07A 2PT2A 3DP4A 5A5XA 2I49A 1P99A 3SEXA 1Z7ME 4H5GA 2E1SA 3FJMA 3IL1B 5I84A 3LBSA 4P0GA 4R72A 4TLLB 3TCFA 4N13A 5I58A 4LQ5A 3E3KA 3TODA 2OWSA 5AE4A 2F5XA 1ANFA 3N6TA 1IXGA 4NWDA 3C9HA 1N3WA 3FUZA 1MXYA 5LOMA 4XTCQ 5TPAA 2Q8JA 3UK4A 2NOOA 1MXVA 2ABHA 4F3PA 3GLBA 3GXAA 1MRPA 5KDTA 1PBQA 4E0WA 4C1TA 4RPNA 4G8NA 1O63A 1FTLA 4R9FA 1URSA 2PT1A 4R2FA 2Z8FA 4NF5A 4F22A 2QSXA 1B7UA 4OXVA 2RCAA 1N04A 4HTGA 4I62A 3G3HA 4ZZEA 1SI0A 4GQOA 1B0HA 3VDFA 3ONMA 4G8HA 1B5JA 4IB2A 3IJXB 5ITPA 1LCFA 2FA7A 2LAOA 3KOSA 5FTHA 4JDFA 1OMPA 4OFJA 3DP8A 3KSJA 1M5EA 2AIXA 4F31B 2O1MA 3ZKKA 4F3GA 2ZNUA 4ZEBA 1JNFA 3EQ1A 2PMSA 1ATGA 4NEDA 1MY0A 3PMVA 1NFTA 5H8SA 1AIVA 1TWYA 4JWXA 4TOZA 3TTLA 4JB7A 1MXUA 3KN3A 2ONRA 5ELVA 4FATA 2QS4A 3USDA 1NMUA 4FORA 4KPTA 4Z0IA 2DWIA 1US5A 4BDMA 3H06B 1SBPA 4EXLA 1JETA 1SW2A 3IO6A 3RN8A 2O84X 4LP2B 5TPAB 3QAXA 3CRBA 4OESA 4KI0E 4I8CA 1DPPA 3HHGA 4F29A 1O7TA 1EZOA 3EPEA 1VE4A 4F39A 3MVZA 2Y84A 4MLQA 2V3UA 3RY3A 5HM4B 2ALUA 3BFTA 2HXWA 3O2AA 3CSGA 1B6HA 5DVFA 2GHBA 5AA2A 3EN3A 1NKXA 4R9GA 3MUQA 4M4GA 3PUWE 4ND9A 1SI1A 4R6HA 1R6ZA 4MLVA 3V89B 4R6KA 3QXMA 1LAGE 1FQBA 1N7WA 5TP9A 3CG3A 1EZPA 3SEWA 2XX9A 1ZU0A 4F3SA 3Q28A 2XXQA 4YAHX 1JVYA 4AB5A 4POWA 3MP6A 4ZEFA 1JVXA 1LAHE 4ZEIA 3WAEA 1I6QA 5ICQA 2V93A 3MZBA 3L6HA 4YMAA 3KOTA 3IR1A 1FCKA 3U1OA 5I2KA 1FTOA 2Y7PA 2I4BA 4IY6A 5H8FA 1FQDA 1UQWA 4U23A 2O6AA 5CMCA 3G7WA 2PVUA 3K01A 4GXSB 1OIBA 1B05A 3S9MC 1Y1MA 3O29A 4OYVA 1PB8A 1QJMA 2XXUA 3KZGA 3JZJA 3BFUA 2GH9A 5K2YA 3OO6A 4JSOA 1A55A 3IB1A 4F1UA 3LSXA 3HSTA 1JW1A 2REJA 3H6VA 3H3GA 4OQOA 2ONKE 1D4NA 5H8HB 1D3KA 2F78A 3MPKA 1FTKA 2UVIA 4EXKA 3C33A 3IOUA 3H7MA 3EHUA 2R6GE 4JSDA 2XD3A 4DXCA 2RC7A 1SVXB 3FVGA 4QFKA 1R9QA 4PFYA 4ONYA 2OJTA 4G68A 4GFRA 4P0IA 2R9JA 2DOJA 5H8QA 1B9JA 1MH4A 4MH5A 2I0BA 2I3WA 4OFLA 3ZKLA 2B3BA 2F34A 5AA2D 3VVDA 4QSDA 1F9BA 2F6PA 2PX1A 1OLCA 3C31A 1A40A 3FJGA 1A99A 5L9MA 5AA4A 4DXBA 1H45A 2H4IA 1OQHA 4BDOA 1Z7NE 2H9BA 2G29A 4OWDA 4YB5A 5I2KB 3RLFE 4GVOA 5H8FB 4QFPA 4YKIA 1SW4A 4KQPA 3G3JA 2F36A 1ZTYA 3MBPA 2OCUA 3TEPA 2HZLA 1MS7A 4EUOA 3RT8A 3MC2A 1MH3A 2XXWA 1GTKA 3SETA 2YJPA 3VLVA 3RPWA 1L5TA 1LBCA 2UVHA 1SW1A 3OSQA 3KN8A 5L9OA 2OLBA 2X7PA 1VFEA 3PUXE 2F35A 3RTFB 4E0XA 3TYHA 3IK6B 1DMBA 1MXZA 3OOAA 3OELA 3CI8A 3K6WA 3MW0A 4TLMB 5DVIA 1QVSA 3KGCA 3UA8A 4LA9A 3PPRA 4NE4A 1PEBA 5H8QB 3PPNA 1Y4TA 2I48A 1BP5A 1J1NA 1LB9A 1UIVA 5H8NA 1UIUA 5JTYA 5CBRA 4FJPA 3UN6A 3FASA 2D3IA 2OBGA 4ELQA 1SQYA 3QSLA 1LLSA 3HV1A 4OMBA 5KCJA 2I6EA 3LR1A 5B70A 3TMGA 2V3TA 4DDDA 3B6TA 5AA4B 2QJEA 1B3GA 5I56A 1SDXA 1AL3A 2OWTA 4FEDA 1A8FA 3O97A 1HSLA 3PUVE 3BKIB 4H67A 4HW8A 5CC2A 2QMXA 1FTMA 4P11A 1B3FA 4KD5A 1Y9UA 3QUJA 4GXAA 3MZ9A 3IAZA 1OQGA 1SW5A 1LCTA 3TCGA 1B7ZA 2QS2A 2AL5A 1P1NA 4UA8A 3F11A 1R9LA 4BLAA 1NL5A 4ZE8A 3P7IA 3S9NC 4BDRA 2V84A 3T9XB 3CSBA 3OO8A 3TDJA 3TZAA 5DEXA 3A3UA 1H43A 5TU0A 1AOVA 4O3AA 3PD9A 1POY1 3Q29A 4ZZAA 3IOTA 2HZKA 2XXXA 2ZXTA 4DLDA 3GBAA 1MDQA 3C32A 3GZGA 3WAFA 1XS5A 4ELOA 5H8NB 5JTYB 2FYIA 4GRKA 1LFGA 1ZLQA 3FVNA 2CMOA 3LSLA 4OENA 3EHSA 1B1XA 1URDA 5KCJB 4OTEA 2H98A 5J1DA 1MPBA 2Z8EA 4NF8A 3JYRA 1TFAA 3VVFA 1Y3QA 3MVXA 3KEIA 2DE2A 4OVJA 2I58A 5B7DA 3K4UA 2ZNTA 3SEYA 2YLNA 2QS1A 3SEUA 3PUYE 3O6GA 3TQLA 3B6QA 1H76A 2DSFA 1HSJA 2WKYA 1MY4A 2HCAA 2RC8A 3S4UA 3HCQA 1BKAA 3MAMA 4GL8A 3RNNA 4R74A 3Q25A 4HS7A 3KN7A 1Q1KA 2I0CA 1N3XA 4XKNA 5ITOA 5A5XB 3KJ7A 5ICTA 4QSEA 2H5YA 1CB6A 1QUIA 4ZDMA 3C36A 4G2ZA 4RYAA 2I4CA 4NWCA 4XXUA 4KFQA 1RYXA 5CMKA 3N26A 4QFLA 1M5BA 1B58A 1QKAA 2F97A 5I58B 1IITA 3TTKA 1H3DA 1MQIA 1DSNA 1BIYA 4ZECA 4O3CA 4I9DA 4DIGA 4MBPA 1QUJA 4PFTA 1II5A 3ILUB 1TXFA 3TAJA 3T66A 3OXNA 3CR9A 1FQEA 1FQCA 5KDTB 3QK6A 2G93A 3S9EA 3H4ZA 1B7HA 1MXWA 2AL4A 1FTJA 3T9HB 3MP1A 2GHAA 5I2NA 5I57A 2F6GA 4LZ7A 4EF2A 4H5FA 4XKRA 4NF5B 2A5TA 1M5CA 3GBBA 1IZ1A 5CBSA 3VXBA 2DWHA 1S9TA 4R75A 1I6AA 4FE8A 5K2XA 4EQBA 3MQ9A 2W7YA 4RJZA 3G3IA 4LATA 3ZSFA 3QYTA 2ONSA 3OO9A 3K0VA 3RTWB 2D5WA 4QFNA 4YKJA 1US4A 4IGTA 4U21A 4TQUQ 2XHDA 1OLAA 3FD3A 2O68A 4WEDA 3PU5A 3IORA 1JW4A 2VHAA 4ZS9A 1DOTA 2A5SA 4FAJA 2F7AA 4IO4A 2VD3A 1VR5A 4MFIA 4N6PA 4UACA 5FTIA 2Q2CA 4ELPA 2XX8A 4ELRA 4PP0A 3FXUA 2F8DA 1UTHA 3U92A 3AXFA 4F1VA 1WVJA 3ILTB 2DP8A 5IKBA 3IO4A 4WEPA 2F7BA 4XKQA 3D4GA 2XD2A 5I57B 2ZYMA 2I3VA 5BWJA 4F18A 1WDNA 1MY3A 4DCYA 2V25A 3PPPA 3SKPA 5AA2B 2XXYA 4F19A 1DTGA 2XXPA 5AA1A 2KLFA 2ZMBA 1N7XA 2ESNA 4DCXA 4LUBA 4IO2A 5TP9B 1FQAA 4HCWA 3M3FA 4LZ8A 3H6UA 2Z23A 5F1QA 2GFEA 3PV0E 3E9XA 2PYYA 3FV1A 1S7YA 1YCJA 2RF1A 3IX1A 3RUMA 3SEVA 1QUKA 1I6BA 2DWAA 3VLWA 5HPQA 1MY2A 3B7DA 4OFOA 4H65A 4IY5A 3FGSA 2DVZA 3VFJA 2Q88A 2UXAA 4JBZA 2GRVA 3LUYA 3HHFA 1B52A 1NNKA 1DTZA 4LZ5A 1GGGA 3EF7A 4K3FA 1MG1A 2UVJA 4X48A 2UYFA 4U1OA 4IO7A 3M3KA 4PFUA 4PE5B 5CRYA 2H99A 2HAVA 4RK2A 3FATA 3O6HA 5L8DA 3OENA 1P1OA 1Q35A 4G8MA 3PMWA 4NF6A 2QL3A 2DYXA 3SESA 5CI5A 3FV2A 3A3CA 1ELJA 5AA3A 1B3EA 3H6TA 4ZEDA 3O66A 3B6WA 4AB6A 3PPQA 2PBWA 3FZVA 4XIGQ 4KYEA 3H6WA 1A8EA 4G68B 3OMBA 1XVXA 1VSOA 3FVKA 3U72A 3KJTA 1MM6A 2O7IA 4NF4A 3T9UA 2RKMA 5FHMA 1QULA 3V5AA 3TQWA 1MPDA 1NNFA 5FHOA 4I1DA 3O6IA 3QIMA 4ZEKA 2O51A 2CZLA 4PQJA 4ZE9A 4H8IA 5BUUA 4KYDA 3HN0A 2ZYNA 3C35A 1LFHA 3TFLA 3T93B 2UYEA 4OEUA 3W15C 4JWYA 3T96B 3S9LC 1FW0A 3K6VA 3T9VA 3K6XA 2RCBA 1TT1A 1SYIA 1WODA 4Q0CA 1IXHA 3PMXA 1B0LA 4BDQA 2QRYA 1LB8A 2QMWA 3RQTA 5JK4A 2OK2A 1P1QA 4IO5A 2REGA 4XKPA 4GD5A 3N94A 1LFIA 3K02A 1ZMGA 4GF8A 3OO7A 3G3FA 5I59A 2O69A 2P0SA 1DPEA 1NNTA 3W9WA 3Q26A 5CMBA 3MP8A 1PBPA 3W9VA 4R2BA 3THIA 4JWOA 4Q5TA 2QS3A 4F2QA 1SYHA 2Y7RA 1ZJLA 2V3QA 4RXLA 1IEJA 2HQ0A 1XHYA 3HPIA 4NF4B 3E4RA 3ODBA 3U93A 4G4PA 3KFMA 5FHNA 2E0SA 1MDP1 1IIWA 3SDFA 1QW0A 4O3BA 2R71A 3PGFA 1USYE 3U8QA 3OEKA 2XXRA 2B65A 4FIMA 3R6UA 3VVEA 4THIA 5I56B 3MPLA 4OHNA 2ZYKA 1IXCA 1AMFA 1D9YA 4YZZA 4G77A 1ZIUA 4EF1A 4IGRA 4QRZA 3I3VA 3DP6A 4U1ZA 2THIA 3R7XA 4WKMA 4C1UA 1B46A 3IB2A 1JEUA 1KWHA 4X1BA 4EQ7A 1A7LA 4BDLA 3FIRA 5I59B 4FECA 3K1NA 3K2DA 1PB9A 4OZ9A 1EH3A 3SERA 3A09A 4U4XA 2Q89A 5DEXB 4PFWA 1D9VA 4L17A 2F7CA 4KHZE 2H25A 4ESWA 4EQ9A 3R26A 1MQGA 2Z22A 4M1VA 1A54A 1GVCA 3I6VA 1VFDA 3BBRA 4KYSA 1IQ7A 1B3HA 4KCDA 1ZKBA 1B3LA 2FNCA 4RPOA 4U2RA 3RGYA 3OD7A 2P2AA 4X1DA 3FXQA 4U4SA 4GWOA 3CFLA 4NF8B 1LSTA 4F2OA 1UTBA 1YTVA 1EZ9A 3EHTA 2DS9A 1MM7A 3TELA 1IXIA 1T0KA 1LAXA 1NNPA 2DXYA 3O9PA 5KZTA 4LVQA 3S2VA 2UVGA 2AYSA 4LQ2A 3RT6B 4R6YA 1URGA 4HCYA 3TPAA 1BLFA 4MF3A 1ZBMA 2ZYOA 3DELB 1GV8A 4H1XA 3LSWA 2X26A 4JXIA 1Y3NA 3M8UA 1MQDA 3KBRA 4ECFA 4YKPA 1RYOA 3K00A 3VXCA 1CE2A 2XXIA 2HEUA 1OVTA 1LBBA 1B51A 3UP9A 1B1HA 1AH5A 2M8CA 4Q30B 3PUZE 5H8HA 2OZZA 1B4HA 1MPCA 3D4CA 5CMMA 1OVBA 1B40A 1I69A 5EHSA 4QHQA 1USYH 1NH8A 4OEVA 4OETA 4ESXA 3N5LA 3TUSA 2DWJA 1HSEA 2O1LA 4POXA 3MZ1A 4YICA 2X7QA 3VE1B 4QSCA 4H8JA 3DLNA 4IO6A 4AQ4A 3M3LA 3TTNA 4R73A 1BTJA 1XT8A 1M5FA 4BDNA 1B5HA 1Y3PA 1UTBB 3N6UA 2DXRA 5L9SA 2XXTA 1LAFE 1RKMA 4RY1A 4F1YA 2VD2A 5I2NB 4RK9A 2NVUB 1XC1A 2RC9A 4RNSA 3UIFA 3VV5A 4GOTA 2IEEA 2Y7KA 2A5TB 2YPNA 3FVOA 2XXVA 3V83A 2XXHA 2DE4A 1N76A 3KSXA 3VLUA 1R1NA 2XX7A 1PDAA 3E13X 3ZS6A 4U22A 3FXRA 2Q9TA 3KG2A 1MQHA 3MWBA 4H0WA 2Z8DA 3IB0A 1EU8A 4EDPA 3FJ7A 4GIZA 1TFDA 2HFBA 2B3FA 3C4MA 3TCHA 5DYHA 2IA4A 2Y7WA 3OSRA 5EYFA 2O7UA 3HO7A 4ISUA 3O28A 4DXUA 3PPOA 4YMBA 1PC3A 4Q8RA 3OEMA 1GR2A 4YU0A 4C0RA 1B5IA 1UTHB 5M2VA 1YPNA 3UGWA 1S50A 4PETA 3QUFA
chains in the Genus database with same CATH superfamily
