3SEUA

Zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form iii)
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
366
structure length
366
Chain Sequence
EGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 125
structure length 366
sequence length 366
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3seuA01
2REJA 4OFLA 2OK2A 2F6GA 3RQTA 1QVSA 3O28A 3IJXB 3VLVA 1A40A 4OTEA 4ESXA 1LFGA 4H0WA 4N07A 4ND9A 2RF1A 4Q30B 5F1QA 1TWYA 4ONYA 1R6ZA 1QW0A 3OD7A 1B3HA 1IEJA 2QRYA 1MH4A 5I57A 1MG1A 3Q28A 1FQCA 3V8XB 3FATA 1KWHA 4EF2A 1URDA 2YJPA 1QJMA 4R2FA 4R9FA 1I69A 4N13A 4BDQA 5FHMA 2DWAA 2RC8A 1YTVA 2HXWA 1MS7A 5AA4B 3A09A 3V5AA 2B3FA 3PUYE 4PE5B 4MLVA 2HZLA 3DP8A 3G3HA 2I49A 4RJZA 3EHTA 3H06B 4OZ9A 3K01A 4ZE9A 3TODA 3PGFA 4DXCA 4C0RA 2IA4A 2NVUB 4Z0IA 3QK6A 4KYEA 4QSCA 2Q89A 4QHQA 2F5XA 5KZTA 3OSQA 2V3QA 2V25A 1Y20A 3CSBA 4OFOA 1Q1KA 2P2AA 1IXCA 2XXHA 4OXVA 1JW1A 2A5SA 3GBBA 2DE4A 5DVFA 4ZZAA 4RXLA 5H8HB 1WODA 2QJEA 1P1UA 4GF8A 2PVUA 2R6GE 2AL4A 1UTBB 2O7IA 4F3GA 4OEUA 3MP1A 1OIBA 2ZYKA 2Q88A 4R75A 3D4GA 2VP1A 3KN7A 4QSDA 4GD5A 1SI1A 5HM4B 1MXUA 1MRPA 1P1NA 4NEDA 2NXOA 5BUUA 2DVCA 1MH3A 5FHOA 2YLNA 3N5LA 3T9XB 5EYFA 4DCYA 3E3KA 1B32A 4LATA 3EHUA 4HS7A 2VOZA 4O3BA 4JSDA 1BIYA 1A55A 1EU8A 3QXMA 3JZJA 5L9MA 1SW2A 4FE8A 3VE1B 2F36A 1NNTA 2F7AA 4H65A 3U72A 1NL5A 1R9QA 3O6IA 4PP0A 3B6QA 4GIZA 3M3KA 5I56A 3IO4A 1AOVA 3PMXA 4P11A 3P7IA 4EXLA 5CMKA 4FJPA 3EF7A 3GZGA 2DOJA 3HPIA 2DSFA 1MDP1 4MH5A 3K2DA 2PYYA 5ICQA 1JEUA 1MDQA 1JW5A 3HN0A 3H6VA 3HV1A 1B52A 4RNSA 2Q8JA 4IO5A 2I58A 1N3XA 5ISUA 5TU0A 1US4A 1MXWA 3TYHA 5CMCA 2O6AA 2GH9A 2UYFA 3S9NC 2AL5A 4Q0CA 1N84A 4KD5A 4LP2B 1TXFA 2Z8EA 3QAXA 4I1DA 2Y7WA 4OEVA 2I3VA 4KYDA 4IY5A 4GL0A 2UXAA 4MBPA 3G3IA 5I56B 4OYVA 1LAGE 2HAVA 3MAMA 3FJMA 3L6GA 1MY4A 1B7UA 4U22A 4C1TA 4YU0A 3Q26A 4H8JA 1VFDA 2F34A 1FQAA 1Y3PA 1YAEA 3G3JA 3RTWB 4KHZE 3CFLA 5IKBA 4EQBA 4UA8A 5EHSA 3VXCA 4LZ8A 3IO6A 4LZ5A 4GLIA 5HPQA 4C1UA 1OQGA 4X48A 1QUJA 4ECFA 3OEKA 1JNFA 2BJJX 1MY3A 4IO3A 5CC2A 2XHDA 4YAHX 2DWIA 3CRBA 1UTHA 2OWSA 4OMBA 4X1BA 4RYAA 4EDPA 3V83A 3FJGA 3RY3A 1DSNA 1ZTYA 5IAIA 3K0VA 3QUFA 1P1WA 2A5TA 3RT8A 2ZYNA 2Q2CA 4NF6A 3R26A 1H43A 3SESA 5KCJA 1OVBA 4R2BA 1B4HA 4DCXA 1XC1A 1PBPA 3TTLA 1M5DA 3K02A 2FA7A 2DWHA 2XX9A 2DS9A 3FJ7A 4U4SA 3Q29A 5K2XA 4ZE8A 3MC2A 3O6GA 3ODBA 4DLDA 1IXIA 4F19A 3MP6A 3HHFA 2Y7IA 3OXNA 1N04A 3T9UA 5CM6A 4LUBA 1MQIA 1ZIUA 1B0HA 1B40A 3E13X 1MXZA 4R72A 5I59B 2P1SA 2X26A 5I2NB 1UTHB 2Q2AA 1MY1A 2DXYA 3MZ1A 1FQFA 2RINA 3FXQA 1QKBA 4R6KA 1Y1ZA 3KN3A 1GV8A 2A5TB 4IO4A 4PFWA 1ANFA 2Z22A 1B7ZA 2XXIA 1FW0A 2GHBA 2G29A 3OEMA 4XKPA 3UGWA 4F1YA 5L9SA 4XXUA 1II5A 4F39A 1OQHA 3MVZA 3TUSA 4QFLA 3W9WA 3PUZE 1PC3A 4QFKA 3EPEA 1B3LA 1WDNA 1MPDA 4OWDA 1IQ7A 3FIRA 1D9VA 1LLSA 1EZPA 1EZOA 3USDA 2XXPA 3R6UA 2XX7A 4OFJA 2RCBA 3K6UA 2G93A 3C32A 2ZNUA 3PPOA 3L6HA 5AA2B 1USYH 5TPAA 1XVYA 3RN8A 4JDFA 5DYHA 4DIGA 2XXXA 2OLBA 3MZBA 2RKMA 5H8NB 2D3IA 1L5TA 1NH7A 4YMBA 3U1OA 3B6WA 4ELOA 3KOTA 4F1UA 2XXVA 1TFAA 3LBSA 4H6DA 1US5A 3M3LA 4OERA 3SKPA 1JETA 3O2AA 3O97A 1PB8A 1JEVA 2QS4A 2LAOA 1H76A 5I58A 4G68B 1XT8A 3GXAA 3FXUA 3SEYA 2ZNTA 3VVDA 2ZYOA 4R74A 1B5HA 4E0WA 2Y7RA 4ZZEA 4NMYA 5FTHA 4U23A 1D3KA 3IR1A 3E4RA 4HCYA 2F97A 1B0LA 1Y4CA 1ZMGA 4EUOA 3HCQA 1Q35A 3ZSFA 2Z8DA 1P99A 1B58A 1O63A 5TPAB 4TLMB 1Z7ME 2O1MA 5JTYA 4XKRA 3KGCA 1NMUA 3TFLA 3CSGA 3U92A 4WEDA 3D4CA 3HSTA 3W9VA 1UQWA 3KJ7A 3GBAA 4YICA 3CIJA 3MVXA 3ZS6A 4G8NA 1EZ9A 3PMVA 4LZ7A 2ONSA 4K3FA 1SVXB 3KFMA 4BDRA 3QSLA 4PQJA 3S9LC 3KZGA 3U8QA 1CB6A 5F7VA 3IOWA 4U4XA 4MLQA 4YKKA 5I57B 3MBPA 2F7BA 3H7MA 2E0SA 4GOTA 4F2OA 4MFIA 2OBGA 4M1VA 1NKXA 3VLWA 3TTRA 5BWJA 3IORA 5B70A 1SW5A 4IO7A 1SDXA 4THIA 4PFTA 4YB6A 3UORA 3O6HA 3UP9A 1SBPA 3FV2A 4NF4A 2Y7PA 4DDDA 1B9JA 1FTMA 1J1NA 3H6WA 4KYSA 1XS5A 4FORA 4YKJA 4F18A 4NWDA 2IEEA 2O69A 5JTYB 5CRYA 1QUIA 3G3FA 3GLBA 2DE3A 1TFDA 2CZLA 4LQ5A 3T93B 5ELVA 1Y3QA 1JQFA 4U2RA 2VD2A 1D4NA 4OVJA 1ATGA 1H45A 4ZEBA 1PDAA 3DP6A 3TEPA 4JWOA 3CG3A 4QFOA 1SYIA 4POXA 3FVNA 4JSOA 4F29A 1MY2A 2NUVA 4JB7A 1B6HA 3LSXA 2VHAA 1MPBA 3MWBA 4OENA 3KN8A 3PUVE 4G68C 2ZYMA 3V89B 4GXSB 4I62A 4PFUA 2RC9A 3I6VA 2HCAA 5JK4A 3RUMA 2O84X 4H5GA 4GQOA 2B65A 3M8UA 1MXXA 4U1ZA 1ZBMA 1T0KA 5I2KA 4H67A 3I3VA 1B1XA 3TTNA 1FTKA 4O3AA 1F9BA 4LQ2A 3JYRA 2ZXTA 1S50A 2DE2A 2Z8FA 3IB0A 4R9GA 1B3EA 4YKIA 4Q5TA 5AA1A 4H1XA 4QSEA 3DM0A 3MP8A 4QRZA 2V3TA 1M5CA 4NWCA 5EHMA 4AB6A 3OO8A 3FVOA 4FEDA 3FV1A 5ICTA 2XXRA 3CFZA 3FGSA 3W15C 2GFEA 4IY6A 2I48A 1FTLA 3K6XA 1PB9A 4ELRA 3A3CA 4DXBA 1B5IA 3K1MA 1FTJA 3DELB 3S9MC 3PMWA 3VV5A 4R6YA 3T22A 1N76A 3WAEA 1UIUA 1LB9A 1I6AA 1R1NA 3DLNA 5I2KB 2XX8A 4EQ9A 3KEIA 2H25A 4IGTA 4YB5A 1A8EA 3CI8A 3TTKA 1WVJA 3PV0E 4KPTA 5K2YA 3IB1A 4ZECA 1LAHE 2H98A 1POY1 1B2HA 1N7WA 4I8CA 3TKDA 1RYOA 2O1LA 4HTGA 3K4UA 1P1OA 1B46A 3K1NA 3AXFA 4WXJA 3O29A 3UN6A 3FZVA 2P0SA 1FQBA 3IOUA 1LSTA 5KDTA 2XXWA 3QIMA 5H8FA 5CMMA 4KR5A 3KJTA 3TTMA 3FD3A 2O7UA 2ONRA 1MY0A 1LFIA 1URGA 3RTFB 4ZDMA 1IIWA 2REGA 4XIGQ 2F35A 3IJOB 4G77A 1OVTA 2GHAA 5CBSA 3OO9A 4FIMA 3MPLA 5CI5A 1MM6A 1DOTA 1A7LA 3KOSA 1B3FA 4ESWA 2CMOA 1POTA 4HW8A 1USYE 3BKIB 3UIFA 5AA3A 2H5YA 1QULA 2O51A 4QFNA 4G8MA 1SW1A 4MF3A 4M4GA 3C33A 3IX1A 4KCDA 4NF6B 5B7DA 5KCJB 3CG1A 2Y84A 1GGGA 1Y4TA 3R7XA 1B4ZA 4TQUQ 2QS2A 2R9JA 2V3UA 4BDLA 5KDTB 4RA1A 2KLFA 3OENA 4EXKA 5LOMA 5AE4A 4KFQA 3FASA 1MQJA 2D5WA 1DMBA 4YKPA 4RK9A 4EF1A 3PD8A 5FTIA 1QKAA 2UVIA 3SEUA 1NNKA 3PPQA 4JWYA 3C36A 3N6TA 3HHGA 2ANJA 2WKYA 1NFTA 3EQ1A 3VLUA 3OO6A 5AA4A 1DPPA 2HAUA 4H8IA 4KQPA 2DWJA 4AB5A 3U93A 3PPRA 1MXYA 2ESNA 3CR9A 1PEBA 4KCCA 3E9XA 1Y1MA 2H4IA 4NF8A 3TAJA 4U1OA 4FATA 1R9LA 2D21A 4WEPA 1AMFA 3TCFA 4F3PA 2XXQA 3C31A 4QFPA 1FCKA 5CMBA 1GTKA 1P1QA 3SEWA 3UK4A 2AYSA 1N0TA 2OZZA 2UVJA 1ZKBA 3TQWA 4DZ1A 1BTJA 4Z7EA 4JWXA 2XXUA 3U94A 4BDNA 5H8HA 1OLAA 2DXRA 3LSFB 3TDJA 3IB2A 4IO6A 4R6HA 1UTBA 1LCFA 3B7DA 2R71A 5FHNA 3F11A 4OQOA 3HO7A 5DVJA 4XKQA 1B5JA 3Q25A 2QS3A 2Q9TA 1CE2A 3T9HB 1Z7NE 1Y3NA 2PT1A 2XD2A 2OJTA 1LBBA 3PPNA 3RLFE 4GL8A 4ZEFA 4NF8B 1ELJA 3I5OA 1LFHA 2ABHA 1TT1A 2QMXA 1QUKA 5A5XA 3MVWA 1VR5A 4LVQA 3SEVA 2UVGA 3T66A 1M5BA 3MZ9A 5I58B 3TPAA 1YPNA 2V93A 2UYEA 3MUQA 4DXUA 3C9HA 3TZAA 3TCGA 1M5EA 3H6UA 3K00A 3G7WA 4BLAA 3ZKKA 3SDFA 1XVXA 3T9VA 3MVYA 4L17A 4U21A 3KBRA 4N6PA 1SW4A 3BBRA 3VDFA 1DTZA 1A8FA 3H4ZA 3C4MA 2YPNA 3H03A 1LBCA 1XOCA 4PFYA 2F8DA 5I84A 3ZKLA 3IAZA 3OELA 4GFRA 2V84A 2PT2A 1UIVA 5DEXA 3G3GA 3BFTA 4GXAA 1BLFA 2ALUA 4UACA 5A5XB 4P0GA 2HQ0A 2I4BA 4GRKA 4YZZA 1FQEA 2AIXA 5TP9A 2DP8A 1RYXA 3ILTB 2ONKE 3K6VA 1SI0A 3PPPA 3QYTA 1FQDA 3FVGA 2I0CA 4F3SA 5ITOA 4ELPA 1S9TA 3IOTA 2Y7KA 3BFUA 3LR1A 1PB7A 4NF4B 1ZJLA 2DQVA 2DYXA 3M3FA 4RPNA 3THIA 3VXBA 4X9TA 4OESA 1B3GA 3N6UA 2ZMBA 2XXYA 4F22A 4OHNA 3O9PA 3LSWA 1HSLA 2HEUA 4NF5A 2NOOA 3C35A 3VFJA 2QL3A 3IL1B 1VSOA 3OMBA 3ILUB 1I6BA 4ZEKA 2HFBA 3K1PA 1B51A 2HZKA 1HSJA 5L8DA 4BDMA 4G8HA 2QS1A 4X1DA 5DEXB 3C34A 3OO7A 1AIVA 3MPKA 2F6PA 3TQLA 3LSLA 4F2QA 4YMAA 3H6TA 1I6QA 3TMGA 3IK6B 3WAFA 1IXHA 5TP9B 4G2ZA 3UA8A 5HBCA 1BKAA 2ZNSA 4ZS9A 2XD3A 4F3BA 1O64A 4IGRA 1LCTA 4ZEIA 2VGQA 1SD3A 2X7QA 3PD9A 4EQ7A 1MQHA 4G4PA 5AA2D 1YCJA 4I9DA 3TELA 3KG2A 4BDOA 1SQYA 3O66A 1NNFA 5H8QA 2QMWA 3TCHA 5ITPA 3RNNA 1VFEA 5CBRA 1VE4A 1IXGA 1URSA 1N7XA 2I3WA 1GVCA 3VVEA 1B05A 4NF5B 1LAXA 4RY1A 5JEIA 1IUDA 5DVIA 3FUZA 1HSEA 3CFXA 2PX1A 3OOAA 4JBZA 3IOVA 5I59A 3B6TA 4TLLB 5I2NA 4O3CA 1BP5A 4GWOA 2NWJA 2OWTA 3PUXE 3CVGA 3S9EA 3RT6B 4KI0E 4R73A 5H8SA 1B7HA 3EN3A 4RPOA 4IO2A 3SEXA 2E1SA 3OSRA 3MQ9A 2UVHA 2RC7A 2DVZA 3LC8A 4F1VA 4DE8A 1DTGA 1DPEA 4H5FA 3MW0A 4XTCQ 3VVFA 1A54A 2THIA 3ECRA 2Z23A 4LA9A 1NH8A 1A99A 2QPQA 1IZ1A 3LUYA 3A3UA 3JV9A 4WKMA 1XHYA 3T96B 5H8QB 1N3WA 4GVOA 3DP4A 3H3GA 4ISUA 1H3DA 3QUJA 3Q27A 5J1DA 2PBWA 2X7PA 3KSXA 3S4UA 1OMPA 1ZU0A 4IB2A 3SETA 5L9OA 2I4CA 1OLCA 2XXTA 4F31B 1JVXA 4LONB 3K6WA 1M5FA 2GRVA 1NNPA 4XKNA 1MM7A 1O7TA 2O68A 3N26A 5AA2A 1ZLQA 4FEBA 4RK2A 2QSXA 4E0XA 3KSJA 3PU5A 1Y9UA 4JXIA 5DT6A 5M2VA 1FTOA 4TOZA 5DTBA 3PUWE 1S7YA 1EH3A 4AQ4A 2FYIA 1D9YA 2I0BA 4FECA 3SERA 1GR2A 2OCUA 4P0IA 1MQDA 3FXRA 5H8NA 2M8CA 3RPWA 4NTLA 1LB8A 4POWA 5H8FB 3MJNA 3EHSA 1H44A 2W7YA 1LGBC 4YB7A 1LAFE 1MQGA 2B3BA 3G3KA 2RCAA 2FNCA 1JVYA 4ZEDA 4G68A 2F7CA 2PMSA 2H9BA 1AL3A 4ELQA 4Q8RA 2F78A 1JW4A 1SYHA 2H99A 3N94A 1MXVA 4OETA 2VD3A 1MPCA 3S2VA 1IITA 1AH5A 4NE4A 3FVKA 4HCWA 1PBQA 2I6EA 3ONMA 4PETA 4QF9A 1RKMA 4FAJA 3RGYA 1B1HA
