3SEWA

Zn-mediated polymer of maltose-binding protein a216h/k220h by synthetic symmetrization (form i)
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
370
structure length
370
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 121
structure length 370
sequence length 370
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sewA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sewA01
4KYSA 2O1MA 1IQ7A 2REGA 4DCYA 4IGTA 3OSRA 3K1PA 3PPPA 4KCDA 5F1QA 1B9JA 3K6UA 1B51A 3E3KA 3H3GA 4QFLA 4P0GA 4DXBA 3U93A 2DS9A 1MY1A 3CVGA 2ANJA 1QULA 3O6IA 5TU0A 3T96B 4H6DA 2GH9A 4FE8A 2Q8JA 3KG2A 4YZZA 3EHSA 4IO6A 4OXVA 2F7BA 3OELA 4THIA 3FVNA 2HZLA 4RK9A 5TPAA 4BLAA 4YMBA 3KJTA 3S2VA 2XXXA 1QUJA 3OEKA 4U22A 3MBPA 4IY6A 1B46A 3K02A 4FJPA 5ICTA 4GL8A 3FJMA 3DM0A 2F36A 3SEXA 1XOCA 1OQGA 5I2KB 3HV1A 2OK2A 3LSFB 3OMBA 3ILUB 4XKPA 3V5AA 4ZECA 1FTLA 1M5EA 2XXWA 1OVBA 1B5HA 5I58B 3IJOB 4ONYA 2Q89A 2H5YA 4G8MA 4HS7A 4NF5A 5TP9A 4BDMA 1IZ1A 4HCYA 1OVTA 1SW5A 3PV0E 1JW1A 2XXQA 4F2QA 5I84A 1EH3A 3SEVA 4N07A 4GF8A 3IO4A 2R6GE 4OYVA 1YPNA 3HCQA 5AA2B 1N84A 2ZNUA 4NF8A 4JWYA 4KCCA 1XVYA 2F97A 1LAHE 3OOAA 3OXNA 1LLSA 3T22A 2O1LA 4IGRA 2B65A 2QPQA 2RKMA 3VFJA 4EXLA 2FA7A 5I59B 1FQDA 4PFTA 1P1WA 4ELQA 4JWXA 3HSTA 4PP0A 3VXBA 2F7AA 4TOZA 4FAJA 2RCAA 4DXCA 3KSXA 3RY3A 3KOTA 5AE4A 5CBRA 5AA2D 5FHNA 3H6UA 3HO7A 1R9LA 4F1YA 5A5XB 5ICQA 2WKYA 4I1DA 4LZ7A 2F6GA 5JEIA 4LONB 1GTKA 2OWTA 5J1DA 2OLBA 4R74A 3EN3A 4F2OA 5B7DA 4KPTA 4XTCQ 5L9MA 3SEYA 3V8XB 3H4ZA 1N3WA 3JZJA 1P1OA 2XHDA 5I56A 3K0VA 2ONKE 3TEPA 1FTKA 2CZLA 4ZEFA 4DLDA 1JEVA 3FUZA 2F6PA 3K2DA 3N5LA 4OEVA 2HQ0A 1IXGA 5CMCA 5DVJA 2AIXA 2NXOA 3IAZA 5EHSA 2DWJA 3MVXA 1QJMA 1A8EA 2H4IA 2YPNA 4G77A 3IX1A 1PEBA 3PD8A 3PMWA 1N04A 4F18A 3USDA 2DXYA 4YICA 3K6VA 4ZS9A 2O84X 1A55A 2Y84A 3O6GA 2XXTA 3LSLA 4GQOA 3U1OA 4GLIA 1MXVA 5I57A 4OQOA 4YB7A 2HZKA 1FCKA 1USYE 3EHUA 4R2FA 2V3UA 4G68C 4EXKA 4EF1A 3B6WA 4LVQA 2Z8DA 3ILTB 2V3TA 4ZEIA 2REJA 3O2AA 1MH3A 1O64A 4LZ5A 1M5DA 4OZ9A 1SW4A 3OD7A 4PFUA 4IB2A 4POXA 4AB5A 2QS2A 4H0WA 1Y1MA 2HFBA 2HAVA 4BDLA 3TCGA 3MZ1A 4ZZAA 5I57B 3E4RA 5JTYB 4E0WA 1S50A 2XX8A 4X48A 3H03A 3OO9A 2M8CA 1M5CA 2DE3A 4LP2B 3U94A 5JK4A 4ESXA 2A5SA 2DQVA 1MQGA 1B4ZA 4R9GA 1P99A 2PX1A 2I4CA 4JSDA 3IR1A 3MAMA 3M3LA 4U4XA 1B3LA 5H8QA 1SQYA 1BKAA 2GFEA 1MXUA 3EQ1A 3LC8A 3KOSA 4X1BA 5M2VA 3T9XB 4WKMA 3TTKA 5CMMA 4TLMB 1NMUA 2A5TA 3BKIB 3KJ7A 3PMXA 4GXAA 4ZE9A 5I56B 1IXCA 1DPEA 1PBPA 1DSNA 3MC2A 1DPPA 4JXIA 4M1VA 4MH5A 4DZ1A 4TQUQ 1Y4TA 3IO6A 3K1MA 1NNPA 4ISUA 4NF4B 1MXXA 1D9VA 5CMBA 2Z8EA 5KDTB 1I69A 4DE8A 1PB9A 4ZEBA 3O66A 3R26A 1AOVA 4NE4A 3G3KA 4RXLA 1MQDA 4QSEA 1N3XA 4Q0CA 2HAUA 4U23A 3O29A 1A99A 1LB9A 1SYIA 1Y4CA 4JSOA 3RT6B 2XXRA 2DE2A 1H43A 4Z7EA 2V3QA 5IAIA 1OLCA 2X26A 1II5A 3G3GA 4GVOA 4XKRA 1DOTA 1YTVA 2R71A 3CG1A 3FXQA 4G2ZA 1B40A 2YLNA 4E0XA 1B0HA 2RINA 2XXYA 1XT8A 2NOOA 3ECRA 3PMVA 1FQFA 4C1TA 5I2NA 1NH8A 1ZMGA 3TDJA 4ELOA 3O97A 3EPEA 3KN8A 3T9VA 4NF5B 5TP9B 2ZYKA 4O3BA 5CC2A 4DCXA 5FHMA 4IO7A 4F3GA 2UXAA 1ZU0A 3ODBA 4POWA 1N7WA 3UP9A 1UIUA 5H8FA 5L9OA 2E1SA 1HSJA 4R75A 3QSLA 1TFAA 2D21A 3V89B 3UORA 1DTZA 4G8HA 3L6GA 3TTLA 1BTJA 3IB2A 4ELRA 1EZOA 4GRKA 4EF2A 3OENA 4I62A 3RTFB 4JDFA 2HEUA 3PUVE 5KZTA 1H3DA 1SBPA 4IO4A 3B6TA 2A5TB 2ALUA 1SDXA 3JV9A 4GFRA 3PPRA 2O69A 2ZYMA 4JB7A 1B2HA 4HCWA 4Z0IA 3TCHA 5I2NB 1M5BA 2PVUA 1A40A 1EZ9A 2I49A 2XD3A 3VVEA 3HN0A 3GLBA 1IIWA 3SERA 1QKBA 1NFTA 3VV5A 1MY0A 3PUWE 1WVJA 2VHAA 2W7YA 3GZGA 4GOTA 4KYEA 4NTLA 4U4SA 3RUMA 1F9BA 3K6XA 4AB6A 3L6HA 4X9TA 3RTWB 1JW4A 1UQWA 3C36A 3GBBA 3KBRA 3PPQA 4R6HA 1JVYA 2Y7WA 4BDRA 5JTYA 1VR5A 2XXHA 3S9MC 1JEUA 3FXRA 4RK2A 1JQFA 1XC1A 5CI5A 3RN8A 1VFEA 4ZE8A 3E9XA 1B0LA 3MQ9A 3UN6A 3FJ7A 2Q9TA 4N6PA 4YKJA 3WAFA 5H8HA 2GHBA 3GXAA 3VVDA 3ZS6A 1P1NA 4DIGA 1JNFA 2QSXA 1O63A 3ONMA 3QAXA 4WEPA 4ZEDA 3CIJA 3QUJA 5AA4A 2PT2A 4KI0E 1A54A 1A8FA 2X7QA 4I9DA 2GRVA 2DP8A 3K6WA 3SEWA 5EYFA 1H45A 4F39A 5KCJB 5IKBA 4F1UA 1ATGA 1MQJA 2UYFA 3KFMA 1B7UA 3MZ9A 3PGFA 2V84A 5H8NA 4QSDA 1FTJA 2LAOA 4QFOA 2YJPA 3MZBA 2QS4A 1GV8A 3TUSA 1LBCA 3CG3A 3PD9A 4H5GA 2PT1A 4RYAA 1OIBA 1P1UA 4YAHX 5F7VA 3KEIA 3TAJA 4ESWA 4R73A 4BDQA 4YB6A 1ANFA 2XX9A 1NH7A 1ZJLA 2VOZA 4DDDA 1B32A 2QS1A 4Q5TA 3W9WA 2I0CA 1M5FA 4OESA 5B70A 1QVSA 4ELPA 2XXUA 1Z7ME 3IOWA 4RNSA 1B7HA 4RJZA 4OEUA 3TPAA 3B7DA 3ZSFA 4C1UA 4PQJA 4QFKA 4RPNA 4UACA 4ZDMA 4F19A 1J1NA 2O7UA 3BBRA 1AH5A 2OCUA 2BJJX 2OZZA 2Q2AA 4MF3A 3VE1B 3MPKA 3C9HA 3OSQA 1B5JA 1FTMA 4NEDA 4AQ4A 4LQ2A 4F29A 4OVJA 4ZZEA 4O3AA 5FTIA 3C33A 3G7WA 3C34A 3KN7A 2XXVA 3E13X 2NVUB 5I59A 4R9FA 2ZYNA 2UVHA 1MXWA 3M3KA 2DWAA 3TODA 3MJNA 3CFLA 2PYYA 1LCFA 3EHTA 3IORA 1ZKBA 3W9VA 2O68A 3QYTA 1ZIUA 5CRYA 3IL1B 1A7LA 1Q35A 3C31A 3IOVA 3G3FA 4YMAA 3IB1A 4F3BA 3RLFE 1VFDA 3K4UA 1LSTA 1BLFA 1XS5A 2QMWA 2ZYOA 3CSGA 1H44A 5K2XA 3VXCA 1JVXA 1TFDA 3DELB 4OHNA 3A09A 4EUOA 2QJEA 4EQ9A 3MVZA 1Y3NA 1P1QA 3IOUA 2I58A 5BWJA 2F5XA 4OERA 3KZGA 1LCTA 5I58A 2FYIA 1B3FA 1JETA 1O7TA 3Q27A 1CE2A 2NWJA 1LFIA 2F35A 3IB0A 1HSEA 4M4GA 4R6YA 1USYH 5DT6A 1LBBA 1WDNA 1CB6A 3KSJA 3OO7A 4RA1A 3BFUA 1PBQA 1RYOA 4OWDA 5H8FB 3FATA 3ZKLA 1Y20A 4F3PA 1ZBMA 3N94A 1MPCA 1GR2A 2E0SA 2PBWA 1MPDA 1QUKA 4F31B 3UGWA 3S9EA 2VD2A 4FEDA 4PETA 4XIGQ 2F8DA 2XXIA 1US4A 3AXFA 4YU0A 1ZLQA 1B4HA 1SI1A 4NF8B 1B1XA 5DVIA 5FHOA 5AA2A 4MLQA 2THIA 1MM6A 3GBAA 2H98A 4YKKA 1PDAA 1B3GA 1D9YA 1QW0A 4OFJA 5DVFA 3U92A 1IXIA 3QIMA 2H9BA 4GWOA 3I6VA 1GVCA 1SW2A 4P11A 2FNCA 1SYHA 3MP1A 2UVGA 1B3EA 4HTGA 1UIVA 3C35A 4P0IA 2DE4A 3A3UA 1B58A 1URSA 2P2AA 1DTGA 3VDFA 1FQBA 4Q8RA 2I4BA 3FV1A 3FV2A 4H8JA 4H67A 5HBCA 3QXMA 2Y7IA 3TZAA 5HM4B 3PPNA 3C4MA 1SD3A 1LAFE 4EDPA 4EQ7A 4R2BA 4LUBA 5KDTA 2O51A 2QMXA 2ABHA 2R9JA 1ELJA 3PU5A 4IO2A 4F1VA 4NF4A 1TWYA 3FVGA 4HW8A 5LOMA 3DP6A 3CSBA 3H6WA 1SW1A 4OMBA 3VLVA 1Q1KA 4YKPA 2Y7PA 1I6AA 2I6EA 3K01A 4H5FA 1S9TA 4L17A 1UTBB 3CR9A 3LUYA 3G3HA 2B3BA 4NWDA 3TFLA 3THIA 1LFHA 3S9LC 5DEXA 1NNFA 5H8QB 4FATA 3RNNA 3WAEA 2I3VA 1QKAA 2NUVA 3HHGA 3OO6A 3Q28A 1B1HA 2VP1A 3IK6B 3M8UA 4C0RA 5BUUA 1NKXA 2F7CA 2RC7A 1SI0A 4OENA 4QHQA 2OJTA 3TKDA 3MWBA 3D4GA 2O7IA 2QS3A 1MY2A 2ONRA 4H8IA 5FTHA 5CM6A 4OETA 2QL3A 2P0SA 4G8NA 4IY5A 2XX7A 4O3CA 2ONSA 3UA8A 5ISUA 3H6VA 2ESNA 4WXJA 4MBPA 2ZNTA 1ZTYA 2Q2CA 2RC8A 3FJGA 4FECA 1KWHA 1N76A 3VLUA 1H76A 3DLNA 2I0BA 1LGBC 3RGYA 4FORA 1MDP1 1MG1A 1MM7A 4R6KA 3O9PA 2RC9A 1MXZA 1URGA 1Y9UA 2AYSA 1NNKA 3CI8A 3HHFA 3O28A 2ZMBA 3S4UA 1L5TA 4KFQA 3TQWA 2QRYA 3ZKKA 3TTNA 1US5A 1MH4A 1B6HA 1FQAA 3IOTA 4LA9A 3FXUA 5ELVA 3K1NA 4UA8A 1POTA 2XXPA 1I6QA 4RY1A 3SKPA 3FGSA 3Q25A 4U1ZA 3CFXA 3UIFA 1LAGE 3MVYA 2Z23A 1UTHA 1WODA 1AL3A 4F3SA 2Q88A 1YAEA 5AA1A 3TELA 5ITPA 3PUZE 3PUYE 1BIYA 1HSLA 2D5WA 2G29A 3TTRA 2V25A 4KHZE 4R72A 3TYHA 1DMBA 5H8HB 1MRPA 4G68A 1FTOA 3RQTA 3LBSA 3MUQA 2Z8FA 3PUXE 1S7YA 1MS7A 4OTEA 4NF6A 4QF9A 1MQIA 4OFLA 1MY4A 4LQ5A 1FQCA 3N6TA 4QFPA 2F78A 2Y7RA 1VSOA 5A5XA 2PMSA 3DP8A 4OFOA 1MXYA 1OQHA 1OMPA 1TXFA 2HCAA 2VD3A 3C32A 3N26A 1SVXB 1MY3A 3D4CA 4FEBA 4GXSB 4KQPA 4NF6B 1N0TA 2GHAA 2VGQA 4Q30B 4YB5A 4NMYA 5L8DA 2X7PA 4G68B 2I48A 4LZ8A 3CFZA 2H99A 3QK6A 3H7MA 1IEJA 3KGCA 3MP6A 4X1DA 1IXHA 3SESA 4QFNA 3VVFA 2IEEA 3TTMA 2Y7KA 3U72A 1Y3QA 1D3KA 3CRBA 3T9HB 3RPWA 3I5OA 5EHMA 3M3FA 1XVXA 3EF7A 3F11A 1UTHB 3T66A 3T93B 2ZNSA 3SEUA 1IITA 3MVWA 4H65A 3S9NC 1MDQA 3FZVA 3I3VA 1Y1ZA 2RF1A 2V93A 2KLFA 1RKMA 2DVZA 1MQHA 3KN3A 4U1OA 3SDFA 1Y3PA 2F34A 2O6AA 4YKIA 4ZEKA 4XKNA 4DXUA 3H6TA 2DXRA 4LATA 3W15C 3H06B 4IO3A 4NWCA 1LB8A 1AMFA 2ZXTA 3Q29A 4F22A 2OBGA 3IJXB 3G3IA 1EU8A 1PC3A 3FD3A 5I2KA 2XD2A 3T9UA 1R1NA 3VLWA 2CMOA 3TMGA 4IO5A 1XHYA 2IA4A 4U21A 1B52A 1LFGA 1N7XA 2I3WA 1I6BA 4TLLB 3TQLA 2UVJA 1POY1 3K00A 5TPAB 4EQBA 4XXUA 4MLVA 3MW0A 1GGGA 1PB7A 5DTBA 3OEMA 4RPOA 2AL4A 1FW0A 2P1SA 3JYRA 4GL0A 4U2RA 3QUFA 4GD5A 4WEDA 1R9QA 1LAXA 1NL5A 2AL5A 1YCJA 2DYXA 1FQEA 3N6UA 3P7IA 2UVIA 2DSFA 3FVKA 1EZPA 2OWSA 3TCFA 2HXWA 2DVCA 3RT8A 4BDNA 1B05A 5AA3A 5CBSA 1R6ZA 2RCBA 3FVOA 2B3FA 3UK4A 3B6QA 4K3FA 4N13A 4PFYA 1D4NA 3OO8A 5DEXB 1TT1A 1B5IA 3O6HA 4XKQA 2Z22A 5DYHA 5H8SA 5ITOA 1Z7NE 3U8QA 1UTBA 3LR1A 3MP8A 4ECFA 5H8NB 3V83A 5L9SA 4FIMA 1B7ZA 2H25A 3R6UA 4JWOA 1JW5A 3HPIA 3MPLA 2DWHA 5K2YA 5KCJA 4JBZA 2G93A 4PFWA 4PE5B 3FIRA 4QSCA 3G3JA 3LSWA 4G4PA 4KYDA 3BFTA 1T0KA 5AA4B 1AIVA 1URDA 1BP5A 1PB8A 1OLAA 1VE4A 4I8CA 5CMKA 2D3IA 4BDOA 1IUDA 3A3CA 1RYXA 3SETA 5HPQA 4KR5A 4QRZA 4ND9A 3PPOA 3Q26A 3DP4A 3FASA 4H1XA 1QUIA 3LSXA 4KD5A 1B3HA 4GIZA 3R7XA 1NNTA 2UYEA 4MFIA 2DOJA 1MPBA 2DWIA