3B8BA 3U94A 1M5DA 1POTA 4HE2A 3MJNA 1B2HA 3G3GA 2VGQA 4RA1A 4X9TA 1Y20A 2Q2AA 4YKKA 2DVCA 2DE3A 3H03A 4F3BA 2CZIA 1FBCA 4NTLA 3V8XB 2P1SA 1JW5A 5HBCA 1YAEA 1SD3A 2VP1A 1FQFA 3JV9A 5ISUA 3IOVA 5IGAA 1Y4CA 1MY1A 3CVGA 1XVYA 4P8BA 2DQVA 5JEIA 4GWZA 1XOCA 1P1WA 2QVUA 2HAUA 3IJOB 3T22A 4H6DA 3TTRA 4I40A 1JQFA 4P56A 4YB7A 4PBQA 1MQJA 4Z7EA 3ECRA 1P1UA 2VOZA 5T3JA 1QKBA 3CHGA 4WXJA 3BIHA 4DZ1A 4GLIA 3UORA 2QPQA 5ESYA 3K1PA 4P3LA 3L6GA 4OERA 4N17A 4YB6A 1N84A 4G61A 3TKDA 3IOWA 4DE8A 5DTBA 4P9KA 5F7VA 3K6UA 3CFZA 3K1MA 4N6DA 3CIJA 1MXXA 2NXOA 4MNCA 2ANJA 1JP4A 4NMYA 4KCCA 4OVRA 1INPA 1B4ZA 1N0TA 3LC8A 3Q27A 1FRPA 2FVZA 1JEVA 4AS5A 4LONB 4GL0A 1LBYA 4N4UA 1H44A 4FEBA 5I7IA 5DT6A 2NWJA 3CFXA 2PFYA 1D9QA 3CG1A 3MVYA 4NF6B 1O64A 4QF9A 4IO3A 1PB7A 2D21A 5IAIA 3TTMA 4JVIA 2BJIA 3I5OA 2RINA 5CM6A 3G3KA 5EHMA 5DVJA 4HE1A 2ZNSA 1FBEA 4GBVA 4QFOA 1Y1ZA 4G68C 1NH7A 2BJJX 3PD8A 1FBPA 1IUDA 3DM0A 4KR5A 1B32A 1LBZA 4NAPA 3LSFB 2Y7IA 3C34A 3MVWA 2NUVA 1LGBC 4N07A 2PT2A 1IMFA 3DP4A 5A5XA 2I49A 2ZZWA 1P99A 4N8GA 2QVRA 3SEXA 1Z7ME 4H5GA 1IMBA 2E1SA 3FJMA 1EYKA 3IL1B 3LBSA 5I84A 4P0GA 5EYHA 4R72A 4TLLB 3TCFA 4N13A 3LUZA 5I58A 4LQ5A 3E3KA 5DW8A 3TODA 2OWSA 5AE4A 2F5XA 1ANFA 3N6TA 1IXGA 4NWDA 3C9HA 1N3WA 1NV3A 3FUZA 1MXYA 1FJ9A 5LOMA 4XTCQ 5TPAA 2Q8JA 3UK4A 2NOOA 4NX1A 1MXVA 2ABHA 4F3PA 3GLBA 3GXAA 1MRPA 5KDTA 1PBQA 4E0WA 4PBHA 2FIXA 4C1TA 4UABA 2HHMA 4RPNA 4G8NA 1O63A 1FTLA 4R9FA 1URSA 2PT1A 4R2FA 2Z8FA 4NF5A 4F22A 2QSXA 4OXVA 1B7UA 2RCAA 1N04A 4HTGA 4I62A 3G3HA 4ZZEA 1K9ZA 2PCRA 1SI0A 4GQOA 1B0HA 3VDFA 3ONMA 3D1RA 4G8HA 1FPIA 2F3BA 1B5JA 5IZ3B 4IB2A 3IJXB 5ITPA 1LCFA 2FA7A 1DK4A 2LAOA 3KOSA 4QXDA 5FTHA 4JDFA 1OMPA 4OFJA 3DP8A 3KSJA 1M5EA 2AIXA 4F31B 2O1MA 3ZKKA 4F3GA 2ZNUA 4ZEBA 1JNFA 3EQ1A 2PMSA 1ATGA 1FJ6A 2HXRA 4NEDA 1MY0A 3PMVA 1NFTA 5H8SA 1AIVA 1TWYA 4JWXA 4TOZA 3TTLA 4JB7A 1MXUA 3KN3A 2ONRA 5ELVA 4FATA 2QS4A 3USDA 1NMUA 4FORA 4KPTA 4Z0IA 2DWIA 1US5A 4BDMA 3H06B 1SBPA 4EXLA 5IZZA 1JETA 1SW2A 3IO6A 3RN8A 2O84X 4QBAA 4LP2B 5TPAB 3QAXA 3CRBA 4OESA 4KI0E 4I8CA 1DPPA 3HHGA 4F29A 1O7TA 1EZOA 3EPEA 1VE4A 4F39A 3MVZA 2Y84A 4MLQA 2V3UA 3RY3A 5HM4B 1IMEA 2ALUA 3BFTA 2HXWA 3O2AA 3CSGA 1B6HA 5DVFA 4XEQA 2GHBA 2VPNA 5AA2A 3EN3A 1NKXA 4R9GA 3MUQA 4M4GA 3PUWE 4ND9A 1SI1A 4R6HA 1R6ZA 4MLVA 3V89B 4R6KA 1NI9A 3QXMA 1LAGE 1FQBA 1N7WA 4MNPA 5TP9A 3CG3A 2VT5A 1EZPA 3SEWA 2XX9A 1FPEA 1ZU0A 4F3SA 3Q28A 3T1BA 2XXQA 4YAHX 1JVYA 4AB5A 4OVTA 4POWA 3MP6A 4ZEFA 1JVXA 1LAHE 5I5PA 4NGUA 4ZEIA 3BIGA 3WAEA 1I6QA 5ICQA 2V93A 3MZBA 3L6HA 4YMAA 3KOTA 3IR1A 1FCKA 3U1OA 5I2KA 1FTOA 2Y7PA 2I4BA 4IY6A 5H8FA 1NV2A 1FQDA 1UQWA 4U23A 2O6AA 5CMCA 1DBZA 3G7WA 4O94A 2PVUA 3K01A 4GXSB 1OIBA 1B05A 3S9MC 1Y1MA 3O29A 4OYVA 1PB8A 1QJMA 2XXUA 3KZGA 3JZJA 3BFUA 1LEVA 2GH9A 1QGXA 5K2YA 3OO6A 4JSOA 1A55A 3IB1A 4F1UA 4HXVA 3LSXA 3HSTA 1JW1A 2REJA 1FBDA 3H6VA 3H3GA 4OQOA 3NOHA 2ONKE 1D4NA 1DCUA 1NV0A 5H8HB 1D3KA 4I3YA 2F78A 3MPKA 1FTKA 2UVIA 4EXKA 3C33A 3IOUA 3H7MA 3EHUA 2R6GE 4JSDA 2XD3A 4DXCA 2RC7A 1SVXB 3FVGA 4QFKA 1R9QA 4PFYA 3T0JA 4ONYA 2OJTA 4GWXA 4G68A 4GFRA 4P0IA 2R9JA 2DOJA 5H8QA 1FTAA 4PCDA 4PGPA 1B9JA 1MH4A 3RPLA 4MH5A 2I0BA 4PFBA 2I3WA 4OFLA 3ZKLA 2B3BA 2F34A 4NG7A 5AA2D 3VVDA 4QSDA 1F9BA 2F6PA 2PX1A 1OLCA 3C31A 1A40A 3FJGA 1A99A 5L9MA 5AA4A 4DXBA 1H45A 2H4IA 1OQHA 4BDOA 1Z7NE 2H9BA 1AWBA 2G29A 4OWDA 4YB5A 5I2KB 3RLFE 4LN5A 4GVOA 5H8FB 4QFPA 4YKIA 2B4LA 1SW4A 4KQPA 3G3JA 2F36A 1ZTYA 3MBPA 2OCUA 3TEPA 2HZLA 1MS7A 4EUOA 3RT8A 3MC2A 1MH3A 2XXWA 3IFAA 4PF6A 1GTKA 3SETA 2YJPA 3VLVA 3RPWA 1L5TA 1LBCA 2UVHA 1SW1A 3OSQA 3KN8A 5L9OA 2OLBA 2X7PA 1IMCA 1VFEA 3PUXE 2F35A 3RTFB 4E0XA 4IR8A 3TYHA 3IK6B 1BK4A 1DMBA 1MXZA 3OOAA 3OELA 3CI8A 3K6WA 3MW0A 4TLMB 5DVIA 1QVSA 3KGCA 3UA8A 3FXBA 4LA9A 3PPRA 4NE4A 1PEBA 5H8QB 3PPNA 1Y4TA 2I48A 1BP5A 1J1NA 1LB9A 1UIVA 5H8NA 1UIUA 5JTYA 5CBRA 4FJPA 3UN6A 3FASA 2D3IA 2OBGA 4ELQA 1SQYA 3QSLA 1LLSA 3HV1A 4OMBA 5KCJA 2I6EA 4PDHA 3LR1A 5B70A 5LTCA 3TMGA 2V3TA 4DDDA 3B6TA 5AA4B 4X8RA 1KA0A 2QJEA 1B3GA 5I56A 1SDXA 1AL3A 2OWTA 4FEDA 1A8FA 3O97A 1RDXA 4DI3D 1HSLA 3PUVE 4O8MA 3ROJA 3BKIB 4H67A 4HW8A 5CC2A 2QMXA 1FTMA 4P11A 1B3FA 4KD5A 1Y9UA 3QUJA 4GXAA 3MZ9A 3IAZA 1OQGA 1SW5A 1LCTA 3TCGA 1B7ZA 3GYYA 2QS2A 2AL5A 1P1NA 4UA8A 3F11A 1R9LA 4BLAA 1NL5A 5EQ8A 4XF5A 3P7IA 4ZE8A 3S9NC 4BDRA 2V84A 1FBFA 3T9XB 3CSBA 3OO8A 3TDJA 4PAIA 3TZAA 1KA1A 5DEXA 3A3UA 3RYDA 1H43A 5TU0A 1AOVA 4O3AA 3PD9A 1POY1 5EYGA 3Q29A 4ZZAA 2XWIA 3IOTA 2HZKA 2XXXA 1NV6A 2ZXTA 4DLDA 3GBAA 2CZKA 1MDQA 3C32A 3GZGA 3WAFA 1XS5A 4ELOA 5H8NB 4PAKA 1YXIA 5JTYB 2FYIA 5ET5A 4GRKA 1LFGA 1ZLQA 3FVNA 2CMOA 3LSLA 4I3EA 4OENA 3EHSA 1B1XA 2CZHA 1URDA 5KCJB 5EQAA 4OTEA 5F24A 2H98A 1RDZA 5J1DA 4P47A 1MPBA 2Z8EA 4NF8A 3JYRA 1TFAA 4MMPA 3VVFA 1Y3QA 2P3NA 3MVXA 3KEIA 2KQZA 2DE2A 4OVJA 2I58A 5B7DA 3K4UA 5EQ9A 2ZNTA 4NN3A 3SEYA 2YLNA 2QS1A 3SEUA 3PUYE 3O6GA 3TQLA 1LBVA 3B6QA 1RDYA 1H76A 2DSFA 1HSJA 2WKYA 1MY4A 2HCAA 2RC8A 3S4UA 3HCQA 1BKAA 3MAMA 4PFIA 4GL8A 3RNNA 4R74A 3Q25A 2QVVA 2P3VA 5IZ1A 4HS7A 3KN7A 1Q1KA 2I0CA 1N3XA 4XKNA 5ITOA 5A5XB 3HFUA 3KJ7A 5ICTA 4QSEA 2H5YA 1CB6A 1QUIA 4ZDMA 3C36A 2CEXA 4G2ZA 4RYAA 4MIJA 2I4CA 4NWCA 4XXUA 4KFQA 1RYXA 5CMKA 3N26A 4QFLA 1M5BA 1B58A 1QKAA 2F97A 5I58B 4MX6A 4OVSA 1IITA 3TTKA 1H3DA 1MQIA 1DSNA 1BIYA 4ZECA 4O3CA 4I9DA 2WYPA 5ET8A 4DIGA 4MBPA 1QUJA 4PFTA 1II5A 3ILUB 1TXFA 3TAJA 3T66A 3OXNA 3CR9A 1FQEA 1FQCA 5KDTB 3QK6A 1NV1A 2G93A 3S9EA 3H4ZA 1B7HA 2ZZVA 1MXWA 2AL4A 1FTJA 3T9HB 3MP1A 2GHAA 2QFLA 5I2NA 5I57A 2F6GA 4LZ7A 4EF2A 4H5FA 4XKRA 4NF5B 2A5TA 4GBWA 1M5CA 3GBBA 1IZ1A 5CBSA 3VXBA 3U65A 2DWHA 1S9TA 4R75A 4OA4A 1I6AA 4FE8A 5K2XA 2VPOA 4EQBA 3MQ9A 2W7YA 4RJZA 3G3IA 4LATA 3ZSFA 3QYTA 2ONSA 3OO9A 3K0VA 3RTWB 2D5WA 4QFNA 4YKJA 1US4A 1NV4A 4IGTA 4U21A 1XI6A 4TQUQ 2XHDA 1OLAA 3FD3A 1G0HA 2O68A 4WEDA 3PU5A 3IORA 1JW4A 2WBDA 2VHAA 1Q9DA 4ZS9A 1DOTA 2A5SA 4P1LA 4FAJA 2F7AA 4IO4A 2VD3A 1VR5A 4MFIA 4N6PA 4UACA 5FTIA 2Q2CA 4GWWA 4ELPA 4OVPA 2XX8A 5A5LA 1VDWA 4ELRA 4PP0A 3FXUA 2F8DA 1UTHA 3U92A 3AXFA 4F1VA 1WVJA 3ILTB 2DP8A 1EYJA 5IKBA 3IO4A 4WEPA 2F7BA 4XKQA 3D4GA 2XD2A 4PDDA 5I57B 2ZYMA 2I3VA 4GX3A 5BWJA 4F18A 1WDNA 1MY3A 4DCYA 2V25A 3PPPA 3SKPA 5AA2B 4GWYA 2XXYA 4F19A 1DTGA 2XXPA 5AA1A 2KLFA 2ZMBA 5ET6A 1N7XA 2ESNA 4DCXA 1FBGA 4OANA 4LUBA 4IO2A 4O7MA 5TP9B 1FQAA 4HCWA 3M3FA 4LZ8A 4NF0A 3H6UA 2Z23A 5F1QA 4GX4A 2GFEA 3PV0E 4NQ8A 3E9XA 2PYYA 3FV1A 1S7YA 1YCJA 3KC0A 2RF1A 3IX1A 3RUMA 3SEVA 1QUKA 5J16A 1I6BA 2DWAA 3VLWA 5HPQA 1MY2A 3B7DA 4OFOA 2CEYA 4H65A 4P1EA 4IY5A 2XWKA 3FGSA 2DVZA 3VFJA 2Q88A 2UXAA 4JBZA 2GRVA 3LUYA 2WBBA 3HHFA 1B52A 1NNKA 1DTZA 3EKIA 4LZ5A 1GGGA 3EF7A 4K3FA 1MG1A 2JJKA 2UVJA 4X48A 2UYFA 4U1OA 4IO7A 3M3KA 4PFUA 4PE5B 4N91A 5CRYA 2H99A 2HAVA 4RK2A 1FPGA 3FATA 3O6HA 5L8DA 3OENA 1P1OA 1Q35A 4G8MA 4JVCA 3PMWA 4NF6A 2QL3A 2MKZA 2DYXA 3SESA 5CI5A 3FV2A 4N6KA 3A3CA 1ELJA 5AA3A 1B3EA 3H6TA 4ZEDA 3O66A 3B6WA 4AB6A 3PPQA 2PBWA 3FZVA 4XIGQ 4KYEA 4GX6A 1YYZA 3H6WA 1A8EA 1NV5A 4G68B 2PFZA 3OMBA 1XVXA 1SPIA 3RPLB 1VSOA 3FVKA 3U72A 3KJTA 1IMAA 1MM6A 2O7IA 4NF4A 1NV7A 3T9UA 2RKMA 5FHMA 1QULA 3V5AA 3TQWA 2XWVA 4N8YA 4O7IA 2FIEA 3MYUA 1MPDA 1NNFA 1FPFA 5FHOA 4I1DA 3SZPA 3O6IA 3QIMA 4ZEKA 2O51A 2CZLA 4PQJA 4ZE9A 4H8IA 5BUUA 4KYDA 3HN0A 4GWUA 2ZYNA 1LBWA 3C35A 1LFHA 3TFLA 4AS4A 3T93B 2UYEA 4OEUA 3W15C 4JWYA 3T96B 3S9LC 1FW0A 1FBHA 3K6VA 3T9VA 3K6XA 2RCBA 1TT1A 1SYIA 2F3DA 1WODA 4Q0CA 1IXHA 1CNQA 2GQ1A 4OVQA 3PMXA 1B0LA 4BDQA 2QRYA 1LB8A 2QMWA 3RQTA 5JK4A 2OK2A 1P1QA 4IO5A 2REGA 2OWZA 4XKPA 4H46A 4GD5A 3N94A 1LFIA 3K02A 1ZMGA 4GF8A 2XXKA 3OO7A 3G3FA 5I59A 2O69A 2P0SA 4X04A 1DPEA 1NNTA 3W9WA 3Q26A 5I3SA 1FPLA 1YZ0A 3ISPA 5CMBA 3MP8A 5FBPA 1PBPA 4MHFA 3W9VA 5IZ3A 4R2BA 3THIA 4JWOA 4Q5TA 2QS3A 4F2QA 1SYHA 2Y7RA 5IM2A 1ZJLA 2V3QA 4PF8A 4RXLA 1IEJA 1FPKA 2HQ0A 1XHYA 3HPIA 4NF4B 3E4RA 3ODBA 3U93A 4G4PA 3KFMA 5FHNA 2E0SA 1MDP1 1IIWA 3SDFA 1QW0A 4O3BA 2R71A 3PGFA 1USYE 3U8QA 3OEKA 2XXRA 2FBPA 2B65A 4FIMA 3R6UA 1NUWA 3VVEA 3FBPA 4THIA 1FPJA 5I56B 3MPLA 4OHNA 2ZYKA 1IXCA 1AMFA 1D9YA 4YZZA 4G77A 1ZIUA 4EF1A 4IGRA 4MJOA 4PAFA 4QRZA 3I3VA 3DP6A 4U1ZA 2THIA 3R7XA 4WKMA 4C1UA 3LV0A 3QMFA 1B46A 3IFCA 3IB2A 1JEUA 1KWHA 4X1BA 4EQ7A 1A7LA 4BDLA 3FIRA 1EYIA 2DDKA 5I59B 4FECA 4PGNA 3K1NA 3K2DA 1PB9A 4OZ9A 1EH3A 3SERA 3A09A 4U4XA 1NUYA 2Q89A 2WEFA 5DEXB 4PFWA 1D9VA 4L17A 2F7CA 4KHZE 2H25A 4ESWA 4EQ9A 2FHYA 3R26A 1MQGA 2Z22A 4M1VA 4GWSA 1A54A 2XWOA 1GVCA 3I6VA 1VFDA 3BBRA 4MEVA 2R8TA 4KYSA 1IQ7A 1B3HA 4KCDA 1ZKBA 1B3LA 2Y5KA 2FNCA 4RPOA 4U2RA 3RGYA 3OD7A 4FBPA 2P2AA 4X1DA 3FXQA 4U4SA 4GWOA 3CFLA 4NF8B 1LSTA 4F2OA 1UTBA 1YTVA 2KR0A 1EZ9A 3EHTA 2DS9A 2ZZXA 1MM7A 4H45A 3TELA 1IXIA 4NHBA 2WYKA 1T0KA 1LAXA 1NNPA 2DXYA 3O9PA 5KZTA 4LVQA 3S2VA 2UVGA 2AYSA 4LQ2A 3RT6B 4R6YA 1URGA 4HCYA 4MCOA 3TPAA 1BLFA 4MF3A 1ZBMA 2ZYOA 2HPGA 3DELB 1GV8A 2XA5A 4H1XA 3LSWA 2X26A 4JXIA 1Y3NA 1NUXA 3M8UA 1MQDA 3KBRA 4ECFA 4YKPA 1RYOA 4JVDA 3K00A 3VXCA 1CE2A 3B50A 2XXIA 2HEUA 1OVTA 1LBBA 1B51A 3UP9A 1B1HA 3A29A 1AH5A 2M8CA 4Q30B 1LBXA 3PUZE 5H8HA 4PTKA 2OZZA 1B4HA 4MAGA 1MPCA 3D4CA 2Y5LA 5CMMA 1OVBA 3PTYA 1B40A 1I69A 5EHSA 4QHQA 4N81A 1USYH 1NH8A 3E79A 4OEVA 4N15A 4OETA 4ESXA 3N5LA 3TUSA 2DWJA 1HSEA 2O1LA 4POXA 3MZ1A 4YICA 2X7QA 3VE1B 4QSCA 4H8JA 3DLNA 4IO6A 4AQ4A 3M3LA 3TTNA 4DI4B 4R73A 2L5VA 1BTJA 1XT8A 1M5FA 4BDNA 4HE0A 1B5HA 1Y3PA 1UTBB 3KBZA 3N6UA 5LDZA 2DXRA 5L9SA 2XXTA 2OX3A 1LAFE 4KXPA 2WX9A 1RKMA 4RY1A 4F1YA 2VD2A 5I2NB 4RK9A 2NVUB 1XC1A 2RC9A 4RNSA 3UIFA 3VV5A 4GOTA 2IEEA 2Y7KA 2A5TB 2YPNA 3FVOA 2XXVA 3V83A 2XXHA 3KC1A 2DE4A 1N76A 1FPDA 3KSXA 3VLUA 1R1NA 4PC9A 2XX7A 1FSAA 1PDAA 4XFEA 3E13X 3ZS6A 4U22A 3FXRA 1FPBA 2Q9TA 1NUZA 3KG2A 1MQHA 3MWBA 4H0WA 1KZ8A 2Z8DA 3IB0A 3MSTA 1EU8A 1G0IA 4EDPA 3FJ7A 4GIZA 1TFDA 2HFBA 1IMDA 2B3FA 2Q74A 3C4MA 3TCHA 5DYHA 2IA4A 2Y7WA 3OSRA 2Q8MA 5EYFA 2O7UA 4MNIA 3HO7A 4ISUA 3O28A 4DXUA 3PPOA 4YMBA 4PFRA 1PC3A 4Q8RA 3OEMA 5EQ7A 3E78A 1GR2A 4YU0A 4C0RA 1K9YA 1B5IA 1UTHB 5M2VA 1YPNA 3UGWA 5ET7A 1S50A 2B4MA 4PETA 4PE3A 2V4CA 3QUFA