chains in the Genus database with same CATH superfamily
4AS5A 2REJA 4HE0A 4OFLA 4XEQA 2OK2A 2F6GA 3RQTA 1QVSA 3O28A 3IJXB 3VLVA 1A40A 4OTEA 4N15A 4ESXA 1LFGA 4H0WA 4N07A 1FPGA 4ND9A 2RF1A 2F3BA 4Q30B 5F1QA 1TWYA 4ONYA 1R6ZA 1QW0A 3OD7A 1B3HA 1IEJA 5I7IA 2QRYA 1LBXA 1MH4A 5I57A 1MG1A 3Q28A 1FQCA 3V8XB 3FATA 1KWHA 3E79A 2CZKA 4GBWA 2P3VA 4EF2A 1URDA 2YJPA 1QJMA 4R2FA 1EYJA 4R9FA 4GWYA 2HXRA 1I69A 4PDHA 1IMEA 4N13A 1FBPA 4BDQA 5FHMA 2DWAA 2RC8A 1YTVA 4JVDA 2HXWA 4PGNA 5IGAA 1MS7A 5AA4B 4PGPA 3A09A 3V5AA 2B3FA 3PUYE 4PE5B 4MLVA 2HZLA 3DP8A 1RDYA 3G3HA 2I49A 2XA5A 4RJZA 1NUXA 3EHTA 1Q9DA 3H06B 4OZ9A 3E78A 3K01A 4ZE9A 3SZPA 3TODA 3PGFA 4DXCA 4C0RA 2IA4A 2NVUB 4Z0IA 3QK6A 4KYEA 4QSCA 2Q89A 4QHQA 2F5XA 5KZTA 4OVQA 3OSQA 2V3QA 2V25A 1Y20A 3CSBA 4OFOA 1Q1KA 2P2AA 1IXCA 2XXHA 1NV5A 4OXVA 1JW1A 2A5SA 3GBBA 4MNCA 2DE4A 5DVFA 1BK4A 3RPLB 4ZZAA 4RXLA 1NI9A 5EQ9A 1DK4A 4HXVA 5H8HB 1WODA 2QJEA 2XWOA 1P1UA 4GF8A 2PVUA 2R6GE 2AL4A 1UTBB 2O7IA 4F3GA 4OEUA 3MP1A 5F24A 1OIBA 4H46A 2ZYKA 2Q88A 4R75A 4OVRA 3D4GA 2VP1A 3KN7A 4QSDA 4P3LA 2QFLA 4GD5A 1SI1A 5HM4B 1MXUA 1MRPA 1P1NA 5T3JA 4NEDA 2NXOA 5BUUA 2DVCA 1MH3A 5FHOA 2YLNA 3N5LA 3T9XB 5EYFA 4NHBA 4DCYA 3E3KA 1LBVA 1B32A 4LATA 3EHUA 4P8BA 4HS7A 2VOZA 4O3BA 4JSDA 1BIYA 3CHGA 2WBBA 1A55A 1EU8A 3QXMA 3JZJA 5L9MA 1SW2A 4FE8A 3VE1B 2F36A 1NNTA 4PE3A 2F7AA 4PBHA 4H65A 3U72A 1NL5A 1R9QA 1NUWA 3O6IA 4PP0A 4OVTA 3B6QA 4GIZA 3M3KA 5I56A 5IM2A 1DBZA 3IFAA 3IO4A 1AOVA 3PMXA 2XWVA 4MHFA 2FBPA 5ET5A 4P11A 3P7IA 4EXLA 5CMKA 4FJPA 3EF7A 3GZGA 2DOJA 3HPIA 2DSFA 1MDP1 2XXKA 1FBHA 4MH5A 3K2DA 2PYYA 5ICQA 1FPEA 1JEUA 1MDQA 2Y5KA 1JW5A 3HN0A 3H6VA 3HV1A 1B52A 4RNSA 2Q8JA 4IO5A 2I58A 1NV3A 1N3XA 5ISUA 5TU0A 4IR8A 1US4A 1MXWA 3TYHA 5CMCA 2O6AA 2GH9A 2UYFA 3D1RA 3S9NC 2AL5A 4Q0CA 1N84A 4AS4A 4KD5A 4LP2B 4O7MA 1TXFA 2Z8EA 3QAXA 4I1DA 2Y7WA 4OEVA 2I3VA 4GWSA 4KYDA 4IY5A 4GL0A 2UXAA 4MBPA 3G3IA 5I56B 4PAIA 4OYVA 1LAGE 2HAVA 2HHMA 3MAMA 3FJMA 3L6GA 1MY4A 1B7UA 4U22A 4C1TA 4YU0A 3Q26A 4H8JA 1VFDA 2F34A 1FQAA 1Y3PA 4NF0A 4PBQA 1YAEA 3G3JA 3RTWB 4KHZE 3CFLA 5IKBA 4EQBA 4UA8A 5EHSA 5ET7A 1FPBA 3VXCA 4LZ8A 3IO6A 4LZ5A 4GLIA 5HPQA 4C1UA 1OQGA 4X48A 1QUJA 4ECFA 2PFYA 3OEKA 1JNFA 2BJJX 1MY3A 2XWKA 4IO3A 5CC2A 2XHDA 4YAHX 2DWIA 3CRBA 1UTHA 2QVVA 2OWSA 4OMBA 1LBYA 4RYAA 4X1BA 4EDPA 3V83A 3FJGA 4MMPA 1FRPA 3RY3A 1DSNA 5ET6A 1ZTYA 5IAIA 3K0VA 3QUFA 1P1WA 2A5TA 3RT8A 2ZYNA 2Q2CA 4NF6A 3R26A 1H43A 3SESA 5J16A 5KCJA 1OVBA 4R2BA 1B4HA 4DCXA 1XC1A 3B50A 1PBPA 3TTLA 2CEXA 1M5DA 3K02A 4NAPA 2FA7A 2DWHA 2XX9A 2DS9A 3FJ7A 4U4SA 5ET8A 3Q29A 2JJKA 5K2XA 4ZE8A 3MC2A 3O6GA 3ODBA 2FIEA 4DLDA 1IXIA 4F19A 3MP6A 3HHFA 1EYIA 2Y7IA 3OXNA 1N04A 3T9UA 4FBPA 5CM6A 4LUBA 1MQIA 1ZIUA 1B0HA 1B40A 3E13X 1MXZA 4R72A 5I59B 2P1SA 2X26A 5I2NB 1UTHB 4P56A 2Q2AA 1MY1A 2DXYA 1AWBA 3MZ1A 1FQFA 2RINA 3FXQA 1RDXA 1QKBA 1FJ6A 4R6KA 1Y1ZA 3KN3A 1GV8A 2A5TB 4IO4A 4PFWA 2VT5A 1ANFA 2Z22A 1B7ZA 2XXIA 1FW0A 2GHBA 2G29A 3OEMA 2P3NA 4XKPA 3UGWA 5EQAA 4F1YA 5L9SA 3IFCA 4XXUA 1II5A 4F39A 1OQHA 3MVZA 3TUSA 4QFLA 3W9WA 3PUZE 1PC3A 4QFKA 3EPEA 1B3LA 1WDNA 1MPDA 4OWDA 1IQ7A 2ZZXA 3FIRA 1D9VA 1LLSA 1EZPA 1EZOA 3USDA 2XXPA 3R6UA 4MEVA 2XX7A 4OFJA 2RCBA 3K6UA 2G93A 3C32A 2ZNUA 1NV0A 3PPOA 3L6HA 5AA2B 1USYH 5TPAA 1XVYA 1FPKA 3RN8A 4JDFA 4PFRA 5DYHA 1FBFA 4DIGA 2XXXA 2OLBA 3MZBA 4NX1A 4O8MA 2Q8MA 2RKMA 5H8NB 2D3IA 1L5TA 1NH7A 4YMBA 3U1OA 3B6WA 4ELOA 3KOTA 1G0HA 4NG7A 4F1UA 2XXVA 1TFAA 3LBSA 4H6DA 1US5A 3M3LA 4OERA 3SKPA 1JETA 1LEVA 3O2AA 3O97A 1PB8A 1JEVA 2QS4A 2LAOA 1FJ9A 2WEFA 1H76A 5I58A 4G68B 1XT8A 3GXAA 1EYKA 3FXUA 3SEYA 2ZNTA 4GWXA 3VVDA 2ZYOA 4R74A 1B5HA 5LTCA 4E0WA 2Y7RA 4ZZEA 4NMYA 5FTHA 4U23A 1D3KA 4GX3A 3IR1A 3E4RA 4HCYA 2F97A 1B0LA 1Y4CA 1ZMGA 4OVSA 4EUOA 2ZZVA 3HCQA 1Q35A 3ZSFA 2Z8DA 1P99A 1B58A 1O63A 5TPAB 4TLMB 1Z7ME 2O1MA 5JTYA 4XKRA 3KGCA 1NMUA 3TFLA 3CSGA 3U92A 4WEDA 3D4CA 3HSTA 3W9VA 1UQWA 3KJ7A 3GBAA 4YICA 3CIJA 3MVXA 3ZS6A 4G8NA 1EZ9A 3PMVA 4LZ7A 2ONSA 4K3FA 1SVXB 3KFMA 4BDRA 3QSLA 4PQJA 3S9LC 3KZGA 3U8QA 1CB6A 5F7VA 3IOWA 2ZZWA 4U4XA 1K9ZA 4MLQA 4YKKA 5I57B 3MBPA 2F7BA 4DI3D 1IMAA 3H7MA 2E0SA 4GOTA 4F2OA 1QGXA 4MFIA 1IMFA 2OBGA 4XFEA 1FBEA 4M1VA 1NKXA 3VLWA 3TTRA 5BWJA 3IORA 5B70A 1SW5A 2DDKA 4IO7A 1SDXA 4GBVA 2CZIA 4THIA 4PFTA 3LV0A 4YB6A 3UORA 3O6HA 1YXIA 3UP9A 1SBPA 3FV2A 4NF4A 4PAFA 2Y7PA 4DDDA 1B9JA 1FTMA 1J1NA 3H6WA 4KYSA 1XS5A 4FORA 4YKJA 4F18A 4NWDA 2IEEA 2O69A 4GWWA 5JTYB 5CRYA 1QUIA 3G3FA 3GLBA 2DE3A 1TFDA 2CZLA 4LQ5A 3T93B 5ELVA 1Y3QA 1JQFA 4U2RA 2VD2A 1D4NA 4OVJA 1ATGA 1H45A 4ZEBA 1PDAA 3DP6A 3TEPA 4JWOA 3CG3A 1NV1A 4QFOA 1SYIA 3MYUA 4POXA 3FVNA 4JSOA 3RYDA 4F29A 1MY2A 2NUVA 4JB7A 1B6HA 3LSXA 2VHAA 1MPBA 3MWBA 4OENA 1FSAA 3KN8A 3PUVE 4G68C 2ZYMA 3V89B 4GXSB 1INPA 2XWIA 4I62A 4MJOA 4PFUA 2RC9A 2PCRA 3I6VA 4PF8A 2HCAA 5JK4A 3RUMA 2O84X 4X8RA 4H5GA 4PFIA 4GQOA 2B65A 3M8UA 1MXXA 4U1ZA 4NN3A 1ZBMA 1KZ8A 1T0KA 5I2KA 4H67A 3I3VA 1B1XA 3TTNA 1FTKA 4O3AA 1F9BA 4LQ2A 3JYRA 2V4CA 3MSTA 2ZXTA 1S50A 2DE2A 5I5PA 2Z8FA 3IB0A 4R9GA 1B3EA 4N4UA 4YKIA 4Q5TA 4N81A 5AA1A 4NGUA 4H1XA 4QSEA 3DM0A 3MP8A 4QRZA 2V3TA 1M5CA 4NWCA 5EHMA 4AB6A 2MKZA 3OO8A 3BIHA 1IMDA 3FVOA 3FBPA 4FEDA 3FV1A 5ICTA 2XXRA 3CFZA 3FGSA 3W15C 1NV2A 2GFEA 4OANA 1NUYA 4IY6A 2I48A 1FTLA 3K6XA 1PB9A 4ELRA 3A3CA 4DXBA 3A29A 1B5IA 3K1MA 1FTJA 3KC0A 4QBAA 3DELB 3S9MC 3PMWA 4HE1A 4N17A 3VV5A 4R6YA 3T22A 1N76A 2WYPA 3WAEA 4MAGA 2WYKA 1UIUA 1LB9A 1I6AA 1R1NA 4MCOA 3DLNA 5I2KB 2XX8A 4EQ9A 3KEIA 2H25A 4IGTA 4YB5A 1A8EA 4P47A 3CI8A 3TTKA 2Q74A 5EQ7A 1WVJA 1FBCA 3PV0E 4KPTA 5K2YA 3IB1A 4ZECA 1LAHE 2H98A 1POY1 1B2HA 1N7WA 4I8CA 3TKDA 1RYOA 2O1LA 4HTGA 3K4UA 2CZHA 1P1OA 1B46A 3K1NA 3AXFA 1LBWA 4WXJA 5IZZA 3ISPA 3O29A 3UN6A 3FZVA 2P0SA 1FQBA 2OWZA 3IOUA 1LSTA 5KDTA 2XXWA 2HPGA 3FXBA 3QIMA 5H8FA 5CMMA 4KR5A 3KJTA 3TTMA 3FD3A 4N91A 2O7UA 2ONRA 5IZ3A 1MY0A 1LFIA 1URGA 3RTFB 4ZDMA 1IIWA 2REGA 4XIGQ 2F35A 3IJOB 4G77A 1OVTA 2GHAA 5CBSA 3OO9A 4FIMA 3MPLA 5CI5A 1MM6A 1DOTA 4N8GA 2PFZA 5EYHA 1A7LA 3KOSA 1B3FA 4ESWA 2CMOA 1POTA 4HW8A 1USYE 3BKIB 3UIFA 5AA3A 2H5YA 1QULA 2O51A 4QFNA 4G8MA 1SW1A 4MF3A 4N8YA 4M4GA 3C33A 4KXPA 3IX1A 4KCDA 4NF6B 5B7DA 1FPFA 3EKIA 4DI4B 5KCJB 3CG1A 2Y84A 1GGGA 1Y4TA 3R7XA 1B4ZA 4TQUQ 2QS2A 2R9JA 2V3UA 1K9YA 4BDLA 5KDTB 4RA1A 2KLFA 3OENA 4OVPA 4EXKA 5LOMA 5AE4A 4KFQA 3FASA 1MQJA 3U65A 2D5WA 1DMBA 4YKPA 4RK9A 4EF1A 1FPDA 3PD8A 5FTIA 1QKAA 2UVIA 1KA0A 3SEUA 1NUZA 1NNKA 3PPQA 4JWYA 3C36A 2VPNA 2Y5LA 2OX3A 3N6TA 2QVUA 1LBZA 4I40A 3HHGA 2ANJA 2WKYA 1NFTA 3EQ1A 3VLUA 3OO6A 5AA4A 1DPPA 2B4MA 2HAUA 5DW8A 4H8IA 4KQPA 2DWJA 4AB5A 3U93A 3PPRA 1MXYA 2ESNA 3CR9A 1PEBA 4KCCA 3E9XA 1Y1MA 2H4IA 4NF8A 3T0JA 3TAJA 2FIXA 4U1OA 4FATA 1R9LA 2D21A 4WEPA 1AMFA 1SPIA 3TCFA 4QFPA 2XXQA 3C31A 4F3PA 1FCKA 1RDZA 5CMBA 1GTKA 1P1QA 3SEWA 3UK4A 2AYSA 1N0TA 2OZZA 2UVJA 1ZKBA 1VDWA 4N6DA 4I3YA 4X04A 3TQWA 4DZ1A 1BTJA 4Z7EA 3RPLA 4JWXA 2XXUA 3U94A 4BDNA 4QXDA 5H8HA 1OLAA 2DXRA 3LSFB 3TDJA 3IB2A 4IO6A 4JVCA 4R6HA 1UTBA 1LCFA 3B7DA 2R71A 5FHNA 3F11A 4OQOA 3HO7A 5DVJA 4XKQA 1B5JA 3Q25A 1FPIA 4PCDA 2QS3A 2Q9TA 1CE2A 3T9HB 1Z7NE 1Y3NA 4PFBA 2PT1A 2XD2A 2OJTA 1LBBA 3PPNA 3T1BA 3RLFE 4GL8A 4NF8B 4ZEFA 1ELJA 3I5OA 1LFHA 2ABHA 1TT1A 3PTYA 2QMXA 1QUKA 3HFUA 5A5XA 3MVWA 1VR5A 4LVQA 3SEVA 2UVGA 3T66A 1M5BA 4PC9A 3MZ9A 5I58B 3TPAA 1YPNA 2V93A 2UYEA 3MUQA 4DXUA 3C9HA 3TZAA 3TCGA 1M5EA 3H6UA 4HE2A 3K00A 3G7WA 4BLAA 1IMBA 3SDFA 3ZKKA 1XVXA 3T9VA 3MVYA 4L17A 4U21A 2QVRA 3KBRA 4N6PA 1SW4A 3BBRA 3VDFA 4I3EA 1DTZA 1A8FA 4OA4A 3H4ZA 3C4MA 3QMFA 2YPNA 3H03A 1LBCA 1XOCA 4PFYA 5IZ1A 2F3DA 2F8DA 5I84A 4XF5A 3ZKLA 3IAZA 3OELA 4GFRA 2V84A 2PT2A 1UIVA 5DEXA 3G3GA 3BFTA 4GXAA 1BLFA 2ALUA 4UACA 5A5XB 4P0GA 2HQ0A 2I4BA 4GRKA 4YZZA 1FQEA 2AIXA 5EYGA 5TP9A 2DP8A 2CEYA 1RYXA 3ILTB 2ONKE 4UABA 3K6VA 1SI0A 3PPPA 3QYTA 1FQDA 3FVGA 2I0CA 4F3SA 5ITOA 4ELPA 1S9TA 3IOTA 2Y7KA 3BFUA 1DCUA 3LR1A 1PB7A 4NF4B 3ROJA 1ZJLA 2DQVA 2DYXA 3M3FA 3NOHA 4PF6A 4RPNA 3THIA 3VXBA 4X9TA 4OESA 1B3GA 2KQZA 3N6UA 2ZMBA 2XXYA 4F22A 4OHNA 3O9PA 4MNIA 2FHYA 1FPLA 3BIGA 3LSWA 1HSLA 2VPOA 3LUZA 4PAKA 5A5LA 2HEUA 4NF5A 2NOOA 3C35A 3VFJA 