chains in the Genus database with same CATH superfamily
3K1PA 3PPPA 5F1QA 1B9JA 3H3GA 4QFLA 4DXBA 2DS9A 3T96B 4H6DA 4IO6A 4OXVA 2XXXA 1B46A 1OQGA 5I2KB 3V5AA 4ZECA 1FTLA 2H5YA 4NF5A 1YZ0A 2VPNA 2OX3A 3PV0E 5I84A 4F2QA 1EH3A 4N07A 4OYVA 1YPNA 4H46A 5AA2B 4NF8A 4JWYA 3OXNA 4NAPA 2QPQA 5FBPA 5I59B 1P1WA 3HSTA 1LEVA 3VXBA 4FAJA 4DXCA 5CBRA 2CEXA 4H45A 4I1DA 2F6GA 2OWZA 2OWTA 5J1DA 4R74A 4KPTA 5L9MA 3H4ZA 2XHDA 1FJ9A 1LBYA 2CZLA 4G61A 4ZEFA 4DLDA 3FUZA 4OVQA 5CMCA 2NXOA 3MVXA 4G77A 2YPNA 3IX1A 3PD8A 3PMWA 3K6VA 3LV0A 4ZS9A 1A55A 4P9KA 4GWWA 4YB7A 1FCKA 4AS5A 4R2FA 4G68C 2Z8DA 4ZEIA 4LZ5A 1RDZA 4AB5A 3TCGA 3H03A 4LP2B 5JK4A 4R9GA 2PX1A 2I4CA 4JSDA 1SQYA 2GFEA 5M2VA 4WKMA 5CMMA 4TLMB 1NMUA 3BKIB 4GXAA 5I56B 1DSNA 2WEFA 1NNPA 4OVSA 1MXXA 5CMBA 2Z8EA 4DE8A 4NE4A 3O29A 1A99A 4JSOA 2XXRA 4O94A 5IAIA 1OLCA 1YTVA 4G2ZA 1B40A 4E0XA 4GWXA 1B0HA 2XA5A 3KN8A 4O3BA 5FHMA 4IO7A 3UP9A 1N7WA 5H8FA 4NG7A 4PE3A 1TFAA 1DTZA 4G8HA 4MNIA 3L6GA 3TTLA 1BTJA 4ELRA 1EZOA 4EF2A 3OENA 4I62A 3RTFB 1H3DA 3TCHA 4Z0IA 3PTYA 1A40A 1EZ9A 2I49A 3VVEA 1NFTA 2B4MA 1F9BA 2ZZWA 1JW4A 3GBBA 1JVYA 3B8BA 3V83A 1JEUA 3HFUA 4ZE8A 1B0LA 4YKJA 1AWBA 2QSXA 3QAXA 3CIJA 4KI0E 1A54A 1A8FA 2X7QA 4I9DA 3K6WA 5EYFA 4F39A 1MQJA 3PGFA 3MZ9A 1FTJA 3MZBA 1GV8A 3CG3A 4H5GA 4YAHX 2PT1A 2VOZA 2QS1A 4Q5TA 3W9WA 4OESA 1QVSA 4PGPA 3ROJA 4QFKA 4ZDMA 1LBXA 2OZZA 4MF3A 4JVDA 3MPKA 3OSQA 1FTMA 1G0IA 1FBCA 3KN7A 2UVHA 1MXWA 3M3KA 3TODA 3CFLA 1FBPA 3EHTA 1ZKBA 3QYTA 2B4LA 1A7LA 4F3BA 1JVXA 1TFDA 3DELB 4EQ9A 3IOUA 2I58A 4OERA 1LCTA 5I58A 2FYIA 1B3FA 1JETA 1O7TA 4P3LA 2NWJA 1LFIA 2F35A 4R6YA 1USYH 3BFUA 1ZBMA 2XXKA 2E0SA 2PBWA 1MPDA 1QUKA 2VD2A 1DBZA 5IM2A 4XIGQ 5FHOA 5AA2A 1MM6A 3GBAA 1PDAA 1B3GA 1QW0A 4OFJA 2H9BA 4F2OA 1SW2A 1SYHA 3MP1A 2PFYA 4GX3A 2I4BA 4H67A 2Y7IA 1IMAA 4EDPA 5IZ1A 4IO2A 4NF4A 1TWYA 4HW8A 4N15A 1S9TA 2B3BA 5DEXA 1NNFA 3EKIA 4FATA 1QKAA 3IK6B 4C0RA 2F7CA 2RC7A 4QHQA 3MWBA 3A29A 5CM6A 2P0SA 4IY5A 2ONSA 1ZTYA 1KWHA 1N76A 4LN5A 3DLNA 4FORA 1MG1A 1MXZA 3CI8A 4P8BA 5IZZA 2QRYA 1US5A 1POTA 3SKPA 3MVYA 2Z23A 1UTHA 1AL3A 5AA1A 1BIYA 1HSLA 2G29A 3TTRA 1DMBA 1FTOA 4OTEA 1S7YA 1MS7A 3T1BA 2FVZA 2FIEA 5I5PA 1MXYA 2VD3A 4GXSB 1SVXB 4FEBA 4NF6B 4KQPA 4Q30B 2VGQA 2X7PA 5H8HA 4X1DA 1IEJA 3MP6A 1IXHA 1NUZA 2IEEA 3U72A 1D3KA 3M3FA 1XVXA 4MHFA 3T66A 2F3DA 3MVWA 3S9NC 3FZVA 2RF1A 2V93A 4U1OA 3SDFA 1Y3PA 2F34A 4ZEKA 4XKNA 4LATA 4NWCA 4F22A 3FD3A 1XHYA 2IA4A 1B52A 2I3WA 4EQBA 2UVJA 4XXUA 1GGGA 4GL0A 2AL5A 1FQEA 3N6UA 1FPLA 3RT8A 1YYZA 2RCBA 3B6QA 5ITOA 1TT1A 3O6HA 4XKQA 5DYHA 4XEQA 4ECFA 1B7ZA 5K2YA 4JWOA 3MPLA 1KA0A 4I40A 3KC0A 4KYDA 1AIVA 1OLAA 3SETA 4ND9A 3Q26A 1YXIA 1B3HA 1JP4A 3RPLA 4IGTA 1KA1A 4KCDA 3K6UA 1LBWA 5TU0A 4RK9A 5TPAA 4BLAA 3OEKA 4IY6A 4GL8A 3OMBA 1NV6A 3KC1A 2XXWA 1OVBA 3IJOB 1IZ1A 4HCYA 3MYUA 1NV1A 4PF6A 2F97A 4HE2A 1LAHE 1LLSA 4IGRA 1FQDA 4PFTA 3HO7A 3EN3A 3V8XB 4XTCQ 3SEYA 4GBWA 1P1OA 3TEPA 1JEVA 1IXGA 5DVJA 2AIXA 3QMFA 1QJMA 4F18A 4PFRA 2DXYA 1NUWA 4GWYA 2XXTA 4GLIA 4PF8A 1USYE 4MMPA 3ILTB 2REJA 3O2AA 3OD7A 4POXA 2QS2A 3MZ1A 3E4RA 1S50A 2A5SA 1MQGA 3IR1A 4U4XA 5H8QA 1BKAA 4X1BA 3PMXA 1PBPA 4DZ1A 5EQ8A 4MJOA 1I69A 1PB9A 4ZEBA 2QVUA 4RXLA 4QSEA 2HAUA 1FBEA 1FPDA 1H43A 2V3QA 1II5A 4GVOA 3FXQA 2XXYA 2RINA 1XT8A 1ZMGA 2CEYA 4F3GA 3ODBA 1HSJA 4MEVA 3QSLA 2D21A 2Y5LA 4GRKA 4JDFA 3PUVE 5KZTA 1SBPA 4IO4A 3B6TA 5EQ7A 3JV9A 4GFRA 1B2HA 5I2NB 1M5BA 3GLBA 3SERA 3VV5A 1QKBA 3RPLB 1WVJA 4NTLA 3GZGA 4U4SA 3K6XA 3L6HA 4ELOA 5JTYA 3S9MC 5CI5A 3RN8A 1VFEA 3MQ9A 3ONMA 4WEPA 5T3JA 3QUJA 5KCJB 2UYFA 2V84A 3TUSA 1LBCA 4RYAA 3LUZA 1OIBA 3KEIA 4BDQA 4YB6A 1ANFA 2XX9A 3GYYA 1NV2A 1B7HA 4RJZA 4NQ8A 3TPAA 4UACA 3BBRA 1AH5A 2OCUA 2HHMA 4ZZEA 3ISPA 4O3AA 3C33A 1RDYA 3G7WA 2XXVA 3E13X 5I3SA 1LCFA 3IORA 1ZIUA 3IL1B 3C31A 3IB1A 1LSTA 2ZYOA 2QMWA 3CSGA 1KZ8A 5ESYA 3A09A 1P1QA 2BJIA 5DT6A 1CB6A 4N4UA 3N94A 1GR2A 4F31B 3S9EA 3BIHA 2F8DA 4FBPA 4PFIA 4YKKA 4P0IA 3C35A 2DE4A 1DTGA 5HBCA 3U65A 3PPNA 4R2BA 4LUBA 2ABHA 4F1VA 3FVGA 4N17A 3DP6A 4OMBA 1FBDA 4YKPA 1I6AA 4L17A 3G3HA 3S9LC 1FPIA 5H8QB 3WAEA 2I3VA 2NUVA 3Q28A 3M8UA 1NKXA 1SI0A 3TKDA 5FTHA 4OETA 3H6VA 4DI3D 4P56A 3FJGA 2Q2CA 4FECA 3IFAA 3WAFA 1MDP1 4HE1A 2AYSA 3O28A 4F1UA 1NNKA 3NOHA 2ZMBA 4KFQA 3ZKKA 1FQAA 3IOTA 4LA9A 3FXUA 2XXPA 3UIFA 5ET8A 1LAGE 2QFLA 1WODA 1FRPA 2Q88A 1YAEA 5EQAA 5EYGA 3TELA 3PUZE 3PUYE 5ITPA 2D5WA 4KHZE 4R72A 1MRPA 4G68A 2Z8FA 4NF6A 1MQIA 2Y7RA 1OQHA 3RUMA 1TXFA 3C32A 4Q0CA 1MY3A 3D4CA 1N0TA 2GHAA 5I58B 3CFZA 2H99A 3H7MA 4N8GA 2Y7KA 3T9HB 3I5OA 3T93B 2ZNSA 1FTAA 1MDQA 2L5VA 2O6AA 4N6KA 2CZIA 2DXRA 4MCOA 1SPIA 4IO3A 1AMFA 2ZXTA 3IJXB 3G3IA 1PC3A 2XD2A 1R1NA 3VLWA 2CMOA 3TMGA 4IO5A 4U21A 5TPAB 4MLVA 3MW0A 5DTBA 4NX1A 2AL4A 4U2RA 1D9QA 1NL5A 2DYXA 2DSFA 1EZPA 3TCFA 2HXWA 4N81A 4QXDA 1B05A 5AA3A 5CBSA 1FBFA 2WYKA 3UK4A 4K3FA 4N13A 1GVCA 5H8SA 1UTBA 4FIMA 3R6UA 4X8RA 1T0KA 1IMEA 1PB8A 1VE4A 4I8CA 2PCRA 4P1LA 1IUDA 1RYXA 3PPOA 3DP4A 3R7XA 4MFIA 2DOJA 5I7IA 2DWIA 2O1MA 1IQ7A 2ZZVA 4IR8A 2DDKA 1B51A 1QULA 3O6IA 4PDDA 2Q8JA 3KG2A 4YZZA 2F7BA 3FVNA 5IGAA 2HZLA 1QUJA 5ICTA 3FJMA 2F36A 1XOCA 3LSFB 3ILUB 1B5HA 4ONYA 2Q89A 4HS7A 4HE0A 1RDXA 3SEVA 4GF8A 3HCQA 1N84A 4KCCA 3OOAA 2FHYA 3T22A 2O1LA 2B65A 2RKMA 4EXLA 3VFJA 2FA7A 4ELQA 4JWXA 4TOZA 2RCAA 3KSXA 3RY3A 3H6UA 5ICQA 4LZ7A 5JEIA 1GTKA 1N3WA 5I56A 3K0VA 2ONKE 1FTKA 3K2DA 2Q8MA 3E78A 2H4IA 3USDA 4GQOA 3LSLA 3U1OA 1NUYA 5I57A 4OQOA 4EF1A 3B6WA 3RYDA 1MH3A 1O64A 1M5DA 4OZ9A 4IB2A 2CZKA 4H0WA 1Y1MA 2HAVA 5I57B 5JTYB 2XX8A 4X48A 3OO9A 2DE3A 3U94A 4ESXA 3FXBA 1B4ZA 1P99A 3MAMA 1B3LA 3T9XB 3EQ1A 3KOSA 3TTKA 3KJ7A 1DPEA 4M1VA 4TQUQ 1Y4TA 3IO6A 4ISUA 4NF4B 3R26A 1AOVA 3G3KA 5LDZA 4U23A 1LB9A 1Y4CA 3RT6B 1FPFA 1K9ZA 4Z7EA 2X26A 3G3GA 3CG1A 3PMVA 3E79A 3ECRA 2NOOA 5I2NA 1FQFA 4PCDA 4OVPA 1NH8A 3TDJA 3T9VA 3EPEA 4NF5B 2UXAA 4POWA 3V89B 4UABA 4GX4A 2A5TB 4JB7A 3PPRA 5ET5A 3HN0A 1IIWA 1MY0A 3PUWE 4KYEA 3RTWB 3C36A 3KBRA 1FJ6A 3PPQA 2XXHA 1JQFA 3E9XA 3UN6A 3FJ7A 2Q9TA 4N6PA 3ZS6A 1VDWA 1JNFA 5AA4A 2GRVA 1H45A 5IKBA 4PGNA 3KFMA 4QSDA 2LAOA 2YJPA 3PD9A 4XFEA 1P1UA 5F7VA 4ESWA 4PAFA 4DDDA 1FSAA 4PC9A 4NN3A 3IOWA 4NGUA 2FIXA 3ZSFA 2KQZA 2BJJX 4AQ4A 4LQ2A 4OVJA 3FBPA 5FTIA 3C34A 2NVUB 5I59A 2ZYNA 2DWAA 2PYYA 3W9VA 3KBZA 3IOVA 5ET7A 3G3FA 3RLFE 3K4UA 5K2XA 3VXCA 2QJEA 1Y3NA 1DK4A 3KZGA 1IMFA 2P3NA 1CE2A 1XI6A 3KSJA 1WDNA 1RYOA 5H8FB 3ZKLA 1Y20A 4JVIA 4OANA 1NV0A 4FEDA 1INPA 3MSTA 2XXIA 2XWIA 1US4A 3AXFA 4YU0A 1ZLQA 1SI1A 4NF8B 1B1XA 3BIGA 2H98A 2FBPA 5ET6A 1IXIA 4GWOA 4P11A 2FNCA 2UVGA 1URSA 3FV1A 2WBBA 5HM4B 3C4MA 1SD3A 1LAFE 5KDTA 2O51A 2QMXA 1ELJA 5LOMA 3VLVA 3H6WA 1SW1A 2Y7PA 4H5FA 3CR9A 3LUYA 4XF5A 4NWDA 3TFLA 2Q74A 3THIA 1LFHA 4HXVA 3HHGA 3OO6A 1B1HA 4JVCA 4OVTA 2OJTA 2O7IA 2CZHA 2QS3A 1MY2A 1FBHA 2ONRA 4H8IA 4G8NA 4MX6A 4O3CA 2HPGA 3UA8A 1CNQA 2RC8A 3RGYA 2I0BA 1LGBC 4BDLA 1MM7A 5L9OA 3O9PA 2RC9A 3HHFA 3SZPA 1L5TA 2ZZXA 3TTNA 1MH4A 4UA8A 1I6QA 3FGSA 3Q25A 4U1ZA 3CFXA 4F3SA 2MKZA 2XWKA 3TYHA 4MNPA 4OA4A 3LBSA 3MUQA 4QF9A 1MY4A 4LQ5A 4QFPA 2F78A 1VSOA 4OFOA 3N26A 4BDMA 5L8DA 4YB5A 5IZ3A 1FPJA 2I48A 3QK6A 3VVFA 4QFNA 3TTMA 3CRBA 3RPWA 1UTHB 5LTCA 3SEUA 1IITA 3I3VA 4PDHA 4DXUA 3Q29A 2OBGA 3T9UA 4YMBA 1LFGA 1POY1 3K00A 1PB7A 3OEMA 4RPOA 1FW0A 2P1SA 2VPOA 4GD5A 4WEDA 1LAXA 1YCJA 3FVKA 4GBVA 4BDNA 2B3FA 1LBZA 2QVRA 5DEXB 3OO8A 1B5IA 2Z22A 1Z7NE 3LR1A 3MP8A 2H25A 1JW5A 3HPIA 2G93A 4PFWA 4PE5B 4QSCA 3G3JA 4G4PA 3BFTA 5AA4B 1URDA 5CMKA 2D3IA 4QRZA 1FPEA 3FASA 4H1XA 4KD5A 4GIZA 1NNTA 2WYPA 4KYSA 2REGA 4DCYA 3OSRA 3E3KA 1DCUA 4P0GA 1MY1A 3CVGA 2ANJA 2GH9A 4FE8A 1IMCA 3EHSA 3OELA 4THIA 3KJTA 3S2VA 4U22A 3MBPA 3K02A 4FJPA 3DM0A 3SEXA 3HV1A 2OK2A 4XKPA 1M5EA 2P3VA 2QVVA 4MNCA 4O7MA 4G8MA 5TP9A 1OVTA 1SW5A 1JW1A 2XXQA 2WBDA 3IO4A 2R6GE 4MIJA 2ZNUA 1XVYA 4PAIA 1NI9A 1NV3A 4PP0A 5J16A 2F7AA 1Q9DA 3KOTA 5AE4A 5AA2D 1R9LA 4F1YA 5A5XB 4GX6A 2WKYA 4LONB 2OLBA 5B7DA 1NV7A 3JZJA 1EYIA 2F6PA 3N5LA 4OEVA 2HQ0A 3IAZA 5EHSA 2DWJA 1A8EA 1PEBA 1N04A 4YICA 4QBAA 2O84X 2Y84A 3O6GA 1MXVA 2HZKA 3EHUA 4PBQA 2KR0A 2V3UA 4EXKA 