chains in the Genus database with same CATH topology
3U94A 1M5DA 1POTA 3MJNA 1B2HA 3G3GA 2VGQA 4RA1A 4X9TA 1Y20A 2Q2AA 4YKKA 2DVCA 2DE3A 3H03A 4F3BA 4NTLA 3V8XB 2P1SA 1JW5A 5HBCA 1YAEA 1SD3A 2VP1A 1FQFA 3JV9A 5ISUA 3IOVA 1Y4CA 1MY1A 3CVGA 1XVYA 2DQVA 5JEIA 1XOCA 1P1WA 2HAUA 3IJOB 3T22A 4H6DA 3TTRA 1JQFA 4YB7A 1MQJA 4Z7EA 3ECRA 1P1UA 2VOZA 1QKBA 4WXJA 4DZ1A 4GLIA 3UORA 2QPQA 3K1PA 3L6GA 4OERA 4YB6A 1N84A 3TKDA 3IOWA 4DE8A 5DTBA 5F7VA 3K6UA 3CFZA 3K1MA 3CIJA 1MXXA 2NXOA 2ANJA 4NMYA 4KCCA 1B4ZA 1N0TA 3LC8A 3Q27A 1JEVA 4LONB 4GL0A 1H44A 4FEBA 5DT6A 2NWJA 3CFXA 3CG1A 3MVYA 4NF6B 1O64A 4QF9A 4IO3A 1PB7A 2D21A 5IAIA 3TTMA 3I5OA 2RINA 5CM6A 3G3KA 5EHMA 5DVJA 2ZNSA 4QFOA 1Y1ZA 4G68C 1NH7A 2BJJX 3PD8A 1IUDA 3DM0A 4KR5A 1B32A 3LSFB 2Y7IA 3C34A 3MVWA 2NUVA 1LGBC 4N07A 2PT2A 3DP4A 5A5XA 2I49A 1P99A 3SEXA 1Z7ME 4H5GA 2E1SA 3FJMA 3IL1B 5I84A 3LBSA 4P0GA 4R72A 4TLLB 3TCFA 4N13A 5I58A 4LQ5A 3E3KA 3TODA 2OWSA 5AE4A 2F5XA 1ANFA 3N6TA 1IXGA 4NWDA 3C9HA 1N3WA 3FUZA 1MXYA 5LOMA 4XTCQ 5TPAA 2Q8JA 3UK4A 2NOOA 1MXVA 2ABHA 4F3PA 3GLBA 3GXAA 1MRPA 5KDTA 1PBQA 4E0WA 4C1TA 4RPNA 4G8NA 1O63A 1FTLA 4R9FA 1URSA 2PT1A 4R2FA 2Z8FA 4NF5A 4F22A 2QSXA 1B7UA 4OXVA 2RCAA 1N04A 4HTGA 4I62A 3G3HA 4ZZEA 1SI0A 4GQOA 1B0HA 3VDFA 3ONMA 4G8HA 1B5JA 4IB2A 3IJXB 5ITPA 1LCFA 2FA7A 2LAOA 3KOSA 5FTHA 4JDFA 1OMPA 4OFJA 3DP8A 3KSJA 1M5EA 2AIXA 4F31B 2O1MA 3ZKKA 4F3GA 2ZNUA 4ZEBA 1JNFA 3EQ1A 2PMSA 1ATGA 4NEDA 1MY0A 3PMVA 1NFTA 5H8SA 1AIVA 1TWYA 4JWXA 4TOZA 3TTLA 4JB7A 1MXUA 3KN3A 2ONRA 5ELVA 4FATA 2QS4A 3USDA 1NMUA 4FORA 4KPTA 4Z0IA 2DWIA 1US5A 4BDMA 3H06B 1SBPA 4EXLA 1JETA 1SW2A 3IO6A 3RN8A 2O84X 4LP2B 5TPAB 3QAXA 3CRBA 4OESA 4KI0E 4I8CA 1DPPA 3HHGA 4F29A 1O7TA 1EZOA 3EPEA 1VE4A 4F39A 3MVZA 2Y84A 4MLQA 2V3UA 3RY3A 5HM4B 2ALUA 3BFTA 2HXWA 3O2AA 3CSGA 1B6HA 5DVFA 2GHBA 5AA2A 3EN3A 1NKXA 4R9GA 3MUQA 4M4GA 3PUWE 4ND9A 1SI1A 4R6HA 1R6ZA 4MLVA 3V89B 4R6KA 3QXMA 1LAGE 1FQBA 1N7WA 5TP9A 3CG3A 1EZPA 3SEWA 2XX9A 1ZU0A 4F3SA 3Q28A 2XXQA 4YAHX 1JVYA 4AB5A 4POWA 3MP6A 4ZEFA 1JVXA 1LAHE 4ZEIA 3WAEA 1I6QA 5ICQA 2V93A 3MZBA 3L6HA 4YMAA 3KOTA 3IR1A 1FCKA 3U1OA 5I2KA 1FTOA 2Y7PA 2I4BA 4IY6A 5H8FA 1FQDA 1UQWA 4U23A 2O6AA 5CMCA 3G7WA 2PVUA 3K01A 4GXSB 1OIBA 1B05A 3S9MC 1Y1MA 3O29A 4OYVA 1PB8A 1QJMA 2XXUA 3KZGA 3JZJA 3BFUA 2GH9A 5K2YA 3OO6A 4JSOA 1A55A 3IB1A 4F1UA 3LSXA 3HSTA 1JW1A 2REJA 3H6VA 3H3GA 4OQOA 2ONKE 1D4NA 5H8HB 1D3KA 2F78A 3MPKA 1FTKA 2UVIA 4EXKA 3C33A 3IOUA 3H7MA 3EHUA 2R6GE 4JSDA 2XD3A 4DXCA 2RC7A 1SVXB 3FVGA 4QFKA 1R9QA 4PFYA 4ONYA 2OJTA 4G68A 4GFRA 4P0IA 2R9JA 2DOJA 5H8QA 1B9JA 1MH4A 4MH5A 2I0BA 2I3WA 4OFLA 3ZKLA 2B3BA 2F34A 5AA2D 3VVDA 4QSDA 1F9BA 2F6PA 2PX1A 1OLCA 3C31A 1A40A 3FJGA 1A99A 5L9MA 5AA4A 4DXBA 1H45A 2H4IA 1OQHA 4BDOA 1Z7NE 2H9BA 2G29A 4OWDA 4YB5A 5I2KB 3RLFE 4GVOA 5H8FB 4QFPA 4YKIA 1SW4A 4KQPA 3G3JA 2F36A 1ZTYA 3MBPA 2OCUA 3TEPA 2HZLA 1MS7A 4EUOA 3RT8A 3MC2A 1MH3A 2XXWA 1GTKA 3SETA 2YJPA 3VLVA 3RPWA 1L5TA 1LBCA 2UVHA 1SW1A 3OSQA 3KN8A 5L9OA 2OLBA 2X7PA 1VFEA 3PUXE 2F35A 3RTFB 4E0XA 3TYHA 3IK6B 1DMBA 1MXZA 3OOAA 3OELA 3CI8A 3K6WA 3MW0A 4TLMB 5DVIA 1QVSA 3KGCA 3UA8A 4LA9A 3PPRA 4NE4A 1PEBA 5H8QB 3PPNA 1Y4TA 2I48A 1BP5A 1J1NA 1LB9A 1UIVA 5H8NA 1UIUA 5JTYA 5CBRA 4FJPA 3UN6A 3FASA 2D3IA 2OBGA 4ELQA 1SQYA 3QSLA 1LLSA 3HV1A 4OMBA 5KCJA 2I6EA 3LR1A 5B70A 3TMGA 2V3TA 4DDDA 3B6TA 5AA4B 2QJEA 1B3GA 5I56A 1SDXA 1AL3A 2OWTA 4FEDA 1A8FA 3O97A 1HSLA 3PUVE 3BKIB 4H67A 4HW8A 5CC2A 2QMXA 1FTMA 4P11A 1B3FA 4KD5A 1Y9UA 3QUJA 4GXAA 3MZ9A 3IAZA 1OQGA 1SW5A 1LCTA 3TCGA 1B7ZA 2QS2A 2AL5A 1P1NA 4UA8A 3F11A 1R9LA 4BLAA 1NL5A 4ZE8A 3P7IA 3S9NC 4BDRA 2V84A 3T9XB 3CSBA 3OO8A 3TDJA 3TZAA 5DEXA 3A3UA 1H43A 5TU0A 1AOVA 4O3AA 3PD9A 1POY1 3Q29A 4ZZAA 3IOTA 2HZKA 2XXXA 2ZXTA 4DLDA 3GBAA 1MDQA 3C32A 3GZGA 3WAFA 1XS5A 4ELOA 5H8NB 5JTYB 2FYIA 4GRKA 1LFGA 1ZLQA 3FVNA 2CMOA 3LSLA 4OENA 3EHSA 1B1XA 1URDA 5KCJB 4OTEA 2H98A 5J1DA 1MPBA 2Z8EA 4NF8A 3JYRA 1TFAA 3VVFA 1Y3QA 3MVXA 3KEIA 2DE2A 4OVJA 2I58A 5B7DA 3K4UA 2ZNTA 3SEYA 2YLNA 2QS1A 3SEUA 3PUYE 3O6GA 3TQLA 3B6QA 1H76A 2DSFA 1HSJA 2WKYA 1MY4A 2HCAA 2RC8A 3S4UA 3HCQA 1BKAA 3MAMA 4GL8A 3RNNA 4R74A 3Q25A 4HS7A 3KN7A 1Q1KA 2I0CA 1N3XA 4XKNA 5ITOA 5A5XB 3KJ7A 5ICTA 4QSEA 2H5YA 1CB6A 1QUIA 4ZDMA 3C36A 4G2ZA 4RYAA 2I4CA 4NWCA 4XXUA 4KFQA 1RYXA 5CMKA 3N26A 4QFLA 1M5BA 1B58A 1QKAA 2F97A 5I58B 1IITA 3TTKA 1H3DA 1MQIA 1DSNA 1BIYA 4ZECA 4O3CA 4I9DA 4DIGA 4MBPA 1QUJA 4PFTA 1II5A 3ILUB 1TXFA 3TAJA 3T66A 3OXNA 3CR9A 1FQEA 1FQCA 5KDTB 3QK6A 2G93A 3S9EA 3H4ZA 1B7HA 1MXWA 2AL4A 1FTJA 3T9HB 3MP1A 2GHAA 5I2NA 5I57A 2F6GA 4LZ7A 4EF2A 4H5FA 4XKRA 4NF5B 2A5TA 1M5CA 3GBBA 1IZ1A 5CBSA 3VXBA 2DWHA 1S9TA 4R75A 1I6AA 4FE8A 5K2XA 4EQBA 3MQ9A 2W7YA 4RJZA 3G3IA 4LATA 3ZSFA 3QYTA 2ONSA 3OO9A 3K0VA 3RTWB 2D5WA 4QFNA 4YKJA 1US4A 4IGTA 4U21A 4TQUQ 2XHDA 1OLAA 3FD3A 2O68A 4WEDA 3PU5A 3IORA 1JW4A 2VHAA 4ZS9A 1DOTA 2A5SA 4FAJA 2F7AA 4IO4A 2VD3A 1VR5A 4MFIA 4N6PA 4UACA 5FTIA 2Q2CA 4ELPA 2XX8A 4ELRA 4PP0A 3FXUA 2F8DA 1UTHA 3U92A 3AXFA 4F1VA 1WVJA 3ILTB 2DP8A 5IKBA 3IO4A 4WEPA 2F7BA 4XKQA 3D4GA 2XD2A 5I57B 2ZYMA 2I3VA 5BWJA 4F18A 1WDNA 1MY3A 4DCYA 2V25A 3PPPA 3SKPA 5AA2B 2XXYA 4F19A 1DTGA 2XXPA 5AA1A 2KLFA 2ZMBA 1N7XA 2ESNA 4DCXA 4LUBA 4IO2A 5TP9B 1FQAA 4HCWA 3M3FA 4LZ8A 3H6UA 2Z23A 5F1QA 2GFEA 3PV0E 3E9XA 2PYYA 3FV1A 1S7YA 1YCJA 2RF1A 3IX1A 3RUMA 3SEVA 1QUKA 1I6BA 2DWAA 3VLWA 5HPQA 1MY2A 3B7DA 4OFOA 4H65A 4IY5A 3FGSA 2DVZA 3VFJA 2Q88A 2UXAA 4JBZA 2GRVA 3LUYA 3HHFA 1B52A 1NNKA 1DTZA 4LZ5A 1GGGA 3EF7A 4K3FA 1MG1A 2UVJA 4X48A 2UYFA 4U1OA 4IO7A 3M3KA 4PFUA 4PE5B 5CRYA 2H99A 2HAVA 4RK2A 3FATA 3O6HA 5L8DA 3OENA 1P1OA 1Q35A 4G8MA 3PMWA 4NF6A 2QL3A 2DYXA 3SESA 5CI5A 3FV2A 3A3CA 1ELJA 5AA3A 1B3EA 3H6TA 4ZEDA 3O66A 3B6WA 4AB6A 3PPQA 2PBWA 3FZVA 4XIGQ 4KYEA 3H6WA 1A8EA 4G68B 3OMBA 1XVXA 1VSOA 3FVKA 3U72A 3KJTA 1MM6A 2O7IA 4NF4A 3T9UA 2RKMA 5FHMA 1QULA 3V5AA 3TQWA 1MPDA 1NNFA 5FHOA 4I1DA 3O6IA 3QIMA 4ZEKA 2O51A 2CZLA 4PQJA 4ZE9A 4H8IA 5BUUA 4KYDA 3HN0A 2ZYNA 3C35A 1LFHA 3TFLA 3T93B 2UYEA 4OEUA 3W15C 4JWYA 3T96B 3S9LC 1FW0A 3K6VA 3T9VA 3K6XA 2RCBA 1TT1A 1SYIA 1WODA 4Q0CA 1IXHA 3PMXA 1B0LA 4BDQA 2QRYA 1LB8A 2QMWA 3RQTA 5JK4A 2OK2A 1P1QA 4IO5A 2REGA 4XKPA 4GD5A 3N94A 1LFIA 3K02A 1ZMGA 4GF8A 3OO7A 3G3FA 5I59A 2O69A 2P0SA 1DPEA 1NNTA 3W9WA 3Q26A 5CMBA 3MP8A 1PBPA 3W9VA 4R2BA 3THIA 4JWOA 4Q5TA 2QS3A 4F2QA 1SYHA 2Y7RA 1ZJLA 2V3QA 4RXLA 1IEJA 2HQ0A 1XHYA 3HPIA 4NF4B 3E4RA 3ODBA 3U93A 4G4PA 3KFMA 5FHNA 2E0SA 1MDP1 1IIWA 3SDFA 1QW0A 4O3BA 2R71A 3PGFA 1USYE 3U8QA 3OEKA 2XXRA 2B65A 4FIMA 3R6UA 3VVEA 4THIA 5I56B 3MPLA 4OHNA 2ZYKA 1IXCA 1AMFA 1D9YA 4YZZA 4G77A 1ZIUA 4EF1A 4IGRA 4QRZA 3I3VA 3DP6A 4U1ZA 2THIA 3R7XA 4WKMA 4C1UA 1B46A 3IB2A 1JEUA 1KWHA 4X1BA 4EQ7A 1A7LA 4BDLA 3FIRA 5I59B 4FECA 3K1NA 3K2DA 1PB9A 4OZ9A 1EH3A 3SERA 3A09A 4U4XA 2Q89A 5DEXB 4PFWA 1D9VA 4L17A 2F7CA 4KHZE 2H25A 4ESWA 4EQ9A 3R26A 1MQGA 2Z22A 4M1VA 1A54A 1GVCA 3I6VA 1VFDA 3BBRA 4KYSA 1IQ7A 1B3HA 4KCDA 1ZKBA 1B3LA 2FNCA 4RPOA 4U2RA 3RGYA 3OD7A 