2QL3A 3IL1B 1VSOA 3OMBA 3ILUB 1I6BA 4ZEKA 2HFBA 3K1PA 1B51A 2HZKA 1HSJA 5L8DA 4BDMA 4G8HA 2QS1A 4X1DA 5DEXB 5I3SA 3C34A 3OO7A 1AIVA 4PTKA 3MPKA 2F6PA 3TQLA 1D9QA 3GYYA 3LSLA 4F2QA 4YMAA 3H6TA 1I6QA 3TMGA 3IK6B 3WAFA 1IXHA 4GX4A 5TP9B 4G2ZA 3UA8A 5HBCA 1BKAA 2ZNSA 4ZS9A 1NV6A 4GX6A 2XD3A 4F3BA 1O64A 4IGRA 5FBPA 1LCTA 4ZEIA 2VGQA 4LN5A 1SD3A 2X7QA 3PD9A 4EQ7A 1MQHA 4G4PA 4GWZA 5AA2D 1KA1A 1YCJA 4I9DA 3TELA 3KG2A 4BDOA 1SQYA 3O66A 3KBZA 1NNFA 5H8QA 2QMWA 4NQ8A 3TCHA 1YZ0A 5ITPA 3RNNA 1VFEA 5CBRA 1VE4A 1IXGA 1URSA 1N7XA 2I3WA 1GVCA 3VVEA 1B05A 4NF5B 1FBGA 1FBDA 1FPJA 1LAXA 4RY1A 5JEIA 1IUDA 5DVIA 3FUZA 1HSEA 3CFXA 2PX1A 3OOAA 4JBZA 1YYZA 4O7IA 3IOVA 2WBDA 5I59A 3B6TA 4TLLB 5I2NA 4G61A 4O3CA 1BP5A 4GWOA 2NWJA 2OWTA 3PUXE 3CVGA 3S9EA 2B4LA 3RT6B 4KI0E 5EQ8A 4R73A 2KR0A 5H8SA 1B7HA 3EN3A 4RPOA 4IO2A 3SEXA 2E1SA 3OSRA 3MQ9A 2WX9A 2UVHA 2RC7A 4P1EA 2DVZA 3LC8A 4F1VA 4DE8A 2R8TA 1DTGA 1DPEA 4H5FA 3MW0A 4XTCQ 3VVFA 1A54A 2THIA 3ECRA 2Z23A 4LA9A 1IMCA 4N6KA 1NH8A 1A99A 4P9KA 3KC1A 2QPQA 5LDZA 1IZ1A 3LUYA 3A3UA 3JV9A 4WKMA 1XHYA 3T96B 5H8QB 1N3WA 4H45A 4GVOA 3DP4A 3H3GA 4ISUA 4PDDA 1H3DA 3QUJA 3Q27A 5J1DA 2PBWA 3B8BA 2X7PA 3KSXA 3S4UA 1OMPA 1ZU0A 4IB2A 3SETA 4O94A 5L9OA 2I4CA 1OLCA 2FVZA 2XXTA 4JVIA 4F31B 1JVXA 4LONB 3K6WA 1M5FA 2GRVA 1NNPA 4XKNA 1MM7A 1G0IA 1O7TA 2O68A 3N26A 5AA2A 1ZLQA 4FEBA 4RK2A 2QSXA 4E0XA 3KSJA 3PU5A 1Y9UA 4JXIA 5DT6A 5M2VA 1FTOA 4TOZA 5DTBA 3PUWE 1S7YA 1EH3A 4AQ4A 2FYIA 1D9YA 2I0BA 4FECA 3SERA 4MX6A 1NV4A 1GR2A 2OCUA 4P0IA 4GWUA 1MQDA 1NV7A 3FXRA 5H8NA 2M8CA 3RPWA 4NTLA 1LB8A 4POWA 5H8FB 3MJNA 3EHSA 4P1LA 1H44A 2W7YA 1LGBC 4YB7A 1LAFE 1MQGA 5IZ3B 2B3BA 3G3KA 2RCAA 2FNCA 1JVYA 4ZEDA 4G68A 2F7CA 2PMSA 2H9BA 1AL3A 4ELQA 4MNPA 4Q8RA 2GQ1A 2F78A 1JW4A 1SYHA 1CNQA 2BJIA 2H99A 5ESYA 3N94A 4MIJA 1MXVA 2L5VA 4OETA 2VD3A 1MPCA 3S2VA 1XI6A 1IITA 1AH5A 4NE4A 3FVKA 4HCWA 1PBQA 2I6EA 3ONMA 4PETA 4QF9A 1RKMA 4FAJA 3RGYA 1FTAA 1B1HA 1JP4A
chains in the Genus database with same CATH topology
2REJA 4OFLA 2OK2A 2F6GA 3RQTA 1QVSA 3O28A 3IJXB 3VLVA 1A40A 4OTEA 4ESXA 1LFGA 4H0WA 4N07A 4ND9A 2RF1A 4Q30B 5F1QA 1TWYA 4ONYA 1R6ZA 1QW0A 3OD7A 1B3HA 1IEJA 2QRYA 1MH4A 5I57A 1MG1A 3Q28A 1FQCA 3V8XB 3FATA 1KWHA 4EF2A 1URDA 2YJPA 1QJMA 4R2FA 4R9FA 1I69A 4N13A 4BDQA 5FHMA 2DWAA 2RC8A 1YTVA 2HXWA 1MS7A 5AA4B 3A09A 3V5AA 2B3FA 3PUYE 4PE5B 4MLVA 2HZLA 3DP8A 3G3HA 2I49A 4RJZA 3EHTA 3H06B 4OZ9A 3K01A 4ZE9A 3TODA 3PGFA 4DXCA 4C0RA 2IA4A 2NVUB 4Z0IA 3QK6A 4KYEA 4QSCA 2Q89A 4QHQA 2F5XA 5KZTA 3OSQA 2V3QA 2V25A 1Y20A 3CSBA 4OFOA 1Q1KA 2P2AA 1IXCA 2XXHA 4OXVA 1JW1A 2A5SA 3GBBA 2DE4A 5DVFA 4ZZAA 4RXLA 5H8HB 1WODA 2QJEA 1P1UA 4GF8A 2PVUA 2R6GE 2AL4A 1UTBB 2O7IA 4F3GA 4OEUA 3MP1A 1OIBA 2ZYKA 2Q88A 4R75A 3D4GA 2VP1A 3KN7A 4QSDA 4GD5A 1SI1A 5HM4B 1MXUA 1MRPA 1P1NA 4NEDA 2NXOA 5BUUA 2DVCA 1MH3A 5FHOA 2YLNA 3N5LA 3T9XB 5EYFA 4DCYA 3E3KA 1B32A 4LATA 3EHUA 4HS7A 2VOZA 4O3BA 4JSDA 1BIYA 1A55A 1EU8A 3QXMA 3JZJA 5L9MA 1SW2A 4FE8A 3VE1B 2F36A 1NNTA 2F7AA 4H65A 3U72A 1NL5A 1R9QA 3O6IA 4PP0A 3B6QA 4GIZA 3M3KA 5I56A 3IO4A 1AOVA 3PMXA 4P11A 3P7IA 4EXLA 5CMKA 4FJPA 3EF7A 3GZGA 2DOJA 3HPIA 2DSFA 1MDP1 4MH5A 3K2DA 2PYYA 5ICQA 1JEUA 1MDQA 1JW5A 3HN0A 3H6VA 3HV1A 1B52A 4RNSA 2Q8JA 4IO5A 2I58A 1N3XA 5ISUA 5TU0A 1US4A 1MXWA 3TYHA 5CMCA 2O6AA 2GH9A 2UYFA 3S9NC 2AL5A 4Q0CA 1N84A 4KD5A 4LP2B 1TXFA 2Z8EA 3QAXA 4I1DA 2Y7WA 4OEVA 2I3VA 4KYDA 4IY5A 4GL0A 2UXAA 4MBPA 3G3IA 5I56B 4OYVA 1LAGE 2HAVA 3MAMA 3FJMA 3L6GA 1MY4A 1B7UA 4U22A 4C1TA 4YU0A 3Q26A 4H8JA 1VFDA 2F34A 1FQAA 1Y3PA 1YAEA 3G3JA 3RTWB 4KHZE 3CFLA 5IKBA 4EQBA 4UA8A 5EHSA 3VXCA 4LZ8A 3IO6A 4LZ5A 4GLIA 5HPQA 4C1UA 1OQGA 4X48A 1QUJA 4ECFA 3OEKA 1JNFA 2BJJX 1MY3A 4IO3A 5CC2A 2XHDA 4YAHX 2DWIA 3CRBA 1UTHA 2OWSA 4OMBA 4X1BA 4RYAA 4EDPA 3V83A 3FJGA 3RY3A 1DSNA 1ZTYA 5IAIA 3K0VA 3QUFA 1P1WA 2A5TA 3RT8A 2ZYNA 2Q2CA 4NF6A 3R26A 1H43A 3SESA 5KCJA 1OVBA 4R2BA 1B4HA 4DCXA 1XC1A 1PBPA 3TTLA 1M5DA 3K02A 2FA7A 2DWHA 2XX9A 2DS9A 3FJ7A 4U4SA 3Q29A 5K2XA 4ZE8A 3MC2A 3O6GA 3ODBA 4DLDA 1IXIA 4F19A 3MP6A 3HHFA 2Y7IA 3OXNA 1N04A 3T9UA 5CM6A 4LUBA 1MQIA 1ZIUA 1B0HA 1B40A 3E13X 1MXZA 4R72A 5I59B 2P1SA 2X26A 5I2NB 1UTHB 2Q2AA 1MY1A 2DXYA 3MZ1A 1FQFA 2RINA 3FXQA 1QKBA 4R6KA 1Y1ZA 3KN3A 1GV8A 2A5TB 4IO4A 4PFWA 1ANFA 2Z22A 1B7ZA 2XXIA 1FW0A 2GHBA 2G29A 3OEMA 4XKPA 3UGWA 4F1YA 5L9SA 4XXUA 1II5A 4F39A 1OQHA 3MVZA 3TUSA 4QFLA 3W9WA 3PUZE 1PC3A 4QFKA 3EPEA 1B3LA 1WDNA 1MPDA 4OWDA 1IQ7A 3FIRA 1D9VA 1LLSA 1EZPA 1EZOA 3USDA 2XXPA 3R6UA 2XX7A 4OFJA 2RCBA 3K6UA 2G93A 3C32A 2ZNUA 3PPOA 3L6HA 5AA2B 1USYH 5TPAA 1XVYA 3RN8A 4JDFA 5DYHA 4DIGA 2XXXA 2OLBA 3MZBA 2RKMA 5H8NB 2D3IA 1L5TA 1NH7A 4YMBA 3U1OA 3B6WA 4ELOA 3KOTA 4F1UA 2XXVA 1TFAA 3LBSA 4H6DA 1US5A 3M3LA 4OERA 3SKPA 1JETA 3O2AA 3O97A 1PB8A 1JEVA 2QS4A 2LAOA 1H76A 5I58A 4G68B 1XT8A 3GXAA 3FXUA 3SEYA 2ZNTA 3VVDA 2ZYOA 4R74A 1B5HA 4E0WA 2Y7RA 4ZZEA 4NMYA 5FTHA 4U23A 1D3KA 3IR1A 3E4RA 4HCYA 2F97A 1B0LA 1Y4CA 1ZMGA 4EUOA 3HCQA 1Q35A 3ZSFA 2Z8DA 1P99A 1B58A 1O63A 5TPAB 4TLMB 1Z7ME 2O1MA 5JTYA 4XKRA 3KGCA 1NMUA 3TFLA 3CSGA 3U92A 4WEDA 3D4CA 3HSTA 3W9VA 1UQWA 3KJ7A 3GBAA 4YICA 3CIJA 3MVXA 3ZS6A 4G8NA 1EZ9A 3PMVA 4LZ7A 2ONSA 4K3FA 1SVXB 3KFMA 4BDRA 3QSLA 4PQJA 3S9LC 3KZGA 3U8QA 1CB6A 5F7VA 3IOWA 4U4XA 4MLQA 4YKKA 5I57B 3MBPA 2F7BA 3H7MA 2E0SA 4GOTA 4F2OA 4MFIA 2OBGA 4M1VA 1NKXA 3VLWA 3TTRA 5BWJA 3IORA 5B70A 1SW5A 4IO7A 1SDXA 4THIA 4PFTA 4YB6A 3UORA 3O6HA 3UP9A 1SBPA 3FV2A 4NF4A 2Y7PA 4DDDA 1B9JA 1FTMA 1J1NA 3H6WA 4KYSA 1XS5A 4FORA 4YKJA 4F18A 4NWDA 2IEEA 2O69A 5JTYB 5CRYA 1QUIA 3G3FA 3GLBA 2DE3A 1TFDA 2CZLA 4LQ5A 3T93B 5ELVA 1Y3QA 1JQFA 4U2RA 2VD2A 1D4NA 4OVJA 1ATGA 1H45A 4ZEBA 1PDAA 3DP6A 3TEPA 4JWOA 3CG3A 4QFOA 1SYIA 4POXA 3FVNA 4JSOA 4F29A 1MY2A 2NUVA 4JB7A 1B6HA 3LSXA 2VHAA 1MPBA 3MWBA 4OENA 3KN8A 3PUVE 4G68C 2ZYMA 3V89B 4GXSB 4I62A 4PFUA 2RC9A 3I6VA 2HCAA 5JK4A 3RUMA 2O84X 4H5GA 4GQOA 2B65A 3M8UA 1MXXA 4U1ZA 1ZBMA 1T0KA 5I2KA 4H67A 3I3VA 1B1XA 3TTNA 1FTKA 4O3AA 1F9BA 4LQ2A 3JYRA 2ZXTA 1S50A 2DE2A 2Z8FA 3IB0A 4R9GA 1B3EA 4YKIA 4Q5TA 5AA1A 4H1XA 4QSEA 3DM0A 3MP8A 4QRZA 2V3TA 1M5CA 4NWCA 5EHMA 4AB6A 3OO8A 3FVOA 4FEDA 3FV1A 5ICTA 2XXRA 3CFZA 3FGSA 3W15C 2GFEA 4IY6A 2I48A 1FTLA 3K6XA 1PB9A 4ELRA 3A3CA 4DXBA 1B5IA 3K1MA 1FTJA 3DELB 3S9MC 3PMWA 3VV5A 4R6YA 3T22A 1N76A 3WAEA 1UIUA 1LB9A 1I6AA 1R1NA 3DLNA 5I2KB 2XX8A 4EQ9A 3KEIA 2H25A 4IGTA 4YB5A 1A8EA 3CI8A 3TTKA 1WVJA 3PV0E 4KPTA 5K2YA 3IB1A 4ZECA 1LAHE 2H98A 1POY1 1B2HA 1N7WA 4I8CA 3TKDA 1RYOA 2O1LA 4HTGA 3K4UA 1P1OA 1B46A 3K1NA 3AXFA 4WXJA 3O29A 3UN6A 3FZVA 2P0SA 1FQBA 3IOUA 1LSTA 5KDTA 2XXWA 3QIMA 5H8FA 5CMMA 4KR5A 3KJTA 3TTMA 3FD3A 2O7UA 2ONRA 1MY0A 1LFIA 1URGA 3RTFB 4ZDMA 1IIWA 2REGA 4XIGQ 2F35A 3IJOB 4G77A 1OVTA 2GHAA 5CBSA 3OO9A 4FIMA 3MPLA 5CI5A 1MM6A 1DOTA 1A7LA 3KOSA 1B3FA 4ESWA 2CMOA 1POTA 4HW8A 1USYE 3BKIB 3UIFA 5AA3A 2H5YA 1QULA 2O51A 4QFNA 4G8MA 1SW1A 4MF3A 4M4GA 3C33A 3IX1A 4KCDA 4NF6B 5B7DA 5KCJB 3CG1A 2Y84A 1GGGA 1Y4TA 3R7XA 1B4ZA 4TQUQ 2QS2A 2R9JA 2V3UA 4BDLA 5KDTB 4RA1A 2KLFA 3OENA 4EXKA 5LOMA 5AE4A 4KFQA 3FASA 1MQJA 2D5WA 1DMBA 4YKPA 4RK9A 4EF1A 3PD8A 5FTIA 1QKAA 2UVIA 3SEUA 1NNKA 3PPQA 4JWYA 3C36A 3N6TA 3HHGA 2ANJA 2WKYA 1NFTA 3EQ1A 3VLUA 3OO6A 5AA4A 1DPPA 2HAUA 4H8IA 4KQPA 2DWJA 4AB5A 3U93A 3PPRA 1MXYA 2ESNA 3CR9A 1PEBA 4KCCA 3E9XA 1Y1MA 2H4IA 4NF8A 3TAJA 4U1OA 4FATA 1R9LA 2D21A 4WEPA 1AMFA 3TCFA 4F3PA 2XXQA 3C31A 4QFPA 1FCKA 5CMBA 1GTKA 1P1QA 3SEWA 3UK4A 2AYSA 1N0TA 2OZZA 2UVJA 1ZKBA 3TQWA 4DZ1A 1BTJA 4Z7EA 4JWXA 2XXUA 3U94A 4BDNA 5H8HA 1OLAA 2DXRA 3LSFB 3TDJA 3IB2A 4IO6A 4R6HA 1UTBA 1LCFA 3B7DA 2R71A 5FHNA 3F11A 4OQOA 3HO7A 5DVJA 4XKQA 1B5JA 3Q25A 2QS3A 2Q9TA 1CE2A 3T9HB 1Z7NE 1Y3NA 2PT1A 2XD2A 2OJTA 1LBBA 3PPNA 3RLFE 4GL8A 4ZEFA 4NF8B 1ELJA 3I5OA 1LFHA 2ABHA 1TT1A 2QMXA 1QUKA 5A5XA 3MVWA 1VR5A 4LVQA 3SEVA 2UVGA 3T66A 1M5BA 3MZ9A 5I58B 3TPAA 1YPNA 2V93A 2UYEA 3MUQA 4DXUA 3C9HA 3TZAA 3TCGA 1M5EA 3H6UA 3K00A 3G7WA 4BLAA 3ZKKA 3SDFA 1XVXA 3T9VA 3MVYA 4L17A 4U21A 3KBRA 4N6PA 1SW4A 3BBRA 3VDFA 1DTZA 1A8FA 3H4ZA 3C4MA 2YPNA 3H03A 1LBCA 1XOCA 4PFYA 2F8DA 5I84A 3ZKLA 3IAZA 3OELA 4GFRA 2V84A 2PT2A 1UIVA 5DEXA 3G3GA 3BFTA 4GXAA 1BLFA 2ALUA 4UACA 5A5XB 4P0GA 2HQ0A 2I4BA 4GRKA 4YZZA 1FQEA 2AIXA 5TP9A 2DP8A 1RYXA 3ILTB 2ONKE 3K6VA 1SI0A 3PPPA 3QYTA 1FQDA 