4LVQA 3B50A 2V3TA 4NHBA 1SW4A 4PFUA 2HFBA 4ZZAA 4E0WA 2M8CA 1M5CA 2R8TA 4NF0A 2DQVA 4GWZA 3M3LA 1MXUA 3LC8A 2A5TA 4ZE9A 1IXCA 4MH5A 3MC2A 1DPPA 4JXIA 3K1MA 1D9VA 5KDTB 3O66A 1MQDA 1N3XA 1NV5A 1FPKA 2XWOA 1SYIA 4PTKA 2DE2A 4XKRA 1DOTA 2R71A 2YLNA 5CC2A 4C1TA 3O97A 2XWVA 5TP9B 2ZYKA 1K9YA 4DCXA 1ZU0A 5A5LA 1UIUA 1NV4A 2E1SA 4R75A 2JJKA 2PFZA 3UORA 5DW8A 1NUXA 3IB2A 2HEUA 4OVRA 2ALUA 1SDXA 2O69A 2ZYMA 4HCWA 2PVUA 2XD3A 4GOTA 2W7YA 2VHAA 4AB6A 4X9TA 3U92A 1UQWA 4R6HA 4BDRA 2Y7WA 1VR5A 3FXRA 4RK2A 1XC1A 4N91A 2GHBA 3GXAA 3VVDA 1P1NA 4DIGA 1O63A 4ZEDA 2PT2A 3SEWA 2DP8A 1ATGA 4PAKA 1B7UA 5H8NA 4QFOA 2QS4A 4N8YA 3TAJA 4I3EA 4R73A 1NH7A 1ZJLA 1B32A 2I0CA 1M5FA 5B70A 4ELPA 4X04A 2XXUA 1Z7ME 4RNSA 4OEUA 3B7DA 4C1UA 4PQJA 4RPNA 4F19A 1J1NA 2O7UA 2WX9A 2Q2AA 4O8MA 3VE1B 3C9HA 1B5JA 4NEDA 4F29A 4R9FA 3MJNA 2O68A 5CRYA 1Q35A 4YMAA 1VFDA 1BLFA 1XS5A 1H44A 4OHNA 4EUOA 2VT5A 3MVZA 5BWJA 2F3BA 2F5XA 5IZ3B 3Q27A 3IB0A 1HSEA 4M4GA 1LBBA 3OO7A 4RA1A 1PBQA 4OWDA 3FATA 4F3PA 1MPCA 4PETA 1B4HA 5DVIA 4MLQA 2THIA 1D9YA 5DVFA 4P1EA 3QIMA 3I6VA 1B3EA 4HTGA 1UIVA 3A3UA 1B58A 3VDFA 2GQ1A 2P2AA 1FQBA 4Q8RA 3FV2A 4H8JA 3QXMA 3TZAA 1FPGA 4EQ7A 2R9JA 5EYHA 3PU5A 3CSBA 1Q1KA 1BK4A 2I6EA 3K01A 1UTBB 4I3YA 4GWUA 3RNNA 2VP1A 5BUUA 1QGXA 4OENA 3D4GA 2QL3A 2XX7A 5EQ9A 5ISUA 1EYKA 2ESNA 1LBVA 4WXJA 4MBPA 2ZNTA 3VLUA 1H76A 3D1RA 4R6KA 5FHNA 3S4UA 1URGA 1Y9UA 3TQWA 1FPBA 1B6HA 2V4CA 5ELVA 1IMBA 3K1NA 4RY1A 3T0JA 1G0HA 2V25A 5H8HB 2HXRA 3RQTA 3IFCA 3PUXE 4OFLA 4DI4B 4MAGA 1FQCA 3N6TA 5A5XA 4O7IA 2PMSA 3DP8A 1OMPA 2HCAA 3UGWA 4NMYA 4LZ8A 4G68B 4PFBA 3U93A 3SESA 3KGCA 1Y3QA 5EHMA 3CHGA 4N6DA 3EF7A 3F11A 4P47A 4H65A 1Y1ZA 2KLFA 1RKMA 2DVZA 1MQHA 3KN3A 4YKIA 3H6TA 3W15C 3H06B 4AS4A 1LB8A 1EU8A 5I2KA 3TQLA 4TLLB 1N7XA 1I6BA 4KXPA 2Y5KA 1FBGA 3JYRA 3QUFA 1R9QA 3P7IA 2UVIA 2OWSA 2DVCA 1R6ZA 3FVOA 4PFYA 1D4NA 3U8QA 5H8NB 5L9SA 4GWSA 2DWHA 5KCJA 4JBZA 3FIRA 3LSWA 1BP5A 4BDOA 3A3CA 5HPQA 4KR5A 4PBHA 1EYJA 1IMDA 1QUIA 3LSXA 2UYEA 1MPBA 5F24A
chains in the Genus database with same CATH topology
4KYSA 2O1MA 1IQ7A 2REGA 4DCYA 4IGTA 3OSRA 3K1PA 3PPPA 4KCDA 5F1QA 1B9JA 3K6UA 1B51A 3E3KA 3H3GA 4QFLA 4P0GA 4DXBA 3U93A 2DS9A 1MY1A 3CVGA 2ANJA 1QULA 3O6IA 5TU0A 3T96B 4H6DA 2GH9A 4FE8A 2Q8JA 3KG2A 4YZZA 3EHSA 4IO6A 4OXVA 2F7BA 3OELA 4THIA 3FVNA 2HZLA 4RK9A 5TPAA 4BLAA 4YMBA 3KJTA 3S2VA 2XXXA 1QUJA 3OEKA 4U22A 3MBPA 4IY6A 1B46A 3K02A 4FJPA 5ICTA 4GL8A 3FJMA 3DM0A 2F36A 3SEXA 1XOCA 1OQGA 5I2KB 3HV1A 2OK2A 3LSFB 3OMBA 3ILUB 4XKPA 3V5AA 4ZECA 1FTLA 1M5EA 2XXWA 1OVBA 1B5HA 5I58B 3IJOB 4ONYA 2Q89A 2H5YA 4G8MA 4HS7A 4NF5A 5TP9A 4BDMA 1IZ1A 4HCYA 1OVTA 1SW5A 3PV0E 1JW1A 2XXQA 4F2QA 5I84A 1EH3A 3SEVA 4N07A 4GF8A 3IO4A 2R6GE 4OYVA 1YPNA 3HCQA 5AA2B 1N84A 2ZNUA 4NF8A 4JWYA 4KCCA 1XVYA 2F97A 1LAHE 3OOAA 3OXNA 1LLSA 3T22A 2O1LA 4IGRA 2B65A 2QPQA 2RKMA 3VFJA 4EXLA 2FA7A 5I59B 1FQDA 4PFTA 1P1WA 4ELQA 4JWXA 3HSTA 4PP0A 3VXBA 2F7AA 4TOZA 4FAJA 2RCAA 4DXCA 3KSXA 3RY3A 3KOTA 5AE4A 5CBRA 5AA2D 5FHNA 3H6UA 3HO7A 1R9LA 4F1YA 5A5XB 5ICQA 2WKYA 4I1DA 4LZ7A 2F6GA 5JEIA 4LONB 1GTKA 2OWTA 5J1DA 2OLBA 4R74A 3EN3A 4F2OA 5B7DA 4KPTA 4XTCQ 5L9MA 3SEYA 3V8XB 3H4ZA 1N3WA 3JZJA 1P1OA 2XHDA 5I56A 3K0VA 2ONKE 3TEPA 1FTKA 2CZLA 4ZEFA 4DLDA 1JEVA 3FUZA 2F6PA 3K2DA 3N5LA 4OEVA 2HQ0A 1IXGA 5CMCA 5DVJA 2AIXA 2NXOA 3IAZA 5EHSA 2DWJA 3MVXA 1QJMA 1A8EA 2H4IA 2YPNA 4G77A 3IX1A 1PEBA 3PD8A 3PMWA 1N04A 4F18A 3USDA 2DXYA 4YICA 3K6VA 4ZS9A 2O84X 1A55A 2Y84A 3O6GA 2XXTA 3LSLA 4GQOA 3U1OA 4GLIA 1MXVA 5I57A 4OQOA 4YB7A 2HZKA 1FCKA 1USYE 3EHUA 4R2FA 2V3UA 4G68C 4EXKA 4EF1A 3B6WA 4LVQA 2Z8DA 3ILTB 2V3TA 4ZEIA 2REJA 3O2AA 1MH3A 1O64A 4LZ5A 1M5DA 4OZ9A 1SW4A 3OD7A 4PFUA 4IB2A 4POXA 4AB5A 2QS2A 4H0WA 1Y1MA 2HFBA 2HAVA 4BDLA 3TCGA 3MZ1A 4ZZAA 5I57B 3E4RA 5JTYB 4E0WA 1S50A 2XX8A 4X48A 3H03A 3OO9A 2M8CA 1M5CA 2DE3A 4LP2B 3U94A 5JK4A 4ESXA 2A5SA 2DQVA 1MQGA 1B4ZA 4R9GA 1P99A 2PX1A 2I4CA 4JSDA 3IR1A 3MAMA 3M3LA 4U4XA 1B3LA 5H8QA 1SQYA 1BKAA 2GFEA 1MXUA 3EQ1A 3LC8A 3KOSA 4X1BA 5M2VA 3T9XB 4WKMA 3TTKA 5CMMA 4TLMB 1NMUA 2A5TA 3BKIB 3KJ7A 3PMXA 4GXAA 4ZE9A 5I56B 1IXCA 1DPEA 1PBPA 1DSNA 3MC2A 1DPPA 4JXIA 4M1VA 4MH5A 4DZ1A 4TQUQ 1Y4TA 3IO6A 3K1MA 1NNPA 4ISUA 4NF4B 1MXXA 1D9VA 5CMBA 2Z8EA 5KDTB 1I69A 4DE8A 1PB9A 4ZEBA 3O66A 3R26A 1AOVA 4NE4A 3G3KA 4RXLA 1MQDA 4QSEA 1N3XA 4Q0CA 2HAUA 4U23A 3O29A 1A99A 1LB9A 1SYIA 1Y4CA 4JSOA 3RT6B 2XXRA 2DE2A 1H43A 4Z7EA 2V3QA 5IAIA 1OLCA 2X26A 1II5A 3G3GA 4GVOA 4XKRA 1DOTA 1YTVA 2R71A 3CG1A 3FXQA 4G2ZA 1B40A 2YLNA 4E0XA 1B0HA 2RINA 2XXYA 1XT8A 2NOOA 3ECRA 3PMVA 1FQFA 4C1TA 5I2NA 1NH8A 1ZMGA 3TDJA 4ELOA 3O97A 3EPEA 3KN8A 3T9VA 4NF5B 5TP9B 2ZYKA 4O3BA 5CC2A 4DCXA 5FHMA 4IO7A 4F3GA 2UXAA 1ZU0A 3ODBA 4POWA 1N7WA 3UP9A 1UIUA 5H8FA 5L9OA 2E1SA 1HSJA 4R75A 3QSLA 1TFAA 2D21A 3V89B 3UORA 1DTZA 4G8HA 3L6GA 3TTLA 1BTJA 3IB2A 4ELRA 1EZOA 4GRKA 4EF2A 3OENA 4I62A 3RTFB 4JDFA 2HEUA 3PUVE 5KZTA 1H3DA 1SBPA 4IO4A 3B6TA 2A5TB 2ALUA 1SDXA 3JV9A 4GFRA 3PPRA 2O69A 2ZYMA 4JB7A 1B2HA 4HCWA 4Z0IA 3TCHA 5I2NB 1M5BA 2PVUA 1A40A 1EZ9A 2I49A 2XD3A 3VVEA 3HN0A 3GLBA 1IIWA 3SERA 1QKBA 1NFTA 3VV5A 1MY0A 3PUWE 1WVJA 2VHAA 2W7YA 3GZGA 4GOTA 4KYEA 4NTLA 4U4SA 3RUMA 1F9BA 3K6XA 4AB6A 3L6HA 4X9TA 3RTWB 1JW4A 1UQWA 3C36A 3GBBA 3KBRA 3PPQA 4R6HA 1JVYA 2Y7WA 4BDRA 5JTYA 1VR5A 2XXHA 3S9MC 1JEUA 3FXRA 4RK2A 1JQFA 1XC1A 5CI5A 3RN8A 1VFEA 4ZE8A 3E9XA 1B0LA 3MQ9A 3UN6A 3FJ7A 2Q9TA 4N6PA 4YKJA 3WAFA 5H8HA 2GHBA 3GXAA 3VVDA 3ZS6A 1P1NA 4DIGA 1JNFA 2QSXA 1O63A 3ONMA 3QAXA 4WEPA 4ZEDA 3CIJA 3QUJA 5AA4A 2PT2A 4KI0E 1A54A 1A8FA 2X7QA 4I9DA 2GRVA 2DP8A 3K6WA 3SEWA 5EYFA 1H45A 4F39A 5KCJB 5IKBA 4F1UA 1ATGA 1MQJA 2UYFA 3KFMA 1B7UA 3MZ9A 3PGFA 2V84A 5H8NA 4QSDA 1FTJA 2LAOA 4QFOA 2YJPA 3MZBA 2QS4A 1GV8A 3TUSA 1LBCA 3CG3A 3PD9A 4H5GA 2PT1A 4RYAA 1OIBA 1P1UA 4YAHX 5F7VA 3KEIA 3TAJA 4ESWA 4R73A 4BDQA 4YB6A 1ANFA 2XX9A 1NH7A 1ZJLA 2VOZA 4DDDA 1B32A 2QS1A 4Q5TA 3W9WA 2I0CA 1M5FA 4OESA 5B70A 1QVSA 4ELPA 2XXUA 1Z7ME 3IOWA 4RNSA 1B7HA 4RJZA 4OEUA 3TPAA 3B7DA 3ZSFA 4C1UA 4PQJA 4QFKA 4RPNA 4UACA 4ZDMA 4F19A 1J1NA 2O7UA 3BBRA 1AH5A 2OCUA 2BJJX 2OZZA 2Q2AA 4MF3A 3VE1B 3MPKA 3C9HA 3OSQA 1B5JA 1FTMA 4NEDA 4AQ4A 4LQ2A 4F29A 4OVJA 4ZZEA 4O3AA 5FTIA 3C33A 3G7WA 3C34A 3KN7A 2XXVA 3E13X 2NVUB 5I59A 4R9FA 2ZYNA 2UVHA 1MXWA 3M3KA 2DWAA 3TODA 3MJNA 3CFLA 2PYYA 1LCFA 3EHTA 3IORA 1ZKBA 3W9VA 2O68A 3QYTA 1ZIUA 5CRYA 3IL1B 1A7LA 1Q35A 3C31A 3IOVA 3G3FA 4YMAA 3IB1A 4F3BA 3RLFE 1VFDA 3K4UA 1LSTA 1BLFA 1XS5A 2QMWA 2ZYOA 3CSGA 1H44A 5K2XA 3VXCA 1JVXA 1TFDA 3DELB 4OHNA 3A09A 4EUOA 2QJEA 4EQ9A 3MVZA 1Y3NA 1P1QA 3IOUA 2I58A 5BWJA 2F5XA 4OERA 3KZGA 1LCTA 5I58A 2FYIA 1B3FA 1JETA 1O7TA 3Q27A 1CE2A 2NWJA 1LFIA 2F35A 3IB0A 1HSEA 4M4GA 4R6YA 1USYH 5DT6A 1LBBA 1WDNA 1CB6A 3KSJA 3OO7A 4RA1A 3BFUA 1PBQA 1RYOA 4OWDA 5H8FB 3FATA 3ZKLA 1Y20A 4F3PA 1ZBMA 3N94A 1MPCA 1GR2A 2E0SA 2PBWA 1MPDA 1QUKA 4F31B 3UGWA 3S9EA 2VD2A 4FEDA 4PETA 4XIGQ 2F8DA 2XXIA 1US4A 3AXFA 4YU0A 1ZLQA 1B4HA 1SI1A 4NF8B 1B1XA 5DVIA 5FHOA 5AA2A 4MLQA 2THIA 1MM6A 3GBAA 2H98A 4YKKA 1PDAA 1B3GA 1D9YA 1QW0A 4OFJA 5DVFA 3U92A 1IXIA 3QIMA 2H9BA 4GWOA 3I6VA 1GVCA 1SW2A 4P11A 2FNCA 1SYHA 3MP1A 2UVGA 1B3EA 4HTGA 1UIVA 3C35A 4P0IA 2DE4A 3A3UA 1B58A 1URSA 2P2AA 1DTGA 3VDFA 1FQBA 4Q8RA 2I4BA 3FV1A 3FV2A 4H8JA 4H67A 5HBCA 3QXMA 2Y7IA 3TZAA 5HM4B 3PPNA 3C4MA 1SD3A 1LAFE 4EDPA 4EQ7A 4R2BA 4LUBA 5KDTA 2O51A 2QMXA 2ABHA 2R9JA 1ELJA 3PU5A 4IO2A 4F1VA 4NF4A 1TWYA 3FVGA 4HW8A 5LOMA 3DP6A 3CSBA 3H6WA 1SW1A 4OMBA 3VLVA 1Q1KA 4YKPA 2Y7PA 1I6AA 2I6EA 3K01A 4H5FA 1S9TA 4L17A 1UTBB 3CR9A 3LUYA 3G3HA 2B3BA 4NWDA 3TFLA 3THIA 1LFHA 3S9LC 5DEXA 1NNFA 5H8QB 4FATA 3RNNA 3WAEA 2I3VA 1QKAA 2NUVA 3HHGA 3OO6A 3Q28A 1B1HA 2VP1A 3IK6B 3M8UA 4C0RA 5BUUA 1NKXA 2F7CA 2RC7A 1SI0A 4OENA 4QHQA 2OJTA 3TKDA 3MWBA 3D4GA 2O7IA 2QS3A 1MY2A 2ONRA 4H8IA 5FTHA 5CM6A 4OETA 2QL3A 2P0SA 4G8NA 4IY5A 2XX7A 4O3CA 2ONSA 3UA8A 5ISUA 3H6VA 2ESNA 4WXJA 4MBPA 2ZNTA 1ZTYA 2Q2CA 2RC8A 3FJGA 4FECA 1KWHA 1N76A 3VLUA 1H76A 3DLNA 2I0BA 1LGBC 3RGYA 4FORA 1MDP1 1MG1A 1MM7A 4R6KA 3O9PA 2RC9A 1MXZA 1URGA 1Y9UA 2AYSA 1NNKA 3CI8A 3HHFA 3O28A 2ZMBA 3S4UA 1L5TA 4KFQA 3TQWA 2QRYA 3ZKKA 3TTNA 1US5A 1MH4A 1B6HA 1FQAA 3IOTA 4LA9A 3FXUA 5ELVA 3K1NA 4UA8A 1POTA 2XXPA 1I6QA 4RY1A 3SKPA 3FGSA 3Q25A 4U1ZA 3CFXA 3UIFA 1LAGE 3MVYA 2Z23A 