2P2AA 4X1DA 3FXQA 4U4SA 4GWOA 3CFLA 4NF8B 1LSTA 4F2OA 1UTBA 1YTVA 1EZ9A 3EHTA 2DS9A 1MM7A 3TELA 1IXIA 1T0KA 1LAXA 1NNPA 2DXYA 3O9PA 5KZTA 4LVQA 3S2VA 2UVGA 2AYSA 4LQ2A 3RT6B 4R6YA 1URGA 4HCYA 3TPAA 1BLFA 4MF3A 1ZBMA 2ZYOA 3DELB 1GV8A 4H1XA 3LSWA 2X26A 4JXIA 1Y3NA 3M8UA 1MQDA 3KBRA 4ECFA 4YKPA 1RYOA 3K00A 3VXCA 1CE2A 2XXIA 2HEUA 1OVTA 1LBBA 1B51A 3UP9A 1B1HA 1AH5A 2M8CA 4Q30B 3PUZE 5H8HA 2OZZA 1B4HA 1MPCA 3D4CA 5CMMA 1OVBA 1B40A 1I69A 5EHSA 4QHQA 1USYH 1NH8A 4OEVA 4OETA 4ESXA 3N5LA 3TUSA 2DWJA 1HSEA 2O1LA 4POXA 3MZ1A 4YICA 2X7QA 3VE1B 4QSCA 4H8JA 3DLNA 4IO6A 4AQ4A 3M3LA 3TTNA 4R73A 1BTJA 1XT8A 1M5FA 4BDNA 1B5HA 1Y3PA 1UTBB 3N6UA 2DXRA 5L9SA 2XXTA 1LAFE 1RKMA 4RY1A 4F1YA 2VD2A 5I2NB 4RK9A 2NVUB 1XC1A 2RC9A 4RNSA 3UIFA 3VV5A 4GOTA 2IEEA 2Y7KA 2A5TB 2YPNA 3FVOA 2XXVA 3V83A 2XXHA 2DE4A 1N76A 3KSXA 3VLUA 1R1NA 2XX7A 1PDAA 3E13X 3ZS6A 4U22A 3FXRA 2Q9TA 3KG2A 1MQHA 3MWBA 4H0WA 2Z8DA 3IB0A 1EU8A 4EDPA 3FJ7A 4GIZA 1TFDA 2HFBA 2B3FA 3C4MA 3TCHA 5DYHA 2IA4A 2Y7WA 3OSRA 5EYFA 2O7UA 3HO7A 4ISUA 3O28A 4DXUA 3PPOA 4YMBA 1PC3A 4Q8RA 3OEMA 1GR2A 4YU0A 4C0RA 1B5IA 1UTHB 5M2VA 1YPNA 3UGWA 1S50A 4PETA 3QUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U94 A;  1M5D A;  1POT A;  3MJN A;  1B2H A;  3G3G A;  2VGQ A;  4RA1 A;  4X9T A;  1Y20 A;  2Q2A A;  4YKK A;  2DVC A;  2DE3 A;  3H03 A;  4F3B A;  4NTL A;  3V8X B;  2P1S A;  1JW5 A;  5HBC A;  1YAE A;  1SD3 A;  2VP1 A;  1FQF A;  3JV9 A;  5ISU A;  3IOV A;  1Y4C A;  1MY1 A;  3CVG A;  1XVY A;  2DQV A;  5JEI A;  1XOC A;  1P1W A;  2HAU A;  3IJO B;  3T22 A;  4H6D A;  3TTR A;  1JQF A;  4YB7 A;  1MQJ A;  4Z7E A;  3ECR A;  1P1U A;  2VOZ A;  1QKB A;  4WXJ A;  4DZ1 A;  4GLI A;  3UOR A;  2QPQ A;  3K1P A;  3L6G A;  4OER A;  4YB6 A;  1N84 A;  3TKD A;  3IOW A;  4DE8 A;  5DTB A;  5F7V A;  3K6U A;  3CFZ A;  3K1M A;  3CIJ A;  1MXX A;  2NXO A;  2ANJ A;  4NMY A;  4KCC A;  1B4Z A;  1N0T A;  3LC8 A;  3Q27 A;  1JEV A;  4LON B;  4GL0 A;  1H44 A;  4FEB A;  5DT6 A;  2NWJ A;  3CFX A;  3CG1 A;  3MVY A;  4NF6 B;  1O64 A;  4QF9 A;  4IO3 A;  1PB7 A;  2D21 A;  5IAI A;  3TTM A;  3I5O A;  2RIN A;  5CM6 A;  3G3K A;  5EHM A;  5DVJ A;  2ZNS A;  4QFO A;  1Y1Z A;  4G68 C;  1NH7 A;  2BJJ X;  3PD8 A;  1IUD A;  3DM0 A;  4KR5 A;  1B32 A;  3LSF B;  2Y7I A;  3C34 A;  3MVW A;  2NUV A;  1LGB C;  4N07 A;  2PT2 A;  3DP4 A;  5A5X A;  2I49 A;  1P99 A;  3SEX A;  1Z7M E;  4H5G A;  2E1S A;  3FJM A;  3IL1 B;  5I84 A;  3LBS A;  4P0G A;  4R72 A;  4TLL B;  3TCF A;  4N13 A;  5I58 A;  4LQ5 A;  3E3K A;  3TOD A;  2OWS A;  5AE4 A;  2F5X A;  1ANF A;  3N6T A;  1IXG A;  4NWD A;  3C9H A;  1N3W A;  3FUZ A;  1MXY A;  5LOM A;  4XTC Q;  5TPA A;  2Q8J A;  3UK4 A;  2NOO A;  1MXV A;  2ABH A;  4F3P A;  3GLB A;  3GXA A;  1MRP A;  5KDT A;  1PBQ A;  4E0W A;  4C1T A;  4RPN A;  4G8N A;  1O63 A;  1FTL A;  4R9F A;  1URS A;  2PT1 A;  4R2F A;  2Z8F A;  4NF5 A;  4F22 A;  2QSX A;  1B7U A;  4OXV A;  2RCA A;  1N04 A;  4HTG A;  4I62 A;  3G3H A;  4ZZE A;  1SI0 A;  4GQO A;  1B0H A;  3VDF A;  3ONM A;  4G8H A;  1B5J A;  4IB2 A;  3IJX B;  5ITP A;  1LCF A;  2FA7 A;  2LAO A;  3KOS A;  5FTH A;  4JDF A;  1OMP A;  4OFJ A;  3DP8 A;  3KSJ A;  1M5E A;  2AIX A;  4F31 B;  2O1M A;  3ZKK A;  4F3G A;  2ZNU A;  4ZEB A;  1JNF A;  3EQ1 A;  2PMS A;  1ATG A;  4NED A;  1MY0 A;  3PMV A;  1NFT A;  5H8S A;  1AIV A;  1TWY A;  4JWX A;  4TOZ A;  3TTL A;  4JB7 A;  1MXU A;  3KN3 A;  2ONR A;  5ELV A;  4FAT A;  2QS4 A;  3USD A;  1NMU A;  4FOR A;  4KPT A;  4Z0I A;  2DWI A;  1US5 A;  4BDM A;  3H06 B;  1SBP A;  4EXL A;  1JET A;  1SW2 A;  3IO6 A;  3RN8 A;  2O84 X;  4LP2 B;  5TPA B;  3QAX A;  3CRB A;  4OES A;  4KI0 E;  4I8C A;  1DPP A;  3HHG A;  4F29 A;  1O7T A;  1EZO A;  3EPE A;  1VE4 A;  4F39 A;  3MVZ A;  2Y84 A;  4MLQ A;  2V3U A;  3RY3 A;  5HM4 B;  2ALU A;  3BFT A;  2HXW A;  3O2A A;  3CSG A;  1B6H A;  5DVF A;  2GHB A;  5AA2 A;  3EN3 A;  1NKX A;  4R9G A;  3MUQ A;  4M4G A;  3PUW E;  4ND9 A;  1SI1 A;  4R6H A;  1R6Z A;  4MLV A;  3V89 B;  4R6K A;  3QXM A;  1LAG E;  1FQB A;  1N7W A;  5TP9 A;  3CG3 A;  1EZP A;  3SEW A;  2XX9 A;  1ZU0 A;  4F3S A;  3Q28 A;  2XXQ A;  4YAH X;  1JVY A;  4AB5 A;  4POW A;  3MP6 A;  4ZEF A;  1JVX A;  1LAH E;  4ZEI A;  3WAE A;  1I6Q A;  5ICQ A;  2V93 A;  3MZB A;  3L6H A;  4YMA A;  3KOT A;  3IR1 A;  1FCK A;  3U1O A;  5I2K A;  1FTO A;  2Y7P A;  2I4B A;  4IY6 A;  5H8F A;  1FQD A;  1UQW A;  4U23 A;  2O6A A;  5CMC A;  3G7W A;  2PVU A;  3K01 A;  4GXS B;  1OIB A;  1B05 A;  3S9M C;  1Y1M A;  3O29 A;  4OYV A;  1PB8 A;  1QJM A;  2XXU A;  3KZG A;  3JZJ A;  3BFU A;  2GH9 A;  5K2Y A;  3OO6 A;  4JSO A;  1A55 A;  3IB1 A;  4F1U A;  3LSX A;  3HST A;  1JW1 A;  2REJ A;  3H6V A;  3H3G A;  4OQO A;  2ONK E;  1D4N A;  5H8H B;  1D3K A;  2F78 A;  3MPK A;  1FTK A;  2UVI A;  4EXK A;  3C33 A;  3IOU A;  3H7M A;  3EHU A;  2R6G E;  4JSD A;  2XD3 A;  4DXC A;  2RC7 A;  1SVX B;  3FVG A;  4QFK A;  1R9Q A;  4PFY A;  4ONY A;  2OJT A;  4G68 A;  4GFR A;  4P0I A;  2R9J A;  2DOJ A;  5H8Q A;  1B9J A;  1MH4 A;  4MH5 A;  2I0B A;  2I3W A;  4OFL A;  3ZKL A;  2B3B A;  2F34 A;  5AA2 D;  3VVD A;  4QSD A;  1F9B A;  2F6P A;  2PX1 A;  1OLC A;  3C31 A;  1A40 A;  3FJG A;  1A99 A;  5L9M A;  5AA4 A;  4DXB A;  1H45 A;  2H4I A;  1OQH A;  4BDO A;  1Z7N E;  2H9B A;  2G29 A;  4OWD A;  4YB5 A;  5I2K B;  3RLF E;  4GVO A;  5H8F B;  4QFP A;  4YKI A;  1SW4 A;  4KQP A;  3G3J A;  2F36 A;  1ZTY A;  3MBP A;  2OCU A;  3TEP A;  2HZL A;  1MS7 A;  4EUO A;  3RT8 A;  3MC2 A;  1MH3 A;  2XXW A;  1GTK A;  3SET A;  2YJP A;  3VLV A;  3RPW A;  1L5T A;  1LBC A;  2UVH A;  1SW1 A;  3OSQ A;  3KN8 A;  5L9O A;  2OLB A;  2X7P A;  1VFE A;  3PUX E;  2F35 A;  3RTF B;  4E0X A;  3TYH A;  3IK6 B;  1DMB A;  1MXZ A;  3OOA A;  3OEL A;  3CI8 A;  3K6W A;  3MW0 A;  4TLM B;  5DVI A;  1QVS A;  3KGC A;  3UA8 A;  4LA9 A;  3PPR A;  4NE4 A;  1PEB A;  5H8Q B;  3PPN A;  1Y4T A;  2I48 A;  1BP5 A;  1J1N A;  1LB9 A;  1UIV A;  5H8N A;  1UIU A;  5JTY A;  5CBR A;  4FJP A;  3UN6 A;  3FAS A;  2D3I A;  2OBG A;  4ELQ A;  1SQY A;  3QSL A;  1LLS A;  3HV1 A;  4OMB A;  5KCJ A;  2I6E A;  3LR1 A;  5B70 A;  3TMG A;  2V3T A;  4DDD A;  3B6T A;  5AA4 B;  2QJE A;  1B3G A;  5I56 A;  1SDX A;  1AL3 A;  2OWT A;  4FED A;  1A8F A;  3O97 A;  1HSL A;  3PUV E;  3BKI B;  4H67 A;  4HW8 A;  5CC2 A;  2QMX A;  1FTM A;  4P11 A;  1B3F A;  4KD5 A;  1Y9U A;  3QUJ A;  4GXA A;  3MZ9 A;  3IAZ A;  1OQG A;  1SW5 A;  1LCT A;  3TCG A;  1B7Z A;  2QS2 A;  2AL5 A;  1P1N A;  4UA8 A;  3F11 A;  1R9L A;  4BLA A;  1NL5 A;  4ZE8 A;  3P7I A;  3S9N C;  4BDR A;  2V84 A;  3T9X B;  3CSB A;  3OO8 A;  3TDJ A;  3TZA A;  5DEX A;  3A3U A;  1H43 A;  5TU0 A;  1AOV A;  4O3A A;  3PD9 A;  1POY 1;  3Q29 A;  4ZZA A;  3IOT A;  2HZK A;  2XXX A;  2ZXT A;  4DLD A;  3GBA A;  1MDQ A;  3C32 A;  3GZG A;  3WAF A;  1XS5 A;  4ELO A;  5H8N B;  5JTY B;  2FYI A;  4GRK A;  1LFG A;  1ZLQ A;  3FVN A;  2CMO A;  3LSL A;  4OEN A;  3EHS A;  1B1X A;  1URD A;  5KCJ B;  4OTE A;  2H98 A;  5J1D A;  1MPB A;  2Z8E A;  4NF8 A;  3JYR A;  1TFA A;  3VVF A;  1Y3Q A;  3MVX A;  3KEI A;  2DE2 A;  4OVJ A;  2I58 A;  5B7D A;  3K4U A;  2ZNT A;  3SEY A;  2YLN A;  2QS1 A;  3SEU A;  3PUY E;  3O6G A;  3TQL A;  3B6Q A;  1H76 A;  2DSF A;  1HSJ A;  2WKY A;  1MY4 A;  2HCA A;  2RC8 A;  3S4U A;  3HCQ A;  1BKA A;  3MAM A;  4GL8 A;  3RNN A;  4R74 A;  3Q25 A;  4HS7 A;  3KN7 A;  1Q1K A;  2I0C A;  1N3X A;  4XKN A;  5ITO A;  5A5X B;  3KJ7 A;  5ICT A;  4QSE A;  2H5Y A;  1CB6 A;  1QUI A;  4ZDM A;  3C36 A;  4G2Z A;  4RYA A;  2I4C A;  4NWC A;  4XXU A;  4KFQ A;  1RYX A;  5CMK A;  3N26 A;  4QFL A;  1M5B A;  1B58 A;  1QKA A;  2F97 A;  5I58 B;  1IIT A;  3TTK A;  1H3D A;  1MQI A;  1DSN A;  1BIY A;  4ZEC A;  4O3C A;  4I9D A;  4DIG A;  4MBP A;  1QUJ A;  4PFT A;  1II5 A;  3ILU B;  1TXF A;  3TAJ A;  3T66 A;  3OXN A;  3CR9 A;  1FQE A;  1FQC A;  5KDT B;  3QK6 A;  2G93 A;  3S9E A;  3H4Z A;  1B7H A;  1MXW A;  2AL4 A;  1FTJ A;  3T9H B;  3MP1 A;  2GHA A;  5I2N A;  5I57 A;  2F6G A;  4LZ7 A;  4EF2 A;  4H5F A;  4XKR A;  4NF5 B;  2A5T A;  1M5C A;  3GBB A;  1IZ1 A;  5CBS A;  3VXB A;  2DWH A;  1S9T A;  4R75 A;  1I6A A;  