3FVGA 2I0CA 4F3SA 5ITOA 4ELPA 1S9TA 3IOTA 2Y7KA 3BFUA 3LR1A 1PB7A 4NF4B 1ZJLA 2DQVA 2DYXA 3M3FA 4RPNA 3THIA 3VXBA 4X9TA 4OESA 1B3GA 3N6UA 2ZMBA 2XXYA 4F22A 4OHNA 3O9PA 3LSWA 1HSLA 2HEUA 4NF5A 2NOOA 3C35A 3VFJA 2QL3A 3IL1B 1VSOA 3OMBA 3ILUB 1I6BA 4ZEKA 2HFBA 3K1PA 1B51A 2HZKA 1HSJA 5L8DA 4BDMA 4G8HA 2QS1A 4X1DA 5DEXB 3C34A 3OO7A 1AIVA 3MPKA 2F6PA 3TQLA 3LSLA 4F2QA 4YMAA 3H6TA 1I6QA 3TMGA 3IK6B 3WAFA 1IXHA 5TP9B 4G2ZA 3UA8A 5HBCA 1BKAA 2ZNSA 4ZS9A 2XD3A 4F3BA 1O64A 4IGRA 1LCTA 4ZEIA 2VGQA 1SD3A 2X7QA 3PD9A 4EQ7A 1MQHA 4G4PA 5AA2D 1YCJA 4I9DA 3TELA 3KG2A 4BDOA 1SQYA 3O66A 1NNFA 5H8QA 2QMWA 3TCHA 5ITPA 3RNNA 1VFEA 5CBRA 1VE4A 1IXGA 1URSA 1N7XA 2I3WA 1GVCA 3VVEA 1B05A 4NF5B 1LAXA 4RY1A 5JEIA 1IUDA 5DVIA 3FUZA 1HSEA 3CFXA 2PX1A 3OOAA 4JBZA 3IOVA 5I59A 3B6TA 4TLLB 5I2NA 4O3CA 1BP5A 4GWOA 2NWJA 2OWTA 3PUXE 3CVGA 3S9EA 3RT6B 4KI0E 4R73A 5H8SA 1B7HA 3EN3A 4RPOA 4IO2A 3SEXA 2E1SA 3OSRA 3MQ9A 2UVHA 2RC7A 2DVZA 3LC8A 4F1VA 4DE8A 1DTGA 1DPEA 4H5FA 3MW0A 4XTCQ 3VVFA 1A54A 2THIA 3ECRA 2Z23A 4LA9A 1NH8A 1A99A 2QPQA 1IZ1A 3LUYA 3A3UA 3JV9A 4WKMA 1XHYA 3T96B 5H8QB 1N3WA 4GVOA 3DP4A 3H3GA 4ISUA 1H3DA 3QUJA 3Q27A 5J1DA 2PBWA 2X7PA 3KSXA 3S4UA 1OMPA 1ZU0A 4IB2A 3SETA 5L9OA 2I4CA 1OLCA 2XXTA 4F31B 1JVXA 4LONB 3K6WA 1M5FA 2GRVA 1NNPA 4XKNA 1MM7A 1O7TA 2O68A 3N26A 5AA2A 1ZLQA 4FEBA 4RK2A 2QSXA 4E0XA 3KSJA 3PU5A 1Y9UA 4JXIA 5DT6A 5M2VA 1FTOA 4TOZA 5DTBA 3PUWE 1S7YA 1EH3A 4AQ4A 2FYIA 1D9YA 2I0BA 4FECA 3SERA 1GR2A 2OCUA 4P0IA 1MQDA 3FXRA 5H8NA 2M8CA 3RPWA 4NTLA 1LB8A 4POWA 5H8FB 3MJNA 3EHSA 1H44A 2W7YA 1LGBC 4YB7A 1LAFE 1MQGA 2B3BA 3G3KA 2RCAA 2FNCA 1JVYA 4ZEDA 4G68A 2F7CA 2PMSA 2H9BA 1AL3A 4ELQA 4Q8RA 2F78A 1JW4A 1SYHA 2H99A 3N94A 1MXVA 4OETA 2VD3A 1MPCA 3S2VA 1IITA 1AH5A 4NE4A 3FVKA 4HCWA 1PBQA 2I6EA 3ONMA 4PETA 4QF9A 1RKMA 4FAJA 3RGYA 1B1HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2REJ A;  4OFL A;  2OK2 A;  2F6G A;  3RQT A;  1QVS A;  3O28 A;  3IJX B;  3VLV A;  1A40 A;  4OTE A;  4ESX A;  1LFG A;  4H0W A;  4N07 A;  4ND9 A;  2RF1 A;  4Q30 B;  5F1Q A;  1TWY A;  4ONY A;  1R6Z A;  1QW0 A;  3OD7 A;  1B3H A;  1IEJ A;  2QRY A;  1MH4 A;  5I57 A;  1MG1 A;  3Q28 A;  1FQC A;  3V8X B;  3FAT A;  1KWH A;  4EF2 A;  1URD A;  2YJP A;  1QJM A;  4R2F A;  4R9F A;  1I69 A;  4N13 A;  4BDQ A;  5FHM A;  2DWA A;  2RC8 A;  1YTV A;  2HXW A;  1MS7 A;  5AA4 B;  3A09 A;  3V5A A;  2B3F A;  3PUY E;  4PE5 B;  4MLV A;  2HZL A;  3DP8 A;  3G3H A;  2I49 A;  4RJZ A;  3EHT A;  3H06 B;  4OZ9 A;  3K01 A;  4ZE9 A;  3TOD A;  3PGF A;  4DXC A;  4C0R A;  2IA4 A;  2NVU B;  4Z0I A;  3QK6 A;  4KYE A;  4QSC A;  2Q89 A;  4QHQ A;  2F5X A;  5KZT A;  3OSQ A;  2V3Q A;  2V25 A;  1Y20 A;  3CSB A;  4OFO A;  1Q1K A;  2P2A A;  1IXC A;  2XXH A;  4OXV A;  1JW1 A;  2A5S A;  3GBB A;  2DE4 A;  5DVF A;  4ZZA A;  4RXL A;  5H8H B;  1WOD A;  2QJE A;  1P1U A;  4GF8 A;  2PVU A;  2R6G E;  2AL4 A;  1UTB B;  2O7I A;  4F3G A;  4OEU A;  3MP1 A;  1OIB A;  2ZYK A;  2Q88 A;  4R75 A;  3D4G A;  2VP1 A;  3KN7 A;  4QSD A;  4GD5 A;  1SI1 A;  5HM4 B;  1MXU A;  1MRP A;  1P1N A;  4NED A;  2NXO A;  5BUU A;  2DVC A;  1MH3 A;  5FHO A;  2YLN A;  3N5L A;  3T9X B;  5EYF A;  4DCY A;  3E3K A;  1B32 A;  4LAT A;  3EHU A;  4HS7 A;  2VOZ A;  4O3B A;  4JSD A;  1BIY A;  1A55 A;  1EU8 A;  3QXM A;  3JZJ A;  5L9M A;  1SW2 A;  4FE8 A;  3VE1 B;  2F36 A;  1NNT A;  2F7A A;  4H65 A;  3U72 A;  1NL5 A;  1R9Q A;  3O6I A;  4PP0 A;  3B6Q A;  4GIZ A;  3M3K A;  5I56 A;  3IO4 A;  1AOV A;  3PMX A;  4P11 A;  3P7I A;  4EXL A;  5CMK A;  4FJP A;  3EF7 A;  3GZG A;  2DOJ A;  3HPI A;  2DSF A;  1MDP 1;  4MH5 A;  3K2D A;  2PYY A;  5ICQ A;  1JEU A;  1MDQ A;  1JW5 A;  3HN0 A;  3H6V A;  3HV1 A;  1B52 A;  4RNS A;  2Q8J A;  4IO5 A;  2I58 A;  1N3X A;  5ISU A;  5TU0 A;  1US4 A;  1MXW A;  3TYH A;  5CMC A;  2O6A A;  2GH9 A;  2UYF A;  3S9N C;  2AL5 A;  4Q0C A;  1N84 A;  4KD5 A;  4LP2 B;  1TXF A;  2Z8E A;  3QAX A;  4I1D A;  2Y7W A;  4OEV A;  2I3V A;  4KYD A;  4IY5 A;  4GL0 A;  2UXA A;  4MBP A;  3G3I A;  5I56 B;  4OYV A;  1LAG E;  2HAV A;  3MAM A;  3FJM A;  3L6G A;  1MY4 A;  1B7U A;  4U22 A;  4C1T A;  4YU0 A;  3Q26 A;  4H8J A;  1VFD A;  2F34 A;  1FQA A;  1Y3P A;  1YAE A;  3G3J A;  3RTW B;  4KHZ E;  3CFL A;  5IKB A;  4EQB A;  4UA8 A;  5EHS A;  3VXC A;  4LZ8 A;  3IO6 A;  4LZ5 A;  4GLI A;  5HPQ A;  4C1U A;  1OQG A;  4X48 A;  1QUJ A;  4ECF A;  3OEK A;  1JNF A;  2BJJ X;  1MY3 A;  4IO3 A;  5CC2 A;  2XHD A;  4YAH X;  2DWI A;  3CRB A;  1UTH A;  2OWS A;  4OMB A;  4X1B A;  4RYA A;  4EDP A;  3V83 A;  3FJG A;  3RY3 A;  1DSN A;  1ZTY A;  5IAI A;  3K0V A;  3QUF A;  1P1W A;  2A5T A;  3RT8 A;  2ZYN A;  2Q2C A;  4NF6 A;  3R26 A;  1H43 A;  3SES A;  5KCJ A;  1OVB A;  4R2B A;  1B4H A;  4DCX A;  1XC1 A;  1PBP A;  3TTL A;  1M5D A;  3K02 A;  2FA7 A;  2DWH A;  2XX9 A;  2DS9 A;  3FJ7 A;  4U4S A;  3Q29 A;  5K2X A;  4ZE8 A;  3MC2 A;  3O6G A;  3ODB A;  4DLD A;  1IXI A;  4F19 A;  3MP6 A;  3HHF A;  2Y7I A;  3OXN A;  1N04 A;  3T9U A;  5CM6 A;  4LUB A;  1MQI A;  1ZIU A;  1B0H A;  1B40 A;  3E13 X;  1MXZ A;  4R72 A;  5I59 B;  2P1S A;  2X26 A;  5I2N B;  1UTH B;  2Q2A A;  1MY1 A;  2DXY A;  3MZ1 A;  1FQF A;  2RIN A;  3FXQ A;  1QKB A;  4R6K A;  1Y1Z A;  3KN3 A;  1GV8 A;  2A5T B;  4IO4 A;  4PFW A;  1ANF A;  2Z22 A;  1B7Z A;  2XXI A;  1FW0 A;  2GHB A;  2G29 A;  3OEM A;  4XKP A;  3UGW A;  4F1Y A;  5L9S A;  4XXU A;  1II5 A;  4F39 A;  1OQH A;  3MVZ A;  3TUS A;  4QFL A;  3W9W A;  3PUZ E;  1PC3 A;  4QFK A;  3EPE A;  1B3L A;  1WDN A;  1MPD A;  4OWD A;  1IQ7 A;  3FIR A;  1D9V A;  1LLS A;  1EZP A;  1EZO A;  3USD A;  2XXP A;  3R6U A;  2XX7 A;  4OFJ A;  2RCB A;  3K6U A;  2G93 A;  3C32 A;  2ZNU A;  3PPO A;  3L6H A;  5AA2 B;  1USY H;  5TPA A;  1XVY A;  3RN8 A;  4JDF A;  5DYH A;  4DIG A;  2XXX A;  2OLB A;  3MZB A;  2RKM A;  5H8N B;  2D3I A;  1L5T A;  1NH7 A;  4YMB A;  3U1O A;  3B6W A;  4ELO A;  3KOT A;  4F1U A;  2XXV A;  1TFA A;  3LBS A;  4H6D A;  1US5 A;  3M3L A;  4OER A;  3SKP A;  1JET A;  3O2A A;  3O97 A;  1PB8 A;  1JEV A;  2QS4 A;  2LAO A;  1H76 A;  5I58 A;  4G68 B;  1XT8 A;  3GXA A;  3FXU A;  3SEY A;  2ZNT A;  3VVD A;  2ZYO A;  4R74 A;  1B5H A;  4E0W A;  2Y7R A;  4ZZE A;  4NMY A;  5FTH A;  4U23 A;  1D3K A;  3IR1 A;  3E4R A;  4HCY A;  2F97 A;  1B0L A;  1Y4C A;  1ZMG A;  4EUO A;  3HCQ A;  1Q35 A;  3ZSF A;  2Z8D A;  1P99 A;  1B58 A;  1O63 A;  5TPA B;  4TLM B;  1Z7M E;  2O1M A;  5JTY A;  4XKR A;  3KGC A;  1NMU A;  3TFL A;  3CSG A;  3U92 A;  4WED A;  3D4C A;  3HST A;  3W9V A;  1UQW A;  3KJ7 A;  3GBA A;  4YIC A;  3CIJ A;  3MVX A;  3ZS6 A;  4G8N A;  1EZ9 A;  3PMV A;  4LZ7 A;  2ONS A;  4K3F A;  1SVX B;  3KFM A;  4BDR A;  3QSL A;  4PQJ A;  3S9L C;  3KZG A;  3U8Q A;  1CB6 A;  5F7V A;  3IOW A;  4U4X A;  4MLQ A;  4YKK A;  5I57 B;  3MBP A;  2F7B A;  3H7M A;  2E0S A;  4GOT A;  4F2O A;  4MFI A;  2OBG A;  4M1V A;  1NKX A;  3VLW A;  3TTR A;  5BWJ A;  3IOR A;  5B70 A;  1SW5 A;  4IO7 A;  1SDX A;  4THI A;  4PFT A;  4YB6 A;  3UOR A;  3O6H A;  3UP9 A;  1SBP A;  3FV2 A;  4NF4 A;  2Y7P A;  4DDD A;  1B9J A;  1FTM A;  1J1N A;  3H6W A;  4KYS A;  1XS5 A;  4FOR A;  4YKJ A;  4F18 A;  4NWD A;  2IEE A;  2O69 A;  5JTY B;  5CRY A;  1QUI A;  3G3F A;  3GLB A;  2DE3 A;  1TFD A;  2CZL A;  4LQ5 A;  3T93 B;  5ELV A;  1Y3Q A;  1JQF A;  4U2R A;  2VD2 A;  1D4N A;  4OVJ A;  1ATG A;  1H45 A;  4ZEB A;  1PDA A;  3DP6 A;  3TEP A;  4JWO A;  3CG3 A;  4QFO A;  1SYI A;  4POX A;  3FVN A;  4JSO A;  4F29 A;  1MY2 A;  2NUV A;  4JB7 A;  1B6H A;  3LSX A;  2VHA A;  1MPB A;  3MWB A;  4OEN A;  3KN8 A;  3PUV E;  4G68 C;  2ZYM A;  3V89 B;  4GXS B;  4I62 A;  4PFU A;  2RC9 A;  3I6V A;  2HCA A;  5JK4 A;  3RUM A;  2O84 X;  4H5G A;  4GQO A;  2B65 A;  3M8U A;  1MXX A;  4U1Z A;  1ZBM A;  1T0K A;  5I2K A;  4H67 A;  3I3V A;  1B1X A;  3TTN A;  1FTK A;  4O3A A;  1F9B A;  4LQ2 A;  3JYR A;  2ZXT A;  1S50 A;  2DE2 A;  2Z8F A;  3IB0 A;  4R9G A;  1B3E A;  4YKI A;  4Q5T A;  5AA1 A;  4H1X A;  4QSE A;  3DM0 A;  3MP8 A;  4QRZ A;  2V3T A;  1M5C A;  4NWC A;  5EHM A;  4AB6 A;  3OO8 A;  3FVO A;  4FED A;  3FV1 A;  5ICT A;  2XXR A;  3CFZ A;  3FGS A;  3W15 C;  2GFE A;  4IY6 A;  2I48 A;  1FTL A;  3K6X A;  1PB9 A;  4ELR A;  3A3C A;  4DXB A;  1B5I A;  3K1M A;  1FTJ A;  3DEL B;  3S9M C;  3PMW A;  3VV5 