1UTHA 1WODA 1AL3A 4F3SA 2Q88A 1YAEA 5AA1A 3TELA 5ITPA 3PUZE 3PUYE 1BIYA 1HSLA 2D5WA 2G29A 3TTRA 2V25A 4KHZE 4R72A 3TYHA 1DMBA 5H8HB 1MRPA 4G68A 1FTOA 3RQTA 3LBSA 3MUQA 2Z8FA 3PUXE 1S7YA 1MS7A 4OTEA 4NF6A 4QF9A 1MQIA 4OFLA 1MY4A 4LQ5A 1FQCA 3N6TA 4QFPA 2F78A 2Y7RA 1VSOA 5A5XA 2PMSA 3DP8A 4OFOA 1MXYA 1OQHA 1OMPA 1TXFA 2HCAA 2VD3A 3C32A 3N26A 1SVXB 1MY3A 3D4CA 4FEBA 4GXSB 4KQPA 4NF6B 1N0TA 2GHAA 2VGQA 4Q30B 4YB5A 4NMYA 5L8DA 2X7PA 4G68B 2I48A 4LZ8A 3CFZA 2H99A 3QK6A 3H7MA 1IEJA 3KGCA 3MP6A 4X1DA 1IXHA 3SESA 4QFNA 3VVFA 2IEEA 3TTMA 2Y7KA 3U72A 1Y3QA 1D3KA 3CRBA 3T9HB 3RPWA 3I5OA 5EHMA 3M3FA 1XVXA 3EF7A 3F11A 1UTHB 3T66A 3T93B 2ZNSA 3SEUA 1IITA 3MVWA 4H65A 3S9NC 1MDQA 3FZVA 3I3VA 1Y1ZA 2RF1A 2V93A 2KLFA 1RKMA 2DVZA 1MQHA 3KN3A 4U1OA 3SDFA 1Y3PA 2F34A 2O6AA 4YKIA 4ZEKA 4XKNA 4DXUA 3H6TA 2DXRA 4LATA 3W15C 3H06B 4IO3A 4NWCA 1LB8A 1AMFA 2ZXTA 3Q29A 4F22A 2OBGA 3IJXB 3G3IA 1EU8A 1PC3A 3FD3A 5I2KA 2XD2A 3T9UA 1R1NA 3VLWA 2CMOA 3TMGA 4IO5A 1XHYA 2IA4A 4U21A 1B52A 1LFGA 1N7XA 2I3WA 1I6BA 4TLLB 3TQLA 2UVJA 1POY1 3K00A 5TPAB 4EQBA 4XXUA 4MLVA 3MW0A 1GGGA 1PB7A 5DTBA 3OEMA 4RPOA 2AL4A 1FW0A 2P1SA 3JYRA 4GL0A 4U2RA 3QUFA 4GD5A 4WEDA 1R9QA 1LAXA 1NL5A 2AL5A 1YCJA 2DYXA 1FQEA 3N6UA 3P7IA 2UVIA 2DSFA 3FVKA 1EZPA 2OWSA 3TCFA 2HXWA 2DVCA 3RT8A 4BDNA 1B05A 5AA3A 5CBSA 1R6ZA 2RCBA 3FVOA 2B3FA 3UK4A 3B6QA 4K3FA 4N13A 4PFYA 1D4NA 3OO8A 5DEXB 1TT1A 1B5IA 3O6HA 4XKQA 2Z22A 5DYHA 5H8SA 5ITOA 1Z7NE 3U8QA 1UTBA 3LR1A 3MP8A 4ECFA 5H8NB 3V83A 5L9SA 4FIMA 1B7ZA 2H25A 3R6UA 4JWOA 1JW5A 3HPIA 3MPLA 2DWHA 5K2YA 5KCJA 4JBZA 2G93A 4PFWA 4PE5B 3FIRA 4QSCA 3G3JA 3LSWA 4G4PA 4KYDA 3BFTA 1T0KA 5AA4B 1AIVA 1URDA 1BP5A 1PB8A 1OLAA 1VE4A 4I8CA 5CMKA 2D3IA 4BDOA 1IUDA 3A3CA 1RYXA 3SETA 5HPQA 4KR5A 4QRZA 4ND9A 3PPOA 3Q26A 3DP4A 3FASA 4H1XA 1QUIA 3LSXA 4KD5A 1B3HA 4GIZA 3R7XA 1NNTA 2UYEA 4MFIA 2DOJA 1MPBA 2DWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYS A;  2O1M A;  1IQ7 A;  2REG A;  4DCY A;  4IGT A;  3OSR A;  3K1P A;  3PPP A;  4KCD A;  5F1Q A;  1B9J A;  3K6U A;  1B51 A;  3E3K A;  3H3G A;  4QFL A;  4P0G A;  4DXB A;  3U93 A;  2DS9 A;  1MY1 A;  3CVG A;  2ANJ A;  1QUL A;  3O6I A;  5TU0 A;  3T96 B;  4H6D A;  2GH9 A;  4FE8 A;  2Q8J A;  3KG2 A;  4YZZ A;  3EHS A;  4IO6 A;  4OXV A;  2F7B A;  3OEL A;  4THI A;  3FVN A;  2HZL A;  4RK9 A;  5TPA A;  4BLA A;  4YMB A;  3KJT A;  3S2V A;  2XXX A;  1QUJ A;  3OEK A;  4U22 A;  3MBP A;  4IY6 A;  1B46 A;  3K02 A;  4FJP A;  5ICT A;  4GL8 A;  3FJM A;  3DM0 A;  2F36 A;  3SEX A;  1XOC A;  1OQG A;  5I2K B;  3HV1 A;  2OK2 A;  3LSF B;  3OMB A;  3ILU B;  4XKP A;  3V5A A;  4ZEC A;  1FTL A;  1M5E A;  2XXW A;  1OVB A;  1B5H A;  5I58 B;  3IJO B;  4ONY A;  2Q89 A;  2H5Y A;  4G8M A;  4HS7 A;  4NF5 A;  5TP9 A;  4BDM A;  1IZ1 A;  4HCY A;  1OVT A;  1SW5 A;  3PV0 E;  1JW1 A;  2XXQ A;  4F2Q A;  5I84 A;  1EH3 A;  3SEV A;  4N07 A;  4GF8 A;  3IO4 A;  2R6G E;  4OYV A;  1YPN A;  3HCQ A;  5AA2 B;  1N84 A;  2ZNU A;  4NF8 A;  4JWY A;  4KCC A;  1XVY A;  2F97 A;  1LAH E;  3OOA A;  3OXN A;  1LLS A;  3T22 A;  2O1L A;  4IGR A;  2B65 A;  2QPQ A;  2RKM A;  3VFJ A;  4EXL A;  2FA7 A;  5I59 B;  1FQD A;  4PFT A;  1P1W A;  4ELQ A;  4JWX A;  3HST A;  4PP0 A;  3VXB A;  2F7A A;  4TOZ A;  4FAJ A;  2RCA A;  4DXC A;  3KSX A;  3RY3 A;  3KOT A;  5AE4 A;  5CBR A;  5AA2 D;  5FHN A;  3H6U A;  3HO7 A;  1R9L A;  4F1Y A;  5A5X B;  5ICQ A;  2WKY A;  4I1D A;  4LZ7 A;  2F6G A;  5JEI A;  4LON B;  1GTK A;  2OWT A;  5J1D A;  2OLB A;  4R74 A;  3EN3 A;  4F2O A;  5B7D A;  4KPT A;  4XTC Q;  5L9M A;  3SEY A;  3V8X B;  3H4Z A;  1N3W A;  3JZJ A;  1P1O A;  2XHD A;  5I56 A;  3K0V A;  2ONK E;  3TEP A;  1FTK A;  2CZL A;  4ZEF A;  4DLD A;  1JEV A;  3FUZ A;  2F6P A;  3K2D A;  3N5L A;  4OEV A;  2HQ0 A;  1IXG A;  5CMC A;  5DVJ A;  2AIX A;  2NXO A;  3IAZ A;  5EHS A;  2DWJ A;  3MVX A;  1QJM A;  1A8E A;  2H4I A;  2YPN A;  4G77 A;  3IX1 A;  1PEB A;  3PD8 A;  3PMW A;  1N04 A;  4F18 A;  3USD A;  2DXY A;  4YIC A;  3K6V A;  4ZS9 A;  2O84 X;  1A55 A;  2Y84 A;  3O6G A;  2XXT A;  3LSL A;  4GQO A;  3U1O A;  4GLI A;  1MXV A;  5I57 A;  4OQO A;  4YB7 A;  2HZK A;  1FCK A;  1USY E;  3EHU A;  4R2F A;  2V3U A;  4G68 C;  4EXK A;  4EF1 A;  3B6W A;  4LVQ A;  2Z8D A;  3ILT B;  2V3T A;  4ZEI A;  2REJ A;  3O2A A;  1MH3 A;  1O64 A;  4LZ5 A;  1M5D A;  4OZ9 A;  1SW4 A;  3OD7 A;  4PFU A;  4IB2 A;  4POX A;  4AB5 A;  2QS2 A;  4H0W A;  1Y1M A;  2HFB A;  2HAV A;  4BDL A;  3TCG A;  3MZ1 A;  4ZZA A;  5I57 B;  3E4R A;  5JTY B;  4E0W A;  1S50 A;  2XX8 A;  4X48 A;  3H03 A;  3OO9 A;  2M8C A;  1M5C A;  2DE3 A;  4LP2 B;  3U94 A;  5JK4 A;  4ESX A;  2A5S A;  2DQV A;  1MQG A;  1B4Z A;  4R9G A;  1P99 A;  2PX1 A;  2I4C A;  4JSD A;  3IR1 A;  3MAM A;  3M3L A;  4U4X A;  1B3L A;  5H8Q A;  1SQY A;  1BKA A;  2GFE A;  1MXU A;  3EQ1 A;  3LC8 A;  3KOS A;  4X1B A;  5M2V A;  3T9X B;  4WKM A;  3TTK A;  5CMM A;  4TLM B;  1NMU A;  2A5T A;  3BKI B;  3KJ7 A;  3PMX A;  4GXA A;  4ZE9 A;  5I56 B;  1IXC A;  1DPE A;  1PBP A;  1DSN A;  3MC2 A;  1DPP A;  4JXI A;  4M1V A;  4MH5 A;  4DZ1 A;  4TQU Q;  1Y4T A;  3IO6 A;  3K1M A;  1NNP A;  4ISU A;  4NF4 B;  1MXX A;  1D9V A;  5CMB A;  2Z8E A;  5KDT B;  1I69 A;  4DE8 A;  1PB9 A;  4ZEB A;  3O66 A;  3R26 A;  1AOV A;  4NE4 A;  3G3K A;  4RXL A;  1MQD A;  4QSE A;  1N3X A;  4Q0C A;  2HAU A;  4U23 A;  3O29 A;  1A99 A;  1LB9 A;  1SYI A;  1Y4C A;  4JSO A;  3RT6 B;  2XXR A;  2DE2 A;  1H43 A;  4Z7E A;  2V3Q A;  5IAI A;  1OLC A;  2X26 A;  1II5 A;  3G3G A;  4GVO A;  4XKR A;  1DOT A;  1YTV A;  2R71 A;  3CG1 A;  3FXQ A;  4G2Z A;  1B40 A;  2YLN A;  4E0X A;  1B0H A;  2RIN A;  2XXY A;  1XT8 A;  2NOO A;  3ECR A;  3PMV A;  1FQF A;  4C1T A;  5I2N A;  1NH8 A;  1ZMG A;  3TDJ A;  4ELO A;  3O97 A;  3EPE A;  3KN8 A;  3T9V A;  4NF5 B;  5TP9 B;  2ZYK A;  4O3B A;  5CC2 A;  4DCX A;  5FHM A;  4IO7 A;  4F3G A;  2UXA A;  1ZU0 A;  3ODB A;  4POW A;  1N7W A;  3UP9 A;  1UIU A;  5H8F A;  5L9O A;  2E1S A;  1HSJ A;  4R75 A;  3QSL A;  1TFA A;  2D21 A;  3V89 B;  3UOR A;  1DTZ A;  4G8H A;  3L6G A;  3TTL A;  1BTJ A;  3IB2 A;  4ELR A;  1EZO A;  4GRK A;  4EF2 A;  3OEN A;  4I62 A;  3RTF B;  4JDF A;  2HEU A;  3PUV E;  5KZT A;  1H3D A;  1SBP A;  4IO4 A;  3B6T A;  2A5T B;  2ALU A;  1SDX A;  3JV9 A;  4GFR A;  3PPR A;  2O69 A;  2ZYM A;  4JB7 A;  1B2H A;  4HCW A;  4Z0I A;  3TCH A;  5I2N B;  1M5B A;  2PVU A;  1A40 A;  1EZ9 A;  2I49 A;  2XD3 A;  3VVE A;  3HN0 A;  3GLB A;  1IIW A;  3SER A;  1QKB A;  1NFT A;  3VV5 A;  1MY0 A;  3PUW E;  1WVJ A;  2VHA A;  2W7Y A;  3GZG A;  4GOT A;  4KYE A;  4NTL A;  4U4S A;  3RUM A;  1F9B A;  3K6X A;  4AB6 A;  3L6H A;  4X9T A;  3RTW B;  1JW4 A;  1UQW A;  3C36 A;  3GBB A;  3KBR A;  3PPQ A;  4R6H A;  1JVY A;  2Y7W A;  4BDR A;  5JTY A;  1VR5 A;  2XXH A;  3S9M C;  1JEU A;  3FXR A;  4RK2 A;  1JQF A;  1XC1 A;  5CI5 A;  3RN8 A;  1VFE A;  4ZE8 A;  3E9X A;  1B0L A;  3MQ9 A;  3UN6 A;  3FJ7 A;  2Q9T A;  4N6P A;  4YKJ A;  3WAF A;  5H8H A;  2GHB A;  3GXA A;  3VVD A;  3ZS6 A;  1P1N A;  4DIG A;  1JNF A;  2QSX A;  1O63 A;  3ONM A;  3QAX A;  4WEP A;  4ZED A;  3CIJ A;  3QUJ A;  5AA4 A;  2PT2 A;  4KI0 E;  1A54 A;  1A8F A;  2X7Q A;  4I9D A;  2GRV A;  2DP8 A;  3K6W A;  3SEW A;  5EYF A;  1H45 A;  4F39 A;  5KCJ B;  5IKB A;  4F1U A;  1ATG A;  1MQJ A;  2UYF A;  3KFM A;  1B7U A;  3MZ9 A;  3PGF A;  2V84 A;  5H8N A;  4QSD A;  1FTJ A;  2LAO A;  4QFO A;  2YJP A;  3MZB A;  2QS4 A;  1GV8 A;  3TUS A;  1LBC A;  3CG3 A;  3PD9 A;  4H5G A;  2PT1 A;  4RYA A;  1OIB A;  1P1U A;  4YAH X;  5F7V A;  3KEI A;  3TAJ A;  4ESW A;  4R73 A;  4BDQ A;  4YB6 A;  1ANF A;  2XX9 A;  1NH7 A;  1ZJL A;  2VOZ A;  4DDD A;  1B32 A;  2QS1 A;  4Q5T A;  3W9W A;  2I0C A;  1M5F A;  4OES A;  5B70 A;  1QVS A;  4ELP A;  2XXU A;  1Z7M E;  3IOW A;  4RNS A;  1B7H A;  4RJZ A;  4OEU A;  3TPA A;  3B7D A;  3ZSF A;  4C1U A;  4PQJ A;  4QFK A;  4RPN A;  4UAC A;  4ZDM A;  4F19 A;  1J1N A;  2O7U A;  3BBR A;  1AH5 A;  2OCU A;  2BJJ X;  2OZZ A;  2Q2A A;  4MF3 A;  3VE1 B;  3MPK A;  3C9H A;  3OSQ A;  1B5J A;  1FTM A;  4NED A;  4AQ4 A;  4LQ2 A;  4F29 A;  4OVJ A;  4ZZE A;  4O3A A;  5FTI A;  3C33 A;  3G7W A;  3C34 A;  3KN7 A;  2XXV A;  3E13 X;  2NVU B;  5I59 A;  4R9F A;  2ZYN A;  2UVH A;  1MXW A;  3M3K A;  2DWA A;  3TOD A;  3MJN A;  3CFL