4FE8 A;  5K2X A;  4EQB A;  3MQ9 A;  2W7Y A;  4RJZ A;  3G3I A;  4LAT A;  3ZSF A;  3QYT A;  2ONS A;  3OO9 A;  3K0V A;  3RTW B;  2D5W A;  4QFN A;  4YKJ A;  1US4 A;  4IGT A;  4U21 A;  4TQU Q;  2XHD A;  1OLA A;  3FD3 A;  2O68 A;  4WED A;  3PU5 A;  3IOR A;  1JW4 A;  2VHA A;  4ZS9 A;  1DOT A;  2A5S A;  4FAJ A;  2F7A A;  4IO4 A;  2VD3 A;  1VR5 A;  4MFI A;  4N6P A;  4UAC A;  5FTI A;  2Q2C A;  4ELP A;  2XX8 A;  4ELR A;  4PP0 A;  3FXU A;  2F8D A;  1UTH A;  3U92 A;  3AXF A;  4F1V A;  1WVJ A;  3ILT B;  2DP8 A;  5IKB A;  3IO4 A;  4WEP A;  2F7B A;  4XKQ A;  3D4G A;  2XD2 A;  5I57 B;  2ZYM A;  2I3V A;  5BWJ A;  4F18 A;  1WDN A;  1MY3 A;  4DCY A;  2V25 A;  3PPP A;  3SKP A;  5AA2 B;  2XXY A;  4F19 A;  1DTG A;  2XXP A;  5AA1 A;  2KLF A;  2ZMB A;  1N7X A;  2ESN A;  4DCX A;  4LUB A;  4IO2 A;  5TP9 B;  1FQA A;  4HCW A;  3M3F A;  4LZ8 A;  3H6U A;  2Z23 A;  5F1Q A;  2GFE A;  3PV0 E;  3E9X A;  2PYY A;  3FV1 A;  1S7Y A;  1YCJ A;  2RF1 A;  3IX1 A;  3RUM A;  3SEV A;  1QUK A;  1I6B A;  2DWA A;  3VLW A;  5HPQ A;  1MY2 A;  3B7D A;  4OFO A;  4H65 A;  4IY5 A;  3FGS A;  2DVZ A;  3VFJ A;  2Q88 A;  2UXA A;  4JBZ A;  2GRV A;  3LUY A;  3HHF A;  1B52 A;  1NNK A;  1DTZ A;  4LZ5 A;  1GGG A;  3EF7 A;  4K3F A;  1MG1 A;  2UVJ A;  4X48 A;  2UYF A;  4U1O A;  4IO7 A;  3M3K A;  4PFU A;  4PE5 B;  5CRY A;  2H99 A;  2HAV A;  4RK2 A;  3FAT A;  3O6H A;  5L8D A;  3OEN A;  1P1O A;  1Q35 A;  4G8M A;  3PMW A;  4NF6 A;  2QL3 A;  2DYX A;  3SES A;  5CI5 A;  3FV2 A;  3A3C A;  1ELJ A;  5AA3 A;  1B3E A;  3H6T A;  4ZED A;  3O66 A;  3B6W A;  4AB6 A;  3PPQ A;  2PBW A;  3FZV A;  4XIG Q;  4KYE A;  3H6W A;  1A8E A;  4G68 B;  3OMB A;  1XVX A;  1VSO A;  3FVK A;  3U72 A;  3KJT A;  1MM6 A;  2O7I A;  4NF4 A;  3T9U A;  2RKM A;  5FHM A;  1QUL A;  3V5A A;  3TQW A;  1MPD A;  1NNF A;  5FHO A;  4I1D A;  3O6I A;  3QIM A;  4ZEK A;  2O51 A;  2CZL A;  4PQJ A;  4ZE9 A;  4H8I A;  5BUU A;  4KYD A;  3HN0 A;  2ZYN A;  3C35 A;  1LFH A;  3TFL A;  3T93 B;  2UYE A;  4OEU A;  3W15 C;  4JWY A;  3T96 B;  3S9L C;  1FW0 A;  3K6V A;  3T9V A;  3K6X A;  2RCB A;  1TT1 A;  1SYI A;  1WOD A;  4Q0C A;  1IXH A;  3PMX A;  1B0L A;  4BDQ A;  2QRY A;  1LB8 A;  2QMW A;  3RQT A;  5JK4 A;  2OK2 A;  1P1Q A;  4IO5 A;  2REG A;  4XKP A;  4GD5 A;  3N94 A;  1LFI A;  3K02 A;  1ZMG A;  4GF8 A;  3OO7 A;  3G3F A;  5I59 A;  2O69 A;  2P0S A;  1DPE A;  1NNT A;  3W9W A;  3Q26 A;  5CMB A;  3MP8 A;  1PBP A;  3W9V A;  4R2B A;  3THI A;  4JWO A;  4Q5T A;  2QS3 A;  4F2Q A;  1SYH A;  2Y7R A;  1ZJL A;  2V3Q A;  4RXL A;  1IEJ A;  2HQ0 A;  1XHY A;  3HPI A;  4NF4 B;  3E4R A;  3ODB A;  3U93 A;  4G4P A;  3KFM A;  5FHN A;  2E0S A;  1MDP 1;  1IIW A;  3SDF A;  1QW0 A;  4O3B A;  2R71 A;  3PGF A;  1USY E;  3U8Q A;  3OEK A;  2XXR A;  2B65 A;  4FIM A;  3R6U A;  3VVE A;  4THI A;  5I56 B;  3MPL A;  4OHN A;  2ZYK A;  1IXC A;  1AMF A;  1D9Y A;  4YZZ A;  4G77 A;  1ZIU A;  4EF1 A;  4IGR A;  4QRZ A;  3I3V A;  3DP6 A;  4U1Z A;  2THI A;  3R7X A;  4WKM A;  4C1U A;  1B46 A;  3IB2 A;  1JEU A;  1KWH A;  4X1B A;  4EQ7 A;  1A7L A;  4BDL A;  3FIR A;  5I59 B;  4FEC A;  3K1N A;  3K2D A;  1PB9 A;  4OZ9 A;  1EH3 A;  3SER A;  3A09 A;  4U4X A;  2Q89 A;  5DEX B;  4PFW A;  1D9V A;  4L17 A;  2F7C A;  4KHZ E;  2H25 A;  4ESW A;  4EQ9 A;  3R26 A;  1MQG A;  2Z22 A;  4M1V A;  1A54 A;  1GVC A;  3I6V A;  1VFD A;  3BBR A;  4KYS A;  1IQ7 A;  1B3H A;  4KCD A;  1ZKB A;  1B3L A;  2FNC A;  4RPO A;  4U2R A;  3RGY A;  3OD7 A;  2P2A A;  4X1D A;  3FXQ A;  4U4S A;  4GWO A;  3CFL A;  4NF8 B;  1LST A;  4F2O A;  1UTB A;  1YTV A;  1EZ9 A;  3EHT A;  2DS9 A;  1MM7 A;  3TEL A;  1IXI A;  1T0K A;  1LAX A;  1NNP A;  2DXY A;  3O9P A;  5KZT A;  4LVQ A;  3S2V A;  2UVG A;  2AYS A;  4LQ2 A;  3RT6 B;  4R6Y A;  1URG A;  4HCY A;  3TPA A;  1BLF A;  4MF3 A;  1ZBM A;  2ZYO A;  3DEL B;  1GV8 A;  4H1X A;  3LSW A;  2X26 A;  4JXI A;  1Y3N A;  3M8U A;  1MQD A;  3KBR A;  4ECF A;  4YKP A;  1RYO A;  3K00 A;  3VXC A;  1CE2 A;  2XXI A;  2HEU A;  1OVT A;  1LBB A;  1B51 A;  3UP9 A;  1B1H A;  1AH5 A;  2M8C A;  4Q30 B;  3PUZ E;  5H8H A;  2OZZ A;  1B4H A;  1MPC A;  3D4C A;  5CMM A;  1OVB A;  1B40 A;  1I69 A;  5EHS A;  4QHQ A;  1USY H;  1NH8 A;  4OEV A;  4OET A;  4ESX A;  3N5L A;  3TUS A;  2DWJ A;  1HSE A;  2O1L A;  4POX A;  3MZ1 A;  4YIC A;  2X7Q A;  3VE1 B;  4QSC A;  4H8J A;  3DLN A;  4IO6 A;  4AQ4 A;  3M3L A;  3TTN A;  4R73 A;  1BTJ A;  1XT8 A;  1M5F A;  4BDN A;  1B5H A;  1Y3P A;  1UTB B;  3N6U A;  2DXR A;  5L9S A;  2XXT A;  1LAF E;  1RKM A;  4RY1 A;  4F1Y A;  2VD2 A;  5I2N B;  4RK9 A;  2NVU B;  1XC1 A;  2RC9 A;  4RNS A;  3UIF A;  3VV5 A;  4GOT A;  2IEE A;  2Y7K A;  2A5T B;  2YPN A;  3FVO A;  2XXV A;  3V83 A;  2XXH A;  2DE4 A;  1N76 A;  3KSX A;  3VLU A;  1R1N A;  2XX7 A;  1PDA A;  3E13 X;  3ZS6 A;  4U22 A;  3FXR A;  2Q9T A;  3KG2 A;  1MQH A;  3MWB A;  4H0W A;  2Z8D A;  3IB0 A;  1EU8 A;  4EDP A;  3FJ7 A;  4GIZ A;  1TFD A;  2HFB A;  2B3F A;  3C4M A;  3TCH A;  5DYH A;  2IA4 A;  2Y7W A;  3OSR A;  5EYF A;  2O7U A;  3HO7 A;  4ISU A;  3O28 A;  4DXU A;  3PPO A;  4YMB A;  1PC3 A;  4Q8R A;  3OEM A;  1GR2 A;  4YU0 A;  4C0R A;  1B5I A;  1UTH B;  5M2V A;  1YPN A;  3UGW A;  1S50 A;  4PET A;  3QUF A; 
#chains in the Genus database with same CATH topology
 3B8B A;  3U94 A;  1M5D A;  1POT A;  4HE2 A;  3MJN A;  1B2H A;  3G3G A;  2VGQ A;  4RA1 A;  4X9T A;  1Y20 A;  2Q2A A;  4YKK A;  2DVC A;  2DE3 A;  3H03 A;  4F3B A;  2CZI A;  1FBC A;  4NTL A;  3V8X B;  2P1S A;  1JW5 A;  5HBC A;  1YAE A;  1SD3 A;  2VP1 A;  1FQF A;  3JV9 A;  5ISU A;  3IOV A;  5IGA A;  1Y4C A;  1MY1 A;  3CVG A;  1XVY A;  4P8B A;  2DQV A;  5JEI A;  4GWZ A;  1XOC A;  1P1W A;  2QVU A;  2HAU A;  3IJO B;  3T22 A;  4H6D A;  3TTR A;  4I40 A;  1JQF A;  4P56 A;  4YB7 A;  4PBQ A;  1MQJ A;  4Z7E A;  3ECR A;  1P1U A;  2VOZ A;  5T3J A;  1QKB A;  3CHG A;  4WXJ A;  3BIH A;  4DZ1 A;  4GLI A;  3UOR A;  2QPQ A;  5ESY A;  3K1P A;  4P3L A;  3L6G A;  4OER A;  4N17 A;  4YB6 A;  1N84 A;  4G61 A;  3TKD A;  3IOW A;  4DE8 A;  5DTB A;  4P9K A;  5F7V A;  3K6U A;  3CFZ A;  3K1M A;  4N6D A;  3CIJ A;  1MXX A;  2NXO A;  4MNC A;  2ANJ A;  1JP4 A;  4NMY A;  4KCC A;  4OVR A;  1INP A;  1B4Z A;  1N0T A;  3LC8 A;  3Q27 A;  1FRP A;  2FVZ A;  1JEV A;  4AS5 A;  4LON B;  4GL0 A;  1LBY A;  4N4U A;  1H44 A;  4FEB A;  5I7I A;  5DT6 A;  2NWJ A;  3CFX A;  2PFY A;  1D9Q A;  3CG1 A;  3MVY A;  4NF6 B;  1O64 A;  4QF9 A;  4IO3 A;  1PB7 A;  2D21 A;  5IAI A;  3TTM A;  4JVI A;  2BJI A;  3I5O A;  2RIN A;  5CM6 A;  3G3K A;  5EHM A;  5DVJ A;  4HE1 A;  2ZNS A;  1FBE A;  4GBV A;  4QFO A;  1Y1Z A;  4G68 C;  1NH7 A;  2BJJ X;  3PD8 A;  1FBP A;  1IUD A;  3DM0 A;  4KR5 A;  1B32 A;  1LBZ A;  4NAP A;  3LSF B;  2Y7I A;  3C34 A;  3MVW A;  2NUV A;  1LGB C;  4N07 A;  2PT2 A;  1IMF A;  3DP4 A;  5A5X A;  2I49 A;  2ZZW A;  1P99 A;  4N8G A;  2QVR A;  3SEX A;  1Z7M E;  4H5G A;  1IMB A;  2E1S A;  3FJM A;  1EYK A;  3IL1 B;  3LBS A;  5I84 A;  4P0G A;  5EYH A;  4R72 A;  4TLL B;  3TCF A;  4N13 A;  3LUZ A;  5I58 A;  4LQ5 A;  3E3K A;  5DW8 A;  3TOD A;  2OWS A;  5AE4 A;  2F5X A;  1ANF A;  3N6T A;  1IXG A;  4NWD A;  3C9H A;  1N3W A;  1NV3 A;  3FUZ A;  1MXY A;  1FJ9 A;  5LOM A;  4XTC Q;  5TPA A;  2Q8J A;  3UK4 A;  2NOO A;  4NX1 A;  1MXV A;  2ABH A;  4F3P A;  3GLB A;  3GXA A;  1MRP A;  5KDT A;  1PBQ A;  4E0W A;  4PBH A;  2FIX A;  4C1T A;  4UAB A;  2HHM A;  4RPN A;  4G8N A;  1O63 A;  1FTL A;  4R9F A;  1URS A;  2PT1 A;  4R2F A;  2Z8F A;  4NF5 A;  4F22 A;  2QSX A;  4OXV A;  1B7U A;  2RCA A;  1N04 A;  4HTG A;  4I62 A;  3G3H A;  4ZZE A;  1K9Z A;  2PCR A;  1SI0 A;  4GQO A;  1B0H A;  3VDF A;  3ONM A;  3D1R A;  4G8H A;  1FPI A;  2F3B A;  1B5J A;  5IZ3 B;  4IB2 A;  3IJX B;  5ITP A;  1LCF A;  2FA7 A;  1DK4 A;  2LAO A;  3KOS A;  4QXD A;  5FTH A;  4JDF A;  1OMP A;  4OFJ A;  3DP8 A;  3KSJ A;  1M5E A;  2AIX A;  4F31 B;  2O1M A;  3ZKK A;  4F3G A;  2ZNU A;  4ZEB A;  1JNF A;  3EQ1 A;  2PMS A;  1ATG A;  1FJ6 A;  2HXR A;  4NED A;  1MY0 A;  3PMV A;  1NFT A;  5H8S A;  1AIV A;  1TWY A;  4JWX A;  4TOZ A;  3TTL A;  4JB7 A;  1MXU A;  3KN3 A;  2ONR A;  5ELV A;  4FAT A;  