A;  4R6Y A;  3T22 A;  1N76 A;  3WAE A;  1UIU A;  1LB9 A;  1I6A A;  1R1N A;  3DLN A;  5I2K B;  2XX8 A;  4EQ9 A;  3KEI A;  2H25 A;  4IGT A;  4YB5 A;  1A8E A;  3CI8 A;  3TTK A;  1WVJ A;  3PV0 E;  4KPT A;  5K2Y A;  3IB1 A;  4ZEC A;  1LAH E;  2H98 A;  1POY 1;  1B2H A;  1N7W A;  4I8C A;  3TKD A;  1RYO A;  2O1L A;  4HTG A;  3K4U A;  1P1O A;  1B46 A;  3K1N A;  3AXF A;  4WXJ A;  3O29 A;  3UN6 A;  3FZV A;  2P0S A;  1FQB A;  3IOU A;  1LST A;  5KDT A;  2XXW A;  3QIM A;  5H8F A;  5CMM A;  4KR5 A;  3KJT A;  3TTM A;  3FD3 A;  2O7U A;  2ONR A;  1MY0 A;  1LFI A;  1URG A;  3RTF B;  4ZDM A;  1IIW A;  2REG A;  4XIG Q;  2F35 A;  3IJO B;  4G77 A;  1OVT A;  2GHA A;  5CBS A;  3OO9 A;  4FIM A;  3MPL A;  5CI5 A;  1MM6 A;  1DOT A;  1A7L A;  3KOS A;  1B3F A;  4ESW A;  2CMO A;  1POT A;  4HW8 A;  1USY E;  3BKI B;  3UIF A;  5AA3 A;  2H5Y A;  1QUL A;  2O51 A;  4QFN A;  4G8M A;  1SW1 A;  4MF3 A;  4M4G A;  3C33 A;  3IX1 A;  4KCD A;  4NF6 B;  5B7D A;  5KCJ B;  3CG1 A;  2Y84 A;  1GGG A;  1Y4T A;  3R7X A;  1B4Z A;  4TQU Q;  2QS2 A;  2R9J A;  2V3U A;  4BDL A;  5KDT B;  4RA1 A;  2KLF A;  3OEN A;  4EXK A;  5LOM A;  5AE4 A;  4KFQ A;  3FAS A;  1MQJ A;  2D5W A;  1DMB A;  4YKP A;  4RK9 A;  4EF1 A;  3PD8 A;  5FTI A;  1QKA A;  2UVI A;  3SEU A;  1NNK A;  3PPQ A;  4JWY A;  3C36 A;  3N6T A;  3HHG A;  2ANJ A;  2WKY A;  1NFT A;  3EQ1 A;  3VLU A;  3OO6 A;  5AA4 A;  1DPP A;  2HAU A;  4H8I A;  4KQP A;  2DWJ A;  4AB5 A;  3U93 A;  3PPR A;  1MXY A;  2ESN A;  3CR9 A;  1PEB A;  4KCC A;  3E9X A;  1Y1M A;  2H4I A;  4NF8 A;  3TAJ A;  4U1O A;  4FAT A;  1R9L A;  2D21 A;  4WEP A;  1AMF A;  3TCF A;  4F3P A;  2XXQ A;  3C31 A;  4QFP A;  1FCK A;  5CMB A;  1GTK A;  1P1Q A;  3SEW A;  3UK4 A;  2AYS A;  1N0T A;  2OZZ A;  2UVJ A;  1ZKB A;  3TQW A;  4DZ1 A;  1BTJ A;  4Z7E A;  4JWX A;  2XXU A;  3U94 A;  4BDN A;  5H8H A;  1OLA A;  2DXR A;  3LSF B;  3TDJ A;  3IB2 A;  4IO6 A;  4R6H A;  1UTB A;  1LCF A;  3B7D A;  2R71 A;  5FHN A;  3F11 A;  4OQO A;  3HO7 A;  5DVJ A;  4XKQ A;  1B5J A;  3Q25 A;  2QS3 A;  2Q9T A;  1CE2 A;  3T9H B;  1Z7N E;  1Y3N A;  2PT1 A;  2XD2 A;  2OJT A;  1LBB A;  3PPN A;  3RLF E;  4GL8 A;  4ZEF A;  4NF8 B;  1ELJ A;  3I5O A;  1LFH A;  2ABH A;  1TT1 A;  2QMX A;  1QUK A;  5A5X A;  3MVW A;  1VR5 A;  4LVQ A;  3SEV A;  2UVG A;  3T66 A;  1M5B A;  3MZ9 A;  5I58 B;  3TPA A;  1YPN A;  2V93 A;  2UYE A;  3MUQ A;  4DXU A;  3C9H A;  3TZA A;  3TCG A;  1M5E A;  3H6U A;  3K00 A;  3G7W A;  4BLA A;  3ZKK A;  3SDF A;  1XVX A;  3T9V A;  3MVY A;  4L17 A;  4U21 A;  3KBR A;  4N6P A;  1SW4 A;  3BBR A;  3VDF A;  1DTZ A;  1A8F A;  3H4Z A;  3C4M A;  2YPN A;  3H03 A;  1LBC A;  1XOC A;  4PFY A;  2F8D A;  5I84 A;  3ZKL A;  3IAZ A;  3OEL A;  4GFR A;  2V84 A;  2PT2 A;  1UIV A;  5DEX A;  3G3G A;  3BFT A;  4GXA A;  1BLF A;  2ALU A;  4UAC A;  5A5X B;  4P0G A;  2HQ0 A;  2I4B A;  4GRK A;  4YZZ A;  1FQE A;  2AIX A;  5TP9 A;  2DP8 A;  1RYX A;  3ILT B;  2ONK E;  3K6V A;  1SI0 A;  3PPP A;  3QYT A;  1FQD A;  3FVG A;  2I0C A;  4F3S A;  5ITO A;  4ELP A;  1S9T A;  3IOT A;  2Y7K A;  3BFU A;  3LR1 A;  1PB7 A;  4NF4 B;  1ZJL A;  2DQV A;  2DYX A;  3M3F A;  4RPN A;  3THI A;  3VXB A;  4X9T A;  4OES A;  1B3G A;  3N6U A;  2ZMB A;  2XXY A;  4F22 A;  4OHN A;  3O9P A;  3LSW A;  1HSL A;  2HEU A;  4NF5 A;  2NOO A;  3C35 A;  3VFJ A;  2QL3 A;  3IL1 B;  1VSO A;  3OMB A;  3ILU B;  1I6B A;  4ZEK A;  2HFB A;  3K1P A;  1B51 A;  2HZK A;  1HSJ A;  5L8D A;  4BDM A;  4G8H A;  2QS1 A;  4X1D A;  5DEX B;  3C34 A;  3OO7 A;  1AIV A;  3MPK A;  2F6P A;  3TQL A;  3LSL A;  4F2Q A;  4YMA A;  3H6T A;  1I6Q A;  3TMG A;  3IK6 B;  3WAF A;  1IXH A;  5TP9 B;  4G2Z A;  3UA8 A;  5HBC A;  1BKA A;  2ZNS A;  4ZS9 A;  2XD3 A;  4F3B A;  1O64 A;  4IGR A;  1LCT A;  4ZEI A;  2VGQ A;  1SD3 A;  2X7Q A;  3PD9 A;  4EQ7 A;  1MQH A;  4G4P A;  5AA2 D;  1YCJ A;  4I9D A;  3TEL A;  3KG2 A;  4BDO A;  1SQY A;  3O66 A;  1NNF A;  5H8Q A;  2QMW A;  3TCH A;  5ITP A;  3RNN A;  1VFE A;  5CBR A;  1VE4 A;  1IXG A;  1URS A;  1N7X A;  2I3W A;  1GVC A;  3VVE A;  1B05 A;  4NF5 B;  1LAX A;  4RY1 A;  5JEI A;  1IUD A;  5DVI A;  3FUZ A;  1HSE A;  3CFX A;  2PX1 A;  3OOA A;  4JBZ A;  3IOV A;  5I59 A;  3B6T A;  4TLL B;  5I2N A;  4O3C A;  1BP5 A;  4GWO A;  2NWJ A;  2OWT A;  3PUX E;  3CVG A;  3S9E A;  3RT6 B;  4KI0 E;  4R73 A;  5H8S A;  1B7H A;  3EN3 A;  4RPO A;  4IO2 A;  3SEX A;  2E1S A;  3OSR A;  3MQ9 A;  2UVH A;  2RC7 A;  2DVZ A;  3LC8 A;  4F1V A;  4DE8 A;  1DTG A;  1DPE A;  4H5F A;  3MW0 A;  4XTC Q;  3VVF A;  1A54 A;  2THI A;  3ECR A;  2Z23 A;  4LA9 A;  1NH8 A;  1A99 A;  2QPQ A;  1IZ1 A;  3LUY A;  3A3U A;  3JV9 A;  4WKM A;  1XHY A;  3T96 B;  5H8Q B;  1N3W A;  4GVO A;  3DP4 A;  3H3G A;  4ISU A;  1H3D A;  3QUJ A;  3Q27 A;  5J1D A;  2PBW A;  2X7P A;  3KSX A;  3S4U A;  1OMP A;  1ZU0 A;  4IB2 A;  3SET A;  5L9O A;  2I4C A;  1OLC A;  2XXT A;  4F31 B;  1JVX A;  4LON B;  3K6W A;  1M5F A;  2GRV A;  1NNP A;  4XKN A;  1MM7 A;  1O7T A;  2O68 A;  3N26 A;  5AA2 A;  1ZLQ A;  4FEB A;  4RK2 A;  2QSX A;  4E0X A;  3KSJ A;  3PU5 A;  1Y9U A;  4JXI A;  5DT6 A;  5M2V A;  1FTO A;  4TOZ A;  5DTB A;  3PUW E;  1S7Y A;  1EH3 A;  4AQ4 A;  2FYI A;  1D9Y A;  2I0B A;  4FEC A;  3SER A;  1GR2 A;  2OCU A;  4P0I A;  1MQD A;  3FXR A;  5H8N A;  2M8C A;  3RPW A;  4NTL A;  1LB8 A;  4POW A;  5H8F B;  3MJN A;  3EHS A;  1H44 A;  2W7Y A;  1LGB C;  4YB7 A;  1LAF E;  1MQG A;  2B3B A;  3G3K A;  2RCA A;  2FNC A;  1JVY A;  4ZED A;  4G68 A;  2F7C A;  2PMS A;  2H9B A;  1AL3 A;  4ELQ A;  4Q8R A;  2F78 A;  1JW4 A;  1SYH A;  2H99 A;  3N94 A;  1MXV A;  4OET A;  2VD3 A;  1MPC A;  3S2V A;  1IIT A;  1AH5 A;  4NE4 A;  3FVK A;  4HCW A;  1PBQ A;  2I6E A;  3ONM A;  4PET A;  4QF9 A;  1RKM A;  4FAJ A;  3RGY A;  1B1H A; 
#chains in the Genus database with same CATH topology
 4AS5 A;  2REJ A;  4HE0 A;  4OFL A;  4XEQ A;  2OK2 A;  2F6G A;  3RQT A;  1QVS A;  3O28 A;  3IJX B;  3VLV A;  1A40 A;  4OTE A;  4N15 A;  4ESX A;  1LFG A;  4H0W A;  4N07 A;  1FPG A;  4ND9 A;  2RF1 A;  2F3B A;  4Q30 B;  5F1Q A;  1TWY A;  4ONY A;  1R6Z A;  1QW0 A;  3OD7 A;  1B3H A;  1IEJ A;  5I7I A;  2QRY A;  1LBX A;  1MH4 A;  5I57 A;  1MG1 A;  3Q28 A;  1FQC A;  3V8X B;  3FAT A;  1KWH A;  3E79 A;  2CZK A;  4GBW A;  2P3V A;  4EF2 A;  1URD A;  2YJP A;  1QJM A;  4R2F A;  1EYJ A;  4R9F A;  4GWY A;  2HXR A;  1I69 A;  4PDH A;  1IME A;  4N13 A;  1FBP A;  4BDQ A;  5FHM A;  2DWA A;  2RC8 A;  1YTV A;  4JVD A;  2HXW A;  4PGN A;  5IGA A;  1MS7 A;  5AA4 B;  4PGP A;  3A09 A;  3V5A A;  2B3F A;  3PUY E;  4PE5 B;  4MLV A;  2HZL A;  3DP8 A;  1RDY A;  3G3H A;  2I49 A;  2XA5 A;  4RJZ A;  1NUX A;  3EHT A;  1Q9D A;  3H06 B;  4OZ9 A;  3E78 A;  3K01 A;  4ZE9 A;  3SZP A;  3TOD A;  3PGF A;  4DXC A;  4C0R A;  2IA4 A;  2NVU B;  4Z0I A;  3QK6 A;  4KYE A;  4QSC A;  2Q89 A;  4QHQ A;  2F5X A;  5KZT A;  4OVQ A;  3OSQ A;  2V3Q A;  2V25 A;  1Y20 A;  3CSB A;  4OFO A;  1Q1K A;  2P2A A;  1IXC A;  2XXH A;  1NV5 A;  4OXV A;  1JW1 A;  2A5S A;  3GBB A;  4MNC A;  2DE4 A;  5DVF A;  1BK4 A;  3RPL B;  4ZZA A;  4RXL A;  1NI9 A;  5EQ9 A;  1DK4 A;  4HXV A;  5H8H B;  1WOD A;  2QJE A;  2XWO A;  1P1U A;  4GF8 A;  2PVU A;  2R6G E;  2AL4 A;  1UTB B;  2O7I A;  4F3G A;  4OEU A;  3MP1 A;  5F24 A;  1OIB A;  4H46 A;  2ZYK A;  2Q88 A;  4R75 A;  4OVR A;  3D4G A;  2VP1 A;  3KN7 A;  4QSD A;  4P3L A;  2QFL A;  4GD5 A;  1SI1 A;  5HM4 B;  1MXU A;  1MRP A;  1P1N A;  5T3J A;  4NED A;  2NXO A;  5BUU A;  2DVC A;  1MH3 A;  5FHO A;  2YLN A;  3N5L A;  3T9X B;  5EYF A;  4NHB A;  4DCY A;  3E3K A;  1LBV A;  1B32 A;  4LAT A;  3EHU A;  4P8B A;  4HS7 A;  2VOZ A;  4O3B A;  4JSD A;  1BIY A;  3CHG A;  2WBB A;  1A55 A;  1EU8 A;  3QXM A;  3JZJ A;  5L9M A;  1SW2 A;  4FE8 A;  3VE1 B;  2F36 A;  1NNT A;  4PE3 A;  2F7A A;  4PBH A;  4H65 A;  3U72 A;  1NL5 A;  1R9Q A;  1NUW A;  3O6I A;  4PP0 A;  4OVT A;  3B6Q A;  4GIZ A;  3M3K A;  5I56 A;  5IM2 A;  1DBZ A;  3IFA A;  3IO4 A;  1AOV A;  3PMX A;  2XWV A;  4MHF A;  2FBP A;  5ET5 A;  4P11 A;  3P7I A;  4EXL A;  5CMK A;  4FJP A;  3EF7 A;  3GZG A;  2DOJ A;  3HPI A;  2DSF A;  1MDP 1;  2XXK A;  1FBH A;  4MH5 A;  3K2D A;  2PYY A;  5ICQ A;  1FPE A;  1JEU A;  1MDQ A;  2Y5K A;  1JW5 A;  3HN0 A;  3H6V A;  3HV1 A;  1B52 A;  4RNS A;  2Q8J A;  4IO5 