A;  2PYY A;  1LCF A;  3EHT A;  3IOR A;  1ZKB A;  3W9V A;  2O68 A;  3QYT A;  1ZIU A;  5CRY A;  3IL1 B;  1A7L A;  1Q35 A;  3C31 A;  3IOV A;  3G3F A;  4YMA A;  3IB1 A;  4F3B A;  3RLF E;  1VFD A;  3K4U A;  1LST A;  1BLF A;  1XS5 A;  2QMW A;  2ZYO A;  3CSG A;  1H44 A;  5K2X A;  3VXC A;  1JVX A;  1TFD A;  3DEL B;  4OHN A;  3A09 A;  4EUO A;  2QJE A;  4EQ9 A;  3MVZ A;  1Y3N A;  1P1Q A;  3IOU A;  2I58 A;  5BWJ A;  2F5X A;  4OER A;  3KZG A;  1LCT A;  5I58 A;  2FYI A;  1B3F A;  1JET A;  1O7T A;  3Q27 A;  1CE2 A;  2NWJ A;  1LFI A;  2F35 A;  3IB0 A;  1HSE A;  4M4G A;  4R6Y A;  1USY H;  5DT6 A;  1LBB A;  1WDN A;  1CB6 A;  3KSJ A;  3OO7 A;  4RA1 A;  3BFU A;  1PBQ A;  1RYO A;  4OWD A;  5H8F B;  3FAT A;  3ZKL A;  1Y20 A;  4F3P A;  1ZBM A;  3N94 A;  1MPC A;  1GR2 A;  2E0S A;  2PBW A;  1MPD A;  1QUK A;  4F31 B;  3UGW A;  3S9E A;  2VD2 A;  4FED A;  4PET A;  4XIG Q;  2F8D A;  2XXI A;  1US4 A;  3AXF A;  4YU0 A;  1ZLQ A;  1B4H A;  1SI1 A;  4NF8 B;  1B1X A;  5DVI A;  5FHO A;  5AA2 A;  4MLQ A;  2THI A;  1MM6 A;  3GBA A;  2H98 A;  4YKK A;  1PDA A;  1B3G A;  1D9Y A;  1QW0 A;  4OFJ A;  5DVF A;  3U92 A;  1IXI A;  3QIM A;  2H9B A;  4GWO A;  3I6V A;  1GVC A;  1SW2 A;  4P11 A;  2FNC A;  1SYH A;  3MP1 A;  2UVG A;  1B3E A;  4HTG A;  1UIV A;  3C35 A;  4P0I A;  2DE4 A;  3A3U A;  1B58 A;  1URS A;  2P2A A;  1DTG A;  3VDF A;  1FQB A;  4Q8R A;  2I4B A;  3FV1 A;  3FV2 A;  4H8J A;  4H67 A;  5HBC A;  3QXM A;  2Y7I A;  3TZA A;  5HM4 B;  3PPN A;  3C4M A;  1SD3 A;  1LAF E;  4EDP A;  4EQ7 A;  4R2B A;  4LUB A;  5KDT A;  2O51 A;  2QMX A;  2ABH A;  2R9J A;  1ELJ A;  3PU5 A;  4IO2 A;  4F1V A;  4NF4 A;  1TWY A;  3FVG A;  4HW8 A;  5LOM A;  3DP6 A;  3CSB A;  3H6W A;  1SW1 A;  4OMB A;  3VLV A;  1Q1K A;  4YKP A;  2Y7P A;  1I6A A;  2I6E A;  3K01 A;  4H5F A;  1S9T A;  4L17 A;  1UTB B;  3CR9 A;  3LUY A;  3G3H A;  2B3B A;  4NWD A;  3TFL A;  3THI A;  1LFH A;  3S9L C;  5DEX A;  1NNF A;  5H8Q B;  4FAT A;  3RNN A;  3WAE A;  2I3V A;  1QKA A;  2NUV A;  3HHG A;  3OO6 A;  3Q28 A;  1B1H A;  2VP1 A;  3IK6 B;  3M8U A;  4C0R A;  5BUU A;  1NKX A;  2F7C A;  2RC7 A;  1SI0 A;  4OEN A;  4QHQ A;  2OJT A;  3TKD A;  3MWB A;  3D4G A;  2O7I A;  2QS3 A;  1MY2 A;  2ONR A;  4H8I A;  5FTH A;  5CM6 A;  4OET A;  2QL3 A;  2P0S A;  4G8N A;  4IY5 A;  2XX7 A;  4O3C A;  2ONS A;  3UA8 A;  5ISU A;  3H6V A;  2ESN A;  4WXJ A;  4MBP A;  2ZNT A;  1ZTY A;  2Q2C A;  2RC8 A;  3FJG A;  4FEC A;  1KWH A;  1N76 A;  3VLU A;  1H76 A;  3DLN A;  2I0B A;  1LGB C;  3RGY A;  4FOR A;  1MDP 1;  1MG1 A;  1MM7 A;  4R6K A;  3O9P A;  2RC9 A;  1MXZ A;  1URG A;  1Y9U A;  2AYS A;  1NNK A;  3CI8 A;  3HHF A;  3O28 A;  2ZMB A;  3S4U A;  1L5T A;  4KFQ A;  3TQW A;  2QRY A;  3ZKK A;  3TTN A;  1US5 A;  1MH4 A;  1B6H A;  1FQA A;  3IOT A;  4LA9 A;  3FXU A;  5ELV A;  3K1N A;  4UA8 A;  1POT A;  2XXP A;  1I6Q A;  4RY1 A;  3SKP A;  3FGS A;  3Q25 A;  4U1Z A;  3CFX A;  3UIF A;  1LAG E;  3MVY A;  2Z23 A;  1UTH A;  1WOD A;  1AL3 A;  4F3S A;  2Q88 A;  1YAE A;  5AA1 A;  3TEL A;  5ITP A;  3PUZ E;  3PUY E;  1BIY A;  1HSL A;  2D5W A;  2G29 A;  3TTR A;  2V25 A;  4KHZ E;  4R72 A;  3TYH A;  1DMB A;  5H8H B;  1MRP A;  4G68 A;  1FTO A;  3RQT A;  3LBS A;  3MUQ A;  2Z8F A;  3PUX E;  1S7Y A;  1MS7 A;  4OTE A;  4NF6 A;  4QF9 A;  1MQI A;  4OFL A;  1MY4 A;  4LQ5 A;  1FQC A;  3N6T A;  4QFP A;  2F78 A;  2Y7R A;  1VSO A;  5A5X A;  2PMS A;  3DP8 A;  4OFO A;  1MXY A;  1OQH A;  1OMP A;  1TXF A;  2HCA A;  2VD3 A;  3C32 A;  3N26 A;  1SVX B;  1MY3 A;  3D4C A;  4FEB A;  4GXS B;  4KQP A;  4NF6 B;  1N0T A;  2GHA A;  2VGQ A;  4Q30 B;  4YB5 A;  4NMY A;  5L8D A;  2X7P A;  4G68 B;  2I48 A;  4LZ8 A;  3CFZ A;  2H99 A;  3QK6 A;  3H7M A;  1IEJ A;  3KGC A;  3MP6 A;  4X1D A;  1IXH A;  3SES A;  4QFN A;  3VVF A;  2IEE A;  3TTM A;  2Y7K A;  3U72 A;  1Y3Q A;  1D3K A;  3CRB A;  3T9H B;  3RPW A;  3I5O A;  5EHM A;  3M3F A;  1XVX A;  3EF7 A;  3F11 A;  1UTH B;  3T66 A;  3T93 B;  2ZNS A;  3SEU A;  1IIT A;  3MVW A;  4H65 A;  3S9N C;  1MDQ A;  3FZV A;  3I3V A;  1Y1Z A;  2RF1 A;  2V93 A;  2KLF A;  1RKM A;  2DVZ A;  1MQH A;  3KN3 A;  4U1O A;  3SDF A;  1Y3P A;  2F34 A;  2O6A A;  4YKI A;  4ZEK A;  4XKN A;  4DXU A;  3H6T A;  2DXR A;  4LAT A;  3W15 C;  3H06 B;  4IO3 A;  4NWC A;  1LB8 A;  1AMF A;  2ZXT A;  3Q29 A;  4F22 A;  2OBG A;  3IJX B;  3G3I A;  1EU8 A;  1PC3 A;  3FD3 A;  5I2K A;  2XD2 A;  3T9U A;  1R1N A;  3VLW A;  2CMO A;  3TMG A;  4IO5 A;  1XHY A;  2IA4 A;  4U21 A;  1B52 A;  1LFG A;  1N7X A;  2I3W A;  1I6B A;  4TLL B;  3TQL A;  2UVJ A;  1POY 1;  3K00 A;  5TPA B;  4EQB A;  4XXU A;  4MLV A;  3MW0 A;  1GGG A;  1PB7 A;  5DTB A;  3OEM A;  4RPO A;  2AL4 A;  1FW0 A;  2P1S A;  3JYR A;  4GL0 A;  4U2R A;  3QUF A;  4GD5 A;  4WED A;  1R9Q A;  1LAX A;  1NL5 A;  2AL5 A;  1YCJ A;  2DYX A;  1FQE A;  3N6U A;  3P7I A;  2UVI A;  2DSF A;  3FVK A;  1EZP A;  2OWS A;  3TCF A;  2HXW A;  2DVC A;  3RT8 A;  4BDN A;  1B05 A;  5AA3 A;  5CBS A;  1R6Z A;  2RCB A;  3FVO A;  2B3F A;  3UK4 A;  3B6Q A;  4K3F A;  4N13 A;  4PFY A;  1D4N A;  3OO8 A;  5DEX B;  1TT1 A;  1B5I A;  3O6H A;  4XKQ A;  2Z22 A;  5DYH A;  5H8S A;  5ITO A;  1Z7N E;  3U8Q A;  1UTB A;  3LR1 A;  3MP8 A;  4ECF A;  5H8N B;  3V83 A;  5L9S A;  4FIM A;  1B7Z A;  2H25 A;  3R6U A;  4JWO A;  1JW5 A;  3HPI A;  3MPL A;  2DWH A;  5K2Y A;  5KCJ A;  4JBZ A;  2G93 A;  4PFW A;  4PE5 B;  3FIR A;  4QSC A;  3G3J A;  3LSW A;  4G4P A;  4KYD A;  3BFT A;  1T0K A;  5AA4 B;  1AIV A;  1URD A;  1BP5 A;  1PB8 A;  1OLA A;  1VE4 A;  4I8C A;  5CMK A;  2D3I A;  4BDO A;  1IUD A;  3A3C A;  1RYX A;  3SET A;  5HPQ A;  4KR5 A;  4QRZ A;  4ND9 A;  3PPO A;  3Q26 A;  3DP4 A;  3FAS A;  4H1X A;  1QUI A;  3LSX A;  4KD5 A;  1B3H A;  4GIZ A;  3R7X A;  1NNT A;  2UYE A;  4MFI A;  2DOJ A;  1MPB A;  2DWI A; 
#chains in the Genus database with same CATH topology
 3K1P A;  3PPP A;  5F1Q A;  1B9J A;  3H3G A;  4QFL A;  4DXB A;  2DS9 A;  3T96 B;  4H6D A;  4IO6 A;  4OXV A;  2XXX A;  1B46 A;  1OQG A;  5I2K B;  3V5A A;  4ZEC A;  1FTL A;  2H5Y A;  4NF5 A;  1YZ0 A;  2VPN A;  2OX3 A;  3PV0 E;  5I84 A;  4F2Q A;  1EH3 A;  4N07 A;  4OYV A;  1YPN A;  4H46 A;  5AA2 B;  4NF8 A;  4JWY A;  3OXN A;  4NAP A;  2QPQ A;  5FBP A;  5I59 B;  1P1W A;  3HST A;  1LEV A;  3VXB A;  4FAJ A;  4DXC A;  5CBR A;  2CEX A;  4H45 A;  4I1D A;  2F6G A;  2OWZ A;  2OWT A;  5J1D A;  4R74 A;  4KPT A;  5L9M A;  3H4Z A;  2XHD A;  1FJ9 A;  1LBY A;  2CZL A;  4G61 A;  4ZEF A;  4DLD A;  3FUZ A;  4OVQ A;  5CMC A;  2NXO A;  3MVX A;  4G77 A;  2YPN A;  3IX1 A;  3PD8 A;  3PMW A;  3K6V A;  3LV0 A;  4ZS9 A;  1A55 A;  4P9K A;  4GWW A;  4YB7 A;  1FCK A;  4AS5 A;  4R2F A;  4G68 C;  2Z8D A;  4ZEI A;  4LZ5 A;  1RDZ A;  4AB5 A;  3TCG A;  3H03 A;  4LP2 B;  5JK4 A;  4R9G A;  2PX1 A;  2I4C A;  4JSD A;  1SQY A;  2GFE A;  5M2V A;  4WKM A;  5CMM A;  4TLM B;  1NMU A;  3BKI B;  4GXA A;  5I56 B;  1DSN A;  2WEF A;  1NNP A;  4OVS A;  1MXX A;  5CMB A;  2Z8E A;  4DE8 A;  4NE4 A;  3O29 A;  1A99 A;  4JSO A;  2XXR A;  4O94 A;  5IAI A;  1OLC A;  1YTV A;  4G2Z A;  1B40 A;  4E0X A;  4GWX A;  1B0H A;  2XA5 A;  3KN8 A;  4O3B A;  5FHM A;  4IO7 A;  3UP9 A;  1N7W A;  5H8F A;  4NG7 A;  4PE3 A;  1TFA A;  1DTZ A;  4G8H A;  4MNI A;  3L6G A;  3TTL A;  1BTJ A;  4ELR A;  1EZO A;  4EF2 A;  3OEN A;  4I62 A;  3RTF B;  1H3D A;  3TCH A;  4Z0I A;  3PTY A;  1A40 A;  1EZ9 A;  2I49 A;  3VVE A;  1NFT A;  2B4M A;  1F9B A;  2ZZW A;  1JW4 A;  3GBB A;  1JVY A;  3B8B A;  3V83 A;  1JEU A;  3HFU A;  4ZE8 A;  1B0L A;  4YKJ A;  1AWB A;  2QSX A;  3QAX A;  3CIJ A;  4KI0 E;  1A54 A;  1A8F A;  2X7Q A;  4I9D A;  3K6W A;  5EYF A;  4F39 A;  1MQJ A;  3PGF A;  3MZ9 A;  1FTJ A;  3MZB A;  1GV8 A;  3CG3 A;  4H5G A;  4YAH X;  2PT1 A;  2VOZ A;  2QS1 A;  4Q5T A;  3W9W A;  4OES A;  1QVS A;  4PGP A;  3ROJ A;  4QFK A;  4ZDM A;  1LBX A;  2OZZ A;  4MF3 A;  4JVD A;  3MPK A;  3OSQ A;  1FTM A;  1G0I A;  1FBC A;  3KN7 A;  2UVH A;  1MXW A;  3M3K A;  3TOD A;  3CFL A;  1FBP A;  3EHT A;  1ZKB A;  3QYT A;  2B4L A;  1A7L A;  4F3B A;  1JVX A;  1TFD A;  3DEL B;  4EQ9 A;  3IOU A;  2I58 A;  4OER A;  1LCT A;  5I58 A;  2FYI A;  1B3F A;  1JET A;  1O7T A;  4P3L A;  2NWJ A;  1LFI A;  2F35 A;  4R6Y A;  1USY H;  3BFU A;  1ZBM A;  2XXK A;  2E0S A;  2PBW A;  1MPD A;  1QUK