2QS4 A;  3USD A;  1NMU A;  4FOR A;  4KPT A;  4Z0I A;  2DWI A;  1US5 A;  4BDM A;  3H06 B;  1SBP A;  4EXL A;  5IZZ A;  1JET A;  1SW2 A;  3IO6 A;  3RN8 A;  2O84 X;  4QBA A;  4LP2 B;  5TPA B;  3QAX A;  3CRB A;  4OES A;  4KI0 E;  4I8C A;  1DPP A;  3HHG A;  4F29 A;  1O7T A;  1EZO A;  3EPE A;  1VE4 A;  4F39 A;  3MVZ A;  2Y84 A;  4MLQ A;  2V3U A;  3RY3 A;  5HM4 B;  1IME A;  2ALU A;  3BFT A;  2HXW A;  3O2A A;  3CSG A;  1B6H A;  5DVF A;  4XEQ A;  2GHB A;  2VPN A;  5AA2 A;  3EN3 A;  1NKX A;  4R9G A;  3MUQ A;  4M4G A;  3PUW E;  4ND9 A;  1SI1 A;  4R6H A;  1R6Z A;  4MLV A;  3V89 B;  4R6K A;  1NI9 A;  3QXM A;  1LAG E;  1FQB A;  1N7W A;  4MNP A;  5TP9 A;  3CG3 A;  2VT5 A;  1EZP A;  3SEW A;  2XX9 A;  1FPE A;  1ZU0 A;  4F3S A;  3Q28 A;  3T1B A;  2XXQ A;  4YAH X;  1JVY A;  4AB5 A;  4OVT A;  4POW A;  3MP6 A;  4ZEF A;  1JVX A;  1LAH E;  5I5P A;  4NGU A;  4ZEI A;  3BIG A;  3WAE A;  1I6Q A;  5ICQ A;  2V93 A;  3MZB A;  3L6H A;  4YMA A;  3KOT A;  3IR1 A;  1FCK A;  3U1O A;  5I2K A;  1FTO A;  2Y7P A;  2I4B A;  4IY6 A;  5H8F A;  1NV2 A;  1FQD A;  1UQW A;  4U23 A;  2O6A A;  5CMC A;  1DBZ A;  3G7W A;  4O94 A;  2PVU A;  3K01 A;  4GXS B;  1OIB A;  1B05 A;  3S9M C;  1Y1M A;  3O29 A;  4OYV A;  1PB8 A;  1QJM A;  2XXU A;  3KZG A;  3JZJ A;  3BFU A;  1LEV A;  2GH9 A;  1QGX A;  5K2Y A;  3OO6 A;  4JSO A;  1A55 A;  3IB1 A;  4F1U A;  4HXV A;  3LSX A;  3HST A;  1JW1 A;  2REJ A;  1FBD A;  3H6V A;  3H3G A;  4OQO A;  3NOH A;  2ONK E;  1D4N A;  1DCU A;  1NV0 A;  5H8H B;  1D3K A;  4I3Y A;  2F78 A;  3MPK A;  1FTK A;  2UVI A;  4EXK A;  3C33 A;  3IOU A;  3H7M A;  3EHU A;  2R6G E;  4JSD A;  2XD3 A;  4DXC A;  2RC7 A;  1SVX B;  3FVG A;  4QFK A;  1R9Q A;  4PFY A;  3T0J A;  4ONY A;  2OJT A;  4GWX A;  4G68 A;  4GFR A;  4P0I A;  2R9J A;  2DOJ A;  5H8Q A;  1FTA A;  4PCD A;  4PGP A;  1B9J A;  1MH4 A;  3RPL A;  4MH5 A;  2I0B A;  4PFB A;  2I3W A;  4OFL A;  3ZKL A;  2B3B A;  2F34 A;  4NG7 A;  5AA2 D;  3VVD A;  4QSD A;  1F9B A;  2F6P A;  2PX1 A;  1OLC A;  3C31 A;  1A40 A;  3FJG A;  1A99 A;  5L9M A;  5AA4 A;  4DXB A;  1H45 A;  2H4I A;  1OQH A;  4BDO A;  1Z7N E;  2H9B A;  1AWB A;  2G29 A;  4OWD A;  4YB5 A;  5I2K B;  3RLF E;  4LN5 A;  4GVO A;  5H8F B;  4QFP A;  4YKI A;  2B4L A;  1SW4 A;  4KQP A;  3G3J A;  2F36 A;  1ZTY A;  3MBP A;  2OCU A;  3TEP A;  2HZL A;  1MS7 A;  4EUO A;  3RT8 A;  3MC2 A;  1MH3 A;  2XXW A;  3IFA A;  4PF6 A;  1GTK A;  3SET A;  2YJP A;  3VLV A;  3RPW A;  1L5T A;  1LBC A;  2UVH A;  1SW1 A;  3OSQ A;  3KN8 A;  5L9O A;  2OLB A;  2X7P A;  1IMC A;  1VFE A;  3PUX E;  2F35 A;  3RTF B;  4E0X A;  4IR8 A;  3TYH A;  3IK6 B;  1BK4 A;  1DMB A;  1MXZ A;  3OOA A;  3OEL A;  3CI8 A;  3K6W A;  3MW0 A;  4TLM B;  5DVI A;  1QVS A;  3KGC A;  3UA8 A;  3FXB A;  4LA9 A;  3PPR A;  4NE4 A;  1PEB A;  5H8Q B;  3PPN A;  1Y4T A;  2I48 A;  1BP5 A;  1J1N A;  1LB9 A;  1UIV A;  5H8N A;  1UIU A;  5JTY A;  5CBR A;  4FJP A;  3UN6 A;  3FAS A;  2D3I A;  2OBG A;  4ELQ A;  1SQY A;  3QSL A;  1LLS A;  3HV1 A;  4OMB A;  5KCJ A;  2I6E A;  4PDH A;  3LR1 A;  5B70 A;  5LTC A;  3TMG A;  2V3T A;  4DDD A;  3B6T A;  5AA4 B;  4X8R A;  1KA0 A;  2QJE A;  1B3G A;  5I56 A;  1SDX A;  1AL3 A;  2OWT A;  4FED A;  1A8F A;  3O97 A;  1RDX A;  4DI3 D;  1HSL A;  3PUV E;  4O8M A;  3ROJ A;  3BKI B;  4H67 A;  4HW8 A;  5CC2 A;  2QMX A;  1FTM A;  4P11 A;  1B3F A;  4KD5 A;  1Y9U A;  3QUJ A;  4GXA A;  3MZ9 A;  3IAZ A;  1OQG A;  1SW5 A;  1LCT A;  3TCG A;  1B7Z A;  3GYY A;  2QS2 A;  2AL5 A;  1P1N A;  4UA8 A;  3F11 A;  1R9L A;  4BLA A;  1NL5 A;  5EQ8 A;  4XF5 A;  3P7I A;  4ZE8 A;  3S9N C;  4BDR A;  2V84 A;  1FBF A;  3T9X B;  3CSB A;  3OO8 A;  3TDJ A;  4PAI A;  3TZA A;  1KA1 A;  5DEX A;  3A3U A;  3RYD A;  1H43 A;  5TU0 A;  1AOV A;  4O3A A;  3PD9 A;  1POY 1;  5EYG A;  3Q29 A;  4ZZA A;  2XWI A;  3IOT A;  2HZK A;  2XXX A;  1NV6 A;  2ZXT A;  4DLD A;  3GBA A;  2CZK A;  1MDQ A;  3C32 A;  3GZG A;  3WAF A;  1XS5 A;  4ELO A;  5H8N B;  4PAK A;  1YXI A;  5JTY B;  2FYI A;  5ET5 A;  4GRK A;  1LFG A;  1ZLQ A;  3FVN A;  2CMO A;  3LSL A;  4I3E A;  4OEN A;  3EHS A;  1B1X A;  2CZH A;  1URD A;  5KCJ B;  5EQA A;  4OTE A;  5F24 A;  2H98 A;  1RDZ A;  5J1D A;  4P47 A;  1MPB A;  2Z8E A;  4NF8 A;  3JYR A;  1TFA A;  4MMP A;  3VVF A;  1Y3Q A;  2P3N A;  3MVX A;  3KEI A;  2KQZ A;  2DE2 A;  4OVJ A;  2I58 A;  5B7D A;  3K4U A;  5EQ9 A;  2ZNT A;  4NN3 A;  3SEY A;  2YLN A;  2QS1 A;  3SEU A;  3PUY E;  3O6G A;  3TQL A;  1LBV A;  3B6Q A;  1RDY A;  1H76 A;  2DSF A;  1HSJ A;  2WKY A;  1MY4 A;  2HCA A;  2RC8 A;  3S4U A;  3HCQ A;  1BKA A;  3MAM A;  4PFI A;  4GL8 A;  3RNN A;  4R74 A;  3Q25 A;  2QVV A;  2P3V A;  5IZ1 A;  4HS7 A;  3KN7 A;  1Q1K A;  2I0C A;  1N3X A;  4XKN A;  5ITO A;  5A5X B;  3HFU A;  3KJ7 A;  5ICT A;  4QSE A;  2H5Y A;  1CB6 A;  1QUI A;  4ZDM A;  3C36 A;  2CEX A;  4G2Z A;  4RYA A;  4MIJ A;  2I4C A;  4NWC A;  4XXU A;  4KFQ A;  1RYX A;  5CMK A;  3N26 A;  4QFL A;  1M5B A;  1B58 A;  1QKA A;  2F97 A;  5I58 B;  4MX6 A;  4OVS A;  1IIT A;  3TTK A;  1H3D A;  1MQI A;  1DSN A;  1BIY A;  4ZEC A;  4O3C A;  4I9D A;  2WYP A;  5ET8 A;  4DIG A;  4MBP A;  1QUJ A;  4PFT A;  1II5 A;  3ILU B;  1TXF A;  3TAJ A;  3T66 A;  3OXN A;  3CR9 A;  1FQE A;  1FQC A;  5KDT B;  3QK6 A;  1NV1 A;  2G93 A;  3S9E A;  3H4Z A;  1B7H A;  2ZZV A;  1MXW A;  2AL4 A;  1FTJ A;  3T9H B;  3MP1 A;  2GHA A;  2QFL A;  5I2N A;  5I57 A;  2F6G A;  4LZ7 A;  4EF2 A;  4H5F A;  4XKR A;  4NF5 B;  2A5T A;  4GBW A;  1M5C A;  3GBB A;  1IZ1 A;  5CBS A;  3VXB A;  3U65 A;  2DWH A;  1S9T A;  4R75 A;  4OA4 A;  1I6A A;  4FE8 A;  5K2X A;  2VPO A;  4EQB A;  3MQ9 A;  2W7Y A;  4RJZ A;  3G3I A;  4LAT A;  3ZSF A;  3QYT A;  2ONS A;  3OO9 A;  3K0V A;  3RTW B;  2D5W A;  4QFN A;  4YKJ A;  1US4 A;  1NV4 A;  4IGT A;  4U21 A;  1XI6 A;  4TQU Q;  2XHD A;  1OLA A;  3FD3 A;  1G0H A;  2O68 A;  4WED A;  3PU5 A;  3IOR A;  1JW4 A;  2WBD A;  2VHA A;  1Q9D A;  4ZS9 A;  1DOT A;  2A5S A;  4P1L A;  4FAJ A;  2F7A A;  4IO4 A;  2VD3 A;  1VR5 A;  4MFI A;  4N6P A;  4UAC A;  5FTI A;  2Q2C A;  4GWW A;  4ELP A;  4OVP A;  2XX8 A;  5A5L A;  1VDW A;  4ELR A;  4PP0 A;  3FXU A;  2F8D A;  1UTH A;  3U92 A;  3AXF A;  4F1V A;  1WVJ A;  3ILT B;  2DP8 A;  1EYJ A;  5IKB A;  3IO4 A;  4WEP A;  2F7B A;  4XKQ A;  3D4G A;  2XD2 A;  4PDD A;  5I57 B;  2ZYM A;  2I3V A;  4GX3 A;  5BWJ A;  4F18 A;  1WDN A;  1MY3 A;  4DCY A;  2V25 A;  3PPP A;  3SKP A;  5AA2 B;  4GWY A;  2XXY A;  4F19 A;  1DTG A;  2XXP A;  5AA1 A;  2KLF A;  2ZMB A;  5ET6 A;  1N7X A;  2ESN A;  4DCX A;  1FBG A;  4OAN A;  4LUB A;  4IO2 A;  4O7M A;  5TP9 B;  1FQA A;  4HCW A;  3M3F A;  4LZ8 A;  4NF0 A;  3H6U A;  2Z23 A;  5F1Q A;  4GX4 A;  2GFE A;  3PV0 E;  4NQ8 A;  3E9X A;  2PYY A;  3FV1 A;  1S7Y A;  1YCJ A;  3KC0 A;  2RF1 A;  3IX1 A;  3RUM A;  3SEV A;  1QUK A;  5J16 A;  1I6B A;  2DWA A;  3VLW A;  5HPQ A;  1MY2 A;  3B7D A;  4OFO A;  2CEY A;  4H65 A;  4P1E A;  4IY5 A;  2XWK A;  3FGS A;  2DVZ A;  3VFJ A;  2Q88 A;  2UXA A;  4JBZ A;  2GRV A;  3LUY A;  2WBB A;  3HHF A;  1B52 A;  1NNK A;  1DTZ A;  3EKI A;  4LZ5 A;  1GGG A;  3EF7 A;  4K3F A;  1MG1 A;  2JJK A;  2UVJ A;  4X48 A;  2UYF A;  4U1O A;  4IO7 A;  3M3K A;  4PFU A;  4PE5 B;  4N91 A;  5CRY A;  2H99 A;  2HAV A;  4RK2 A;  1FPG A;  3FAT A;  3O6H A;  5L8D A;  3OEN A;  1P1O A;  1Q35 A;  4G8M A;  4JVC A;  3PMW A;  4NF6 A;  2QL3 A;  2MKZ A;  2DYX A;  3SES A;  5CI5 A;  3FV2 A;  4N6K A;  3A3C A;  1ELJ A;  5AA3 A;  1B3E A;  3H6T A;  4ZED A;  3O66 A;  3B6W A;  4AB6 A;  3PPQ A;  2PBW A;  3FZV A;  4XIG Q;  4KYE A;  4GX6 A;  1YYZ A;  3H6W A;  1A8E A;  1NV5 A;  4G68 B;  2PFZ A;  3OMB A;  1XVX A;  1SPI A;  3RPL B;  1VSO A;  3FVK A;  3U72 A;  3KJT A;  1IMA A;  1MM6 A;  2O7I A;  4NF4 A;  1NV7 A;  3T9U A;  2RKM A;  5FHM A;  1QUL A;  3V5A A;  3TQW A;  2XWV A;  4N8Y A;  4O7I A;  2FIE A;  3MYU A;  1MPD A;  1NNF A;  1FPF A;  5FHO A;  4I1D A;  3SZP A;  3O6I A;  3QIM A;  4ZEK A;  2O51 A;  2CZL A;  4PQJ A;  4ZE9 A;  4H8I A;  5BUU A;  4KYD A;  3HN0 A;  4GWU A;  2ZYN A;  1LBW A;  3C35 A;  1LFH A;  3TFL A;  4AS4 A;  3T93 B;  2UYE A;  4OEU A;  3W15 C;  4JWY A;  3T96 B;  3S9L C;  