A;  2I58 A;  1NV3 A;  1N3X A;  5ISU A;  5TU0 A;  4IR8 A;  1US4 A;  1MXW A;  3TYH A;  5CMC A;  2O6A A;  2GH9 A;  2UYF A;  3D1R A;  3S9N C;  2AL5 A;  4Q0C A;  1N84 A;  4AS4 A;  4KD5 A;  4LP2 B;  4O7M A;  1TXF A;  2Z8E A;  3QAX A;  4I1D A;  2Y7W A;  4OEV A;  2I3V A;  4GWS A;  4KYD A;  4IY5 A;  4GL0 A;  2UXA A;  4MBP A;  3G3I A;  5I56 B;  4PAI A;  4OYV A;  1LAG E;  2HAV A;  2HHM A;  3MAM A;  3FJM A;  3L6G A;  1MY4 A;  1B7U A;  4U22 A;  4C1T A;  4YU0 A;  3Q26 A;  4H8J A;  1VFD A;  2F34 A;  1FQA A;  1Y3P A;  4NF0 A;  4PBQ A;  1YAE A;  3G3J A;  3RTW B;  4KHZ E;  3CFL A;  5IKB A;  4EQB A;  4UA8 A;  5EHS A;  5ET7 A;  1FPB A;  3VXC A;  4LZ8 A;  3IO6 A;  4LZ5 A;  4GLI A;  5HPQ A;  4C1U A;  1OQG A;  4X48 A;  1QUJ A;  4ECF A;  2PFY A;  3OEK A;  1JNF A;  2BJJ X;  1MY3 A;  2XWK A;  4IO3 A;  5CC2 A;  2XHD A;  4YAH X;  2DWI A;  3CRB A;  1UTH A;  2QVV A;  2OWS A;  4OMB A;  1LBY A;  4RYA A;  4X1B A;  4EDP A;  3V83 A;  3FJG A;  4MMP A;  1FRP A;  3RY3 A;  1DSN A;  5ET6 A;  1ZTY A;  5IAI A;  3K0V A;  3QUF A;  1P1W A;  2A5T A;  3RT8 A;  2ZYN A;  2Q2C A;  4NF6 A;  3R26 A;  1H43 A;  3SES A;  5J16 A;  5KCJ A;  1OVB A;  4R2B A;  1B4H A;  4DCX A;  1XC1 A;  3B50 A;  1PBP A;  3TTL A;  2CEX A;  1M5D A;  3K02 A;  4NAP A;  2FA7 A;  2DWH A;  2XX9 A;  2DS9 A;  3FJ7 A;  4U4S A;  5ET8 A;  3Q29 A;  2JJK A;  5K2X A;  4ZE8 A;  3MC2 A;  3O6G A;  3ODB A;  2FIE A;  4DLD A;  1IXI A;  4F19 A;  3MP6 A;  3HHF A;  1EYI A;  2Y7I A;  3OXN A;  1N04 A;  3T9U A;  4FBP A;  5CM6 A;  4LUB A;  1MQI A;  1ZIU A;  1B0H A;  1B40 A;  3E13 X;  1MXZ A;  4R72 A;  5I59 B;  2P1S A;  2X26 A;  5I2N B;  1UTH B;  4P56 A;  2Q2A A;  1MY1 A;  2DXY A;  1AWB A;  3MZ1 A;  1FQF A;  2RIN A;  3FXQ A;  1RDX A;  1QKB A;  1FJ6 A;  4R6K A;  1Y1Z A;  3KN3 A;  1GV8 A;  2A5T B;  4IO4 A;  4PFW A;  2VT5 A;  1ANF A;  2Z22 A;  1B7Z A;  2XXI A;  1FW0 A;  2GHB A;  2G29 A;  3OEM A;  2P3N A;  4XKP A;  3UGW A;  5EQA A;  4F1Y A;  5L9S A;  3IFC A;  4XXU A;  1II5 A;  4F39 A;  1OQH A;  3MVZ A;  3TUS A;  4QFL A;  3W9W A;  3PUZ E;  1PC3 A;  4QFK A;  3EPE A;  1B3L A;  1WDN A;  1MPD A;  4OWD A;  1IQ7 A;  2ZZX A;  3FIR A;  1D9V A;  1LLS A;  1EZP A;  1EZO A;  3USD A;  2XXP A;  3R6U A;  4MEV A;  2XX7 A;  4OFJ A;  2RCB A;  3K6U A;  2G93 A;  3C32 A;  2ZNU A;  1NV0 A;  3PPO A;  3L6H A;  5AA2 B;  1USY H;  5TPA A;  1XVY A;  1FPK A;  3RN8 A;  4JDF A;  4PFR A;  5DYH A;  1FBF A;  4DIG A;  2XXX A;  2OLB A;  3MZB A;  4NX1 A;  4O8M A;  2Q8M A;  2RKM A;  5H8N B;  2D3I A;  1L5T A;  1NH7 A;  4YMB A;  3U1O A;  3B6W A;  4ELO A;  3KOT A;  1G0H A;  4NG7 A;  4F1U A;  2XXV A;  1TFA A;  3LBS A;  4H6D A;  1US5 A;  3M3L A;  4OER A;  3SKP A;  1JET A;  1LEV A;  3O2A A;  3O97 A;  1PB8 A;  1JEV A;  2QS4 A;  2LAO A;  1FJ9 A;  2WEF A;  1H76 A;  5I58 A;  4G68 B;  1XT8 A;  3GXA A;  1EYK A;  3FXU A;  3SEY A;  2ZNT A;  4GWX A;  3VVD A;  2ZYO A;  4R74 A;  1B5H A;  5LTC A;  4E0W A;  2Y7R A;  4ZZE A;  4NMY A;  5FTH A;  4U23 A;  1D3K A;  4GX3 A;  3IR1 A;  3E4R A;  4HCY A;  2F97 A;  1B0L A;  1Y4C A;  1ZMG A;  4OVS A;  4EUO A;  2ZZV A;  3HCQ A;  1Q35 A;  3ZSF A;  2Z8D A;  1P99 A;  1B58 A;  1O63 A;  5TPA B;  4TLM B;  1Z7M E;  2O1M A;  5JTY A;  4XKR A;  3KGC A;  1NMU A;  3TFL A;  3CSG A;  3U92 A;  4WED A;  3D4C A;  3HST A;  3W9V A;  1UQW A;  3KJ7 A;  3GBA A;  4YIC A;  3CIJ A;  3MVX A;  3ZS6 A;  4G8N A;  1EZ9 A;  3PMV A;  4LZ7 A;  2ONS A;  4K3F A;  1SVX B;  3KFM A;  4BDR A;  3QSL A;  4PQJ A;  3S9L C;  3KZG A;  3U8Q A;  1CB6 A;  5F7V A;  3IOW A;  2ZZW A;  4U4X A;  1K9Z A;  4MLQ A;  4YKK A;  5I57 B;  3MBP A;  2F7B A;  4DI3 D;  1IMA A;  3H7M A;  2E0S A;  4GOT A;  4F2O A;  1QGX A;  4MFI A;  1IMF A;  2OBG A;  4XFE A;  1FBE A;  4M1V A;  1NKX A;  3VLW A;  3TTR A;  5BWJ A;  3IOR A;  5B70 A;  1SW5 A;  2DDK A;  4IO7 A;  1SDX A;  4GBV A;  2CZI A;  4THI A;  4PFT A;  3LV0 A;  4YB6 A;  3UOR A;  3O6H A;  1YXI A;  3UP9 A;  1SBP A;  3FV2 A;  4NF4 A;  4PAF A;  2Y7P A;  4DDD A;  1B9J A;  1FTM A;  1J1N A;  3H6W A;  4KYS A;  1XS5 A;  4FOR A;  4YKJ A;  4F18 A;  4NWD A;  2IEE A;  2O69 A;  4GWW A;  5JTY B;  5CRY A;  1QUI A;  3G3F A;  3GLB A;  2DE3 A;  1TFD A;  2CZL A;  4LQ5 A;  3T93 B;  5ELV A;  1Y3Q A;  1JQF A;  4U2R A;  2VD2 A;  1D4N A;  4OVJ A;  1ATG A;  1H45 A;  4ZEB A;  1PDA A;  3DP6 A;  3TEP A;  4JWO A;  3CG3 A;  1NV1 A;  4QFO A;  1SYI A;  3MYU A;  4POX A;  3FVN A;  4JSO A;  3RYD A;  4F29 A;  1MY2 A;  2NUV A;  4JB7 A;  1B6H A;  3LSX A;  2VHA A;  1MPB A;  3MWB A;  4OEN A;  1FSA A;  3KN8 A;  3PUV E;  4G68 C;  2ZYM A;  3V89 B;  4GXS B;  1INP A;  2XWI A;  4I62 A;  4MJO A;  4PFU A;  2RC9 A;  2PCR A;  3I6V A;  4PF8 A;  2HCA A;  5JK4 A;  3RUM A;  2O84 X;  4X8R A;  4H5G A;  4PFI A;  4GQO A;  2B65 A;  3M8U A;  1MXX A;  4U1Z A;  4NN3 A;  1ZBM A;  1KZ8 A;  1T0K A;  5I2K A;  4H67 A;  3I3V A;  1B1X A;  3TTN A;  1FTK A;  4O3A A;  1F9B A;  4LQ2 A;  3JYR A;  2V4C A;  3MST A;  2ZXT A;  1S50 A;  2DE2 A;  5I5P A;  2Z8F A;  3IB0 A;  4R9G A;  1B3E A;  4N4U A;  4YKI A;  4Q5T A;  4N81 A;  5AA1 A;  4NGU A;  4H1X A;  4QSE A;  3DM0 A;  3MP8 A;  4QRZ A;  2V3T A;  1M5C A;  4NWC A;  5EHM A;  4AB6 A;  2MKZ A;  3OO8 A;  3BIH A;  1IMD A;  3FVO A;  3FBP A;  4FED A;  3FV1 A;  5ICT A;  2XXR A;  3CFZ A;  3FGS A;  3W15 C;  1NV2 A;  2GFE A;  4OAN A;  1NUY A;  4IY6 A;  2I48 A;  1FTL A;  3K6X A;  1PB9 A;  4ELR A;  3A3C A;  4DXB A;  3A29 A;  1B5I A;  3K1M A;  1FTJ A;  3KC0 A;  4QBA A;  3DEL B;  3S9M C;  3PMW A;  4HE1 A;  4N17 A;  3VV5 A;  4R6Y A;  3T22 A;  1N76 A;  2WYP A;  3WAE A;  4MAG A;  2WYK A;  1UIU A;  1LB9 A;  1I6A A;  1R1N A;  4MCO A;  3DLN A;  5I2K B;  2XX8 A;  4EQ9 A;  3KEI A;  2H25 A;  4IGT A;  4YB5 A;  1A8E A;  4P47 A;  3CI8 A;  3TTK A;  2Q74 A;  5EQ7 A;  1WVJ A;  1FBC A;  3PV0 E;  4KPT A;  5K2Y A;  3IB1 A;  4ZEC A;  1LAH E;  2H98 A;  1POY 1;  1B2H A;  1N7W A;  4I8C A;  3TKD A;  1RYO A;  2O1L A;  4HTG A;  3K4U A;  2CZH A;  1P1O A;  1B46 A;  3K1N A;  3AXF A;  1LBW A;  4WXJ A;  5IZZ A;  3ISP A;  3O29 A;  3UN6 A;  3FZV A;  2P0S A;  1FQB A;  2OWZ A;  3IOU A;  1LST A;  5KDT A;  2XXW A;  2HPG A;  3FXB A;  3QIM A;  5H8F A;  5CMM A;  4KR5 A;  3KJT A;  3TTM A;  3FD3 A;  4N91 A;  2O7U A;  2ONR A;  5IZ3 A;  1MY0 A;  1LFI A;  1URG A;  3RTF B;  4ZDM A;  1IIW A;  2REG A;  4XIG Q;  2F35 A;  3IJO B;  4G77 A;  1OVT A;  2GHA A;  5CBS A;  3OO9 A;  4FIM A;  3MPL A;  5CI5 A;  1MM6 A;  1DOT A;  4N8G A;  2PFZ A;  5EYH A;  1A7L A;  3KOS A;  1B3F A;  4ESW A;  2CMO A;  1POT A;  4HW8 A;  1USY E;  3BKI B;  3UIF A;  5AA3 A;  2H5Y A;  1QUL A;  2O51 A;  4QFN A;  4G8M A;  1SW1 A;  4MF3 A;  4N8Y A;  4M4G A;  3C33 A;  4KXP A;  3IX1 A;  4KCD A;  4NF6 B;  5B7D A;  1FPF A;  3EKI A;  4DI4 B;  5KCJ B;  3CG1 A;  2Y84 A;  1GGG A;  1Y4T A;  3R7X A;  1B4Z A;  4TQU Q;  2QS2 A;  2R9J A;  2V3U A;  1K9Y A;  4BDL A;  5KDT B;  4RA1 A;  2KLF A;  3OEN A;  4OVP A;  4EXK A;  5LOM A;  5AE4 A;  4KFQ A;  3FAS A;  1MQJ A;  3U65 A;  2D5W A;  1DMB A;  4YKP A;  4RK9 A;  4EF1 A;  1FPD A;  3PD8 A;  5FTI A;  1QKA A;  2UVI A;  1KA0 A;  3SEU A;  1NUZ A;  1NNK A;  3PPQ A;  4JWY A;  3C36 A;  2VPN A;  2Y5L A;  2OX3 A;  3N6T A;  2QVU A;  1LBZ A;  4I40 A;  3HHG A;  2ANJ A;  2WKY A;  1NFT A;  3EQ1 A;  3VLU A;  3OO6 A;  5AA4 A;  1DPP A;  2B4M A;  2HAU A;  5DW8 A;  4H8I A;  4KQP A;  2DWJ A;  4AB5 A;  3U93 A;  3PPR A;  1MXY A;  2ESN A;  3CR9 A;  1PEB A;  4KCC A;  3E9X A;  1Y1M A;  2H4I A;  4NF8 A;  3T0J A;  3TAJ A;  2FIX A;  4U1O A;  4FAT A;  1R9L A;  2D21 A;  4WEP A;  1AMF A;  1SPI A;  3TCF A;  4QFP A;  2XXQ A;  3C31 A;  4F3P A;  1FCK A;  1RDZ A;  5CMB A;  1GTK A;  1P1Q A;  3SEW A;  3UK4 A;  2AYS A;  1N0T A;  2OZZ A;  2UVJ A;  1ZKB A;  1VDW A;  4N6D A;  4I3Y A;  4X04 A;  3TQW A;  4DZ1 A;  1BTJ A;  4Z7E A;  3RPL A;  4JWX A;  2XXU A;  3U94 A;  4BDN A;  4QXD A;  5H8H A;  1OLA A;  2DXR A;  3LSF B;  3TDJ A;  3IB2 A;  4IO6 A;  4JVC A;  4R6H A;  1UTB A;  1LCF A;  3B7D A;  2R71 A;  5FHN A;  3F11 A;  4OQO A;  3HO7 A;  5DVJ A;  4XKQ A;  1B5J A;  3Q25 A;  1FPI A;  4PCD A;  2QS3 A;  2Q9T A;  1CE2 A;  3T9H B;  1Z7N E;  1Y3N A;  4PFB A;  2PT1 A;  2XD2 A;  2OJT A;  1LBB A;  3PPN A;  3T1B A;  3RLF E;  4GL8 A;  4NF8 B;  4ZEF A;  1ELJ A;  3I5O A;  1LFH A;  2ABH A;  1TT1 A;  3PTY A;  2QMX A;  