A;  2VD2 A;  1DBZ A;  5IM2 A;  4XIG Q;  5FHO A;  5AA2 A;  1MM6 A;  3GBA A;  1PDA A;  1B3G A;  1QW0 A;  4OFJ A;  2H9B A;  4F2O A;  1SW2 A;  1SYH A;  3MP1 A;  2PFY A;  4GX3 A;  2I4B A;  4H67 A;  2Y7I A;  1IMA A;  4EDP A;  5IZ1 A;  4IO2 A;  4NF4 A;  1TWY A;  4HW8 A;  4N15 A;  1S9T A;  2B3B A;  5DEX A;  1NNF A;  3EKI A;  4FAT A;  1QKA A;  3IK6 B;  4C0R A;  2F7C A;  2RC7 A;  4QHQ A;  3MWB A;  3A29 A;  5CM6 A;  2P0S A;  4IY5 A;  2ONS A;  1ZTY A;  1KWH A;  1N76 A;  4LN5 A;  3DLN A;  4FOR A;  1MG1 A;  1MXZ A;  3CI8 A;  4P8B A;  5IZZ A;  2QRY A;  1US5 A;  1POT A;  3SKP A;  3MVY A;  2Z23 A;  1UTH A;  1AL3 A;  5AA1 A;  1BIY A;  1HSL A;  2G29 A;  3TTR A;  1DMB A;  1FTO A;  4OTE A;  1S7Y A;  1MS7 A;  3T1B A;  2FVZ A;  2FIE A;  5I5P A;  1MXY A;  2VD3 A;  4GXS B;  1SVX B;  4FEB A;  4NF6 B;  4KQP A;  4Q30 B;  2VGQ A;  2X7P A;  5H8H A;  4X1D A;  1IEJ A;  3MP6 A;  1IXH A;  1NUZ A;  2IEE A;  3U72 A;  1D3K A;  3M3F A;  1XVX A;  4MHF A;  3T66 A;  2F3D A;  3MVW A;  3S9N C;  3FZV A;  2RF1 A;  2V93 A;  4U1O A;  3SDF A;  1Y3P A;  2F34 A;  4ZEK A;  4XKN A;  4LAT A;  4NWC A;  4F22 A;  3FD3 A;  1XHY A;  2IA4 A;  1B52 A;  2I3W A;  4EQB A;  2UVJ A;  4XXU A;  1GGG A;  4GL0 A;  2AL5 A;  1FQE A;  3N6U A;  1FPL A;  3RT8 A;  1YYZ A;  2RCB A;  3B6Q A;  5ITO A;  1TT1 A;  3O6H A;  4XKQ A;  5DYH A;  4XEQ A;  4ECF A;  1B7Z A;  5K2Y A;  4JWO A;  3MPL A;  1KA0 A;  4I40 A;  3KC0 A;  4KYD A;  1AIV A;  1OLA A;  3SET A;  4ND9 A;  3Q26 A;  1YXI A;  1B3H A;  1JP4 A;  3RPL A;  4IGT A;  1KA1 A;  4KCD A;  3K6U A;  1LBW A;  5TU0 A;  4RK9 A;  5TPA A;  4BLA A;  3OEK A;  4IY6 A;  4GL8 A;  3OMB A;  1NV6 A;  3KC1 A;  2XXW A;  1OVB A;  3IJO B;  1IZ1 A;  4HCY A;  3MYU A;  1NV1 A;  4PF6 A;  2F97 A;  4HE2 A;  1LAH E;  1LLS A;  4IGR A;  1FQD A;  4PFT A;  3HO7 A;  3EN3 A;  3V8X B;  4XTC Q;  3SEY A;  4GBW A;  1P1O A;  3TEP A;  1JEV A;  1IXG A;  5DVJ A;  2AIX A;  3QMF A;  1QJM A;  4F18 A;  4PFR A;  2DXY A;  1NUW A;  4GWY A;  2XXT A;  4GLI A;  4PF8 A;  1USY E;  4MMP A;  3ILT B;  2REJ A;  3O2A A;  3OD7 A;  4POX A;  2QS2 A;  3MZ1 A;  3E4R A;  1S50 A;  2A5S A;  1MQG A;  3IR1 A;  4U4X A;  5H8Q A;  1BKA A;  4X1B A;  3PMX A;  1PBP A;  4DZ1 A;  5EQ8 A;  4MJO A;  1I69 A;  1PB9 A;  4ZEB A;  2QVU A;  4RXL A;  4QSE A;  2HAU A;  1FBE A;  1FPD A;  1H43 A;  2V3Q A;  1II5 A;  4GVO A;  3FXQ A;  2XXY A;  2RIN A;  1XT8 A;  1ZMG A;  2CEY A;  4F3G A;  3ODB A;  1HSJ A;  4MEV A;  3QSL A;  2D21 A;  2Y5L A;  4GRK A;  4JDF A;  3PUV E;  5KZT A;  1SBP A;  4IO4 A;  3B6T A;  5EQ7 A;  3JV9 A;  4GFR A;  1B2H A;  5I2N B;  1M5B A;  3GLB A;  3SER A;  3VV5 A;  1QKB A;  3RPL B;  1WVJ A;  4NTL A;  3GZG A;  4U4S A;  3K6X A;  3L6H A;  4ELO A;  5JTY A;  3S9M C;  5CI5 A;  3RN8 A;  1VFE A;  3MQ9 A;  3ONM A;  4WEP A;  5T3J A;  3QUJ A;  5KCJ B;  2UYF A;  2V84 A;  3TUS A;  1LBC A;  4RYA A;  3LUZ A;  1OIB A;  3KEI A;  4BDQ A;  4YB6 A;  1ANF A;  2XX9 A;  3GYY A;  1NV2 A;  1B7H A;  4RJZ A;  4NQ8 A;  3TPA A;  4UAC A;  3BBR A;  1AH5 A;  2OCU A;  2HHM A;  4ZZE A;  3ISP A;  4O3A A;  3C33 A;  1RDY A;  3G7W A;  2XXV A;  3E13 X;  5I3S A;  1LCF A;  3IOR A;  1ZIU A;  3IL1 B;  3C31 A;  3IB1 A;  1LST A;  2ZYO A;  2QMW A;  3CSG A;  1KZ8 A;  5ESY A;  3A09 A;  1P1Q A;  2BJI A;  5DT6 A;  1CB6 A;  4N4U A;  3N94 A;  1GR2 A;  4F31 B;  3S9E A;  3BIH A;  2F8D A;  4FBP A;  4PFI A;  4YKK A;  4P0I A;  3C35 A;  2DE4 A;  1DTG A;  5HBC A;  3U65 A;  3PPN A;  4R2B A;  4LUB A;  2ABH A;  4F1V A;  3FVG A;  4N17 A;  3DP6 A;  4OMB A;  1FBD A;  4YKP A;  1I6A A;  4L17 A;  3G3H A;  3S9L C;  1FPI A;  5H8Q B;  3WAE A;  2I3V A;  2NUV A;  3Q28 A;  3M8U A;  1NKX A;  1SI0 A;  3TKD A;  5FTH A;  4OET A;  3H6V A;  4DI3 D;  4P56 A;  3FJG A;  2Q2C A;  4FEC A;  3IFA A;  3WAF A;  1MDP 1;  4HE1 A;  2AYS A;  3O28 A;  4F1U A;  1NNK A;  3NOH A;  2ZMB A;  4KFQ A;  3ZKK A;  1FQA A;  3IOT A;  4LA9 A;  3FXU A;  2XXP A;  3UIF A;  5ET8 A;  1LAG E;  2QFL A;  1WOD A;  1FRP A;  2Q88 A;  1YAE A;  5EQA A;  5EYG A;  3TEL A;  3PUZ E;  3PUY E;  5ITP A;  2D5W A;  4KHZ E;  4R72 A;  1MRP A;  4G68 A;  2Z8F A;  4NF6 A;  1MQI A;  2Y7R A;  1OQH A;  3RUM A;  1TXF A;  3C32 A;  4Q0C A;  1MY3 A;  3D4C A;  1N0T A;  2GHA A;  5I58 B;  3CFZ A;  2H99 A;  3H7M A;  4N8G A;  2Y7K A;  3T9H B;  3I5O A;  3T93 B;  2ZNS A;  1FTA A;  1MDQ A;  2L5V A;  2O6A A;  4N6K A;  2CZI A;  2DXR A;  4MCO A;  1SPI A;  4IO3 A;  1AMF A;  2ZXT A;  3IJX B;  3G3I A;  1PC3 A;  2XD2 A;  1R1N A;  3VLW A;  2CMO A;  3TMG A;  4IO5 A;  4U21 A;  5TPA B;  4MLV A;  3MW0 A;  5DTB A;  4NX1 A;  2AL4 A;  4U2R A;  1D9Q A;  1NL5 A;  2DYX A;  2DSF A;  1EZP A;  3TCF A;  2HXW A;  4N81 A;  4QXD A;  1B05 A;  5AA3 A;  5CBS A;  1FBF A;  2WYK A;  3UK4 A;  4K3F A;  4N13 A;  1GVC A;  5H8S A;  1UTB A;  4FIM A;  3R6U A;  4X8R A;  1T0K A;  1IME A;  1PB8 A;  1VE4 A;  4I8C A;  2PCR A;  4P1L A;  1IUD A;  1RYX A;  3PPO A;  3DP4 A;  3R7X A;  4MFI A;  2DOJ A;  5I7I A;  2DWI A;  2O1M A;  1IQ7 A;  2ZZV A;  4IR8 A;  2DDK A;  1B51 A;  1QUL A;  3O6I A;  4PDD A;  2Q8J A;  3KG2 A;  4YZZ A;  2F7B A;  3FVN A;  5IGA A;  2HZL A;  1QUJ A;  5ICT A;  3FJM A;  2F36 A;  1XOC A;  3LSF B;  3ILU B;  1B5H A;  4ONY A;  2Q89 A;  4HS7 A;  4HE0 A;  1RDX A;  3SEV A;  4GF8 A;  3HCQ A;  1N84 A;  4KCC A;  3OOA A;  2FHY A;  3T22 A;  2O1L A;  2B65 A;  2RKM A;  4EXL A;  3VFJ A;  2FA7 A;  4ELQ A;  4JWX A;  4TOZ A;  2RCA A;  3KSX A;  3RY3 A;  3H6U A;  5ICQ A;  4LZ7 A;  5JEI A;  1GTK A;  1N3W A;  5I56 A;  3K0V A;  2ONK E;  1FTK A;  3K2D A;  2Q8M A;  3E78 A;  2H4I A;  3USD A;  4GQO A;  3LSL A;  3U1O A;  1NUY A;  5I57 A;  4OQO A;  4EF1 A;  3B6W A;  3RYD A;  1MH3 A;  1O64 A;  1M5D A;  4OZ9 A;  4IB2 A;  2CZK A;  4H0W A;  1Y1M A;  2HAV A;  5I57 B;  5JTY B;  2XX8 A;  4X48 A;  3OO9 A;  2DE3 A;  3U94 A;  4ESX A;  3FXB A;  1B4Z A;  1P99 A;  3MAM A;  1B3L A;  3T9X B;  3EQ1 A;  3KOS A;  3TTK A;  3KJ7 A;  1DPE A;  4M1V A;  4TQU Q;  1Y4T A;  3IO6 A;  4ISU A;  4NF4 B;  3R26 A;  1AOV A;  3G3K A;  5LDZ A;  4U23 A;  1LB9 A;  1Y4C A;  3RT6 B;  1FPF A;  1K9Z A;  4Z7E A;  2X26 A;  3G3G A;  3CG1 A;  3PMV A;  3E79 A;  3ECR A;  2NOO A;  5I2N A;  1FQF A;  4PCD A;  4OVP A;  1NH8 A;  3TDJ A;  3T9V A;  3EPE A;  4NF5 B;  2UXA A;  4POW A;  3V89 B;  4UAB A;  4GX4 A;  2A5T B;  4JB7 A;  3PPR A;  5ET5 A;  3HN0 A;  1IIW A;  1MY0 A;  3PUW E;  4KYE A;  3RTW B;  3C36 A;  3KBR A;  1FJ6 A;  3PPQ A;  2XXH A;  1JQF A;  3E9X A;  3UN6 A;  3FJ7 A;  2Q9T A;  4N6P A;  3ZS6 A;  1VDW A;  1JNF A;  5AA4 A;  2GRV A;  1H45 A;  5IKB A;  4PGN A;  3KFM A;  4QSD A;  2LAO A;  2YJP A;  3PD9 A;  4XFE A;  1P1U A;  5F7V A;  4ESW A;  4PAF A;  4DDD A;  1FSA A;  4PC9 A;  4NN3 A;  3IOW A;  4NGU A;  2FIX A;  3ZSF A;  2KQZ A;  2BJJ X;  4AQ4 A;  4LQ2 A;  4OVJ A;  3FBP A;  5FTI A;  3C34 A;  2NVU B;  5I59 A;  2ZYN A;  2DWA A;  2PYY A;  3W9V A;  3KBZ A;  3IOV A;  5ET7 A;  3G3F A;  3RLF E;  3K4U A;  5K2X A;  3VXC A;  2QJE A;  1Y3N A;  1DK4 A;  3KZG A;  1IMF A;  2P3N A;  1CE2 A;  1XI6 A;  3KSJ A;  1WDN A;  1RYO A;  5H8F B;  3ZKL A;  1Y20 A;  4JVI A;  4OAN A;  1NV0 A;  4FED A;  1INP A;  3MST A;  2XXI A;  2XWI A;  1US4 A;  3AXF A;  4YU0 A;  1ZLQ A;  1SI1 A;  4NF8 B;  1B1X A;  3BIG A;  2H98 A;  2FBP A;  5ET6 A;  1IXI A;  4GWO A;  4P11 A;  2FNC A;  2UVG A;  1URS A;  3FV1 A;  2WBB A;  5HM4 B;  3C4M A;  1SD3 A;  1LAF E;  5KDT A;  2O51 A;  2QMX A;  1ELJ A;  5LOM A;  3VLV A;  3H6W A;  1SW1 A;  2Y7P A;  4H5F A;  3CR9 A;  3LUY A;  4XF5 A;  4NWD A;  3TFL A;  2Q74 A;  3THI A;  1LFH A;  4HXV A;  3HHG A;  3OO6 A;  1B1H A;  4JVC A;  4OVT A;  2OJT A;  2O7I A;  2CZH A;  2QS3 A;  1MY2 A;  1FBH A;  2ONR A;  4H8I A;  4G8N A;  4MX6 A;  4O3C A;  2HPG A;  3UA8 A;  1CNQ A;  2RC8 A;  3RGY A;  2I0B A;  1LGB C;  4BDL A;  1MM7 A;  5L9O A;  3O9P A;  2RC9 A;  3HHF A;  3SZP A;  1L5T A;  2ZZX A;  3TTN A;  1MH4 A;  4UA8 A;  1I6Q A;  3FGS A;  3Q25 A;  4U1Z A;  3CFX A;  4F3S A;  2MKZ A;  2XWK A;  3TYH A;  4MNP A;  4OA4 A;  3LBS A;  3MUQ A;  4QF9 A;  1MY4 A;  4LQ5 A;  4QFP A;  2F78 A;  1VSO A;  4OFO A;  3N26 A;  4BDM A;  5L8D A;  4YB5 A;  5IZ3 A;  1FPJ A;  2I48 A;  3QK6 A;  3VVF A;  4QFN A;  3TTM A;  3CRB A;  3RPW A;  1UTH B;  5LTC A;  3SEU A;  1IIT A;  3I3V A;  4PDH A;  4DXU A;  3Q29 A;  2OBG A;  3T9U A;  4YMB A;  