1FW0 A;  1FBH A;  3K6V A;  3T9V A;  3K6X A;  2RCB A;  1TT1 A;  1SYI A;  2F3D A;  1WOD A;  4Q0C A;  1IXH A;  1CNQ A;  2GQ1 A;  4OVQ A;  3PMX A;  1B0L A;  4BDQ A;  2QRY A;  1LB8 A;  2QMW A;  3RQT A;  5JK4 A;  2OK2 A;  1P1Q A;  4IO5 A;  2REG A;  2OWZ A;  4XKP A;  4H46 A;  4GD5 A;  3N94 A;  1LFI A;  3K02 A;  1ZMG A;  4GF8 A;  2XXK A;  3OO7 A;  3G3F A;  5I59 A;  2O69 A;  2P0S A;  4X04 A;  1DPE A;  1NNT A;  3W9W A;  3Q26 A;  5I3S A;  1FPL A;  1YZ0 A;  3ISP A;  5CMB A;  3MP8 A;  5FBP A;  1PBP A;  4MHF A;  3W9V A;  5IZ3 A;  4R2B A;  3THI A;  4JWO A;  4Q5T A;  2QS3 A;  4F2Q A;  1SYH A;  2Y7R A;  5IM2 A;  1ZJL A;  2V3Q A;  4PF8 A;  4RXL A;  1IEJ A;  1FPK A;  2HQ0 A;  1XHY A;  3HPI A;  4NF4 B;  3E4R A;  3ODB A;  3U93 A;  4G4P A;  3KFM A;  5FHN A;  2E0S A;  1MDP 1;  1IIW A;  3SDF A;  1QW0 A;  4O3B A;  2R71 A;  3PGF A;  1USY E;  3U8Q A;  3OEK A;  2XXR A;  2FBP A;  2B65 A;  4FIM A;  3R6U A;  1NUW A;  3VVE A;  3FBP A;  4THI A;  1FPJ A;  5I56 B;  3MPL A;  4OHN A;  2ZYK A;  1IXC A;  1AMF A;  1D9Y A;  4YZZ A;  4G77 A;  1ZIU A;  4EF1 A;  4IGR A;  4MJO A;  4PAF A;  4QRZ A;  3I3V A;  3DP6 A;  4U1Z A;  2THI A;  3R7X A;  4WKM A;  4C1U A;  3LV0 A;  3QMF A;  1B46 A;  3IFC A;  3IB2 A;  1JEU A;  1KWH A;  4X1B A;  4EQ7 A;  1A7L A;  4BDL A;  3FIR A;  1EYI A;  2DDK A;  5I59 B;  4FEC A;  4PGN A;  3K1N A;  3K2D A;  1PB9 A;  4OZ9 A;  1EH3 A;  3SER A;  3A09 A;  4U4X A;  1NUY A;  2Q89 A;  2WEF A;  5DEX B;  4PFW A;  1D9V A;  4L17 A;  2F7C A;  4KHZ E;  2H25 A;  4ESW A;  4EQ9 A;  2FHY A;  3R26 A;  1MQG A;  2Z22 A;  4M1V A;  4GWS A;  1A54 A;  2XWO A;  1GVC A;  3I6V A;  1VFD A;  3BBR A;  4MEV A;  2R8T A;  4KYS A;  1IQ7 A;  1B3H A;  4KCD A;  1ZKB A;  1B3L A;  2Y5K A;  2FNC A;  4RPO A;  4U2R A;  3RGY A;  3OD7 A;  4FBP A;  2P2A A;  4X1D A;  3FXQ A;  4U4S A;  4GWO A;  3CFL A;  4NF8 B;  1LST A;  4F2O A;  1UTB A;  1YTV A;  2KR0 A;  1EZ9 A;  3EHT A;  2DS9 A;  2ZZX A;  1MM7 A;  4H45 A;  3TEL A;  1IXI A;  4NHB A;  2WYK A;  1T0K A;  1LAX A;  1NNP A;  2DXY A;  3O9P A;  5KZT A;  4LVQ A;  3S2V A;  2UVG A;  2AYS A;  4LQ2 A;  3RT6 B;  4R6Y A;  1URG A;  4HCY A;  4MCO A;  3TPA A;  1BLF A;  4MF3 A;  1ZBM A;  2ZYO A;  2HPG A;  3DEL B;  1GV8 A;  2XA5 A;  4H1X A;  3LSW A;  2X26 A;  4JXI A;  1Y3N A;  1NUX A;  3M8U A;  1MQD A;  3KBR A;  4ECF A;  4YKP A;  1RYO A;  4JVD A;  3K00 A;  3VXC A;  1CE2 A;  3B50 A;  2XXI A;  2HEU A;  1OVT A;  1LBB A;  1B51 A;  3UP9 A;  1B1H A;  3A29 A;  1AH5 A;  2M8C A;  4Q30 B;  1LBX A;  3PUZ E;  5H8H A;  4PTK A;  2OZZ A;  1B4H A;  4MAG A;  1MPC A;  3D4C A;  2Y5L A;  5CMM A;  1OVB A;  3PTY A;  1B40 A;  1I69 A;  5EHS A;  4QHQ A;  4N81 A;  1USY H;  1NH8 A;  3E79 A;  4OEV A;  4N15 A;  4OET A;  4ESX A;  3N5L A;  3TUS A;  2DWJ A;  1HSE A;  2O1L A;  4POX A;  3MZ1 A;  4YIC A;  2X7Q A;  3VE1 B;  4QSC A;  4H8J A;  3DLN A;  4IO6 A;  4AQ4 A;  3M3L A;  3TTN A;  4DI4 B;  4R73 A;  2L5V A;  1BTJ A;  1XT8 A;  1M5F A;  4BDN A;  4HE0 A;  1B5H A;  1Y3P A;  1UTB B;  3KBZ A;  3N6U A;  5LDZ A;  2DXR A;  5L9S A;  2XXT A;  2OX3 A;  1LAF E;  4KXP A;  2WX9 A;  1RKM A;  4RY1 A;  4F1Y A;  2VD2 A;  5I2N B;  4RK9 A;  2NVU B;  1XC1 A;  2RC9 A;  4RNS A;  3UIF A;  3VV5 A;  4GOT A;  2IEE A;  2Y7K A;  2A5T B;  2YPN A;  3FVO A;  2XXV A;  3V83 A;  2XXH A;  3KC1 A;  2DE4 A;  1N76 A;  1FPD A;  3KSX A;  3VLU A;  1R1N A;  4PC9 A;  2XX7 A;  1FSA A;  1PDA A;  4XFE A;  3E13 X;  3ZS6 A;  4U22 A;  3FXR A;  1FPB A;  2Q9T A;  1NUZ A;  3KG2 A;  1MQH A;  3MWB A;  4H0W A;  1KZ8 A;  2Z8D A;  3IB0 A;  3MST A;  1EU8 A;  1G0I A;  4EDP A;  3FJ7 A;  4GIZ A;  1TFD A;  2HFB A;  1IMD A;  2B3F A;  2Q74 A;  3C4M A;  3TCH A;  5DYH A;  2IA4 A;  2Y7W A;  3OSR A;  2Q8M A;  5EYF A;  2O7U A;  4MNI A;  3HO7 A;  4ISU A;  3O28 A;  4DXU A;  3PPO A;  4YMB A;  4PFR A;  1PC3 A;  4Q8R A;  3OEM A;  5EQ7 A;  3E78 A;  1GR2 A;  4YU0 A;  4C0R A;  1K9Y A;  1B5I A;  1UTH B;  5M2V A;  1YPN A;  3UGW A;  5ET7 A;  1S50 A;  2B4M A;  4PET A;  4PE3 A;  2V4C A;  3QUF A; 
#chains in the Genus database with same CATH homology
 3U94 A;  1M5D A;  1POT A;  3MJN A;  1B2H A;  3G3G A;  2VGQ A;  4RA1 A;  4X9T A;  1Y20 A;  2Q2A A;  4YKK A;  2DVC A;  2DE3 A;  3H03 A;  4F3B A;  4NTL A;  3V8X B;  2P1S A;  1JW5 A;  5HBC A;  1YAE A;  1SD3 A;  2VP1 A;  1FQF A;  3JV9 A;  5ISU A;  3IOV A;  1Y4C A;  1MY1 A;  3CVG A;  1XVY A;  2DQV A;  5JEI A;  1XOC A;  1P1W A;  2HAU A;  3IJO B;  3T22 A;  4H6D A;  3TTR A;  1JQF A;  4YB7 A;  1MQJ A;  4Z7E A;  3ECR A;  1P1U A;  2VOZ A;  1QKB A;  4WXJ A;  4DZ1 A;  4GLI A;  3UOR A;  2QPQ A;  3K1P A;  3L6G A;  4OER A;  4YB6 A;  1N84 A;  3TKD A;  3IOW A;  4DE8 A;  5DTB A;  5F7V A;  3K6U A;  3CFZ A;  3K1M A;  3CIJ A;  1MXX A;  2NXO A;  2ANJ A;  4NMY A;  4KCC A;  1B4Z A;  1N0T A;  3LC8 A;  3Q27 A;  1JEV A;  4LON B;  4GL0 A;  1H44 A;  4FEB A;  5DT6 A;  2NWJ A;  3CFX A;  3CG1 A;  3MVY A;  4NF6 B;  1O64 A;  4QF9 A;  4IO3 A;  1PB7 A;  2D21 A;  5IAI A;  3TTM A;  3I5O A;  2RIN A;  5CM6 A;  3G3K A;  5EHM A;  5DVJ A;  2ZNS A;  4QFO A;  1Y1Z A;  4G68 C;  1NH7 A;  2BJJ X;  3PD8 A;  1IUD A;  3DM0 A;  4KR5 A;  1B32 A;  3LSF B;  2Y7I A;  3C34 A;  3MVW A;  2NUV A;  1LGB C;  4N07 A;  2PT2 A;  3DP4 A;  5A5X A;  2I49 A;  1P99 A;  3SEX A;  1Z7M E;  4H5G A;  2E1S A;  3FJM A;  3IL1 B;  5I84 A;  3LBS A;  4P0G A;  4R72 A;  4TLL B;  3TCF A;  4N13 A;  5I58 A;  4LQ5 A;  3E3K A;  3TOD A;  2OWS A;  5AE4 A;  2F5X A;  1ANF A;  3N6T A;  1IXG A;  4NWD A;  3C9H A;  1N3W A;  3FUZ A;  1MXY A;  5LOM A;  4XTC Q;  5TPA A;  2Q8J A;  3UK4 A;  2NOO A;  1MXV A;  2ABH A;  4F3P A;  3GLB A;  3GXA A;  1MRP A;  5KDT A;  1PBQ A;  4E0W A;  4C1T A;  4RPN A;  4G8N A;  1O63 A;  1FTL A;  4R9F A;  1URS A;  2PT1 A;  4R2F A;  2Z8F A;  4NF5 A;  4F22 A;  2QSX A;  1B7U A;  4OXV A;  2RCA A;  1N04 A;  4HTG A;  4I62 A;  3G3H A;  4ZZE A;  1SI0 A;  4GQO A;  1B0H A;  3VDF A;  3ONM A;  4G8H A;  1B5J A;  4IB2 A;  3IJX B;  5ITP A;  1LCF A;  2FA7 A;  2LAO A;  3KOS A;  5FTH A;  4JDF A;  1OMP A;  4OFJ A;  3DP8 A;  3KSJ A;  1M5E A;  2AIX A;  4F31 B;  2O1M A;  3ZKK A;  4F3G A;  2ZNU A;  4ZEB A;  1JNF A;  3EQ1 A;  2PMS A;  1ATG A;  4NED A;  1MY0 A;  3PMV A;  1NFT A;  5H8S A;  1AIV A;  1TWY A;  4JWX A;  4TOZ A;  3TTL A;  4JB7 A;  1MXU A;  3KN3 A;  2ONR A;  5ELV A;  4FAT A;  2QS4 A;  3USD A;  1NMU A;  4FOR A;  4KPT A;  4Z0I A;  2DWI A;  1US5 A;  4BDM A;  3H06 B;  1SBP A;  4EXL A;  1JET A;  1SW2 A;  3IO6 A;  3RN8 A;  2O84 X;  4LP2 B;  5TPA B;  3QAX A;  3CRB A;  4OES A;  4KI0 E;  4I8C A;  1DPP A;  3HHG A;  4F29 A;  1O7T A;  1EZO A;  3EPE A;  1VE4 A;  4F39 A;  3MVZ A;  2Y84 A;  4MLQ A;  2V3U A;  3RY3 A;  5HM4 B;  2ALU A;  3BFT A;  2HXW A;  3O2A A;  3CSG A;  1B6H A;  5DVF A;  2GHB A;  5AA2 A;  3EN3 A;  1NKX A;  4R9G A;  3MUQ A;  4M4G A;  3PUW E;  4ND9 A;  1SI1 A;  4R6H A;  1R6Z A;  4MLV A;  3V89 B;  4R6K A;  3QXM A;  1LAG E;  1FQB A;  1N7W A;  5TP9 A;  3CG3 A;  1EZP A;  3SEW A;  2XX9 A;  1ZU0 A;  4F3S A;  3Q28 A;  2XXQ A;  4YAH X;  1JVY A;  4AB5 A;  4POW A;  3MP6 A;  4ZEF A;  1JVX A;  1LAH E;  4ZEI A;  3WAE A;  1I6Q A;  5ICQ A;  2V93 A;  3MZB A;  3L6H A;  4YMA A;  3KOT A;  3IR1 A;  1FCK A;  3U1O A;  5I2K A;  1FTO A;  2Y7P A;  2I4B A;  4IY6 A;  5H8F A;  1FQD A;  1UQW A;  4U23 A;  2O6A A;  5CMC A;  3G7W A;  2PVU A;  3K01 A;  4GXS B;  1OIB A;  1B05 A;  3S9M C;  1Y1M A;  3O29 A;  4OYV A;  1PB8 A;  1QJM A;  2XXU A;  3KZG A;  3JZJ A;  3BFU A;  2GH9 A;  5K2Y A;  3OO6 A;  4JSO A;  1A55 A;  3IB1 A;  4F1U A;  3LSX A;  3HST A;  1JW1 A;  2REJ A;  3H6V A;  3H3G A;  4OQO A;  2ONK E;  1D4N A;  5H8H B;  1D3K A;  2F78 A;  3MPK A;  1FTK A;  2UVI A;  4EXK A;  3C33 A;  3IOU A;  3H7M A;  3EHU A;  2R6G E;  4JSD A;  2XD3 A;  4DXC A;  2RC7 A;  1SVX B;  3FVG A;  4QFK A;  1R9Q A;  4PFY A;  4ONY A;  2OJT A;  4G68 A;  4GFR A;  4P0I A;  2R9J A;  2DOJ A;  5H8Q A;  1B9J A;  1MH4 A;  4MH5 A;  2I0B A;  2I3W A;  4OFL A;  3ZKL A;  2B3B A;  2F34 A;  5AA2 D;  3VVD A;  4QSD A;  1F9B A;  2F6P A;  2PX1 A;  1OLC A;  3C31 A;  1A40 A;  3FJG A;  1A99 A;  5L9M A;  5AA4 A;  4DXB A;  1H45 A;  2H4I A;  1OQH A;  4BDO A;  1Z7N