1QUK A;  3HFU A;  5A5X A;  3MVW A;  1VR5 A;  4LVQ A;  3SEV A;  2UVG A;  3T66 A;  1M5B A;  4PC9 A;  3MZ9 A;  5I58 B;  3TPA A;  1YPN A;  2V93 A;  2UYE A;  3MUQ A;  4DXU A;  3C9H A;  3TZA A;  3TCG A;  1M5E A;  3H6U A;  4HE2 A;  3K00 A;  3G7W A;  4BLA A;  1IMB A;  3SDF A;  3ZKK A;  1XVX A;  3T9V A;  3MVY A;  4L17 A;  4U21 A;  2QVR A;  3KBR A;  4N6P A;  1SW4 A;  3BBR A;  3VDF A;  4I3E A;  1DTZ A;  1A8F A;  4OA4 A;  3H4Z A;  3C4M A;  3QMF A;  2YPN A;  3H03 A;  1LBC A;  1XOC A;  4PFY A;  5IZ1 A;  2F3D A;  2F8D A;  5I84 A;  4XF5 A;  3ZKL A;  3IAZ A;  3OEL A;  4GFR A;  2V84 A;  2PT2 A;  1UIV A;  5DEX A;  3G3G A;  3BFT A;  4GXA A;  1BLF A;  2ALU A;  4UAC A;  5A5X B;  4P0G A;  2HQ0 A;  2I4B A;  4GRK A;  4YZZ A;  1FQE A;  2AIX A;  5EYG A;  5TP9 A;  2DP8 A;  2CEY A;  1RYX A;  3ILT B;  2ONK E;  4UAB A;  3K6V A;  1SI0 A;  3PPP A;  3QYT A;  1FQD A;  3FVG A;  2I0C A;  4F3S A;  5ITO A;  4ELP A;  1S9T A;  3IOT A;  2Y7K A;  3BFU A;  1DCU A;  3LR1 A;  1PB7 A;  4NF4 B;  3ROJ A;  1ZJL A;  2DQV A;  2DYX A;  3M3F A;  3NOH A;  4PF6 A;  4RPN A;  3THI A;  3VXB A;  4X9T A;  4OES A;  1B3G A;  2KQZ A;  3N6U A;  2ZMB A;  2XXY A;  4F22 A;  4OHN A;  3O9P A;  4MNI A;  2FHY A;  1FPL A;  3BIG A;  3LSW A;  1HSL A;  2VPO A;  3LUZ A;  4PAK A;  5A5L A;  2HEU A;  4NF5 A;  2NOO A;  3C35 A;  3VFJ A;  2QL3 A;  3IL1 B;  1VSO A;  3OMB A;  3ILU B;  1I6B A;  4ZEK A;  2HFB A;  3K1P A;  1B51 A;  2HZK A;  1HSJ A;  5L8D A;  4BDM A;  4G8H A;  2QS1 A;  4X1D A;  5DEX B;  5I3S A;  3C34 A;  3OO7 A;  1AIV A;  4PTK A;  3MPK A;  2F6P A;  3TQL A;  1D9Q A;  3GYY A;  3LSL A;  4F2Q A;  4YMA A;  3H6T A;  1I6Q A;  3TMG A;  3IK6 B;  3WAF A;  1IXH A;  4GX4 A;  5TP9 B;  4G2Z A;  3UA8 A;  5HBC A;  1BKA A;  2ZNS A;  4ZS9 A;  1NV6 A;  4GX6 A;  2XD3 A;  4F3B A;  1O64 A;  4IGR A;  5FBP A;  1LCT A;  4ZEI A;  2VGQ A;  4LN5 A;  1SD3 A;  2X7Q A;  3PD9 A;  4EQ7 A;  1MQH A;  4G4P A;  4GWZ A;  5AA2 D;  1KA1 A;  1YCJ A;  4I9D A;  3TEL A;  3KG2 A;  4BDO A;  1SQY A;  3O66 A;  3KBZ A;  1NNF A;  5H8Q A;  2QMW A;  4NQ8 A;  3TCH A;  1YZ0 A;  5ITP A;  3RNN A;  1VFE A;  5CBR A;  1VE4 A;  1IXG A;  1URS A;  1N7X A;  2I3W A;  1GVC A;  3VVE A;  1B05 A;  4NF5 B;  1FBG A;  1FBD A;  1FPJ A;  1LAX A;  4RY1 A;  5JEI A;  1IUD A;  5DVI A;  3FUZ A;  1HSE A;  3CFX A;  2PX1 A;  3OOA A;  4JBZ A;  1YYZ A;  4O7I A;  3IOV A;  2WBD A;  5I59 A;  3B6T A;  4TLL B;  5I2N A;  4G61 A;  4O3C A;  1BP5 A;  4GWO A;  2NWJ A;  2OWT A;  3PUX E;  3CVG A;  3S9E A;  2B4L A;  3RT6 B;  4KI0 E;  5EQ8 A;  4R73 A;  2KR0 A;  5H8S A;  1B7H A;  3EN3 A;  4RPO A;  4IO2 A;  3SEX A;  2E1S A;  3OSR A;  3MQ9 A;  2WX9 A;  2UVH A;  2RC7 A;  4P1E A;  2DVZ A;  3LC8 A;  4F1V A;  4DE8 A;  2R8T A;  1DTG A;  1DPE A;  4H5F A;  3MW0 A;  4XTC Q;  3VVF A;  1A54 A;  2THI A;  3ECR A;  2Z23 A;  4LA9 A;  1IMC A;  4N6K A;  1NH8 A;  1A99 A;  4P9K A;  3KC1 A;  2QPQ A;  5LDZ A;  1IZ1 A;  3LUY A;  3A3U A;  3JV9 A;  4WKM A;  1XHY A;  3T96 B;  5H8Q B;  1N3W A;  4H45 A;  4GVO A;  3DP4 A;  3H3G A;  4ISU A;  4PDD A;  1H3D A;  3QUJ A;  3Q27 A;  5J1D A;  2PBW A;  3B8B A;  2X7P A;  3KSX A;  3S4U A;  1OMP A;  1ZU0 A;  4IB2 A;  3SET A;  4O94 A;  5L9O A;  2I4C A;  1OLC A;  2FVZ A;  2XXT A;  4JVI A;  4F31 B;  1JVX A;  4LON B;  3K6W A;  1M5F A;  2GRV A;  1NNP A;  4XKN A;  1MM7 A;  1G0I A;  1O7T A;  2O68 A;  3N26 A;  5AA2 A;  1ZLQ A;  4FEB A;  4RK2 A;  2QSX A;  4E0X A;  3KSJ A;  3PU5 A;  1Y9U A;  4JXI A;  5DT6 A;  5M2V A;  1FTO A;  4TOZ A;  5DTB A;  3PUW E;  1S7Y A;  1EH3 A;  4AQ4 A;  2FYI A;  1D9Y A;  2I0B A;  4FEC A;  3SER A;  4MX6 A;  1NV4 A;  1GR2 A;  2OCU A;  4P0I A;  4GWU A;  1MQD A;  1NV7 A;  3FXR A;  5H8N A;  2M8C A;  3RPW A;  4NTL A;  1LB8 A;  4POW A;  5H8F B;  3MJN A;  3EHS A;  4P1L A;  1H44 A;  2W7Y A;  1LGB C;  4YB7 A;  1LAF E;  1MQG A;  5IZ3 B;  2B3B A;  3G3K A;  2RCA A;  2FNC A;  1JVY A;  4ZED A;  4G68 A;  2F7C A;  2PMS A;  2H9B A;  1AL3 A;  4ELQ A;  4MNP A;  4Q8R A;  2GQ1 A;  2F78 A;  1JW4 A;  1SYH A;  1CNQ A;  2BJI A;  2H99 A;  5ESY A;  3N94 A;  4MIJ A;  1MXV A;  2L5V A;  4OET A;  2VD3 A;  1MPC A;  3S2V A;  1XI6 A;  1IIT A;  1AH5 A;  4NE4 A;  3FVK A;  4HCW A;  1PBQ A;  2I6E A;  3ONM A;  4PET A;  4QF9 A;  1RKM A;  4FAJ A;  3RGY A;  1FTA A;  1B1H A;  1JP4 A; 
#chains in the Genus database with same CATH homology
 2REJ A;  4OFL A;  2OK2 A;  2F6G A;  3RQT A;  1QVS A;  3O28 A;  3IJX B;  3VLV A;  1A40 A;  4OTE A;  4ESX A;  1LFG A;  4H0W A;  4N07 A;  4ND9 A;  2RF1 A;  4Q30 B;  5F1Q A;  1TWY A;  4ONY A;  1R6Z A;  1QW0 A;  3OD7 A;  1B3H A;  1IEJ A;  2QRY A;  1MH4 A;  5I57 A;  1MG1 A;  3Q28 A;  1FQC A;  3V8X B;  3FAT A;  1KWH A;  4EF2 A;  1URD A;  2YJP A;  1QJM A;  4R2F A;  4R9F A;  1I69 A;  4N13 A;  4BDQ A;  5FHM A;  2DWA A;  2RC8 A;  1YTV A;  2HXW A;  1MS7 A;  5AA4 B;  3A09 A;  3V5A A;  2B3F A;  3PUY E;  4PE5 B;  4MLV A;  2HZL A;  3DP8 A;  3G3H A;  2I49 A;  4RJZ A;  3EHT A;  3H06 B;  4OZ9 A;  3K01 A;  4ZE9 A;  3TOD A;  3PGF A;  4DXC A;  4C0R A;  2IA4 A;  2NVU B;  4Z0I A;  3QK6 A;  4KYE A;  4QSC A;  2Q89 A;  4QHQ A;  2F5X A;  5KZT A;  3OSQ A;  2V3Q A;  2V25 A;  1Y20 A;  3CSB A;  4OFO A;  1Q1K A;  2P2A A;  1IXC A;  2XXH A;  4OXV A;  1JW1 A;  2A5S A;  3GBB A;  2DE4 A;  5DVF A;  4ZZA A;  4RXL A;  5H8H B;  1WOD A;  2QJE A;  1P1U A;  4GF8 A;  2PVU A;  2R6G E;  2AL4 A;  1UTB B;  2O7I A;  4F3G A;  4OEU A;  3MP1 A;  1OIB A;  2ZYK A;  2Q88 A;  4R75 A;  3D4G A;  2VP1 A;  3KN7 A;  4QSD A;  4GD5 A;  1SI1 A;  5HM4 B;  1MXU A;  1MRP A;  1P1N A;  4NED A;  2NXO A;  5BUU A;  2DVC A;  1MH3 A;  5FHO A;  2YLN A;  3N5L A;  3T9X B;  5EYF A;  4DCY A;  3E3K A;  1B32 A;  4LAT A;  3EHU A;  4HS7 A;  2VOZ A;  4O3B A;  4JSD A;  1BIY A;  1A55 A;  1EU8 A;  3QXM A;  3JZJ A;  5L9M A;  1SW2 A;  4FE8 A;  3VE1 B;  2F36 A;  1NNT A;  2F7A A;  4H65 A;  3U72 A;  1NL5 A;  1R9Q A;  3O6I A;  4PP0 A;  3B6Q A;  4GIZ A;  3M3K A;  5I56 A;  3IO4 A;  1AOV A;  3PMX A;  4P11 A;  3P7I A;  4EXL A;  5CMK A;  4FJP A;  3EF7 A;  3GZG A;  2DOJ A;  3HPI A;  2DSF A;  1MDP 1;  4MH5 A;  3K2D A;  2PYY A;  5ICQ A;  1JEU A;  1MDQ A;  1JW5 A;  3HN0 A;  3H6V A;  3HV1 A;  1B52 A;  4RNS A;  2Q8J A;  4IO5 A;  2I58 A;  1N3X A;  5ISU A;  5TU0 A;  1US4 A;  1MXW A;  3TYH A;  5CMC A;  2O6A A;  2GH9 A;  2UYF A;  3S9N C;  2AL5 A;  4Q0C A;  1N84 A;  4KD5 A;  4LP2 B;  1TXF A;  2Z8E A;  3QAX A;  4I1D A;  2Y7W A;  4OEV A;  2I3V A;  4KYD A;  4IY5 A;  4GL0 A;  2UXA A;  4MBP A;  3G3I A;  5I56 B;  4OYV A;  1LAG E;  2HAV A;  3MAM A;  3FJM A;  3L6G A;  1MY4 A;  1B7U A;  4U22 A;  4C1T A;  4YU0 A;  3Q26 A;  4H8J A;  1VFD A;  2F34 A;  1FQA A;  1Y3P A;  1YAE A;  3G3J A;  3RTW B;  4KHZ E;  3CFL A;  5IKB A;  4EQB A;  4UA8 A;  5EHS A;  3VXC A;  4LZ8 A;  3IO6 A;  4LZ5 A;  4GLI A;  5HPQ A;  4C1U A;  1OQG A;  4X48 A;  1QUJ A;  4ECF A;  3OEK A;  1JNF A;  2BJJ X;  1MY3 A;  4IO3 A;  5CC2 A;  2XHD A;  4YAH X;  2DWI A;  3CRB A;  1UTH A;  2OWS A;  4OMB A;  4X1B A;  4RYA A;  4EDP A;  3V83 A;  3FJG A;  3RY3 A;  1DSN A;  1ZTY A;  5IAI A;  3K0V A;  3QUF A;  1P1W A;  2A5T A;  3RT8 A;  2ZYN A;  2Q2C A;  4NF6 A;  3R26 A;  1H43 A;  3SES A;  5KCJ A;  1OVB A;  4R2B A;  1B4H A;  4DCX A;  1XC1 A;  1PBP A;  3TTL A;  1M5D A;  3K02 A;  2FA7 A;  2DWH A;  2XX9 A;  2DS9 A;  3FJ7 A;  4U4S A;  3Q29 A;  5K2X A;  4ZE8 A;  3MC2 A;  3O6G A;  3ODB A;  4DLD A;  1IXI A;  4F19 A;  3MP6 A;  3HHF A;  2Y7I A;  3OXN A;  1N04 A;  3T9U A;  5CM6 A;  4LUB A;  1MQI A;  1ZIU A;  1B0H A;  1B40 A;  3E13 X;  1MXZ A;  4R72 A;  5I59 B;  2P1S A;  2X26 A;  5I2N B;  1UTH B;  2Q2A A;  1MY1 A;  2DXY A;  3MZ1 A;  1FQF A;  2RIN A;  3FXQ A;  1QKB A;  4R6K A;  1Y1Z A;  3KN3 A;  1GV8 A;  2A5T B;  4IO4 A;  4PFW A;  1ANF A;  2Z22 A;  1B7Z A;  2XXI A;  1FW0 A;  2GHB A;  2G29 A;  3OEM A;  4XKP A;  3UGW A;  4F1Y A;  5L9S A;  4XXU A;  1II5 A;  4F39 A;  1OQH A;  3MVZ A;  3TUS A;  4QFL A;  3W9W A;  3PUZ E;  1PC3 A;  4QFK A;  3EPE A;  1B3L A;  1WDN A;  1MPD A;  4OWD A;  1IQ7 A;  3FIR A;  1D9V A;  1LLS A;  1EZP A;  1EZO A;  3USD A;  2XXP A;  3R6U A;  2XX7 A;  4OFJ A;  2RCB A;  3K6U A;  2G93 A;  3C32 A;  2ZNU A;  3PPO A;  3L6H A;  5AA2 B;  1USY H;  5TPA A;  1XVY A;  3RN8 A;  4JDF A;  5DYH A;  4DIG A;  2XXX A;  2OLB A;  3MZB A;  2RKM A;  5H8N