1LFG A;  1POY 1;  3K00 A;  1PB7 A;  3OEM A;  4RPO A;  1FW0 A;  2P1S A;  2VPO A;  4GD5 A;  4WED A;  1LAX A;  1YCJ A;  3FVK A;  4GBV A;  4BDN A;  2B3F A;  1LBZ A;  2QVR A;  5DEX B;  3OO8 A;  1B5I A;  2Z22 A;  1Z7N E;  3LR1 A;  3MP8 A;  2H25 A;  1JW5 A;  3HPI A;  2G93 A;  4PFW A;  4PE5 B;  4QSC A;  3G3J A;  4G4P A;  3BFT A;  5AA4 B;  1URD A;  5CMK A;  2D3I A;  4QRZ A;  1FPE A;  3FAS A;  4H1X A;  4KD5 A;  4GIZ A;  1NNT A;  2WYP A;  4KYS A;  2REG A;  4DCY A;  3OSR A;  3E3K A;  1DCU A;  4P0G A;  1MY1 A;  3CVG A;  2ANJ A;  2GH9 A;  4FE8 A;  1IMC A;  3EHS A;  3OEL A;  4THI A;  3KJT A;  3S2V A;  4U22 A;  3MBP A;  3K02 A;  4FJP A;  3DM0 A;  3SEX A;  3HV1 A;  2OK2 A;  4XKP A;  1M5E A;  2P3V A;  2QVV A;  4MNC A;  4O7M A;  4G8M A;  5TP9 A;  1OVT A;  1SW5 A;  1JW1 A;  2XXQ A;  2WBD A;  3IO4 A;  2R6G E;  4MIJ A;  2ZNU A;  1XVY A;  4PAI A;  1NI9 A;  1NV3 A;  4PP0 A;  5J16 A;  2F7A A;  1Q9D A;  3KOT A;  5AE4 A;  5AA2 D;  1R9L A;  4F1Y A;  5A5X B;  4GX6 A;  2WKY A;  4LON B;  2OLB A;  5B7D A;  1NV7 A;  3JZJ A;  1EYI A;  2F6P A;  3N5L A;  4OEV A;  2HQ0 A;  3IAZ A;  5EHS A;  2DWJ A;  1A8E A;  1PEB A;  1N04 A;  4YIC A;  4QBA A;  2O84 X;  2Y84 A;  3O6G A;  1MXV A;  2HZK A;  3EHU A;  4PBQ A;  2KR0 A;  2V3U A;  4EXK A;  4LVQ A;  3B50 A;  2V3T A;  4NHB A;  1SW4 A;  4PFU A;  2HFB A;  4ZZA A;  4E0W A;  2M8C A;  1M5C A;  2R8T A;  4NF0 A;  2DQV A;  4GWZ A;  3M3L A;  1MXU A;  3LC8 A;  2A5T A;  4ZE9 A;  1IXC A;  4MH5 A;  3MC2 A;  1DPP A;  4JXI A;  3K1M A;  1D9V A;  5KDT B;  3O66 A;  1MQD A;  1N3X A;  1NV5 A;  1FPK A;  2XWO A;  1SYI A;  4PTK A;  2DE2 A;  4XKR A;  1DOT A;  2R71 A;  2YLN A;  5CC2 A;  4C1T A;  3O97 A;  2XWV A;  5TP9 B;  2ZYK A;  1K9Y A;  4DCX A;  1ZU0 A;  5A5L A;  1UIU A;  1NV4 A;  2E1S A;  4R75 A;  2JJK A;  2PFZ A;  3UOR A;  5DW8 A;  1NUX A;  3IB2 A;  2HEU A;  4OVR A;  2ALU A;  1SDX A;  2O69 A;  2ZYM A;  4HCW A;  2PVU A;  2XD3 A;  4GOT A;  2W7Y A;  2VHA A;  4AB6 A;  4X9T A;  3U92 A;  1UQW A;  4R6H A;  4BDR A;  2Y7W A;  1VR5 A;  3FXR A;  4RK2 A;  1XC1 A;  4N91 A;  2GHB A;  3GXA A;  3VVD A;  1P1N A;  4DIG A;  1O63 A;  4ZED A;  2PT2 A;  3SEW A;  2DP8 A;  1ATG A;  4PAK A;  1B7U A;  5H8N A;  4QFO A;  2QS4 A;  4N8Y A;  3TAJ A;  4I3E A;  4R73 A;  1NH7 A;  1ZJL A;  1B32 A;  2I0C A;  1M5F A;  5B70 A;  4ELP A;  4X04 A;  2XXU A;  1Z7M E;  4RNS A;  4OEU A;  3B7D A;  4C1U A;  4PQJ A;  4RPN A;  4F19 A;  1J1N A;  2O7U A;  2WX9 A;  2Q2A A;  4O8M A;  3VE1 B;  3C9H A;  1B5J A;  4NED A;  4F29 A;  4R9F A;  3MJN A;  2O68 A;  5CRY A;  1Q35 A;  4YMA A;  1VFD A;  1BLF A;  1XS5 A;  1H44 A;  4OHN A;  4EUO A;  2VT5 A;  3MVZ A;  5BWJ A;  2F3B A;  2F5X A;  5IZ3 B;  3Q27 A;  3IB0 A;  1HSE A;  4M4G A;  1LBB A;  3OO7 A;  4RA1 A;  1PBQ A;  4OWD A;  3FAT A;  4F3P A;  1MPC A;  4PET A;  1B4H A;  5DVI A;  4MLQ A;  2THI A;  1D9Y A;  5DVF A;  4P1E A;  3QIM A;  3I6V A;  1B3E A;  4HTG A;  1UIV A;  3A3U A;  1B58 A;  3VDF A;  2GQ1 A;  2P2A A;  1FQB A;  4Q8R A;  3FV2 A;  4H8J A;  3QXM A;  3TZA A;  1FPG A;  4EQ7 A;  2R9J A;  5EYH A;  3PU5 A;  3CSB A;  1Q1K A;  1BK4 A;  2I6E A;  3K01 A;  1UTB B;  4I3Y A;  4GWU A;  3RNN A;  2VP1 A;  5BUU A;  1QGX A;  4OEN A;  3D4G A;  2QL3 A;  2XX7 A;  5EQ9 A;  5ISU A;  1EYK A;  2ESN A;  1LBV A;  4WXJ A;  4MBP A;  2ZNT A;  3VLU A;  1H76 A;  3D1R A;  4R6K A;  5FHN A;  3S4U A;  1URG A;  1Y9U A;  3TQW A;  1FPB A;  1B6H A;  2V4C A;  5ELV A;  1IMB A;  3K1N A;  4RY1 A;  3T0J A;  1G0H A;  2V25 A;  5H8H B;  2HXR A;  3RQT A;  3IFC A;  3PUX E;  4OFL A;  4DI4 B;  4MAG A;  1FQC A;  3N6T A;  5A5X A;  4O7I A;  2PMS A;  3DP8 A;  1OMP A;  2HCA A;  3UGW A;  4NMY A;  4LZ8 A;  4G68 B;  4PFB A;  3U93 A;  3SES A;  3KGC A;  1Y3Q A;  5EHM A;  3CHG A;  4N6D A;  3EF7 A;  3F11 A;  4P47 A;  4H65 A;  1Y1Z A;  2KLF A;  1RKM A;  2DVZ A;  1MQH A;  3KN3 A;  4YKI A;  3H6T A;  3W15 C;  3H06 B;  4AS4 A;  1LB8 A;  1EU8 A;  5I2K A;  3TQL A;  4TLL B;  1N7X A;  1I6B A;  4KXP A;  2Y5K A;  1FBG A;  3JYR A;  3QUF A;  1R9Q A;  3P7I A;  2UVI A;  2OWS A;  2DVC A;  1R6Z A;  3FVO A;  4PFY A;  1D4N A;  3U8Q A;  5H8N B;  5L9S A;  4GWS A;  2DWH A;  5KCJ A;  4JBZ A;  3FIR A;  3LSW A;  1BP5 A;  4BDO A;  3A3C A;  5HPQ A;  4KR5 A;  4PBH A;  1EYJ A;  1IMD A;  1QUI A;  3LSX A;  2UYE A;  1MPB A;  5F24 A; 
#chains in the Genus database with same CATH homology
 4KYS A;  2O1M A;  1IQ7 A;  2REG A;  4DCY A;  4IGT A;  3OSR A;  3K1P A;  3PPP A;  4KCD A;  5F1Q A;  1B9J A;  3K6U A;  1B51 A;  3E3K A;  3H3G A;  4QFL A;  4P0G A;  4DXB A;  3U93 A;  2DS9 A;  1MY1 A;  3CVG A;  2ANJ A;  1QUL A;  3O6I A;  5TU0 A;  3T96 B;  4H6D A;  2GH9 A;  4FE8 A;  2Q8J A;  3KG2 A;  4YZZ A;  3EHS A;  4IO6 A;  4OXV A;  2F7B A;  3OEL A;  4THI A;  3FVN A;  2HZL A;  4RK9 A;  5TPA A;  4BLA A;  4YMB A;  3KJT A;  3S2V A;  2XXX A;  1QUJ A;  3OEK A;  4U22 A;  3MBP A;  4IY6 A;  1B46 A;  3K02 A;  4FJP A;  5ICT A;  4GL8 A;  3FJM A;  3DM0 A;  2F36 A;  3SEX A;  1XOC A;  1OQG A;  5I2K B;  3HV1 A;  2OK2 A;  3LSF B;  3OMB A;  3ILU B;  4XKP A;  3V5A A;  4ZEC A;  1FTL A;  1M5E A;  2XXW A;  1OVB A;  1B5H A;  5I58 B;  3IJO B;  4ONY A;  2Q89 A;  2H5Y A;  4G8M A;  4HS7 A;  4NF5 A;  5TP9 A;  4BDM A;  1IZ1 A;  4HCY A;  1OVT A;  1SW5 A;  3PV0 E;  1JW1 A;  2XXQ A;  4F2Q A;  5I84 A;  1EH3 A;  3SEV A;  4N07 A;  4GF8 A;  3IO4 A;  2R6G E;  4OYV A;  1YPN A;  3HCQ A;  5AA2 B;  1N84 A;  2ZNU A;  4NF8 A;  4JWY A;  4KCC A;  1XVY A;  2F97 A;  1LAH E;  3OOA A;  3OXN A;  1LLS A;  3T22 A;  2O1L A;  4IGR A;  2B65 A;  2QPQ A;  2RKM A;  3VFJ A;  4EXL A;  2FA7 A;  5I59 B;  1FQD A;  4PFT A;  1P1W A;  4ELQ A;  4JWX A;  3HST A;  4PP0 A;  3VXB A;  2F7A A;  4TOZ A;  4FAJ A;  2RCA A;  4DXC A;  3KSX A;  3RY3 A;  3KOT A;  5AE4 A;  5CBR A;  5AA2 D;  5FHN A;  3H6U A;  3HO7 A;  1R9L A;  4F1Y A;  5A5X B;  5ICQ A;  2WKY A;  4I1D A;  4LZ7 A;  2F6G A;  5JEI A;  4LON B;  1GTK A;  2OWT A;  5J1D A;  2OLB A;  4R74 A;  3EN3 A;  4F2O A;  5B7D A;  4KPT A;  4XTC Q;  5L9M A;  3SEY A;  3V8X B;  3H4Z A;  1N3W A;  3JZJ A;  1P1O A;  2XHD A;  5I56 A;  3K0V A;  2ONK E;  3TEP A;  1FTK A;  2CZL A;  4ZEF A;  4DLD A;  1JEV A;  3FUZ A;  2F6P A;  3K2D A;  3N5L A;  4OEV A;  2HQ0 A;  1IXG A;  5CMC A;  5DVJ A;  2AIX A;  2NXO A;  3IAZ A;  5EHS A;  2DWJ A;  3MVX A;  1QJM A;  1A8E A;  2H4I A;  2YPN A;  4G77 A;  3IX1 A;  1PEB A;  3PD8 A;  3PMW A;  1N04 A;  4F18 A;  3USD A;  2DXY A;  4YIC A;  3K6V A;  4ZS9 A;  2O84 X;  1A55 A;  2Y84 A;  3O6G A;  2XXT A;  3LSL A;  4GQO A;  3U1O A;  4GLI A;  1MXV A;  5I57 A;  4OQO A;  4YB7 A;  2HZK A;  1FCK A;  1USY E;  3EHU A;  4R2F A;  2V3U A;  4G68 C;  4EXK A;  4EF1 A;  3B6W A;  4LVQ A;  2Z8D A;  3ILT B;  2V3T A;  4ZEI A;  2REJ A;  3O2A A;  1MH3 A;  1O64 A;  4LZ5 A;  1M5D A;  4OZ9 A;  1SW4 A;  3OD7 A;  4PFU A;  4IB2 A;  4POX A;  4AB5 A;  2QS2 A;  4H0W A;  1Y1M A;  2HFB A;  2HAV A;  4BDL A;  3TCG A;  3MZ1 A;  4ZZA A;  5I57 B;  3E4R A;  5JTY B;  4E0W A;  1S50 A;  2XX8 A;  4X48 A;  3H03 A;  3OO9 A;  2M8C A;  1M5C A;  2DE3 A;  4LP2 B;  3U94 A;  5JK4 A;  4ESX A;  2A5S A;  2DQV A;  1MQG A;  1B4Z A;  4R9G A;  1P99 A;  2PX1 A;  2I4C A;  4JSD A;  3IR1 A;  3MAM A;  3M3L A;  4U4X A;  1B3L A;  5H8Q A;  1SQY A;  1BKA A;  2GFE A;  1MXU A;  3EQ1 A;  3LC8 A;  3KOS A;  4X1B A;  5M2V A;  3T9X B;  4WKM A;  3TTK A;  5CMM A;  4TLM B;  1NMU A;  2A5T A;  3BKI B;  3KJ7 A;  3PMX A;  4GXA A;  4ZE9 A;  5I56 B;  1IXC A;  1DPE A;  1PBP A;  1DSN A;  3MC2 A;  1DPP A;  4JXI A;  4M1V A;  4MH5 A;  4DZ1 A;  4TQU Q;  1Y4T A;  3IO6 A;  3K1M A;  1NNP A;  4ISU A;  4NF4 B;  1MXX A;  1D9V A;  5CMB A;  2Z8E A;  5KDT B;  1I69 A;  4DE8 A;  1PB9 A;  4ZEB A;  3O66 A;  3R26 A;  1AOV A;  4NE4 A;  3G3K A;  4RXL A;  1MQD A;  4QSE A;  1N3X A;  4Q0C A;  2HAU A;  4U23 A;  3O29 A;  1A99 A;  1LB9 A;  1SYI A;  1Y4C A;  4JSO A;  3RT6 B;  2XXR A;  2DE2 A;  1H43 A;  4Z7E A;  2V3Q A;  5IAI A;  1OLC A;  2X26 A;  1II5 A;  3G3G A;  4GVO A;  4XKR A;  1DOT A;  1YTV A;  2R71 A;  3CG1 A;  3FXQ A;  4G2Z A;  1B40 A;  2YLN A;  4E0X A;  1B0H A;  2RIN A;  2XXY A;  1XT8 A;  2NOO A;  3ECR A;  3PMV A;  1FQF A;  4C1T A;  5I2N A;  1NH8 A;  1ZMG A;  3TDJ A;  4ELO A;  3O97 A;  3EPE A;  3KN8 A;  3T9V A;  4NF5 B;  5TP9 B;  2ZYK A;  4O3B A;  5CC2 A;  4DCX A;  5FHM A;  