E;  2H9B A;  2G29 A;  4OWD A;  4YB5 A;  5I2K B;  3RLF E;  4GVO A;  5H8F B;  4QFP A;  4YKI A;  1SW4 A;  4KQP A;  3G3J A;  2F36 A;  1ZTY A;  3MBP A;  2OCU A;  3TEP A;  2HZL A;  1MS7 A;  4EUO A;  3RT8 A;  3MC2 A;  1MH3 A;  2XXW A;  1GTK A;  3SET A;  2YJP A;  3VLV A;  3RPW A;  1L5T A;  1LBC A;  2UVH A;  1SW1 A;  3OSQ A;  3KN8 A;  5L9O A;  2OLB A;  2X7P A;  1VFE A;  3PUX E;  2F35 A;  3RTF B;  4E0X A;  3TYH A;  3IK6 B;  1DMB A;  1MXZ A;  3OOA A;  3OEL A;  3CI8 A;  3K6W A;  3MW0 A;  4TLM B;  5DVI A;  1QVS A;  3KGC A;  3UA8 A;  4LA9 A;  3PPR A;  4NE4 A;  1PEB A;  5H8Q B;  3PPN A;  1Y4T A;  2I48 A;  1BP5 A;  1J1N A;  1LB9 A;  1UIV A;  5H8N A;  1UIU A;  5JTY A;  5CBR A;  4FJP A;  3UN6 A;  3FAS A;  2D3I A;  2OBG A;  4ELQ A;  1SQY A;  3QSL A;  1LLS A;  3HV1 A;  4OMB A;  5KCJ A;  2I6E A;  3LR1 A;  5B70 A;  3TMG A;  2V3T A;  4DDD A;  3B6T A;  5AA4 B;  2QJE A;  1B3G A;  5I56 A;  1SDX A;  1AL3 A;  2OWT A;  4FED A;  1A8F A;  3O97 A;  1HSL A;  3PUV E;  3BKI B;  4H67 A;  4HW8 A;  5CC2 A;  2QMX A;  1FTM A;  4P11 A;  1B3F A;  4KD5 A;  1Y9U A;  3QUJ A;  4GXA A;  3MZ9 A;  3IAZ A;  1OQG A;  1SW5 A;  1LCT A;  3TCG A;  1B7Z A;  2QS2 A;  2AL5 A;  1P1N A;  4UA8 A;  3F11 A;  1R9L A;  4BLA A;  1NL5 A;  4ZE8 A;  3P7I A;  3S9N C;  4BDR A;  2V84 A;  3T9X B;  3CSB A;  3OO8 A;  3TDJ A;  3TZA A;  5DEX A;  3A3U A;  1H43 A;  5TU0 A;  1AOV A;  4O3A A;  3PD9 A;  1POY 1;  3Q29 A;  4ZZA A;  3IOT A;  2HZK A;  2XXX A;  2ZXT A;  4DLD A;  3GBA A;  1MDQ A;  3C32 A;  3GZG A;  3WAF A;  1XS5 A;  4ELO A;  5H8N B;  5JTY B;  2FYI A;  4GRK A;  1LFG A;  1ZLQ A;  3FVN A;  2CMO A;  3LSL A;  4OEN A;  3EHS A;  1B1X A;  1URD A;  5KCJ B;  4OTE A;  2H98 A;  5J1D A;  1MPB A;  2Z8E A;  4NF8 A;  3JYR A;  1TFA A;  3VVF A;  1Y3Q A;  3MVX A;  3KEI A;  2DE2 A;  4OVJ A;  2I58 A;  5B7D A;  3K4U A;  2ZNT A;  3SEY A;  2YLN A;  2QS1 A;  3SEU A;  3PUY E;  3O6G A;  3TQL A;  3B6Q A;  1H76 A;  2DSF A;  1HSJ A;  2WKY A;  1MY4 A;  2HCA A;  2RC8 A;  3S4U A;  3HCQ A;  1BKA A;  3MAM A;  4GL8 A;  3RNN A;  4R74 A;  3Q25 A;  4HS7 A;  3KN7 A;  1Q1K A;  2I0C A;  1N3X A;  4XKN A;  5ITO A;  5A5X B;  3KJ7 A;  5ICT A;  4QSE A;  2H5Y A;  1CB6 A;  1QUI A;  4ZDM A;  3C36 A;  4G2Z A;  4RYA A;  2I4C A;  4NWC A;  4XXU A;  4KFQ A;  1RYX A;  5CMK A;  3N26 A;  4QFL A;  1M5B A;  1B58 A;  1QKA A;  2F97 A;  5I58 B;  1IIT A;  3TTK A;  1H3D A;  1MQI A;  1DSN A;  1BIY A;  4ZEC A;  4O3C A;  4I9D A;  4DIG A;  4MBP A;  1QUJ A;  4PFT A;  1II5 A;  3ILU B;  1TXF A;  3TAJ A;  3T66 A;  3OXN A;  3CR9 A;  1FQE A;  1FQC A;  5KDT B;  3QK6 A;  2G93 A;  3S9E A;  3H4Z A;  1B7H A;  1MXW A;  2AL4 A;  1FTJ A;  3T9H B;  3MP1 A;  2GHA A;  5I2N A;  5I57 A;  2F6G A;  4LZ7 A;  4EF2 A;  4H5F A;  4XKR A;  4NF5 B;  2A5T A;  1M5C A;  3GBB A;  1IZ1 A;  5CBS A;  3VXB A;  2DWH A;  1S9T A;  4R75 A;  1I6A A;  4FE8 A;  5K2X A;  4EQB A;  3MQ9 A;  2W7Y A;  4RJZ A;  3G3I A;  4LAT A;  3ZSF A;  3QYT A;  2ONS A;  3OO9 A;  3K0V A;  3RTW B;  2D5W A;  4QFN A;  4YKJ A;  1US4 A;  4IGT A;  4U21 A;  4TQU Q;  2XHD A;  1OLA A;  3FD3 A;  2O68 A;  4WED A;  3PU5 A;  3IOR A;  1JW4 A;  2VHA A;  4ZS9 A;  1DOT A;  2A5S A;  4FAJ A;  2F7A A;  4IO4 A;  2VD3 A;  1VR5 A;  4MFI A;  4N6P A;  4UAC A;  5FTI A;  2Q2C A;  4ELP A;  2XX8 A;  4ELR A;  4PP0 A;  3FXU A;  2F8D A;  1UTH A;  3U92 A;  3AXF A;  4F1V A;  1WVJ A;  3ILT B;  2DP8 A;  5IKB A;  3IO4 A;  4WEP A;  2F7B A;  4XKQ A;  3D4G A;  2XD2 A;  5I57 B;  2ZYM A;  2I3V A;  5BWJ A;  4F18 A;  1WDN A;  1MY3 A;  4DCY A;  2V25 A;  3PPP A;  3SKP A;  5AA2 B;  2XXY A;  4F19 A;  1DTG A;  2XXP A;  5AA1 A;  2KLF A;  2ZMB A;  1N7X A;  2ESN A;  4DCX A;  4LUB A;  4IO2 A;  5TP9 B;  1FQA A;  4HCW A;  3M3F A;  4LZ8 A;  3H6U A;  2Z23 A;  5F1Q A;  2GFE A;  3PV0 E;  3E9X A;  2PYY A;  3FV1 A;  1S7Y A;  1YCJ A;  2RF1 A;  3IX1 A;  3RUM A;  3SEV A;  1QUK A;  1I6B A;  2DWA A;  3VLW A;  5HPQ A;  1MY2 A;  3B7D A;  4OFO A;  4H65 A;  4IY5 A;  3FGS A;  2DVZ A;  3VFJ A;  2Q88 A;  2UXA A;  4JBZ A;  2GRV A;  3LUY A;  3HHF A;  1B52 A;  1NNK A;  1DTZ A;  4LZ5 A;  1GGG A;  3EF7 A;  4K3F A;  1MG1 A;  2UVJ A;  4X48 A;  2UYF A;  4U1O A;  4IO7 A;  3M3K A;  4PFU A;  4PE5 B;  5CRY A;  2H99 A;  2HAV A;  4RK2 A;  3FAT A;  3O6H A;  5L8D A;  3OEN A;  1P1O A;  1Q35 A;  4G8M A;  3PMW A;  4NF6 A;  2QL3 A;  2DYX A;  3SES A;  5CI5 A;  3FV2 A;  3A3C A;  1ELJ A;  5AA3 A;  1B3E A;  3H6T A;  4ZED A;  3O66 A;  3B6W A;  4AB6 A;  3PPQ A;  2PBW A;  3FZV A;  4XIG Q;  4KYE A;  3H6W A;  1A8E A;  4G68 B;  3OMB A;  1XVX A;  1VSO A;  3FVK A;  3U72 A;  3KJT A;  1MM6 A;  2O7I A;  4NF4 A;  3T9U A;  2RKM A;  5FHM A;  1QUL A;  3V5A A;  3TQW A;  1MPD A;  1NNF A;  5FHO A;  4I1D A;  3O6I A;  3QIM A;  4ZEK A;  2O51 A;  2CZL A;  4PQJ A;  4ZE9 A;  4H8I A;  5BUU A;  4KYD A;  3HN0 A;  2ZYN A;  3C35 A;  1LFH A;  3TFL A;  3T93 B;  2UYE A;  4OEU A;  3W15 C;  4JWY A;  3T96 B;  3S9L C;  1FW0 A;  3K6V A;  3T9V A;  3K6X A;  2RCB A;  1TT1 A;  1SYI A;  1WOD A;  4Q0C A;  1IXH A;  3PMX A;  1B0L A;  4BDQ A;  2QRY A;  1LB8 A;  2QMW A;  3RQT A;  5JK4 A;  2OK2 A;  1P1Q A;  4IO5 A;  2REG A;  4XKP A;  4GD5 A;  3N94 A;  1LFI A;  3K02 A;  1ZMG A;  4GF8 A;  3OO7 A;  3G3F A;  5I59 A;  2O69 A;  2P0S A;  1DPE A;  1NNT A;  3W9W A;  3Q26 A;  5CMB A;  3MP8 A;  1PBP A;  3W9V A;  4R2B A;  3THI A;  4JWO A;  4Q5T A;  2QS3 A;  4F2Q A;  1SYH A;  2Y7R A;  1ZJL A;  2V3Q A;  4RXL A;  1IEJ A;  2HQ0 A;  1XHY A;  3HPI A;  4NF4 B;  3E4R A;  3ODB A;  3U93 A;  4G4P A;  3KFM A;  5FHN A;  2E0S A;  1MDP 1;  1IIW A;  3SDF A;  1QW0 A;  4O3B A;  2R71 A;  3PGF A;  1USY E;  3U8Q A;  3OEK A;  2XXR A;  2B65 A;  4FIM A;  3R6U A;  3VVE A;  4THI A;  5I56 B;  3MPL A;  4OHN A;  2ZYK A;  1IXC A;  1AMF A;  1D9Y A;  4YZZ A;  4G77 A;  1ZIU A;  4EF1 A;  4IGR A;  4QRZ A;  3I3V A;  3DP6 A;  4U1Z A;  2THI A;  3R7X A;  4WKM A;  4C1U A;  1B46 A;  3IB2 A;  1JEU A;  1KWH A;  4X1B A;  4EQ7 A;  1A7L A;  4BDL A;  3FIR A;  5I59 B;  4FEC A;  3K1N A;  3K2D A;  1PB9 A;  4OZ9 A;  1EH3 A;  3SER A;  3A09 A;  4U4X A;  2Q89 A;  5DEX B;  4PFW A;  1D9V A;  4L17 A;  2F7C A;  4KHZ E;  2H25 A;  4ESW A;  4EQ9 A;  3R26 A;  1MQG A;  2Z22 A;  4M1V A;  1A54 A;  1GVC A;  3I6V A;  1VFD A;  3BBR A;  4KYS A;  1IQ7 A;  1B3H A;  4KCD A;  1ZKB A;  1B3L A;  2FNC A;  4RPO A;  4U2R A;  3RGY A;  3OD7 A;  2P2A A;  4X1D A;  3FXQ A;  4U4S A;  4GWO A;  3CFL A;  4NF8 B;  1LST A;  4F2O A;  1UTB A;  1YTV A;  1EZ9 A;  3EHT A;  2DS9 A;  1MM7 A;  3TEL A;  1IXI A;  1T0K A;  1LAX A;  1NNP A;  2DXY A;  3O9P A;  5KZT A;  4LVQ A;  3S2V A;  2UVG A;  2AYS A;  4LQ2 A;  3RT6 B;  4R6Y A;  1URG A;  4HCY A;  3TPA A;  1BLF A;  4MF3 A;  1ZBM A;  2ZYO A;  3DEL B;  1GV8 A;  4H1X A;  3LSW A;  2X26 A;  4JXI A;  1Y3N A;  3M8U A;  1MQD A;  3KBR A;  4ECF A;  4YKP A;  1RYO A;  3K00 A;  3VXC A;  1CE2 A;  2XXI A;  2HEU A;  1OVT A;  1LBB A;  1B51 A;  3UP9 A;  1B1H A;  1AH5 A;  2M8C A;  4Q30 B;  3PUZ E;  5H8H A;  2OZZ A;  1B4H A;  1MPC A;  3D4C A;  5CMM A;  1OVB A;  1B40 A;  1I69 A;  5EHS A;  4QHQ A;  1USY H;  1NH8 A;  4OEV A;  4OET A;  4ESX A;  3N5L A;  3TUS A;  2DWJ A;  1HSE A;  2O1L A;  4POX A;  3MZ1 A;  4YIC A;  2X7Q A;  3VE1 B;  4QSC A;  4H8J A;  3DLN A;  4IO6 A;  4AQ4 A;  3M3L A;  3TTN A;  4R73 A;  1BTJ A;  1XT8 A;  1M5F A;  4BDN A;  1B5H A;  1Y3P A;  1UTB B;  3N6U A;  2DXR A;  5L9S A;  2XXT A;  1LAF E;  1RKM A;  4RY1 A;  4F1Y A;  2VD2 A;  5I2N B;  4RK9 A;  2NVU B;  1XC1 A;  2RC9 A;  4RNS A;  3UIF A;  3VV5 A;  4GOT A;  2IEE A;  2Y7K A;  2A5T B;  2YPN A;  3FVO A;  2XXV A;  3V83 A;  2XXH A;  2DE4 A;  1N76 A;  3KSX A;  3VLU A;  1R1N A;  2XX7 A;  1PDA A;  3E13 X;  3ZS6 A;  4U22 A;  3FXR A;  2Q9T A;  3KG2 A;  1MQH A;  3MWB A;  4H0W A;  2Z8D A;  3IB0 A;  1EU8 A;  4EDP A;  3FJ7 A;  4GIZ A;  1TFD A;  2HFB A;  2B3F A;  3C4M A;  3TCH A;  5DYH A;  2IA4 A;  2Y7W A;  3OSR A;  5EYF A;  2O7U A;  3HO7 A;  4ISU A;  3O28 A;  4DXU A;  3PPO A;  4YMB A;  1PC3 A;  4Q8R A;  3OEM A;  1GR2 A;  4YU0 A;  4C0R A;  1B5I A;  1UTH B;  5M2V A;  1YPN A;  3UGW A;  1S50 A;  4PET A;  3QUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...