B;  2D3I A;  1L5T A;  1NH7 A;  4YMB A;  3U1O A;  3B6W A;  4ELO A;  3KOT A;  4F1U A;  2XXV A;  1TFA A;  3LBS A;  4H6D A;  1US5 A;  3M3L A;  4OER A;  3SKP A;  1JET A;  3O2A A;  3O97 A;  1PB8 A;  1JEV A;  2QS4 A;  2LAO A;  1H76 A;  5I58 A;  4G68 B;  1XT8 A;  3GXA A;  3FXU A;  3SEY A;  2ZNT A;  3VVD A;  2ZYO A;  4R74 A;  1B5H A;  4E0W A;  2Y7R A;  4ZZE A;  4NMY A;  5FTH A;  4U23 A;  1D3K A;  3IR1 A;  3E4R A;  4HCY A;  2F97 A;  1B0L A;  1Y4C A;  1ZMG A;  4EUO A;  3HCQ A;  1Q35 A;  3ZSF A;  2Z8D A;  1P99 A;  1B58 A;  1O63 A;  5TPA B;  4TLM B;  1Z7M E;  2O1M A;  5JTY A;  4XKR A;  3KGC A;  1NMU A;  3TFL A;  3CSG A;  3U92 A;  4WED A;  3D4C A;  3HST A;  3W9V A;  1UQW A;  3KJ7 A;  3GBA A;  4YIC A;  3CIJ A;  3MVX A;  3ZS6 A;  4G8N A;  1EZ9 A;  3PMV A;  4LZ7 A;  2ONS A;  4K3F A;  1SVX B;  3KFM A;  4BDR A;  3QSL A;  4PQJ A;  3S9L C;  3KZG A;  3U8Q A;  1CB6 A;  5F7V A;  3IOW A;  4U4X A;  4MLQ A;  4YKK A;  5I57 B;  3MBP A;  2F7B A;  3H7M A;  2E0S A;  4GOT A;  4F2O A;  4MFI A;  2OBG A;  4M1V A;  1NKX A;  3VLW A;  3TTR A;  5BWJ A;  3IOR A;  5B70 A;  1SW5 A;  4IO7 A;  1SDX A;  4THI A;  4PFT A;  4YB6 A;  3UOR A;  3O6H A;  3UP9 A;  1SBP A;  3FV2 A;  4NF4 A;  2Y7P A;  4DDD A;  1B9J A;  1FTM A;  1J1N A;  3H6W A;  4KYS A;  1XS5 A;  4FOR A;  4YKJ A;  4F18 A;  4NWD A;  2IEE A;  2O69 A;  5JTY B;  5CRY A;  1QUI A;  3G3F A;  3GLB A;  2DE3 A;  1TFD A;  2CZL A;  4LQ5 A;  3T93 B;  5ELV A;  1Y3Q A;  1JQF A;  4U2R A;  2VD2 A;  1D4N A;  4OVJ A;  1ATG A;  1H45 A;  4ZEB A;  1PDA A;  3DP6 A;  3TEP A;  4JWO A;  3CG3 A;  4QFO A;  1SYI A;  4POX A;  3FVN A;  4JSO A;  4F29 A;  1MY2 A;  2NUV A;  4JB7 A;  1B6H A;  3LSX A;  2VHA A;  1MPB A;  3MWB A;  4OEN A;  3KN8 A;  3PUV E;  4G68 C;  2ZYM A;  3V89 B;  4GXS B;  4I62 A;  4PFU A;  2RC9 A;  3I6V A;  2HCA A;  5JK4 A;  3RUM A;  2O84 X;  4H5G A;  4GQO A;  2B65 A;  3M8U A;  1MXX A;  4U1Z A;  1ZBM A;  1T0K A;  5I2K A;  4H67 A;  3I3V A;  1B1X A;  3TTN A;  1FTK A;  4O3A A;  1F9B A;  4LQ2 A;  3JYR A;  2ZXT A;  1S50 A;  2DE2 A;  2Z8F A;  3IB0 A;  4R9G A;  1B3E A;  4YKI A;  4Q5T A;  5AA1 A;  4H1X A;  4QSE A;  3DM0 A;  3MP8 A;  4QRZ A;  2V3T A;  1M5C A;  4NWC A;  5EHM A;  4AB6 A;  3OO8 A;  3FVO A;  4FED A;  3FV1 A;  5ICT A;  2XXR A;  3CFZ A;  3FGS A;  3W15 C;  2GFE A;  4IY6 A;  2I48 A;  1FTL A;  3K6X A;  1PB9 A;  4ELR A;  3A3C A;  4DXB A;  1B5I A;  3K1M A;  1FTJ A;  3DEL B;  3S9M C;  3PMW A;  3VV5 A;  4R6Y A;  3T22 A;  1N76 A;  3WAE A;  1UIU A;  1LB9 A;  1I6A A;  1R1N A;  3DLN A;  5I2K B;  2XX8 A;  4EQ9 A;  3KEI A;  2H25 A;  4IGT A;  4YB5 A;  1A8E A;  3CI8 A;  3TTK A;  1WVJ A;  3PV0 E;  4KPT A;  5K2Y A;  3IB1 A;  4ZEC A;  1LAH E;  2H98 A;  1POY 1;  1B2H A;  1N7W A;  4I8C A;  3TKD A;  1RYO A;  2O1L A;  4HTG A;  3K4U A;  1P1O A;  1B46 A;  3K1N A;  3AXF A;  4WXJ A;  3O29 A;  3UN6 A;  3FZV A;  2P0S A;  1FQB A;  3IOU A;  1LST A;  5KDT A;  2XXW A;  3QIM A;  5H8F A;  5CMM A;  4KR5 A;  3KJT A;  3TTM A;  3FD3 A;  2O7U A;  2ONR A;  1MY0 A;  1LFI A;  1URG A;  3RTF B;  4ZDM A;  1IIW A;  2REG A;  4XIG Q;  2F35 A;  3IJO B;  4G77 A;  1OVT A;  2GHA A;  5CBS A;  3OO9 A;  4FIM A;  3MPL A;  5CI5 A;  1MM6 A;  1DOT A;  1A7L A;  3KOS A;  1B3F A;  4ESW A;  2CMO A;  1POT A;  4HW8 A;  1USY E;  3BKI B;  3UIF A;  5AA3 A;  2H5Y A;  1QUL A;  2O51 A;  4QFN A;  4G8M A;  1SW1 A;  4MF3 A;  4M4G A;  3C33 A;  3IX1 A;  4KCD A;  4NF6 B;  5B7D A;  5KCJ B;  3CG1 A;  2Y84 A;  1GGG A;  1Y4T A;  3R7X A;  1B4Z A;  4TQU Q;  2QS2 A;  2R9J A;  2V3U A;  4BDL A;  5KDT B;  4RA1 A;  2KLF A;  3OEN A;  4EXK A;  5LOM A;  5AE4 A;  4KFQ A;  3FAS A;  1MQJ A;  2D5W A;  1DMB A;  4YKP A;  4RK9 A;  4EF1 A;  3PD8 A;  5FTI A;  1QKA A;  2UVI A;  3SEU A;  1NNK A;  3PPQ A;  4JWY A;  3C36 A;  3N6T A;  3HHG A;  2ANJ A;  2WKY A;  1NFT A;  3EQ1 A;  3VLU A;  3OO6 A;  5AA4 A;  1DPP A;  2HAU A;  4H8I A;  4KQP A;  2DWJ A;  4AB5 A;  3U93 A;  3PPR A;  1MXY A;  2ESN A;  3CR9 A;  1PEB A;  4KCC A;  3E9X A;  1Y1M A;  2H4I A;  4NF8 A;  3TAJ A;  4U1O A;  4FAT A;  1R9L A;  2D21 A;  4WEP A;  1AMF A;  3TCF A;  4F3P A;  2XXQ A;  3C31 A;  4QFP A;  1FCK A;  5CMB A;  1GTK A;  1P1Q A;  3SEW A;  3UK4 A;  2AYS A;  1N0T A;  2OZZ A;  2UVJ A;  1ZKB A;  3TQW A;  4DZ1 A;  1BTJ A;  4Z7E A;  4JWX A;  2XXU A;  3U94 A;  4BDN A;  5H8H A;  1OLA A;  2DXR A;  3LSF B;  3TDJ A;  3IB2 A;  4IO6 A;  4R6H A;  1UTB A;  1LCF A;  3B7D A;  2R71 A;  5FHN A;  3F11 A;  4OQO A;  3HO7 A;  5DVJ A;  4XKQ A;  1B5J A;  3Q25 A;  2QS3 A;  2Q9T A;  1CE2 A;  3T9H B;  1Z7N E;  1Y3N A;  2PT1 A;  2XD2 A;  2OJT A;  1LBB A;  3PPN A;  3RLF E;  4GL8 A;  4ZEF A;  4NF8 B;  1ELJ A;  3I5O A;  1LFH A;  2ABH A;  1TT1 A;  2QMX A;  1QUK A;  5A5X A;  3MVW A;  1VR5 A;  4LVQ A;  3SEV A;  2UVG A;  3T66 A;  1M5B A;  3MZ9 A;  5I58 B;  3TPA A;  1YPN A;  2V93 A;  2UYE A;  3MUQ A;  4DXU A;  3C9H A;  3TZA A;  3TCG A;  1M5E A;  3H6U A;  3K00 A;  3G7W A;  4BLA A;  3ZKK A;  3SDF A;  1XVX A;  3T9V A;  3MVY A;  4L17 A;  4U21 A;  3KBR A;  4N6P A;  1SW4 A;  3BBR A;  3VDF A;  1DTZ A;  1A8F A;  3H4Z A;  3C4M A;  2YPN A;  3H03 A;  1LBC A;  1XOC A;  4PFY A;  2F8D A;  5I84 A;  3ZKL A;  3IAZ A;  3OEL A;  4GFR A;  2V84 A;  2PT2 A;  1UIV A;  5DEX A;  3G3G A;  3BFT A;  4GXA A;  1BLF A;  2ALU A;  4UAC A;  5A5X B;  4P0G A;  2HQ0 A;  2I4B A;  4GRK A;  4YZZ A;  1FQE A;  2AIX A;  5TP9 A;  2DP8 A;  1RYX A;  3ILT B;  2ONK E;  3K6V A;  1SI0 A;  3PPP A;  3QYT A;  1FQD A;  3FVG A;  2I0C A;  4F3S A;  5ITO A;  4ELP A;  1S9T A;  3IOT A;  2Y7K A;  3BFU A;  3LR1 A;  1PB7 A;  4NF4 B;  1ZJL A;  2DQV A;  2DYX A;  3M3F A;  4RPN A;  3THI A;  3VXB A;  4X9T A;  4OES A;  1B3G A;  3N6U A;  2ZMB A;  2XXY A;  4F22 A;  4OHN A;  3O9P A;  3LSW A;  1HSL A;  2HEU A;  4NF5 A;  2NOO A;  3C35 A;  3VFJ A;  2QL3 A;  3IL1 B;  1VSO A;  3OMB A;  3ILU B;  1I6B A;  4ZEK A;  2HFB A;  3K1P A;  1B51 A;  2HZK A;  1HSJ A;  5L8D A;  4BDM A;  4G8H A;  2QS1 A;  4X1D A;  5DEX B;  3C34 A;  3OO7 A;  1AIV A;  3MPK A;  2F6P A;  3TQL A;  3LSL A;  4F2Q A;  4YMA A;  3H6T A;  1I6Q A;  3TMG A;  3IK6 B;  3WAF A;  1IXH A;  5TP9 B;  4G2Z A;  3UA8 A;  5HBC A;  1BKA A;  2ZNS A;  4ZS9 A;  2XD3 A;  4F3B A;  1O64 A;  4IGR A;  1LCT A;  4ZEI A;  2VGQ A;  1SD3 A;  2X7Q A;  3PD9 A;  4EQ7 A;  1MQH A;  4G4P A;  5AA2 D;  1YCJ A;  4I9D A;  3TEL A;  3KG2 A;  4BDO A;  1SQY A;  3O66 A;  1NNF A;  5H8Q A;  2QMW A;  3TCH A;  5ITP A;  3RNN A;  1VFE A;  5CBR A;  1VE4 A;  1IXG A;  1URS A;  1N7X A;  2I3W A;  1GVC A;  3VVE A;  1B05 A;  4NF5 B;  1LAX A;  4RY1 A;  5JEI A;  1IUD A;  5DVI A;  3FUZ A;  1HSE A;  3CFX A;  2PX1 A;  3OOA A;  4JBZ A;  3IOV A;  5I59 A;  3B6T A;  4TLL B;  5I2N A;  4O3C A;  1BP5 A;  4GWO A;  2NWJ A;  2OWT A;  3PUX E;  3CVG A;  3S9E A;  3RT6 B;  4KI0 E;  4R73 A;  5H8S A;  1B7H A;  3EN3 A;  4RPO A;  4IO2 A;  3SEX A;  2E1S A;  3OSR A;  3MQ9 A;  2UVH A;  2RC7 A;  2DVZ A;  3LC8 A;  4F1V A;  4DE8 A;  1DTG A;  1DPE A;  4H5F A;  3MW0 A;  4XTC Q;  3VVF A;  1A54 A;  2THI A;  3ECR A;  2Z23 A;  4LA9 A;  1NH8 A;  1A99 A;  2QPQ A;  1IZ1 A;  3LUY A;  3A3U A;  3JV9 A;  4WKM A;  1XHY A;  3T96 B;  5H8Q B;  1N3W A;  4GVO A;  3DP4 A;  3H3G A;  4ISU A;  1H3D A;  3QUJ A;  3Q27 A;  5J1D A;  2PBW A;  2X7P A;  3KSX A;  3S4U A;  1OMP A;  1ZU0 A;  4IB2 A;  3SET A;  5L9O A;  2I4C A;  1OLC A;  2XXT A;  4F31 B;  1JVX A;  4LON B;  3K6W A;  1M5F A;  2GRV A;  1NNP A;  4XKN A;  1MM7 A;  1O7T A;  2O68 A;  3N26 A;  5AA2 A;  1ZLQ A;  4FEB A;  4RK2 A;  2QSX A;  4E0X A;  3KSJ A;  3PU5 A;  1Y9U A;  4JXI A;  5DT6 A;  5M2V A;  1FTO A;  4TOZ A;  5DTB A;  3PUW E;  1S7Y A;  1EH3 A;  4AQ4 A;  2FYI A;  1D9Y A;  2I0B A;  4FEC A;  3SER A;  1GR2 A;  2OCU A;  4P0I A;  1MQD A;  3FXR A;  5H8N A;  2M8C A;  3RPW A;  4NTL A;  1LB8 A;  4POW A;  5H8F B;  3MJN A;  3EHS A;  1H44 A;  2W7Y A;  1LGB C;  4YB7 A;  1LAF E;  1MQG A;  2B3B A;  3G3K A;  2RCA A;  2FNC A;  1JVY A;  4ZED A;  4G68 A;  2F7C A;  2PMS A;  2H9B A;  1AL3 A;  4ELQ A;  4Q8R A;  2F78 A;  1JW4 A;  1SYH A;  2H99 A;  3N94 A;  1MXV A;  4OET A;  2VD3 A;  1MPC A;  3S2V A;  1IIT A;  1AH5 A;  4NE4 A;  3FVK A;  4HCW A;  1PBQ A;  2I6E A;  3ONM A;  4PET A;  4QF9 A;  1RKM A;  4FAJ A;  3RGY A;  1B1H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...