4IO7 A;  4F3G A;  2UXA A;  1ZU0 A;  3ODB A;  4POW A;  1N7W A;  3UP9 A;  1UIU A;  5H8F A;  5L9O A;  2E1S A;  1HSJ A;  4R75 A;  3QSL A;  1TFA A;  2D21 A;  3V89 B;  3UOR A;  1DTZ A;  4G8H A;  3L6G A;  3TTL A;  1BTJ A;  3IB2 A;  4ELR A;  1EZO A;  4GRK A;  4EF2 A;  3OEN A;  4I62 A;  3RTF B;  4JDF A;  2HEU A;  3PUV E;  5KZT A;  1H3D A;  1SBP A;  4IO4 A;  3B6T A;  2A5T B;  2ALU A;  1SDX A;  3JV9 A;  4GFR A;  3PPR A;  2O69 A;  2ZYM A;  4JB7 A;  1B2H A;  4HCW A;  4Z0I A;  3TCH A;  5I2N B;  1M5B A;  2PVU A;  1A40 A;  1EZ9 A;  2I49 A;  2XD3 A;  3VVE A;  3HN0 A;  3GLB A;  1IIW A;  3SER A;  1QKB A;  1NFT A;  3VV5 A;  1MY0 A;  3PUW E;  1WVJ A;  2VHA A;  2W7Y A;  3GZG A;  4GOT A;  4KYE A;  4NTL A;  4U4S A;  3RUM A;  1F9B A;  3K6X A;  4AB6 A;  3L6H A;  4X9T A;  3RTW B;  1JW4 A;  1UQW A;  3C36 A;  3GBB A;  3KBR A;  3PPQ A;  4R6H A;  1JVY A;  2Y7W A;  4BDR A;  5JTY A;  1VR5 A;  2XXH A;  3S9M C;  1JEU A;  3FXR A;  4RK2 A;  1JQF A;  1XC1 A;  5CI5 A;  3RN8 A;  1VFE A;  4ZE8 A;  3E9X A;  1B0L A;  3MQ9 A;  3UN6 A;  3FJ7 A;  2Q9T A;  4N6P A;  4YKJ A;  3WAF A;  5H8H A;  2GHB A;  3GXA A;  3VVD A;  3ZS6 A;  1P1N A;  4DIG A;  1JNF A;  2QSX A;  1O63 A;  3ONM A;  3QAX A;  4WEP A;  4ZED A;  3CIJ A;  3QUJ A;  5AA4 A;  2PT2 A;  4KI0 E;  1A54 A;  1A8F A;  2X7Q A;  4I9D A;  2GRV A;  2DP8 A;  3K6W A;  3SEW A;  5EYF A;  1H45 A;  4F39 A;  5KCJ B;  5IKB A;  4F1U A;  1ATG A;  1MQJ A;  2UYF A;  3KFM A;  1B7U A;  3MZ9 A;  3PGF A;  2V84 A;  5H8N A;  4QSD A;  1FTJ A;  2LAO A;  4QFO A;  2YJP A;  3MZB A;  2QS4 A;  1GV8 A;  3TUS A;  1LBC A;  3CG3 A;  3PD9 A;  4H5G A;  2PT1 A;  4RYA A;  1OIB A;  1P1U A;  4YAH X;  5F7V A;  3KEI A;  3TAJ A;  4ESW A;  4R73 A;  4BDQ A;  4YB6 A;  1ANF A;  2XX9 A;  1NH7 A;  1ZJL A;  2VOZ A;  4DDD A;  1B32 A;  2QS1 A;  4Q5T A;  3W9W A;  2I0C A;  1M5F A;  4OES A;  5B70 A;  1QVS A;  4ELP A;  2XXU A;  1Z7M E;  3IOW A;  4RNS A;  1B7H A;  4RJZ A;  4OEU A;  3TPA A;  3B7D A;  3ZSF A;  4C1U A;  4PQJ A;  4QFK A;  4RPN A;  4UAC A;  4ZDM A;  4F19 A;  1J1N A;  2O7U A;  3BBR A;  1AH5 A;  2OCU A;  2BJJ X;  2OZZ A;  2Q2A A;  4MF3 A;  3VE1 B;  3MPK A;  3C9H A;  3OSQ A;  1B5J A;  1FTM A;  4NED A;  4AQ4 A;  4LQ2 A;  4F29 A;  4OVJ A;  4ZZE A;  4O3A A;  5FTI A;  3C33 A;  3G7W A;  3C34 A;  3KN7 A;  2XXV A;  3E13 X;  2NVU B;  5I59 A;  4R9F A;  2ZYN A;  2UVH A;  1MXW A;  3M3K A;  2DWA A;  3TOD A;  3MJN A;  3CFL A;  2PYY A;  1LCF A;  3EHT A;  3IOR A;  1ZKB A;  3W9V A;  2O68 A;  3QYT A;  1ZIU A;  5CRY A;  3IL1 B;  1A7L A;  1Q35 A;  3C31 A;  3IOV A;  3G3F A;  4YMA A;  3IB1 A;  4F3B A;  3RLF E;  1VFD A;  3K4U A;  1LST A;  1BLF A;  1XS5 A;  2QMW A;  2ZYO A;  3CSG A;  1H44 A;  5K2X A;  3VXC A;  1JVX A;  1TFD A;  3DEL B;  4OHN A;  3A09 A;  4EUO A;  2QJE A;  4EQ9 A;  3MVZ A;  1Y3N A;  1P1Q A;  3IOU A;  2I58 A;  5BWJ A;  2F5X A;  4OER A;  3KZG A;  1LCT A;  5I58 A;  2FYI A;  1B3F A;  1JET A;  1O7T A;  3Q27 A;  1CE2 A;  2NWJ A;  1LFI A;  2F35 A;  3IB0 A;  1HSE A;  4M4G A;  4R6Y A;  1USY H;  5DT6 A;  1LBB A;  1WDN A;  1CB6 A;  3KSJ A;  3OO7 A;  4RA1 A;  3BFU A;  1PBQ A;  1RYO A;  4OWD A;  5H8F B;  3FAT A;  3ZKL A;  1Y20 A;  4F3P A;  1ZBM A;  3N94 A;  1MPC A;  1GR2 A;  2E0S A;  2PBW A;  1MPD A;  1QUK A;  4F31 B;  3UGW A;  3S9E A;  2VD2 A;  4FED A;  4PET A;  4XIG Q;  2F8D A;  2XXI A;  1US4 A;  3AXF A;  4YU0 A;  1ZLQ A;  1B4H A;  1SI1 A;  4NF8 B;  1B1X A;  5DVI A;  5FHO A;  5AA2 A;  4MLQ A;  2THI A;  1MM6 A;  3GBA A;  2H98 A;  4YKK A;  1PDA A;  1B3G A;  1D9Y A;  1QW0 A;  4OFJ A;  5DVF A;  3U92 A;  1IXI A;  3QIM A;  2H9B A;  4GWO A;  3I6V A;  1GVC A;  1SW2 A;  4P11 A;  2FNC A;  1SYH A;  3MP1 A;  2UVG A;  1B3E A;  4HTG A;  1UIV A;  3C35 A;  4P0I A;  2DE4 A;  3A3U A;  1B58 A;  1URS A;  2P2A A;  1DTG A;  3VDF A;  1FQB A;  4Q8R A;  2I4B A;  3FV1 A;  3FV2 A;  4H8J A;  4H67 A;  5HBC A;  3QXM A;  2Y7I A;  3TZA A;  5HM4 B;  3PPN A;  3C4M A;  1SD3 A;  1LAF E;  4EDP A;  4EQ7 A;  4R2B A;  4LUB A;  5KDT A;  2O51 A;  2QMX A;  2ABH A;  2R9J A;  1ELJ A;  3PU5 A;  4IO2 A;  4F1V A;  4NF4 A;  1TWY A;  3FVG A;  4HW8 A;  5LOM A;  3DP6 A;  3CSB A;  3H6W A;  1SW1 A;  4OMB A;  3VLV A;  1Q1K A;  4YKP A;  2Y7P A;  1I6A A;  2I6E A;  3K01 A;  4H5F A;  1S9T A;  4L17 A;  1UTB B;  3CR9 A;  3LUY A;  3G3H A;  2B3B A;  4NWD A;  3TFL A;  3THI A;  1LFH A;  3S9L C;  5DEX A;  1NNF A;  5H8Q B;  4FAT A;  3RNN A;  3WAE A;  2I3V A;  1QKA A;  2NUV A;  3HHG A;  3OO6 A;  3Q28 A;  1B1H A;  2VP1 A;  3IK6 B;  3M8U A;  4C0R A;  5BUU A;  1NKX A;  2F7C A;  2RC7 A;  1SI0 A;  4OEN A;  4QHQ A;  2OJT A;  3TKD A;  3MWB A;  3D4G A;  2O7I A;  2QS3 A;  1MY2 A;  2ONR A;  4H8I A;  5FTH A;  5CM6 A;  4OET A;  2QL3 A;  2P0S A;  4G8N A;  4IY5 A;  2XX7 A;  4O3C A;  2ONS A;  3UA8 A;  5ISU A;  3H6V A;  2ESN A;  4WXJ A;  4MBP A;  2ZNT A;  1ZTY A;  2Q2C A;  2RC8 A;  3FJG A;  4FEC A;  1KWH A;  1N76 A;  3VLU A;  1H76 A;  3DLN A;  2I0B A;  1LGB C;  3RGY A;  4FOR A;  1MDP 1;  1MG1 A;  1MM7 A;  4R6K A;  3O9P A;  2RC9 A;  1MXZ A;  1URG A;  1Y9U A;  2AYS A;  1NNK A;  3CI8 A;  3HHF A;  3O28 A;  2ZMB A;  3S4U A;  1L5T A;  4KFQ A;  3TQW A;  2QRY A;  3ZKK A;  3TTN A;  1US5 A;  1MH4 A;  1B6H A;  1FQA A;  3IOT A;  4LA9 A;  3FXU A;  5ELV A;  3K1N A;  4UA8 A;  1POT A;  2XXP A;  1I6Q A;  4RY1 A;  3SKP A;  3FGS A;  3Q25 A;  4U1Z A;  3CFX A;  3UIF A;  1LAG E;  3MVY A;  2Z23 A;  1UTH A;  1WOD A;  1AL3 A;  4F3S A;  2Q88 A;  1YAE A;  5AA1 A;  3TEL A;  5ITP A;  3PUZ E;  3PUY E;  1BIY A;  1HSL A;  2D5W A;  2G29 A;  3TTR A;  2V25 A;  4KHZ E;  4R72 A;  3TYH A;  1DMB A;  5H8H B;  1MRP A;  4G68 A;  1FTO A;  3RQT A;  3LBS A;  3MUQ A;  2Z8F A;  3PUX E;  1S7Y A;  1MS7 A;  4OTE A;  4NF6 A;  4QF9 A;  1MQI A;  4OFL A;  1MY4 A;  4LQ5 A;  1FQC A;  3N6T A;  4QFP A;  2F78 A;  2Y7R A;  1VSO A;  5A5X A;  2PMS A;  3DP8 A;  4OFO A;  1MXY A;  1OQH A;  1OMP A;  1TXF A;  2HCA A;  2VD3 A;  3C32 A;  3N26 A;  1SVX B;  1MY3 A;  3D4C A;  4FEB A;  4GXS B;  4KQP A;  4NF6 B;  1N0T A;  2GHA A;  2VGQ A;  4Q30 B;  4YB5 A;  4NMY A;  5L8D A;  2X7P A;  4G68 B;  2I48 A;  4LZ8 A;  3CFZ A;  2H99 A;  3QK6 A;  3H7M A;  1IEJ A;  3KGC A;  3MP6 A;  4X1D A;  1IXH A;  3SES A;  4QFN A;  3VVF A;  2IEE A;  3TTM A;  2Y7K A;  3U72 A;  1Y3Q A;  1D3K A;  3CRB A;  3T9H B;  3RPW A;  3I5O A;  5EHM A;  3M3F A;  1XVX A;  3EF7 A;  3F11 A;  1UTH B;  3T66 A;  3T93 B;  2ZNS A;  3SEU A;  1IIT A;  3MVW A;  4H65 A;  3S9N C;  1MDQ A;  3FZV A;  3I3V A;  1Y1Z A;  2RF1 A;  2V93 A;  2KLF A;  1RKM A;  2DVZ A;  1MQH A;  3KN3 A;  4U1O A;  3SDF A;  1Y3P A;  2F34 A;  2O6A A;  4YKI A;  4ZEK A;  4XKN A;  4DXU A;  3H6T A;  2DXR A;  4LAT A;  3W15 C;  3H06 B;  4IO3 A;  4NWC A;  1LB8 A;  1AMF A;  2ZXT A;  3Q29 A;  4F22 A;  2OBG A;  3IJX B;  3G3I A;  1EU8 A;  1PC3 A;  3FD3 A;  5I2K A;  2XD2 A;  3T9U A;  1R1N A;  3VLW A;  2CMO A;  3TMG A;  4IO5 A;  1XHY A;  2IA4 A;  4U21 A;  1B52 A;  1LFG A;  1N7X A;  2I3W A;  1I6B A;  4TLL B;  3TQL A;  2UVJ A;  1POY 1;  3K00 A;  5TPA B;  4EQB A;  4XXU A;  4MLV A;  3MW0 A;  1GGG A;  1PB7 A;  5DTB A;  3OEM A;  4RPO A;  2AL4 A;  1FW0 A;  2P1S A;  3JYR A;  4GL0 A;  4U2R A;  3QUF A;  4GD5 A;  4WED A;  1R9Q A;  1LAX A;  1NL5 A;  2AL5 A;  1YCJ A;  2DYX A;  1FQE A;  3N6U A;  3P7I A;  2UVI A;  2DSF A;  3FVK A;  1EZP A;  2OWS A;  3TCF A;  2HXW A;  2DVC A;  3RT8 A;  4BDN A;  1B05 A;  5AA3 A;  5CBS A;  1R6Z A;  2RCB A;  3FVO A;  2B3F A;  3UK4 A;  3B6Q A;  4K3F A;  4N13 A;  4PFY A;  1D4N A;  3OO8 A;  5DEX B;  1TT1 A;  1B5I A;  3O6H A;  4XKQ A;  2Z22 A;  5DYH A;  5H8S A;  5ITO A;  1Z7N E;  3U8Q A;  1UTB A;  3LR1 A;  3MP8 A;  4ECF A;  5H8N B;  3V83 A;  5L9S A;  4FIM A;  1B7Z A;  2H25 A;  3R6U A;  4JWO A;  1JW5 A;  3HPI A;  3MPL A;  2DWH A;  5K2Y A;  5KCJ A;  4JBZ A;  2G93 A;  4PFW A;  4PE5 B;  3FIR A;  4QSC A;  3G3J A;  3LSW A;  4G4P A;  4KYD A;  3BFT A;  1T0K A;  5AA4 B;  1AIV A;  1URD A;  1BP5 A;  1PB8 A;  1OLA A;  1VE4 A;  4I8C A;  5CMK A;  2D3I A;  4BDO A;  1IUD A;  3A3C A;  1RYX A;  3SET A;  5HPQ A;  4KR5 A;  4QRZ A;  4ND9 A;  3PPO A;  3Q26 A;  3DP4 A;  3FAS A;  4H1X A;  1QUI A;  3LSX A;  4KD5 A;  1B3H A;  4GIZ A;  3R7X A;  1NNT A;  2UYE A;  4MFI A;  2DOJ A;  1MPB A;  2DWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...